Analysis of material removed from UCLA tokamaks Microtor and Macrotor

International Nuclear Information System (INIS)

Baer, D.R.; Thomas, M.T.; Taylor, R.J.

1979-02-01

This paper reports a first effort to examine the surface of the UCLA tokamaks, Microtor and Macrotor, by analyzing samples that have been exposed to plasma discharge and cleaning for long periods. The samples were sent to the Surface Science Section at the Pacific Northwest Laboratory (PNL). There, Auger electron spectrometry and sputter profile techniques were used to examine the samples, which had been handled in atmospheric conditions after being removed from the tokamak

Initial draft of CSE-UCLA evaluation model based on weighted product in order to optimize digital library services in computer college in Bali

Science.gov (United States)

Divayana, D. G. H.; Adiarta, A.; Abadi, I. B. G. S.

2018-01-01

The aim of this research was to create initial design of CSE-UCLA evaluation model modified with Weighted Product in evaluating digital library service at Computer College in Bali. The method used in this research was developmental research method and developed by Borg and Gall model design. The results obtained from the research that conducted earlier this month was a rough sketch of Weighted Product based CSE-UCLA evaluation model that the design had been able to provide a general overview of the stages of weighted product based CSE-UCLA evaluation model used in order to optimize the digital library services at the Computer Colleges in Bali.

Effectiveness and safety of oxycodone/naloxone in the management of chronic pain in patients with systemic sclerosis with recurrent digital ulcers: two case reports

Directory of Open Access Journals (Sweden)

Ughi N

2016-03-01

Full Text Available Nicola Ughi, Chiara Crotti, Francesca Ingegnoli Division of Rheumatology, Department of Clinical Sciences and Community Health, Gaetano Pini Institute, The University of Milan, Milan, Italy Abstract: Digital ulcers (DUs are a severe and frequent clinical feature of patients with systemic sclerosis (SSc. The presence of DUs may cause severe pain and often lead to impairment of patient’s functional activities and health-related quality of life. Moreover, poor patient cooperation during the wound care procedure due to pain may be associated with a negative outcome of DU healing. Therefore, pain management has a key role in patients with SSc. These two case reports describe the effectiveness and safety of oxycodone/naloxone in patients with SSc complicated by painful chronic DUs. Such a therapy has provided pain relief and consequently an increased compliance during redressing wounds. Keywords: oxycodone, naloxone, systemic sclerosis, pain, digital ulcer, scleroderma, analgaesia, wound healing, opioids, calcinosis, UCLA-SCTC GIT 2.0

UCLA Particle Physics Research Group annual progress report

International Nuclear Information System (INIS)

Nefkens, B.M.K.

1983-11-01

The objectives, basic research programs, recent results, and continuing activities of the UCLA Particle Physics Research Group are presented. The objectives of the research are to discover, to formulate, and to elucidate the physics laws that govern the elementary constituents of matter and to determine basic properties of particles. The research carried out by the Group last year may be divided into three separate programs: (1) baryon spectroscopy, (2) investigations of charge symmetry and isospin invariance, and (3) tests of time reversal invariance. The main body of this report is the account of the techniques used in our investigations, the results obtained, and the plans for continuing and new research. An update of the group bibliography is given at the end

77 FR 25739 - Notice of Inventory Completion: Fowler Museum at UCLA, Los Angeles, CA

Science.gov (United States)

2012-05-01

... objects are 1 awl, 1 bone tool, 2 obsidian biface fragments, 9 bags of obsidian debitage, 4 stone metate fragments, 4 bags of animal bone, 1 obsidian hydration sample, and 5 bags of organic flotation residue. The... artifacts and obsidian hydration dating. The Fowler Museum at UCLA has determined the human remains and...

Leveraging lean principles in creating a comprehensive quality program: The UCLA health readmission reduction initiative.

Science.gov (United States)

Afsar-Manesh, Nasim; Lonowski, Sarah; Namavar, Aram A

2017-12-01

UCLA Health embarked to transform care by integrating lean methodology in a key clinical project, Readmission Reduction Initiative (RRI). The first step focused on assembling a leadership team to articulate system-wide priorities for quality improvement. The lean principle of creating a culture of change and accountability was established by: 1) engaging stakeholders, 2) managing the process with performance accountability, and, 3) delivering patient-centered care. The RRI utilized three major lean principles: 1) A3, 2) root cause analyses, 3) value stream mapping. Baseline readmission rate at UCLA from 9/2010-12/2011 illustrated a mean of 12.1%. After the start of the RRI program, for the period of 1/2012-6/2013, the readmission rate decreased to 11.3% (p<0.05). To impact readmissions, solutions must evolve from smaller service- and location-based interventions into strategies with broader approach. As elucidated, a systematic clinical approach grounded in lean methodologies is a viable solution to this complex problem. Copyright © 2017 Elsevier Inc. All rights reserved.

Experimental And Theoretical High Energy Physics Research At UCLA

Energy Technology Data Exchange (ETDEWEB)

Cousins, Robert D. [University of California Los Angeles

2013-07-22

This is the final report of the UCLA High Energy Physics DOE Grant No. DE-FG02- 91ER40662. This report covers the last grant project period, namely the three years beginning January 15, 2010, plus extensions through April 30, 2013. The report describes the broad range of our experimental research spanning direct dark matter detection searches using both liquid xenon (XENON) and liquid argon (DARKSIDE); present (ICARUS) and R&D for future (LBNE) neutrino physics; ultra-high-energy neutrino and cosmic ray detection (ANITA); and the highest-energy accelerator-based physics with the CMS experiment and CERN’s Large Hadron Collider. For our theory group, the report describes frontier activities including particle astrophysics and cosmology; neutrino physics; LHC interaction cross section calculations now feasible due to breakthroughs in theoretical techniques; and advances in the formal theory of supergravity.

Recent reflectometry results from the UCLA plasma diagnostics group

International Nuclear Information System (INIS)

Gilmore, M.; Doyle, E.J.; Kubota, S.; Nguyen, X.V.; Peebles, W.A.; Rhodes, T.L.; Zeng, L.

2001-01-01

The UCLA Plasma Diagnostics Group has an active ongoing reflectometry program. The program is threefold, including 1) profile and 2) fluctuation measurements on fusion devices (DIII-D, NSTX, and others), and 3) basic reflectometry studies in linear and laboratory plasmas that seek to develop new measurement capabilities and increase the physics understanding of reflectometry. Recent results on the DIII-D tokamak include progress toward the implementation of FM reflectometry as a standard density profile diagnostic, and correlation length measurements in QDB discharges that indicate a very different scaling than normally observed in L-mode plasmas. The first reflectometry measurements in a spherical torus (ST) have also been obtained on NSTX. Profiles in NSTX show good agreement with those of Thomson scattering. Finally, in a linear device, a local magnetic field strength measurement based on O-X correlation reflectometry has been demonstrated to proof of principle level, and correlation lengths measured by reflectometry are in good agreement with probes. (author)

Construction and initial operation of MHD PbLi facility at UCLA

International Nuclear Information System (INIS)

Kunugi, T.; Yokomine, T.; Ueki, Y.; Smolentsev, S.; Li, F.-C.; Sketchley, T.; Abdou, M.A.; Yuki, K.

2014-01-01

We review current accomplishments in Task 1-3 'Flow Control and Thermofluid Modeling' of the Japan-US 'TITAN' collaboration program. Our task focuses on experimental activities and also computer modeling of magnetohydrodynamic flows and heat and mass transfer of electrically conducting fluids under conditions relevant to fusion blankets. Since our task started, major efforts were taken to design, construct and test a new magnetohydrodynamic lead-lithium (PbLi) loop at UCLA, to accumulate the PbLi handling technology, and to develop a high-temperature ultrasonic Doppler velocimetry and a differential-pressure measurement system for PbLi flows. In the present paper, the loop construction, the electromagnetic pump performance test, our on-going experiments with the constructed loop are described. (author)

Strengthening the fission reactor nuclear science and engineering program at UCLA. Final technical report

International Nuclear Information System (INIS)

Okrent, D.

1997-01-01

This is the final report on DOE Award No. DE-FG03-92ER75838 A000, a three year matching grant program with Pacific Gas and Electric Company (PG and E) to support strengthening of the fission reactor nuclear science and engineering program at UCLA. The program began on September 30, 1992. The program has enabled UCLA to use its strong existing background to train students in technological problems which simultaneously are of interest to the industry and of specific interest to PG and E. The program included undergraduate scholarships, graduate traineeships and distinguished lecturers. Four topics were selected for research the first year, with the benefit of active collaboration with personnel from PG and E. These topics remained the same during the second year of this program. During the third year, two topics ended with the departure o the students involved (reflux cooling in a PWR during a shutdown and erosion/corrosion of carbon steel piping). Two new topics (long-term risk and fuel relocation within the reactor vessel) were added; hence, the topics during the third year award were the following: reflux condensation and the effect of non-condensable gases; erosion/corrosion of carbon steel piping; use of artificial intelligence in severe accident diagnosis for PWRs (diagnosis of plant status during a PWR station blackout scenario); the influence on risk of organization and management quality; considerations of long term risk from the disposal of hazardous wastes; and a probabilistic treatment of fuel motion and fuel relocation within the reactor vessel during a severe core damage accident

Looking for alternative energy supplies / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2010-01-01

Vilniuses toimunud Balti Arengufoorumil räägiti energeetika teemadel. Euroopa Komisjoni presidendi Jose Manuel Barroso ja Leedu presidendi Dalia Grybauskaite kohtumisel räägiti Leedu-Poola gaasijuhtme rajamisest ja Euroopa integreeritud elektrienergiaturu loomisest

Photocathode driven linac at UCLA for FEL and plasma wakefield acceleration experiments

International Nuclear Information System (INIS)

Hartman, S.; Aghamir, F.; Barletta, W.; Cline, D.; Dodd, J.; Katsouleas, T.; Kolonko, J.; Park, S.; Pellegrini, C.; Rosenzweig, J.; Smolin, J.; Terrien, J.; Davis, J.; Hairapetian, G.; Joshi, C.; Luhmann, N. Jr.; McDermott, D.

1991-01-01

The UCLA compact 20-MeV/c electron linear accelerator is designed to produce a single electron bunch with a peak current of 200 A, an rms energy spread of 0.2% or less, and a short 1.2 picosecond rms pulse duration. The linac is also designed to minimize emittance growth down the beamline so as to obtain emittances of the order of 8πmm-mrad in the experimental region. The linac will feed two beamlines, the first will run straight into the undulator for FEL experiments while the second will be used for diagnostics, longitudinal bunch compression, and other electron beam experiments. Here the authors describe the considerations put into the design of the accelerating structures and the transport to the experimental areas

The UCLA/SLAC Ultra-High Gradient Cerenkov Wakefield Accelerator Experiment

CERN Document Server

Thompson, Matthew C; Hogan, Mark; Ischebeck, Rasmus; Muggli, Patric; Rosenzweig, James E; Scott, A; Siemann, Robert; Travish, Gil; Walz, Dieter; Yoder, Rodney

2005-01-01

An experiment is planned to study the performance of dielectric Cerenkov wakefield accelerating structures at extremely high gradients in the GV/m range. This new UCLA/SLAC collaboration will take advantage of the unique SLAC FFTB electron beam and its demonstrated ultra-short pulse lengths and high currents (e.g., sz = 20 μm at Q = 3 nC). The electron beam will be focused down and sent through varying lengths of fused silica capillary tubing with two different sizes: ID = 200 μm / OD = 325 μm and ID = 100 μm / OD = 325 μm. The pulse length of the electron beam will be varied in order to alter the accelerating gradient and probe the breakdown threshold of the dielectric structures. In addition to breakdown studies, we plan to collect and measure coherent Cerenkov radiation emitted from the capillary tube to gain information about the strength of the accelerating fields. Status and progress on the experiment are reported.

Development and Testing of UCLA's Electron Losses and Fields Investigation (ELFIN) Instrument Payload

Science.gov (United States)

Wilkins, C.; Bingley, L.; Angelopoulos, V.; Caron, R.; Cruce, P. R.; Chung, M.; Rowe, K.; Runov, A.; Liu, J.; Tsai, E.

2017-12-01

UCLA's Electron Losses and Fields Investigation (ELFIN) is a 3U+ CubeSat mission designed to study relativistic particle precipitation in Earth's polar regions from Low Earth Orbit. Upon its 2018 launch, ELFIN will aim to address an important open question in Space Physics: Are Electromagnetic Ion-Cyclotron (EMIC) waves the dominant source of pitch-angle scattering of high-energy radiation belt charged particles into Earth's atmosphere during storms and substorms? Previous studies have indicated these scattering events occur frequently during storms and substorms, and ELFIN will be the first mission to study this process in-situ.Paramount to ELFIN's success is its instrument suite consisting of an Energetic Particle Detector (EPD) and a Fluxgate Magnetometer (FGM). The EPD is comprised of two collimated solid-state detector stacks which will measure the incident flux of energetic electrons from 50 keV to 4 MeV and ions from 50 keV to 300 keV. The FGM is a 3-axis magnetic field sensor which will capture the local magnetic field and its variations at frequencies up to 5 Hz. The ELFIN spacecraft spins perpendicular to the geomagnetic field to provide 16 pitch-angle particle data sectors per revolution. Together these factors provide the capability to address the nature of radiation belt particle precipitation by pitch-angle scattering during storms and substorms.ELFIN's instrument development has progressed into the late Engineering Model (EM) phase and will soon enter Flight Model (FM) development. The instrument suite is currently being tested and calibrated at UCLA using a variety of methods including the use of radioactive sources and applied magnetics to simulate orbit conditions during spin sectoring. We present the methods and test results from instrument calibration and performance validation.

Kaarin Raid / [vestelnud Kalju Orro

Index Scriptorium Estoniae

Raid, Kaarin, 1942-2014

2007-01-01

Moskva GITIS-esse sisseastumisest, õppimisest, õpetajatest, Lavakunstikoolis õpetamisest. Kaarin Raid õppis Moskva GITIS-es režii erialal (1962-1967). Osalenud Lavakunstikoolis kursuse juhendajana 8. lennu ning erialaõppejõuna 7., 10., 12., 14. ja 15. lennu töös

Material analyses of foam-based SiC FCI after dynamic testing in PbLi in MaPLE loop at UCLA

Energy Technology Data Exchange (ETDEWEB)

Gonzalez, Maria, E-mail: maria.gonzalez@ciemat.es [LNF-CIEMAT, Avda Complutense, 40, 28040 Madrid (Spain); Rapisarda, David; Ibarra, Angel [LNF-CIEMAT, Avda Complutense, 40, 28040 Madrid (Spain); Courtessole, Cyril; Smolentsev, Sergey; Abdou, Mohamed [Fusion Science and Technology Center, UCLA (United States)

2016-11-01

Highlights: • Samples from foam-based SiC FCI were analyzed by looking at their SEM microstructure and elemental composition. • After finishing dynamic experiments in the flowing hot PbLi, the liquid metal ingress has been confirmed due to infiltration through local defects in the protective inner CVD layer. • No direct evidences of corrosion/erosion were observed; these defects could be related to the manufacturing process. - Abstract: Foam-based SiC flow channel inserts (FCIs) developed and manufactured by Ultramet, USA are currently under testing in the flowing hot lead-lithium (PbLi) alloy in the MaPLE loop at UCLA to address chemical/physical compatibility and to access the MHD pressure drop reduction. UCLA has finished the first experimental series, where a single uninterrupted long-term (∼6500 h) test was performed on a 30-cm FCI segment in a magnetic field up to 1.8 T at the temperature of 300 °C and maximum flow velocities of ∼ 15 cm/s. After finishing the experiments, the FCI sample was extracted from the host stainless steel duct and cut into slices. Few of them have been analyzed at CIEMAT as a part of the joint collaborative effort on the development of the DCLL blanket concept in the EU and the US. The initial inspection of the slices using optical microscopic analysis at UCLA showed significant PbLi ingress into the bulk FCI material that resulted in degradation of insulating properties of the FCI. Current material analyses at CIEMAT are based on advanced techniques, including characterization of FCI samples by FESEM to study PbLi ingress, imaging of cross sections, composition analysis by EDX and crack inspection. These analyses suggest that the ingress was caused by local defects in the protective inner CVD layer that might be originally present in the FCI or occurred during testing.

Global general pediatric surgery partnership: The UCLA-Mozambique experience.

Science.gov (United States)

Amado, Vanda; Martins, Deborah B; Karan, Abraar; Johnson, Brittni; Shekherdimian, Shant; Miller, Lee T; Taela, Atanasio; DeUgarte, Daniel A

2017-09-01

There has been increasing recognition of the disparities in surgical care throughout the world. Increasingly, efforts are being made to improve local infrastructure and training of surgeons in low-income settings. The purpose of this study was to review the first 5-years of a global academic pediatric general surgery partnership between UCLA and the Eduardo Mondlane University in Maputo, Mozambique. A mixed-methods approach was utilized to perform an ongoing needs assessment. A retrospective review of admission and operative logbooks was performed. Partnership activities were summarized. The needs assessment identified several challenges including limited operative time, personnel, equipment, and resources. Review of logbooks identified a high frequency of burn admissions and colorectal procedures. Partnership activities focused on providing educational resources, on-site proctoring, training opportunities, and research collaboration. This study highlights the spectrum of disease and operative case volume of a referral center for general pediatric surgery in sub-Saharan Africa, and it provides a context for academic partnership activities to facilitate training and improve the quality of pediatric general surgical care in limited-resource settings. Level IV. Copyright © 2017 Elsevier Inc. All rights reserved.

An analysis of appropriate delivery of postoperative radiation therapy for endometrial cancer using the RAND/UCLA Appropriateness Method: Executive summary

Directory of Open Access Journals (Sweden)

Ellen Jones, MD, PhD

2016-01-01

Conclusions: This analysis based on the RAND/UCLA Method shows significant agreement with the 2014 endometrial Guideline. Areas of divergence, often in scenarios with low-level evidence, included use of external beam RT plus vaginal brachytherapy in stages II and III and external beam RT alone in early-stage patients. Furthermore, the analysis explores other important questions regarding management of this disease site.

Educating European Corporate Communication Professionals for Senior Management Positions: A Collaboration between UCLA's Anderson School of Management and the University of Lugano

Science.gov (United States)

Forman, Janis

2005-01-01

UCLA's program in strategic management for European corporate communication professionals provides participants with a concentrated, yet selective, immersion in those management disciplines taught at U.S. business schools, topics that are essential to their work as senior advisors to CEOs and as leaders in the field. The choice of topics…

Vision screening of abused and neglected children by the UCLA Mobile Eye Clinic.

Science.gov (United States)

Yoo, R; Logani, S; Mahat, M; Wheeler, N C; Lee, D A

1999-07-01

The purpose of our study was to present descriptive findings of ocular abnormalities in vision screening examinations of abused and neglected children. We compared the prevalence and the nature of eye diseases and refractive error between abused and neglected boys staying at the Hathaway Home, a residential facility for abused children, and boys from neighboring Boys and Girls clubs. The children in the study received vision screening examinations through the UCLA Mobile Eye Clinic following a standard format. Clinical data were analyzed by chi-square test. The children with a history of abuse demonstrated significantly higher prevalence of myopia, astigmatism, and external eye disorders. Our study suggests that children with a history of abuse may be at higher risk for visual impairment. These visual impairments may be the long-term sequelae of child abuse.

One more high ranking meeting with Putin / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2010-01-01

Leedu peaministri Andrius Kubiliuse ja Venemaa peaministri Vladimir Putini kohtumisel Novo-Ogariovos räägiti majandussuhetest ning energeetikast. Nendel teemadel räägiti ka Leedu presidendi Dalia Grybauskaite ja Vladimir Putini 10. veebruaril Helsingis toimunud kohtumisel. Andrius Kubilius edastas Vladimir Putinile kutse osaleda 1.-2. juunil toimuval Balti assambleel

Neutralization of several adult and paediatric HIV-1 subtype C isolates using a shortened synthetic derivative of gp120 binding aptamer called UCLA1.

CSIR Research Space (South Africa)

Mufhandu, Hazel T

2009-07-01

Full Text Available This paper present a chemically synthesised derivative of the B40 parental aptamer, called UCLA1 (Cohen et al., 2008), was used for neutralization of endemic subtype C clinical isolates of HIV-1 from adult and paediatric patients and subtype B lab...

UCLA intermediate energy nuclear physics and relativistic heavy ion physics. Annual report, February 1, 1983-January 31, 1984

International Nuclear Information System (INIS)

1984-01-01

In this contract year the UCLA Intermediate Energy Group has continued to pursue a general set of problems in intermediate energy physics using new research tools and theoretical insights. Our program to study N-N scattering and proton-light nucleus scattering has been enhanced by a new polarized target facility (both hydrogen and deuterium) at the High Resolution Spectrometer (HRS) of the Los Alamos Meson Physics Facility (LAMPF). This facility has been constructed by our group in collaboration with physicists from KEK, LAMPF and the University of Minnesota; and the first set of experiments studying polarized beam-polarized target scattering at the HRS were completed this summer and early fall. The HRS mode of operation has led to some unique design features which are described. At the Bevalac, a new beam line spectrometer will be constructed for us during this year and next to significantly enhance our capability to study subthreshold k + , k - and anti p production in relativistic heavy ion collisions and to search for fractionally charged particles. During this period a proposal is being prepared for a very large acceptance spectrometer and its associated beam line which will be used to detect dilepton pairs produced in relativistic heavy ion collisions. In concert with these experimental projects, theoretical advances in the understanding of new data from the HRS, particularly spin transfer data, have been made by the UCLA group and are described

RESEÑA DE LAS I JORNADAS DE INVESTIGACIÓN DE INGENIERÍA CIVIL Y URBANISMO UCLA 2015

OpenAIRE

J. C. Rincón

2016-01-01

A través del presente ensayo, se esboza el acontecer de las I Jornadas de Investigación de Ingeniería Civil y Urbanismo UCLA 2015, la cual se desarrolló durante los días 15 y 16 de marzo del 2016, en las instalaciones del decanato de Ingeniería Civil de la Universidad Centroccidental Lisandro Alvarado. Se presentaron ponencias alusivas a trabajos de investigación relacionados a ingeniería civil, específicamente en las áreas de estructuras, hidráulica y sanitaria, ingeniería de construcción...

Emittance studies of the BNL/SLAC/UCLA 1.6 cell photocathode rf gun

International Nuclear Information System (INIS)

Palmer, D.T.; Miller, R.H.; Wang, X.J.

1997-01-01

The symmetrized 1.6 cell S-band photocathode gun developed by the BNL/SLAC/UCLA collaboration is in operation at the Brookhaven Accelerator Test Facility (ATF). A novel emittance compensation solenoid magnet has also been designed, built and is in operation at the ATF. These two subsystems form an emittance compensated photoinjector used for beam dynamics, advanced acceleration and free electron laser experiments at the ATF. The highest acceleration field achieved on the copper cathode is 150 MV/m, and the guns normal operating field is 130 MV/m. The maximum rf pulse length is 3 micros. The transverse emittance of the photoelectron beam were measured for various injection parameters. The 1 nC emittance results are presented along with electron bunch length measurements that indicated that at above the 400 pC, space charge bunch lengthening is occurring. The thermal emittance, ε o , of the copper cathode has been measured

LGBT and Information Studies: The Library and Archive OUTreach Symposium at UCLA; and In the Footsteps of Barbara Gittings: An Appreciation

OpenAIRE

Keilty, Patrick

2007-01-01

On November 17, 2006 the InterActions editorial team attended the Library and Archives OUTreach symposium at UCLA. This galvanizing event brought together academics, practitioners, and activists from the information studies field to discuss the importance of increasing visibility around lesbian, gay, bisexual, and transgendered (LGBT) issues as they pertain to libraries and information seeking. Given the tremendous energy generated by these proceedings, we asked Patrick Keilty, a doctoral st...

UCLA's Molecular Screening Shared Resource: enhancing small molecule discovery with functional genomics and new technology.

Science.gov (United States)

Damoiseaux, Robert

2014-05-01

The Molecular Screening Shared Resource (MSSR) offers a comprehensive range of leading-edge high throughput screening (HTS) services including drug discovery, chemical and functional genomics, and novel methods for nano and environmental toxicology. The MSSR is an open access environment with investigators from UCLA as well as from the entire globe. Industrial clients are equally welcome as are non-profit entities. The MSSR is a fee-for-service entity and does not retain intellectual property. In conjunction with the Center for Environmental Implications of Nanotechnology, the MSSR is unique in its dedicated and ongoing efforts towards high throughput toxicity testing of nanomaterials. In addition, the MSSR engages in technology development eliminating bottlenecks from the HTS workflow and enabling novel assays and readouts currently not available.

Development and validation of Australian aphasia rehabilitation best practice statements using the RAND/UCLA appropriateness method

Science.gov (United States)

Power, Emma; Thomas, Emma; Worrall, Linda; Rose, Miranda; Togher, Leanne; Nickels, Lyndsey; Hersh, Deborah; Godecke, Erin; O'Halloran, Robyn; Lamont, Sue; O'Connor, Claire; Clarke, Kim

2015-01-01

Objectives To develop and validate a national set of best practice statements for use in post-stroke aphasia rehabilitation. Design Literature review and statement validation using the RAND/UCLA Appropriateness Method (RAM). Participants A national Community of Practice of over 250 speech pathologists, researchers, consumers and policymakers developed a framework consisting of eight areas of care in aphasia rehabilitation. This framework provided the structure for the development of a care pathway containing aphasia rehabilitation best practice statements. Nine speech pathologists with expertise in aphasia rehabilitation participated in two rounds of RAND/UCLA appropriateness ratings of the statements. Panellists consisted of researchers, service managers, clinicians and policymakers. Main outcome measures Statements that achieved a high level of agreement and an overall median score of 7–9 on a nine-point scale were rated as ‘appropriate’. Results 74 best practice statements were extracted from the literature and rated across eight areas of care (eg, receiving the right referrals, providing intervention). At the end of Round 1, 71 of the 74 statements were rated as appropriate, no statements were rated as inappropriate, and three statements were rated as uncertain. All 74 statements were then rated again in the face-to-face second round. 16 statements were added through splitting existing items or adding new statements. Seven statements were deleted leaving 83 statements. Agreement was reached for 82 of the final 83 statements. Conclusions This national set of 82 best practice statements across eight care areas for the rehabilitation of people with aphasia is the first to be validated by an expert panel. These statements form a crucial component of the Australian Aphasia Rehabilitation Pathway (AARP) (http://www.aphasiapathway.com.au) and provide the basis for more consistent implementation of evidence-based practice in stroke rehabilitation. PMID:26137883

Microscopic evaluation of implant platform adaptation with UCLA-type abutments: in vitro study

Directory of Open Access Journals (Sweden)

Vinícius Anéas RODRIGUES

Full Text Available Abstract Introduction The fit between abutment and implant is crucial to determine the longevity of implant-supported prostheses and the maintenance of peri-implant bones. Objective To evaluate the vertical misfit between different abutments in order to provide information to assist abutment selection. Material and method UCLA components (N=40 with anti-rotational system were divided as follows: components usinated in titanium (n=10 and plastic components cast proportionally in titanium (n=10, nickel-chromium-titanium-molybdenum (n=10 and nickel-chromium (n=10 alloys. All components were submitted to stereomicroscope analysis and were randomly selected for characterization by SEM. Result Data were analyzed using mean and standard deviation and subjected to ANOVA-one way, where the groups proved to statistically different (p=<0.05, followed by Tukey’s test. Conclusion The selection of material influences the value of vertical misfit. The group machined in Ti showed the lowest value while the group cast in Ni Cr showed the highest value of vertical misfit.

Investigating plasma-rotation methods for the Space-Plasma Physics Campaign at UCLA's BAPSF.

Science.gov (United States)

Finnegan, S. M.; Koepke, M. E.; Reynolds, E. W.

2006-10-01

In D'Angelo et al., JGR 79, 4747 (1974), rigid-body ExB plasma flow was inferred from parabolic floating-potential profiles produced by a spiral ionizing surface. Here, taking a different approach, we report effects on barium-ion azimuthal-flow profiles using either a non-emissive or emissive spiral end-electrode in the WVU Q-machine. Neither electrode produced a radially-parabolic space-potential profile. The emissive spiral, however, generated controllable, radially-parabolic structure in the floating potential, consistent with a second population of electrons having a radially-parabolic parallel-energy profile. Laser-induced-fluorescence measurements of spatially resolved, azimuthal-velocity distribution functions show that, for a given flow profile, the diamagnetic drift of hot (>>0.2eV) ions overwhelms the ExB-drift contribution. Our experiments constitute a first attempt at producing controllable, rigid-body, ExB plasma flow for future experiments on the LArge-Plasma-Device (LAPD), as part of the Space-Plasma Physics Campaign (at UCLA's BAPSF).

Construction and initial operation of MHD PbLi facility at UCLA

Energy Technology Data Exchange (ETDEWEB)

Smolentsev, S., E-mail: sergey@fusion.ucla.edu; Li, F.-C.; Morley, N.; Ueki, Y.; Abdou, M.; Sketchley, T.

2013-06-15

Highlights: • New MHD PbLi loop has been constructed and tested at UCLA. • Pressure diagnostics system has been developed and successfully tested. • Ultrasound Doppler velocimeter is tested as velocity diagnostics. • Experiments on pressure drop reduction have been performed. • Experiments on MHD flow in a duct with SiC flow channel insert are underway. -- Abstract: A magnetohydrodynamic flow facility MaPLE (Magnetohydrodynamic PbLi Experiment) that utilizes molten eutectic alloy lead–lithium (PbLi) as working fluid has been constructed and tested at University of California, Los Angeles. The loop operation parameters are: maximum magnetic field 1.8 T, PbLi temperature up to 350 °C, maximum PbLi flow rate with/without a magnetic field 15/50 l/min, maximum pressure head 0.15 MPa. The paper describes the loop itself and its major components, basic operation procedures, experience of handling PbLi, initial loop testing, flow diagnostics and current and near-future experiments. The obtained test results of the loop and its components have demonstrated that the new facility is fully functioning and ready for experimental studies of magnetohydrodynamic, heat and mass transfer phenomena in PbLi flows and also can be used in mock up testing in conditions relevant to fusion applications.

Development and validation of Australian aphasia rehabilitation best practice statements using the RAND/UCLA appropriateness method.

Science.gov (United States)

Power, Emma; Thomas, Emma; Worrall, Linda; Rose, Miranda; Togher, Leanne; Nickels, Lyndsey; Hersh, Deborah; Godecke, Erin; O'Halloran, Robyn; Lamont, Sue; O'Connor, Claire; Clarke, Kim

2015-07-02

To develop and validate a national set of best practice statements for use in post-stroke aphasia rehabilitation. Literature review and statement validation using the RAND/UCLA Appropriateness Method (RAM). A national Community of Practice of over 250 speech pathologists, researchers, consumers and policymakers developed a framework consisting of eight areas of care in aphasia rehabilitation. This framework provided the structure for the development of a care pathway containing aphasia rehabilitation best practice statements. Nine speech pathologists with expertise in aphasia rehabilitation participated in two rounds of RAND/UCLA appropriateness ratings of the statements. Panellists consisted of researchers, service managers, clinicians and policymakers. Statements that achieved a high level of agreement and an overall median score of 7-9 on a nine-point scale were rated as 'appropriate'. 74 best practice statements were extracted from the literature and rated across eight areas of care (eg, receiving the right referrals, providing intervention). At the end of Round 1, 71 of the 74 statements were rated as appropriate, no statements were rated as inappropriate, and three statements were rated as uncertain. All 74 statements were then rated again in the face-to-face second round. 16 statements were added through splitting existing items or adding new statements. Seven statements were deleted leaving 83 statements. Agreement was reached for 82 of the final 83 statements. This national set of 82 best practice statements across eight care areas for the rehabilitation of people with aphasia is the first to be validated by an expert panel. These statements form a crucial component of the Australian Aphasia Rehabilitation Pathway (AARP) (http://www.aphasiapathway.com.au) and provide the basis for more consistent implementation of evidence-based practice in stroke rehabilitation. Published by the BMJ Publishing Group Limited. For permission to use (where not already

UCLA1, a synthetic derivative of a gp120 RNA aptamer, inhibits entry of human immunodeficiency virus type 1 subtype C

CSIR Research Space (South Africa)

Mufhandu, Hazel T

2012-05-01

Full Text Available such as South Africa (47), where this study was conducted, we assessed the sensitivity of a large panel of subtype C isolates derived from adult and pediatric patients at different stages of HIV-1 infection against UCLA1. We examined its neutralization..., 34). These were derived from the CAPRISA 002 acute infection study cohort (18), subtype C reference panel (31), pediatric and AIDS patients? isolates (9, 17), and a subtype C consensus sequence clone (ConC) (26). The subtype C pseudoviruses were...

Simulations of the BNL/SLAC/UCLA 1.6 cell emittance compensated photocathode RF gun low energy beam line

International Nuclear Information System (INIS)

Palmer, D.T.; Miller, R.H.; Winick, H.

1995-01-01

A dedicated low energy (2 to 10 MeV) experimental beam line is now under construction at Brookhaven National Laboratories Accelerator Test Facility (BNL/ATF) for photocathode RF gun testing and photoemission experiments. The design of the experimental line, using the 1.6 cell photocathode RF gun developed by the BNL/SLAC/UCLA RF gun collaboration is presented. Detailed beam dynamics simulations were performed for the 1.6 cell RF gun injector using a solenoidal emittance compensation technique. An experimental program for testing the 1.6 cell RF gun is presented. This program includes beam loading caused by dark current, higher order mode field measurements, integrated and slice emittance measurements using a pepper-pot and RF kicker cavity

UCLA Particle and Nuclear Physics Research Group, 1993 progress report

International Nuclear Information System (INIS)

Nefkens, B.M.K.; Clajus, M.; Price, J.W.; Tippens, W.B.; White, D.B.

1993-09-01

The research programs of the UCLA Particle and Nuclear Physics Research Group, the research objectives, results of experiments, the continuing activities and new initiatives are presented. The primary goal of the research is to test the symmetries and invariances of particle/nuclear physics with special emphasis on investigating charge symmetry, isospin invariance, charge conjugation, and CP. Another important part of our work is baryon spectroscopy, which is the determination of the properties (mass, width, decay modes, etc.) of particles and resonances. We also measure some basic properties of light nuclei, for example the hadronic radii of 3 H and 3 He. Special attention is given to the eta meson, its production using photons, electrons, π ± , and protons, and its rare and not-so-rare decays. In Section 1, the physics motivation of our research is outlined. Section 2 provides a summary of the research projects. The status of each program is given in Section 3. We discuss the various experimental techniques used, the results obtained, and we outline the plans for the continuing and the new research. Details are presented of new research that is made possible by the use of the Crystal Ball Detector, a highly segmented NaI calorimeter and spectrometer with nearly 4π acceptance (it was built and used at SLAC and is to be moved to BNL). The appendix contains an update of the bibliography, conference participation, and group memos; it also indicates our share in the organization of conferences, and gives a listing of the colloquia and seminars presented by us

Relativistic electron diffraction at the UCLA Pegasus photoinjector laboratory

Energy Technology Data Exchange (ETDEWEB)

Musumeci, P. [UCLA Department of Physics and Astronomy, 475 Portola Plaza, Los Angeles, CA 90095-1547 (United States)], E-mail: musumeci@physics.ucla.edu; Moody, J.T.; Scoby, C.M. [UCLA Department of Physics and Astronomy, 475 Portola Plaza, Los Angeles, CA 90095-1547 (United States)

2008-10-15

Electron diffraction holds the promise to yield real-time resolution of atomic motion in an easily accessible environment like a university laboratory at a fraction of the cost of fourth-generation X-ray sources. Currently the limit in time-resolution for conventional electron diffraction is set by how short an electron pulse can be made. A very promising solution to maintain the highest possible beam intensity without excessive pulse broadening from space charge effects is to increase the electron energy to the MeV level where relativistic effects significantly reduce the space charge forces. Rf photoinjectors can in principle deliver up to 10{sup 7}-10{sup 8} electrons packed in bunches of {approx}100-fs length, allowing an unprecedented time resolution and enabling the study of irreversible phenomena by single-shot diffraction patterns. The use of rf photoinjectors as sources for ultrafast electron diffraction has been recently at the center of various theoretical and experimental studies. The UCLA Pegasus laboratory, commissioned in early 2007 as an advanced photoinjector facility, is the only operating system in the country, which has recently demonstrated electron diffraction using a relativistic beam from an rf photoinjector. Due to the use of a state-of-the-art ultrashort photoinjector driver laser system, the beam has been measured to be sub-100-fs long, at least a factor of 5 better than what measured in previous relativistic electron diffraction setups. Moreover, diffraction patterns from various metal targets (titanium and aluminum) have been obtained using the Pegasus beam. One of the main laboratory goals in the near future is to fully develop the rf photoinjector-based ultrafast electron diffraction technique with particular attention to the optimization of the working point of the photoinjector in a low-charge ultrashort pulse regime, and to the development of suitable beam diagnostics.

Relativistic electron diffraction at the UCLA Pegasus photoinjector laboratory

International Nuclear Information System (INIS)

Musumeci, P.; Moody, J.T.; Scoby, C.M.

2008-01-01

Electron diffraction holds the promise to yield real-time resolution of atomic motion in an easily accessible environment like a university laboratory at a fraction of the cost of fourth-generation X-ray sources. Currently the limit in time-resolution for conventional electron diffraction is set by how short an electron pulse can be made. A very promising solution to maintain the highest possible beam intensity without excessive pulse broadening from space charge effects is to increase the electron energy to the MeV level where relativistic effects significantly reduce the space charge forces. Rf photoinjectors can in principle deliver up to 10 7 -10 8 electrons packed in bunches of ∼100-fs length, allowing an unprecedented time resolution and enabling the study of irreversible phenomena by single-shot diffraction patterns. The use of rf photoinjectors as sources for ultrafast electron diffraction has been recently at the center of various theoretical and experimental studies. The UCLA Pegasus laboratory, commissioned in early 2007 as an advanced photoinjector facility, is the only operating system in the country, which has recently demonstrated electron diffraction using a relativistic beam from an rf photoinjector. Due to the use of a state-of-the-art ultrashort photoinjector driver laser system, the beam has been measured to be sub-100-fs long, at least a factor of 5 better than what measured in previous relativistic electron diffraction setups. Moreover, diffraction patterns from various metal targets (titanium and aluminum) have been obtained using the Pegasus beam. One of the main laboratory goals in the near future is to fully develop the rf photoinjector-based ultrafast electron diffraction technique with particular attention to the optimization of the working point of the photoinjector in a low-charge ultrashort pulse regime, and to the development of suitable beam diagnostics

Relativistic electron diffraction at the UCLA Pegasus photoinjector laboratory.

Science.gov (United States)

Musumeci, P; Moody, J T; Scoby, C M

2008-10-01

Electron diffraction holds the promise to yield real-time resolution of atomic motion in an easily accessible environment like a university laboratory at a fraction of the cost of fourth-generation X-ray sources. Currently the limit in time-resolution for conventional electron diffraction is set by how short an electron pulse can be made. A very promising solution to maintain the highest possible beam intensity without excessive pulse broadening from space charge effects is to increase the electron energy to the MeV level where relativistic effects significantly reduce the space charge forces. Rf photoinjectors can in principle deliver up to 10(7)-10(8) electrons packed in bunches of approximately 100-fs length, allowing an unprecedented time resolution and enabling the study of irreversible phenomena by single-shot diffraction patterns. The use of rf photoinjectors as sources for ultrafast electron diffraction has been recently at the center of various theoretical and experimental studies. The UCLA Pegasus laboratory, commissioned in early 2007 as an advanced photoinjector facility, is the only operating system in the country, which has recently demonstrated electron diffraction using a relativistic beam from an rf photoinjector. Due to the use of a state-of-the-art ultrashort photoinjector driver laser system, the beam has been measured to be sub-100-fs long, at least a factor of 5 better than what measured in previous relativistic electron diffraction setups. Moreover, diffraction patterns from various metal targets (titanium and aluminum) have been obtained using the Pegasus beam. One of the main laboratory goals in the near future is to fully develop the rf photoinjector-based ultrafast electron diffraction technique with particular attention to the optimization of the working point of the photoinjector in a low-charge ultrashort pulse regime, and to the development of suitable beam diagnostics.

The fitness of copings constructed over UCLA abutments and the implant, constructed by different techniques: casting and casting with laser welding Adaptação de copings de ritânio ao implante, construídos sobre pilares UCLA por duas técnicas: fundição e fundição com soldagem de bordo laser

Directory of Open Access Journals (Sweden)

Elza Maria Valadares da Costa

2004-12-01

Full Text Available The alternative for the reposition of a missing tooth is the osteointegrated implant being the passive adaptation between the prosthodontic structure and the implant a significant factor for the success of this experiment, a comparative study was done between the two methods for confectioning a single prosthodontic supported by an implant. To do so a screwed implant with a diameter of 3.75mm and a length of 10.0mm (3i Implant innovations, Brasil was positioned in the middle of a resin block and over it we screwed 15 UCLA abutments shaped and anti-rotationable (137CNB, Conexão Sistemas de Próteses, Brasil with a torque of 20N.cm without any laboratorial procedure (control group - CTRLG. From a silicon model 15 UCLA-type calcinatable compounds (56CNB, Conexão Sistemas de Próteses, Brasil were screwed (20 N.cm, received a standard waxing (plain buccal surface and were cast in titanium (casting group - CG and other 15 compounds, UCLA - type shaped in titanium (137 CNB, Conexão Sistemas de Próteses, Brasil received the same standard waxing. These last copings were cast in titanium separated from each other and were laser-welded to the respective abutments on their border (Laser-welding group - LWG. The border adaptation was observed in the implant/compound interface, under measurement microscope, on the y axis, in 4 vestibular, lingual, mesial and distal referential points previously marked on the block. The arithmetical means were obtained and an exploratory data analysis was performed to determine the most appropriate statistical test. Descriptive statistics data (µm for Control (mean±standard deviation: 13.50 ± 21.80; median 0.00, for Casting (36.20±12.60; 37.00, for Laser (10.50 ±12.90; 3.00 were submitted to Kruskal-Wallis ANOVA, alpha = 5%. Results test showed that distorsion median values differ statistically (kw = 17.40; df =2; p = 0.001A reposição de um elemento dentário pode ser feita por um implante osseointegrado sendo que a

Preliminary conceptual design for a 510 MeV electron/positron injector for a UCLA φ factory

International Nuclear Information System (INIS)

Dahlbacka, G.; Hartline, R.; Barletta, W.; Pellegrini, C.

1991-01-01

UCLA is proposing a compact suer conducting high luminosity (10 32-33 cm -2 sec -1 ) e + e - collider for a φ factory. To achieve the required e + e - currents, full energy injections from a linac with intermediate storage in a Positron Accumulator Ring (PAR) is used. The elements of the linac are outlined with cost and future flexibility in mind. The preliminary conceptual design starts with a high current gun similar in design to those developed at SLAC and at ANL (for the APS). Four 4-section linac modules follow, each driven by a 60 MW klystron with a 1 μsec macropulse and an average current of 8.6 A. The first 4-section model is used to create positrons in a tungsten target at 186 MeV. The three remaining three modules are used to accelerate the e + e - beam to 558 MeV (no load limit) for injection into the PAR

The Benefits of Adding SETI to the University Curriculum and What We Have Learned from a SETI Course Recently Offered at UCLA

Science.gov (United States)

Lesyna, Larry; Margot, Jean-Luc; Greenberg, Adam; Shinde, Akshay; Alladi, Yashaswi; Prasad MN, Srinivas; Bowman, Oliver; Fisher, Callum; Gyalay, Szilard; McKibbin, William; Miles, Brittany E.; Nguyen, Donald; Power, Conor; Ramani, Namrata; Raviprasad, Rashmi; Santana, Jesse

2017-01-01

We advocate for the inclusion of a full-term course entirely devoted to SETI in the university curriculum. SETI usually warrants only a few lectures in a traditional astronomy or astrobiology course. SETI’s rich interdisciplinary character serves astronomy students by introducing them to scientific and technological concepts that will aid them in their dissertation research or later in their careers. SETI is also an exciting topic that draws students from other disciplines and teaches them astronomical concepts that they might otherwise never encounter in their university studies. We have composed syllabi that illustrate the breadth and depth that SETI courses provide for advanced undergraduate or graduate students. The syllabi can also be used as a guide for an effective SETI course taught at a descriptive level.After a pilot course in 2015, UCLA formally offered a course titled "EPSS C179/279 - Search for Extraterrestrial Intelligence: Theory and Applications" in Spring 2016. The course was designed for advanced undergraduate students and graduate students in the science, technical, engineering, and mathematical fields. In 2016, 9 undergraduate students and 5 graduate students took the course. Students designed an observing sequence for the Arecibo and Green Bank telescopes, observed known planetary systems remotely, wrote a sophisticated and modular data processing pipeline, analyzed the data, and presented the results. In the process, they learned radio astronomy fundamentals, software development, signal processing, and statistics. The instructor believes that the students were eager to learn because of the engrossing nature of SETI. The students rated the course highly, in part because of the observing experience and the teamwork approach. The next offering will be in Spring 2017.See lxltech.com and seti.ucla.edu

32 CFR 806.26 - Addressing FOIA requests.

Science.gov (United States)

2010-07-01

.../SCTC, 230 East Flight Line Road, Langley AFB VA 23665-2781. (2) Air Education and Training Command... AFCEE/MSI, 3207 North Road, Brooks AFB, TX 78235-5363. (4) Air Force Civil Engineering Support Agency... Inspection Agency (AFIA): (Shared FOIA office/function, AFIA and Air Force Safety Agency) AFSA/JAR, 9700...

Wavelet-based blind identification of the UCLA Factor building using ambient and earthquake responses

International Nuclear Information System (INIS)

Hazra, B; Narasimhan, S

2010-01-01

Blind source separation using second-order blind identification (SOBI) has been successfully applied to the problem of output-only identification, popularly known as ambient system identification. In this paper, the basic principles of SOBI for the static mixtures case is extended using the stationary wavelet transform (SWT) in order to improve the separability of sources, thereby improving the quality of identification. Whereas SOBI operates on the covariance matrices constructed directly from measurements, the method presented in this paper, known as the wavelet-based modified cross-correlation method, operates on multiple covariance matrices constructed from the correlation of the responses. The SWT is selected because of its time-invariance property, which means that the transform of a time-shifted signal can be obtained as a shifted version of the transform of the original signal. This important property is exploited in the construction of several time-lagged covariance matrices. The issue of non-stationary sources is addressed through the formation of several time-shifted, windowed covariance matrices. Modal identification results are presented for the UCLA Factor building using ambient vibration data and for recorded responses from the Parkfield earthquake, and compared with published results for this building. Additionally, the effect of sensor density on the identification results is also investigated

Science and Engineering of the Environment of Los Angeles: A GK-12 Experiment at Developing Science Communications Skills in UCLA's Graduate Program

Science.gov (United States)

Moldwin, M. B.; Hogue, T. S.; Nonacs, P.; Shope, R. E.; Daniel, J.

2008-12-01

Many science and research skills are taught by osmosis in graduate programs with the expectation that students will develop good communication skills (speaking, writing, and networking) by observing others, attending meetings, and self reflection. A new National Science Foundation Graduate Teaching Fellows in K- 12 Education (GK-12; http://ehrweb.aaas.org/gk12new/) program at UCLA (SEE-LA; http://measure.igpp.ucla.edu/GK12-SEE-LA/overview.html ) attempts to make the development of good communication skills an explicit part of the graduate program of science and engineering students. SEE-LA places the graduate fellows in two pairs of middle and high schools within Los Angeles to act as scientists-in- residence. They are partnered with two master science teachers and spend two-days per week in the classroom. They are not student teachers, or teacher aides, but scientists who contribute their content expertise, excitement and experience with research, and new ideas for classroom activities and lessons that incorporate inquiry science. During the one-year fellowship, the graduate students also attend a year-long Preparing Future Faculty seminar that discusses many skills needed as they begin their academic or research careers. Students are also required to include a brief (two-page) summary of their research that their middle or high school students would be able to understand as part of their published thesis. Having students actively thinking about and communicating their science to a pre-college audience provides important science communication training and helps contribute to science education. University and local pre- college school partnerships provide an excellent opportunity to support the development of graduate student communication skills while also contributing significantly to the dissemination of sound science to K-12 teachers and students.

National Cancer Institute's leadership role in promoting State and Community Tobacco Control research.

Science.gov (United States)

Ginexi, Elizabeth M; Vollinger, Robert E

2016-10-01

The National Cancer Institute (NCI) has been at the vanguard of funding tobacco control research for decades with major efforts such as the Community Intervention Trial for Smoking Cessation (COMMIT) in 1988 and the American Stop Smoking Intervention Study (ASSIST) in 1991, followed by the Tobacco Research Initiative for State and Community Interventions in 1999. Most recently, in 2011, the NCI launched the State and Community Tobacco Control (SCTC) Research Initiative to address gaps in secondhand smoke policies, tax and pricing policies, mass media countermeasures, community and social norms and tobacco marketing. The initiative supported large scale research projects and time-sensitive ancillary pilot studies in response to expressed needs of state and community partners. This special issue of Tobacco Control showcases exciting findings from the SCTC. In this introductory article, we provide a brief account of NCI's historical commitment to promoting research to inform tobacco control policy. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

Climate action issues on the table / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Peaminister Andrus Ansipi ja Euroopa Komisjoni kliimameetmete voliniku Connie Hedegaardi kohtumisel räägiti üleilmse kliimakokkuleppest, keskkonnasõbralikuma tootmise võimalustest ning kasvuhoonegaaside riiklikust jaotuskavast

ESK aastakoosolek / Priit Aruvald

Index Scriptorium Estoniae

Aruvald, Priit

2005-01-01

Eesti Sihtkapital Kanadas pidas 27. aprillil 2005 oma koosolekut Toronto Eesti Majas, esitati aruanded, räägiti rahalistest toetustest, stipendiumidest, uuest tegevuskavast. Esimeheks valiti tagasi Lia Hess

Self-help is key to recovery

Index Scriptorium Estoniae

2011-01-01

31. oktoobril Kopenhaagenis toimunud Balti- ja Põhjamaade peaministrite kohtumisel räägiti Euroopa majandusolukorrast. Peaminister Andrus Ansip rääkis ka Eesti hiljutistest kogemustest majanduskriisist väljatulemisel

HOLi liikmed pooldavad omavalitsusliitude tugevdamist / Kristiina Nurmis

Index Scriptorium Estoniae

Nurmis, Kristiina

2003-01-01

Jõelähtmel toimunud Harjumaa Omavalitsuste Liidu nõupäeval ja volikogu istungil räägiti regionaalhaldusest, transpordist ning spordi- ja kultuuriobjektide rahastamisest. Siseminister Jaan Õunapuu esinemisest

Birma südames / Silver Meikar

Index Scriptorium Estoniae

Meikar, Silver, 1978-

2007-01-01

Reformierakonna liige käis Prahas toimunud Birma konverentsil, kus räägiti Birma militaarrežiimi kuritegudest ja kirjutati alla avaldusele, mis soovib tugevdada Euroopa panust birmalaste aitamiseks

Regional chiefs meet to discuss key issues / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2009-01-01

Stockholmis toimunud Põhja- ja Baltimaade peaministrite kohtumisel räägiti energiajulgeolekust, praegusest majandusolukorrast ja detsembris toimuva ÜRO kliimakonverentsi ettevalmistustest. Andrus Ansip rõhutas uue rahvusvahelise kliimalepingu tähtsust

GMO konverents Brüsselis / Nastja Pertsjonok

Index Scriptorium Estoniae

Pertsjonok, Nastja

2007-01-01

Brüsselis toimunud GMO-vabade piirkondade konverentsist, kus räägiti GMO-vabade piirkondade liikumisest, GMO-de lubamisest ja keelamisest ning hoiakutest nende suhtes Euroopa Liidus ja mujal maailmas

Latvia offers template for U.S

Index Scriptorium Estoniae

2011-01-01

20. aprillil toimunud Läti presidendi Valdis Zatlersi ja USA senaatorite delegatsiooni kohtumisel räägiti riikidevahelistest suhetest, energiapoliitikast, majandus- ning sõjalisest koostööst. Delegatsiooniga kohtus ka kaitseminister Artis Pabriks

Estonia in closer ties with Canada / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Välisminister Urmas Paet kohtus Kanada välisministri Lawrence Cannoni ja kaitseminister Peter MacKay'ga. Kohtumisel räägiti Eesti panusest Afganistani ja Arktika arengusse. Välisminister kohtus ka eesti kogukonnaga

South Koreans' withdrawal from the competition over Lithuania's new nuke / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2010-01-01

Energiafirma Korea Electric Power Corporation (KEPCO) loobus ootamatult Ignalina tuumajaama rajamiseks korraldatud konkursis osalemast. Selle otsuse võimalikest tagamaadest. 5. detsembril Varssavis toimunud Poola ja Baltimaade peaministrite kohtumisel räägiti energiajulgeoleku probleemidest

Enefit gaining Latvian customers

Index Scriptorium Estoniae

2011-01-01

3. märtsil toimunud Riia linnapea Nils Usakovsi ja Enefiti esindajate kohtumisel räägiti firma tariifidest, mida nad võiks munitsipaalettevõtetele ja -organisatsioonidele pakkuda. Latvenergo tõstab hindu 1. aprillil

Vaba ruum raamatukaante vahel ja konverentsisaalis / Mark Foster Cage, Walter Nicolino, Mario Carpo

Index Scriptorium Estoniae

2014-01-01

Biennaali ametliku avamisprogrammi raames toimunud sümpoosionil räägiti arhitektuuri puudutavate tegurite muutumisest ühiskondlikus olukorras. Eesti ekspositsiooni kuraatorite kutsel tulid ettekannete autorid Teatro Piccolo Arsenales kokku, et vestelda digitaalsest arhitektuurist

Vene elektrivõrk : Gazprom on ebakindel gaasitarnija / Raimo Poom

Index Scriptorium Estoniae

Poom, Raimo

2007-01-01

Tallinnas toimunud rahvusvahelisel energiajulgeoleku konverentsil räägiti energia- ja keskkonnateemadel. Vene elektrivõrkude esindaja Marina Liborakina hoiatas Gazpromi vigade eest gaasi tarnimisel. Kommenteerib Briti nõustamisfirma E3G juhataja Nick Mabey

Disease: H01676 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available hat cause inflammation of the arachnoid, such as subarachnoid hemorrhage, traumatic brain injury, or menin...gitis. As many as half of patients with NPH have no identifiable risk factor, and i

City Council increases efforts to deal with rising unemployment / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2009-01-01

Tallinna Linnavalitsus korraldas kohtumise keskkooli õpilastele ja nende vanematele, räägiti karjäärivõimalustest, tööpuudusest ja Tallinna linna kriisiplaanist. Üritusest võttis osa ka Tarmo Kriis

A framework for improving access and customer service times in health care: application and analysis at the UCLA Medical Center.

Science.gov (United States)

Duda, Catherine; Rajaram, Kumar; Barz, Christiane; Rosenthal, J Thomas

2013-01-01

There has been an increasing emphasis on health care efficiency and costs and on improving quality in health care settings such as hospitals or clinics. However, there has not been sufficient work on methods of improving access and customer service times in health care settings. The study develops a framework for improving access and customer service time for health care settings. In the framework, the operational concept of the bottleneck is synthesized with queuing theory to improve access and reduce customer service times without reduction in clinical quality. The framework is applied at the Ronald Reagan UCLA Medical Center to determine the drivers for access and customer service times and then provides guidelines on how to improve these drivers. Validation using simulation techniques shows significant potential for reducing customer service times and increasing access at this institution. Finally, the study provides several practice implications that could be used to improve access and customer service times without reduction in clinical quality across a range of health care settings from large hospitals to small community clinics.

Estonian Air püüdis viimase hetkeni Top Toursi päästa / Mirko Ojakivi

Index Scriptorium Estoniae

Ojakivi, Mirko

2010-01-01

Estonian Air kaalus Top Toursile appiminekut, sest reisifirma oli Estonian Airil üks olulisemaid koostööpartnereid. Abi oleks puudutanud ennekõike uutele lendudele allahindluse tegemist, räägiti ka võimalikust krediidist

Government continues work on economic plan

Index Scriptorium Estoniae

2009-01-01

25. augustil toimunud Läti välisministri Maris Riekstinsi ja Austria välisministri Michael Spindeleggeri kohtumisel räägiti riikidevahelistest suhetest. Energeetikaministeeriumi konverentsil esines Euroopa Komisjoni volinik Andris Piebalgs. Läti majandusplaanist

Disease: H00306 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available found in the animal's oral cavity. Disseminated Pasteurella infections can lead to serious diseases including septic shock and menin...gitis mostly in infants and pregnant women. Many patients with P. multocida-related

Putin and Kubilius in energy talks

Index Scriptorium Estoniae

2010-01-01

Leedu peaministri Andrius Kubiliuse ja Venemaa peaministri Vladimir Putini kohtumisel räägiti energeetikast. Andrius Kubilius rõhutas, et Leedu kavatseb ehitada tuumaelektrijaama Visaginasesse ja ei plaani teistest regionaalsetest energeetika-alastest projektidest osa võtta

Ansip confident on euro adoption next year / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

9. aprillil toimunud peaminister Andrus Ansipi, Soome peaministri Matti Vanhaneni ja rahandusministri Jyrki Kataineni kohtumisel räägiti Eesti võimalikust liitumisest euroga. Matti Vanhanen ja Jyrki Katainen avaldasid tunnustust Eesti valitsuse tööle

Estonia to support crisis management mechanism at European Council meeting in Brussels / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

28.-29. oktoobril Brüsselis toimunud Euroopa Ülemkogul räägiti, kuidas võiks Euroopa Liidu majanduspoliitikat kriiside vältimiseks paremini koordineerida. Euroopa Liidu eelarve kasvu piiramist toetab teiste riikide hulgas ka Eesti

Defense policies under review / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Välisminister Urmas Paeti ja Ameerika Ühendriikide poliitika-ala asekaitseministri Michele Flournoy 26. veebruaril toimunud kohtumisel räägiti Eesti ja USA koostööst Afganistanis, NATO-Vene suhetest ning NATO-st üldiselt

Lithuania will build its liquid gas terminal / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2010-01-01

21. juulil otsustas Leedu valitsus, et Klaipedasse ehitatakse veeldatud maagaasi terminal. See otsus lõpetab Gazpromi monopoli. 28. juunil toimunud Valgevene presidendi Aleksander Lukashenko ja Leedu peaministri Andrius Kubiliuse kohtumisel räägiti samuti veeldatud maagaasi terminalidest

Malnutrition and sarcopenia in a large cohort of patients with systemic sclerosis.

Science.gov (United States)

Caimmi, C; Caramaschi, P; Venturini, A; Bertoldo, E; Vantaggiato, E; Viapiana, O; Ferrari, M; Lippi, G; Frulloni, L; Rossini, M

2018-04-01

Systemic sclerosis (SSc) is an autoimmune disease which may lead to malnutrition. Previous studies have defined it with different criteria. No thorough evaluations of sarcopenia in SSc are available. The aim of the present study was to assess the prevalence and the potential association of malnutrition and sarcopenia in a large cohort of SSc cases. A total of 141 SSc consecutive outpatients were enrolled. Body composition was analyzed by densitometry. Malnutrition was defined according to recently published ESPEN criteria, whereas sarcopenia was diagnosed in patients with reduced skeletal muscle index. Malnutrition was diagnosed in 9.2% of patients (95% CI, 4.4-14.0%). Malnourished patients had worse gastrointestinal symptoms according to UCLA SCTC GIT 2.0 questionnaire (p = 0.007), lower physical activity (p = 0.028), longer disease duration (p = 0.019), worse predicted DLCO/VA and FVC (p = 0.009, respectively), worse disease severity according to Medsger severity score (p < 0.001), lower hemoglobin (p = 0.023), and fat-free mass (p < 0.001) and were more often sarcopenic (p < 0.001). In multivariate analysis, only FVC (p = 0.006) and disease severity (p = 0.003), in particular for the lungs (p = 0.013), were confirmed to be worse in malnourished patients. Sarcopenia was diagnosed in 29\\140 patients (20.7%; 95% CI, 14.0-27.4%); 11\\29 were also malnourished. In multivariate analysis, sarcopenic patients had longer disease duration (p = 0.049), worse DLCO/VA (p = 0.002), and lung (p = 0.006) and skin (p = 0.014) involvement. In SSc, malnutrition defined with ESPEN criteria was found to be lower than previously reported. Sarcopenia was found to be somewhat common. Lung involvement was significantly associated with nutritional status and may not be explained only by muscle weakness.

Validation of the UCLA Child Post traumatic stress disorder-reaction index in Zambia

Directory of Open Access Journals (Sweden)

Cohen Judith A

2011-09-01

Full Text Available Abstract Background Sexual violence against children is a major global health and human rights problem. In order to address this issue there needs to be a better understanding of the issue and the consequences. One major challenge in accomplishing this goal has been a lack of validated child mental health assessments in low-resource countries where the prevalence of sexual violence is high. This paper presents results from a validation study of a trauma-focused mental health assessment tool - the UCLA Post-traumatic Stress Disorder - Reaction Index (PTSD-RI in Zambia. Methods The PTSD-RI was adapted through the addition of locally relevant items and validated using local responses to three cross-cultural criterion validity questions. Reliability of the symptoms scale was assessed using Cronbach alpha analyses. Discriminant validity was assessed comparing mean scale scores of cases and non-cases. Concurrent validity was assessed comparing mean scale scores to a traumatic experience index. Sensitivity and specificity analyses were run using receiver operating curves. Results Analysis of data from 352 youth attending a clinic specializing in sexual abuse showed that this adapted PTSD-RI demonstrated good reliability, with Cronbach alpha scores greater than .90 on all the evaluated scales. The symptom scales were able to statistically significantly discriminate between locally identified cases and non-cases, and higher symptom scale scores were associated with increased numbers of trauma exposures which is an indication of concurrent validity. Sensitivity and specificity analyses resulted in an adequate area under the curve, indicating that this tool was appropriate for case definition. Conclusions This study has shown that validating mental health assessment tools in a low-resource country is feasible, and that by taking the time to adapt a measure to the local context, a useful and valid Zambian version of the PTSD-RI was developed to detect

Lower pay for equal work / Matt Garrick

Index Scriptorium Estoniae

Garrick, Matt

2011-01-01

30. juunil Vilniuses toimunud demokraatiat suurendavatele naistele pühendatud konverentsil räägiti suhtumisest naistesse ja naisjuhtidesse. Konverentsist võtsid osa ka Leedu president Dalia Grybauskaite, Soome riigipea Tarja Halonen ja USA riigisekretär Hillary Clinton

Estonia ready to contribute to OECD / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Eestis visiidil viibinud OECD peasekretär Angel Gurria kohtus president Toomas Hendrik Ilvese ja peaminister Andrus Ansipiga. Kohtumistel räägiti Eesti liitumisest OECD-ga. Andrus Ansip ja Angel Gurria kirjutasid alla Eesti ühinemislepingule OECD-ga

Zatlers discusses energy issues in Lithuania / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2011-01-01

10. veebruaril alanud Läti presidendi Valdis Zatlersi Leedu riigivisiidist, mille käigus ta kohtus ka Leedu presidendi Dalia Grybauskaitega. Kohtumisel räägiti energeetika teemadel ja rõhutati, et riikidevahelised suhted on jätkuvalt head

Maaelu Edendamise Sihtasutuse tööd / Raul Rosenberg

Index Scriptorium Estoniae

Rosenberg, Raul, 1961-

2005-01-01

Vastukaja Toomas Mattsoni artiklile "Laenumiljonid tuulte meelevallas" 3. märtsi Maalehes lk. 10, kus räägiti Riigikontrolli aruandest Maaelu Edendamise Sihtasutuse kaudu maaelu ja ettevõtluse edendamiseks antud laenude kohta. Sihtasutuse tegevusest maapiirkondade majandusliku arengu toetamisel

I pravda - vratshi bez granits / Jevgeni Kapov

Index Scriptorium Estoniae

Kapov, Jevgeni

2007-01-01

Peterburi ja Novgorodi meditsiinitöötajad ja ametnikud külastasid Kohtla-Järvet, kus kohtuti linnajuhtidega ja käidi Ida-Viru keskhaiglas ning räägiti meedikute koostööplaanidest. Vt. samas intervjuud Anatoli Domashenkoga

Closer integration called for in Vihula

Index Scriptorium Estoniae

2011-01-01

11. veebruaril Vihulas toimunud Balti ministrite nõukogu peaministrite mitteametlikul kohtumisel räägiti majanduspoliitika, energeetika ja digitaalse siseturu loomise teemadel. Läti peaministri Valdis Dombrovskise arvamused. Kohtumisest võttis osa ka Euroopa Komisjoni rahandus- ja majandusvolinik Olli Rehn

Preparation for Lithuania's leadership over the EU / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2010-01-01

14. jaanuaril toimunud Leedu välisministri Vygaudas Ušackase ja Kreeka asevälisministri Dimitris Droutsase kohtumisel räägiti ka sellest, et 2013. aasta teisel poolel saab Leedust Euroopa Liidu eesestujamaa. Kreeka saab Euroopa Liidu eesistujamaaks 2014. aasta esimesel pool

35 - eto serjozno / Erki Aule ; interv. Nikolai Hrustaljov

Index Scriptorium Estoniae

Aule, Erki

2005-01-01

Lavastaja ja Vene Teatriakadeemia (endine GITIS) magistrant Erki Aule oma elust ja tegemistest. Suvelavastusest "Vapper Mikko" Trumm teatri esituses Rahvusraamatukogu amfiteatris ja oma näidendist "Varblased lendasid ära", mis nimetati 10 parima näidendi hulgas Üleliidulisel dramaturgia konkursil

Dutch ties strengthened / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Eesti välisministri Urmas Paeti ja Hollandi välisministri Uri Rosenthali kohtumisel räägiti riikidevahelisest kaitsealasest koostööst, EL-i poliitikast, Euroopa naabruspoliitikast ja idapartnerlusest. Urmas Paet märkis, et Holland on üks suurimatest Eestisse investeerijatest

Kruuda tahab Kalevi ja Tere ikkagi Altale müüa / Hindrek Riikoja

Index Scriptorium Estoniae

Riikoja, Hindrek

2008-01-01

Oliver Kruuda firmade Kalev ja Tere müügiläbirääkimiste katkemisest Altaga. Alta Capitali juhi Indrek Rahumaa sõnul loodetakse müügilepinguni jõuda aasta teises pooles. Lisa: Mille üle läbi räägiti

Kokk discusses unified foreign service with Czechs / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Välisministeeriumi kantsler Marten Kokk kohtus Tšehhi Euroopa asjade asevälisministri Vladimir Galuska ja haldusküsimuste aseministri Milan Sedlacekiga. Kohtumistel räägiti Euroopa Liidu välisteenistuse loomisest, Euroopa Liidu laienemisest ja idapartnerlusest ning Eesti ja Tšehhi vahelistest suhetest

Kolm ministrit valgustasid Kagu-Eesti omavalitsusjuhte / Mari-Anne Leht

Index Scriptorium Estoniae

Leht, Mari-Anne, 1950-

2003-01-01

Valgamaal Taageperas räägiti Kagu-Eesti omavalitsusjuhtidele haridusest, haridusreformist ja rahast. Kohal olid ka haridus- ja teadusminister Toivo Maimets, siseminister Jaan Õunapuu ja majandusminister Meelis Atonen. Kommenteerivad Rein Randver, Pille Tali, Sirje Tobreluts jt. Vt. samas: Hannes Võrno kaebas rasket elu

"Bizkon" pomogajet razvivat prigranitshnoje sotrudnitshestvo i mezhdunarodnõje biznes-kontaktõ / Aleksandr Komshin

Index Scriptorium Estoniae

Komshin, Aleksandr

2008-01-01

Kohtla-Järvel toimunud rahvusvahelisel seminaril räägiti piirikoostöö arendamisest ning Eesti, Soome ja Venemaa väikese- ja keskmise ettevõtluse toetusest regionaalsel tasandil. Seminar toimus kohaliku omavalitsuse ja Sankt-Peterburgi أBIZKONؤ ärikeskuse koostöö raames

Peregruzka? Podzarjadka? / Eteri Kekelidze

Index Scriptorium Estoniae

Kekelidze, Eteri, 1944-

2008-01-01

Tallinnas toimunud Reformierakonna majanduskonverentsil Restart, millest võttis osa ka Euroopa Parlamendi liige Siim Kallas, räägiti majanduslangusest. Ka Eesti Suurettevõtjate Assotsiatsiooni konverentsil kõneldi majandusprobleemidest ja Eesti-Vene suhetest. Arvamust avaldavad: Endel Siff, Fjodor Berman ja Jüri Käo

Berliinis räägiti NordStreami venimisest / Raavo Raadik

Index Scriptorium Estoniae

Raadik, Raavo

2008-01-01

Financial Times Deutschland (FTD) ajakirjanikud vahendasid Vene gaasikontserni Gazprom juhatuse liikme Valeri Jassevi kinnitusi, et gaasijuhtme esimene osa peaks valmima 2011. aastal ja 2012. aastal peaks algama esimesed gaasitarned. Seni oli NordStream lähtunud varasematest tähtaegadest

Inimese papilloomiviiruse vastane vaktsiin imet ei tee, aga kaitseb siiski / Marika Kusnets

Index Scriptorium Estoniae

Kusnets, Marika

2006-01-01

5. oktoobril korraldas ravimifirma Merck Sharp & Dohme koostöös erialaarstide, Eesti Vähiliidu ja Quattromediga ajakirjanikele ümarlaua, kus räägiti emakakaelavähi põhjustest ja ravist, HPV tüüpidest, nakatumis- ja kaitsemehhanismidest ning uuest Eesti turule jõudvast vaktsiinist

Lithuania is cautious regarding sanctions against Minsk / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2011-01-01

23. mail toimus Valgevenes devalvatsioon. Poola välisminister Radoslaw Sikorski üritab veenda Euroopa Liitu Valgevene suhtes majandussanktsioone rakendama. Läti ja Leedu ei ole sellega nõus. 23. mail toimunud president Dalia Grybauskaite ja peaminister Andrius Kubiliuse kohtumisel räägiti Valgevene teemadel

EU leaders discuss Europe 2010 action plan / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Märtsis Brüsselis toimunud Euroopa Ülemkogul arutati Euroopa Liidu konkurentsivõime tõstmisele suunatud tegevuskava „Euroopa 2020“ ja kliimapoliitikat. Peaminister Andrus Ansipi ja Euroopa Komisjoni presidendi José Manuel Barroso kohtumisel räägiti võimalikust Eesti euroalaga ühinemisesest

Final Report UCLA-Thermochemical Storage with Anhydrous Ammonia

Energy Technology Data Exchange (ETDEWEB)

Lavine, Adrienne [Univ. of California, Los Angeles, CA (United States)

2018-02-05

investigation. UCLA has filed a patent that protects the new ideas developed during this project. Discussions are ongoing with potential investors with the aim of partnering for further work. As well as immediate improvements and extra work with the existing experimental system, a key goal is to extend it to a small solar-driven project at an early opportunity.

Foreign Ministers discuss expansion of EU foreign policy / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Eesti, Soome, Hispaania, Itaalia, Prantsuse, Rootsi ja Türgi välisministrid kohtusid Saariselkäs Euroopa Liidu välispoliitika juhi Catherine Ashtoniga. 12.-14. märtsil toimunud kohtumisel räägiti välispoliitikast, Euroopa Liidust ja selle koostööst teiste riikidega

Region's leaders meet / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Välisministeeriumi kantsler Marten Kokk osales 18. veebruaril Vilniuses toimunud Põhja-Balti koostööministrite kohtumisel, kus räägiti Põhja- ja Baltimaade koostöövõimalustest, Euroopa Liidu koostööst Valgevenega ning Läänemere strateegiast. Leedus asuva Euroopa Humanitaarülikooli toetamisest

Paet meets with policy leaders / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

8. aprillil kohtus välisminister Urmas Paet Euroopa Liidu endise välispoliitikajuhi Javier Solana ja USA endise asevälisministri Strobe Talbottiga. Kohtumisel räägiti Tallinnas toimuvast NATO välisministrite kohtumisest, Venemaa ja NATO suhetest ning Euroopa Liidu ja USA koostööst

Estonia builds ties with South Korea

Index Scriptorium Estoniae

2010-01-01

Korea Vabariigis toimunud välisminister Urmas Paeti ja Lõuna-Korea välis- ja kaubandusministri Yu Myung-hwani kohtumisel räägiti Eesti ja Lõuna-Korea poliitilise, majandus-, teadus- ning infotehnoloogiaalase koostöö arendamisest. Urmas Paet kohtus ka Lõuna-Korea energia ja infotehnoloogia aseministri Cho Seokiga

The UCLA Multimodal Connectivity Database: A web-based platform for brain connectivity matrix sharing and analysis

Directory of Open Access Journals (Sweden)

Jesse A. Brown

2012-11-01

Full Text Available Brain connectomics research has rapidly expanded using functional MRI (fMRI and diffusion-weighted MRI (dwMRI. A common product of these varied analyses is a connectivity matrix (CM. A CM stores the connection strength between any two regions (nodes in a brain network. This format is useful for several reasons: 1 it is highly distilled, with minimal data size and complexity, 2 graph theory can be applied to characterize the network’s topology, and 3 it retains sufficient information to capture individual differences such as age, gender, intelligence quotient, or disease state. Here we introduce the UCLA Multimodal Connectivity Database (http://umcd.humanconnectomeproject.org, an openly available website for brain network analysis and data sharing. The site is a repository for researchers to publicly share CMs derived from their data. The site also allows users to select any CM shared by another user, compute graph theoretical metrics on the site, visualize a report of results, or download the raw CM. To date, users have contributed over 2000 individual CMs, spanning different imaging modalities (fMRI, dwMRI and disorders (Alzheimer’s, autism, Attention Deficit Hyperactive Disorder. To demonstrate the site’s functionality, whole brain functional and structural connectivity matrices are derived from 60 subjects’ (ages 26-45 resting state fMRI (rs-fMRI and dwMRI data and uploaded to the site. The site is utilized to derive graph theory global and regional measures for the rs-fMRI and dwMRI networks. Global and nodal graph theoretical measures between functional and structural networks exhibit low correspondence. This example demonstrates how this tool can enhance the comparability of brain networks from different imaging modalities and studies. The existence of this connectivity-based repository should foster broader data sharing and enable larger-scale meta analyses comparing networks across imaging modality, age group, and disease state.

Elu kui näitemäng / Helju Koger

Index Scriptorium Estoniae

Koger, Helju, 1943-

2007-01-01

VI kihelkonnapäevadest Juurus. Juuru Mihkli kirikus esines ansambel Resonabilis. Konverentsil räägiti Järlepa mõisast, Anu Allikvee pidas ettekande "August von Kotzebue elu nagu näitemäng" jm. Näitemängu "Pärmi Jaagu unenägu" nägi kohalike asjaarmastajate esituses

Paet offers full support to Moldova / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Välisminister Urmas Paet võttis osa Chişinăus toimunud Euroopa Liidu riikide välisministrite Moldova sõprade rühma kohtumisest, kus räägiti Moldova tegutsemisest Euroopa Liidu suunal. Välisministrid kohtusid ka Moldova peaministri Vladimir Filati ja riigi välisministri Iurie Leancaga

Lithuanian trade mission visits Tokyo

Index Scriptorium Estoniae

2010-01-01

Leedu välisministri Andronius Azubalise ja Jaapani välisministri Seiji Maehara kohtumisel räägiti riikidevahelisest koostööst. Tokyo visiidi ajal kohtus välisminister ka alamkoja väliskomitee esimehe Tadamasa Kodaira ja majandus- ja tööstusministri asetäitja Motohisa Ikedaga

Belarus and Russia in OSCE Ministerial Council focus / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2011-01-01

6.-7. detsembril Vilniuses toimunud OSCE Ministrite Nõukogu kohtumisel räägiti inimõiguste probleemidest, meediavabadusest, Afganistanist, Araabia kevadest, Valgevenes toimuvast ja Venemaal toimunud parlamendivalimistest. Kohtumise avas Leedu president Dalia Grybauskaite. 6. detsembril kohtus USA riigisekretär Hillary Clinton president Dalia Grybauskaite ja välisminister Audronius Azubalisega

Pilk maestro Neeme Järvi muusikalisse loometöösse / Airi Vaga

Index Scriptorium Estoniae

Vaga, Airi, 1940-

2006-01-01

kohtumisest New Jersey Symphony Orchestra mängijate ja dirigendiga 13. jaanuaril 2006 Newarkis, kus tutvustati sümfooniaorkestri 2006 - 2007. aasta programmi ning räägiti tööst Beethoveni 9. sümfoonia ettevalmistamisel kontserdiks. Tunti muret noorte muusikakasvatuse ühekülgse arengu pärast

Heated squabble over Belarus marks beginning of the year / Linas Jegelevicius

Index Scriptorium Estoniae

Jegelevicius, Linas

2011-01-01

Leedu ekspresident Valdas Adamkus on kritiseerinud president Dalia Grybauskaite välispoliitikat Valgevene suhtes. 3. jaanuaril toimunud presidendi ja välisminister Andronius Azubalise kohtumisel räägiti ka Valgevene presidendivalimistest ja sealsest olukorrast. Dalia Grybauskaite prognoose ja eesmärke 2011. aastaks on samuti kritiseeritud. Leedu on 2011. aastal OSCE eesistuja

Ilves urges closer ties while in Austria / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

President Toomas Hendrik Ilvese ametlik visiit Austria Vabariiki 22.11.2010 - 24.11.2010. Eesti riigipea pidas kõne Austria Majanduskojas Eesti-Austria majandusfoorumil, kohtus Alam-Austria Liidumaa parlamendi presidendi Hanz Penz'i ning Austria presidendi Heinz Fischeriga. Presidentide kohtumisel räägiti EL-i laienemispoliitikast, energiajulgeoleku probleemidest, Euroopa naabruspoliitikast ja idapartnerlusest

Clown prince Lembergs lashes out at Zatlers

Index Scriptorium Estoniae

2011-01-01

Läti kaubandus-tööstuskoja endine esimees Zaneta Jaunzeme-Grende liitus poliitilise ühendusega „Kõik Läti heaks”, et saaks Lätis valitseva oligarhiaga võidelda. Läti president Valdis Zatlers osales Viinis toimunud ülemaailmsel majandusfoorumil, kus räägiti ka korruptsiooni teemadel. 8. juunil Riias toimunud oligarhidevastasest meeleavaldusest

Work starts after regimes fall

Index Scriptorium Estoniae

2011-01-01

27. mail Varssavis toimunud Kesk-Euroopa riigipeade kohtumisel räägiti, kuidas võiks Euroopa naabruses elavaid rahvaid stabiilse ja demokraatliku poliitilise süsteemi loomisel aidata. Eesti president Toomas Hendrik Ilves rõhutas oma kõnes, et iga revolutsiooni tulemus ei ole alati demokraatia. Õhtul saabus Varssavi ka USA president Barack Obama

Grybauskaite's historic visit to Belarus / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2010-01-01

Minskis toimunud presidentide Dalia Grybauskaite ja Aleksandr Lukašenko kohtumisel räägiti 19. detsembril toimuvatest Valgevene presidendivalimistest ja idapartnerlusest. Leedu president kohtus ka opositsiooni liikmetega. Visiidi ajal allkirjastasid riikide välisministrid Audronius Azubalis ja Sergei Martõnov lepingu, mis lihtsustab kahe riigi piiriäärsete elanike piiriületust

How does sagittal imbalance affect the appropriateness of surgical indications and selection of procedure in the treatment of degenerative scoliosis? Findings from the RAND/UCLA Appropriate Use Criteria study.

Science.gov (United States)

Daubs, Michael D; Brara, Harsimran S; Raaen, Laura B; Chen, Peggy Guey-Chi; Anderson, Ashaunta T; Asch, Steven M; Nuckols, Teryl K

2018-05-01

Degenerative lumbar scoliosis (DLS) is often associated with sagittal imbalance, which may affect patients' health outcomes before and after surgery. The appropriateness of surgery and preferred operative approaches has not been examined in detail for patients with DLS and sagittal imbalance. The goals of this article were to describe what is currently known about the relationship between sagittal imbalance and health outcomes among patients with DLS and to determine how indications for surgery in patients with DLS differ when sagittal imbalance is present. This study included a literature review and an expert panel using the RAND/University of California at Los Angeles (UCLA) Appropriateness Method. To develop appropriate use criteria for DLS, researchers at the RAND Corporation recently employed the RAND/UCLA Appropriateness Method, which involves a systematic review of the literature and multidisciplinary expert panel process. Experts reviewed a synopsis of published literature and rated the appropriateness of five common operative approaches for 260 different clinical scenarios. In the present work, we updated the literature review and compared panelists' ratings in scenarios where imbalance was present versus absent. This work was funded by the Collaborative Spine Research Foundation, a group of surgical specialty societies and device manufacturers. On the basis of 13 eligible studies that examined sagittal imbalance and outcomes in patients with DLS, imbalance was associated with worse functional status in the absence of surgery and worse symptoms and complications postoperatively. Panelists' ratings demonstrated a consistent pattern across the diverse clinical scenarios. In general, when imbalance was present, surgery was more likely to be appropriate or necessary, including in some situations where surgery would otherwise be inappropriate. For patients with moderate to severe symptoms and imbalance, a deformity correction procedure was usually appropriate

Kubilius conquers America / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2010-01-01

5.- 9. maini kestnud Ameerika Ühendriikide visiidi ajal kohtus Leedu peaminister Andrius Kubilius riigisekretäri Hillary Rodham Clintoniga, kellega räägiti riikidevahelistest suhetest, CIA salavanglast ja Egle Kusaitest, kes väidetavalt plaanis Venemaa sõjalistel objektidel läbi viia terrorirünnakud. Andrius Kubilius kohtus ka IBMi esindajatega. IBM plaanib rajada Leetu uurimiskeskuse

Russian-Belarusian propaganda war and Vilnius / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2010-01-01

Venemaa-Valgevene konfliktist, mille käigus tsenseeritakse meediat ning kritiseeritakse president Aleksandr Lukašenkot ja peaminister Vladimir Putinit, põhjuseks on maagaasi hind. 27. juulil toimunud Leedu peaministri Andrius Kubiliuse ja Valgevene peaministri Sergei Sidorski kohtumisel räägiti vedeldatud gaasi terminali projektist. 26. juunil toimunud Andrius Kubiliuse ja Aleksandr Lukašenko kohtumisest

Järelkaja Talsinki linnaaktivismi aruteluõhtule / Kaija-Luisa Kurik

Index Scriptorium Estoniae

Kurik, Kaija-Luisa

2010-01-01

7. juunil 2010 räägiti Uue Maailma seltsimajas Helsingi linnaplaneerimisest ja linnaaktivismist ning mõeldi, mida oleks Tallinnal naaberlinnalt õppida, millisel tasandil on olemas Tallinna ja Helsingi vaheline suhtlus. Tallinn-Helsingi kaksiklinnast Talsinki. Helsingi linnaplaneerimisest rääkis Kristi Grišakov, DODO-nimelisest keskkonnaorganisatsioonist Elisa Niemi, DEMOSe nimelisest organisatsioonist ja noorteorganisatsioonist ORANSSi Kaija-Luisa Kurik

Concepteur de matériel pédagogique et rédacteur technique (h/f ...

International Development Research Centre (IDRC) Digital Library (Canada)

Le titulaire veille à ce que ce contenu fasse mieux connaître les services et les outils de GI-TI, y compris les changements récents. Il se tient au courant des changements survenus dans le domaine et entretient des relations avec la communauté locale et virtuelle de l'apprentissage et de la rédaction technique afin de ...

Baltic Sea oil spill may be inevitable / Linas Jegelevicius

Index Scriptorium Estoniae

Jegelevicius, Linas

2011-01-01

23.-24. märtsil Budapestis toimunud EL-i keskkonnanõukogu konverentsil märgiti, et Läänemere maad peavad olema võimalikuks naftareostuse tekkeks valmis ja räägiti ka Jaapanis juhtunud tuumakatastroofist. EL-i keskkonnavolinik Janez Potocnik leiab, et Valgevene peaks oma Leedu piiri lähedale plaanitava tuumaelektrijaama küsimuses ka Leedu huvidega arvestama

EU meets with Russia at Rostov-on-Don

Index Scriptorium Estoniae

2010-01-01

31. mail Rostovis Doni ääres toimunud Venemaa ja Euroopa Liidu tippkohtumisel räägiti viisavabadusest, EL-i ja Venemaa vahelistest suhetest, Venemaa liitumisest Maailma Kaubandusorganisatsiooniga ja moderniseerimispartnerlusest. Kohtumisest võtsid osa Venemaa peaminister Vladimir Putin, president Dmitri Medvedev, Euroopa Liidu president Herman Van Rompuy, välispoliitika juht Catherine Ashton ja Euroopa Komisjoni president Jose ManuelBarroso

Baltic cooperation twenty years later / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2011-01-01

2. detsembril Tallinnas toimunud Baltimaade ja Poola presidentide kohtumisel arutati Rail Balticu projektiga seonduvat. 2. detsembril Kaunases toimunud Baltimaade kaitseministrite Mart Laari, Rasa Jukneviciene ja Artis Pabriksi kohtumisel arutati Balti riikide kaitsekoostööga seotud küsimusi. Samal ajal Visaginases toimunud Läti ja Leedu peaministrite kohtumisel räägiti Visaginase tuumaelektrijaama projektist. LNG terminaliga seotud vaidlustest

Radiation-Induced Immune Modulation in Prostate Cancer

Science.gov (United States)

2008-01-01

Toxicology Program, Riverside, CA Invited Seminar: “The Proteasome as a Sensor of Stress” 3/17/04 McBride, W.H., UCLA Department of Dentistry Monthly...McBride1 1Radiation Oncology at UCLA, 2Surgical Oncology at UCLA, 3Pathology & Laboratory Medicine at UCLA, 4Public Health Biostatistics

YouthCaN 2001 / Sirje Janikson

Index Scriptorium Estoniae

Janikson, Sirje

2001-01-01

Aprillis 2001 toimus keskkonnateemaline õpilaskonverents YouthCaN 2001 Ameerika Loodusajaloo Muuseumis New Yorkìs. 35 seminarist ühe viis läbi Tartu Noorte Loodusmaja geoloogia ja keskkonnaringi esindus, tutvustati loodusmaja keskkonnaprojekte ja räägiti keskkonnaalaste veebilehtede koostamise kogemustest. YouthCaN (Youth Communicating and Networking) on rahvusvaheline noorte organisatsioon, mis vahendab kogemusi ja uusi ideid elukeskkonnast huvitatud noorte hulgas

Ilves meets with van Rompuy / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2010-01-01

Eesti presidendi Toomas Hendrik Ilvese ja Euroopa Ülemkogu eesistuja Herman van Rompuy kohtumisel räägiti euroala finantskriisist ja EL-i põllumajanduspoliitikast. 9. dets. 2010 kohtus Eesti riigipea Brüsselis NATO peasekretäri Anders Fogh Rasmusseni, Euroopa Komisjoni asepresidendi, transpordivolinik Siim Kallase ja Euroopa Komisjoni asepresidendi Neelie Kroes'iga. Töövisiit Brüsselisse 08.12.2010 - 10.12.2010

Aaviksoo goes to Washington

Index Scriptorium Estoniae

2010-01-01

Oma USA visiidi ajal kohtus kaitseminister Jaak Aaviksoo USA relvajõudude küberväejuhatuse ülema kindral Keith Alexander'iga ja sai ülevaate USA küberkaitsekorraldusest. Ministri ja USA Esindajatekoja järgmise koosseisu relvajõudude komitee esimehe Howard McKeon'i kohtumisel räägiti Euroopa ja Eesti praegusest julgeolekunägemusest. Kaitseministri plaanis oli ka kohtumine USA kaitseministri Robert Gates'iga

Ucla, escuela elemental

Directory of Open Access Journals (Sweden)

Neutra, Richard J.

1962-03-01

Full Text Available La Escuela Elemental de Preparación de la Universidad de California, en Los Angeles, está dedicada a la educación e investigación y preparación del profesorado de la infancia. Se ha construido en un paraje maravilloso, de frondosa vegetación, frente a un terreno bastante quebrado, circunstancia que presta mayor encanto al conjunto, construido con gran pericia y adaptación al paisaje a base de una dominante horizontalidad, con materiales sencillos (ladrillos, hierro y madera y gran comunicación con la naturaleza mediante grandes cristaleras correderas que ensanchan las clases y las suplementan hacia el jardín de acuerdo con las nuevas normas y prácticas docentes.

Reform tugevdagu demokraatiat / Anu Jänes

Index Scriptorium Estoniae

Jänes, Anu, 1948-

2001-01-01

Eestimaa Rahvaliidu avatud ülikooli ürituste esimesel õppusel räägiti haldusreformist. Autor: ERL. Ilmunud ka: Meie Maa, 1. märts 2001, lk. 4; Nädaline, 3. märts 2001, lk. 5; Hiiu Leht, 2. märts 2001, lk. 2; Koit, 1. märts 2001, lk. 6; Lääne-Harju Ekspress, 3. märts 2001, lk. 3; Valgamaalane, 6. märts 2001, lk. 2

EU funds-related Baltic controversies in Brussels / Rokas M. Tracevskis

Index Scriptorium Estoniae

Tracevskis, Rokas M.

2011-01-01

10.–13. okt. toimus Brüsselis Euroopa Liidu regionaalpoliitika iga-aastane foorum – Avatud Uste Päevad, kus räägiti ühtekuuluvuspoliitika teemadel. 6. oktoobril saatsid Baltimaade ja Ungari peaministrid EL-i juhtidele kirja, milles ütlevad, et nad ei ole EL-i ühtekuuluvuspoliitika rahastamisega seotud ettepanekutega nõus. Baltimaade põllumehed avaldasid Brüsselis meelt ja nõudsid võrdseid konkurentsitingimusi ning toetusi kõikidele EL-i riikidele

Security conference convenes in Munich / Ella Karapetyan

Index Scriptorium Estoniae

Karapetyan, Ella

2011-01-01

Eesti president osales Münchenis toimunud rahvusvahelisel julgeolekupoliitika konverentsil, kus räägiti ka strateegilist tuumarelvastust piiravast START lepingust, olukorrast araabia maades ja finantskriisi mõjust julgeolekule. Toomas Hendrik Ilves juhtis diskussiooni relvastuskontrollist. Konverentsil osalesid ka Robert Zoellick, Wolfgang Schaueble, George Soros, Karl-Theodor zu Guttenberg, William Hague, Hillary Clinton, Sergei Lavrov, David Cameron, Catherine Ashton, Ban ki-moon, Anders Fogh Rasmussen ja Angela Merkel. Müncheni julgeolekukonverents 04.02.2011 - 06.02.2011

Regulation of the Prostate Cancer Tumor Microenvironment

Science.gov (United States)

2017-06-01

lipopolysaccharide   (LPS)   found   in   gram-­negative   bacterial  walls   recognized   by   TLR4,   double   stranded  RNA  produced  by  many  viruses  for...UCLA, Los Angeles, California 4Department of Pathology, UCLA, Los Angeles, California 5Eli & Edythe Broad Stem Cell Research Center, UCLA, Los Angeles...Broad Stem Cell Research Center Scholars in Translational Medicine; Grant sponsor: UCLA Broad Stem Cell Research Center Flow Cytometry Core; Grant

Tallinnas räägiti karjääriplaneerimise oskuste vajalikkusest / Margit Rammo

Index Scriptorium Estoniae

Rammo, Margit

2015-01-01

Karjäärioskuste teemalisel konverentsil Tallinnas osalesid karjäärispetsialistid Eestist, Lätist, Põhjamaadest, Iirimaalt. Vestlusest konverentsil osalenud Raimo Vuorineni, Bo Klindt Poulseni, Linda Darbey ja Kristina Orioniga

Software Engineering Support of the Third Round of Scientific Grand Challenge Investigations: An Earth Modeling System Software Framework Strawman Design that Integrates Cactus and UCLA/UCB Distributed Data Broker

Science.gov (United States)

Talbot, Bryan; Zhou, Shu-Jia; Higgins, Glenn

2002-01-01

One of the most significant challenges in large-scale climate modeling, as well as in high-performance computing in other scientific fields, is that of effectively integrating many software models from multiple contributors. A software framework facilitates the integration task. both in the development and runtime stages of the simulation. Effective software frameworks reduce the programming burden for the investigators, freeing them to focus more on the science and less on the parallel communication implementation, while maintaining high performance across numerous supercomputer and workstation architectures. This document proposes a strawman framework design for the climate community based on the integration of Cactus, from the relativistic physics community, and UCLA/UCB Distributed Data Broker (DDB) from the climate community. This design is the result of an extensive survey of climate models and frameworks in the climate community as well as frameworks from many other scientific communities. The design addresses fundamental development and runtime needs using Cactus, a framework with interfaces for FORTRAN and C-based languages, and high-performance model communication needs using DDB. This document also specifically explores object-oriented design issues in the context of climate modeling as well as climate modeling issues in terms of object-oriented design.

Biochemistry Instrumentation Core Technology Center

Data.gov (United States)

Federal Laboratory Consortium — The UCLA-DOE Biochemistry Instrumentation Core Facility provides the UCLA biochemistry community with easy access to sophisticated instrumentation for a wide variety...

AcEST: BP912775 [AcEST

Lifescience Database Archive (English)

Full Text Available 9VIRU L protein OS=Lymphocytic choriomeningitis... 33 10.0 >tr|Q672V4|Q672V4_ASPFL Monooxygenase OS=Aspergil...N 162 >tr|A2SUM3|A2SUM3_9VIRU L protein OS=Lymphocytic choriomeningitis virus GN=L PE=4 SV=1 Length = 2209 S...: 261 LSLGKWLKPVGNKGVRAAVTPSGQAIALVEEKG-KRASSVFVARPAGMD 308 >sp|P14240|L_LYCVA RNA-directed RNA polymerase OS=Lymphocytic choriomenin...gitis virus (strain Armstrong) GN=L PE=1 SV=1 Length = 2210 Score = 30.8 bits (68),

Medical Effects of Atomic Bombs. The Report of the Joint Commission for the Investigation of the Effects of the Atomic Bomb in Japan; Volume 1. Section 1. Introduction. Section 2. Physics. Section 3H. Hiroshima City. Section 3N. Nagasaki City

Science.gov (United States)

1951-04-19

relation to defervescence the pharyn- gitis ceased before or durir^, and the gingivitis after, the end of the febrile period. Recovery was associated...talltlag. SsTere daaage to the concrete stmct-ure. A ne* btiiMing ("Bttsiaess-aea’s Clab") has teen constructed in the interval "between tlie two...3^600. I have had no epilation, no gingivitis , no purpura, and no bleeding. 31(3W) 203 • .20.,••: .."^miXmm :^imcmA-’-𔄀f, the’B&ffll5iag..’.of

Análise comparativa do resultado da sutura artroscópica da lesão do manguito rotador em pacientes fumantes e não fumantes Comparative analysis on the result from arthroscopic suturing of rotator cuff injuries between smoking and non-smoking patients

Directory of Open Access Journals (Sweden)

Alexandre Almeida

2011-04-01

Full Text Available OBJETIVO: Analisar de forma comparativa o resultado da sutura artroscópica da lesão do manguito rotador em pacientes fumantes e não fumantes. MÉTODOS: Foi analisado um grupo de 286 pacientes submetidos à sutura artroscópica de uma lesão primária do manguito rotador no período de 12 de junho de 2002 a 14 de maio de 2008. Os pacientes incluídos no estudo foram avaliados pela escala de UCLA com um seguimento mínimo de 12 meses e médio de 56,52 meses. As variáveis estudadas foram: idade, sexo, lado operado, dominância, perfil de uso de cigarros e índice de UCLA. RESULTADOS: O estudo avaliou um total de 205 pacientes. Foi analisada estatisticamente a média de idade (p = 0,289 e o sexo (p = 0,124 entre o grupo de pacientes fumantes e não fumantes e ambos foram considerados semelhantes. Quando analisamos os pacientes não fumantes (143, verificamos um UCLA médio de 34 (32 a 35. Quando analisamos os pacientes fumantes (51, verificamos um UCLA médio de 33 (29-35. Não houve diferença estatisticamente significativa quando foi avaliado de forma comparativa o UCLA de pacientes não fumantes com o de pacientes fumantes (p = 0,123. Para fins de análise estatística agrupamos as lesões pequenas e médias (107 e comparamos com as grandes e extensas (80 entre pacientes fumantes e não fumantes. Não houve diferença estatisticamente significativa pelo teste de Mann-Whitney quando foi avaliado de forma comparativa o UCLA de lesões pequenas e médias (p = 818. Houve diferença estatisticamente significativa pelo teste de Mann-Whitney quando foi avaliado de forma comparativa o UCLA de lesões grandes e extensas entre os pacientes não fumantes e fumantes, sendo que os pacientes não fumantes apresentaram melhor UCLA (p = 0,038. CONCLUSÃO: O resultado da sutura artroscópica das lesões grandes e extensas do manguito rotador é inferior em pacientes fumantes.OBJECTIVE: To comparatively analyze the results from arthroscopic suturing of rotator

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... patient's and family's experience with illness. Category Science & Technology License Standard YouTube License Show more Show less ... 35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health ...

In-Flight Calibration Processes for the MMS Fluxgate Magnetometers

Science.gov (United States)

Bromund, K. R.; Leinweber, H. K.; Plaschke, F.; Strangeway, R. J.; Magnes, W.; Fischer, D.; Nakamura, R.; Anderson, B. J.; Russell, C. T.; Baumjohann, W.;

In-Flight Calibration Processes for the MMS Fluxgate Magnetometers

Science.gov (United States)

Bromund, K. R.; Leinweber, H. K.; Plaschke, F.; Strangeway, R. J.; Magnes, W.; Fischer, D.; Nakamura, R.; Anderson, B. J.; Russell, C. T.; Baumjohann, W.; Chutter, M.; Torbert, R. B.; Le, G.; Slavin, J. A.; Kepko, L.

2015-12-01

The calibration effort for the Magnetospheric Multiscale Mission (MMS) Analog Fluxgate (AFG) and Digital Fluxgate (DFG) magnetometers is a coordinated effort between three primary institutions: University of California, Los Angeles (UCLA); Space Research Institute, Graz, Austria (IWF); and Goddard Space Flight Center (GSFC). Since the successful deployment of all 8 magnetometers on 17 March 2015, the effort to confirm and update the ground calibrations has been underway during the MMS commissioning phase. The in-flight calibration processes evaluate twelve parameters that determine the alignment, orthogonalization, offsets, and gains for all 8 magnetometers using algorithms originally developed by UCLA and the Technical University of Braunschweig and tailored to MMS by IWF, UCLA, and GSFC. We focus on the processes run at GSFC to determine the eight parameters associated with spin tones and harmonics. We will also discuss the processing flow and interchange of parameters between GSFC, IWF, and UCLA. IWF determines the low range spin axis offsets using the Electron Drift Instrument (EDI). UCLA determines the absolute gains and sensor azimuth orientation using Earth field comparisons. We evaluate the performance achieved for MMS and give examples of the quality of the resulting calibrations.

The librarian as research informationist: a case study.

Science.gov (United States)

Federer, Lisa

2013-10-01

How can an embedded research informationist add value to the scientific output of research teams? The University of California-Los Angeles (UCLA) Louise M. Darling Biomedical Library is an academic health sciences library serving the clinical, educational, and research needs of the UCLA community. A grant from the National Library of Medicine funded a librarian to join a UCLA research team as an informationist. The informationist meets regularly with the research team and provides guidance related to data management, preservation, and other information-related issues. Early results suggest that the informationist's involvement has influenced the team's data gathering, storage, and curation methods. The UCLA Library has also changed the librarian's title to research informationist to reflect the new activities that she performs. The research informationist role provides an opportunity for librarians to become effective members of research teams and improve research output.

Activated learning; providing structure in global health education at the David Geffen School of Medicine at the University of California, Los Angeles (UCLA)- a pilot study.

Science.gov (United States)

Jordan, Jaime; Hoffman, Risa; Arora, Gitanjli; Coates, Wendy

2016-02-16

Global health rotations are increasingly popular amongst medical students. The training abroad is highly variable and there is a recognized need for global health curriculum development. We sought to create and evaluate a curriculum, applicable to any global health rotation, that requires students to take an active role in their education and promotes engagement. Prospective, observational, mixed method study of 4th year medical students enrolled in global health courses at UCLA in 2011-12. Course directors identified 4 topics common to all rotations (traditional medicine, health systems, limited resources, pathology) and developed activities for students to complete abroad: observation, interview and reflection on resources, pathology, medical practices; and compare/contrast their experience with the US healthcare system. Students posted responses on a discussion board moderated by US faculty. After the rotation, students completed an anonymous internet-based evaluative survey. Responses were tabulated. Qualitative data from discussion board postings and free response survey items were analyzed using the framework method. 14 (100 %) students completed the Activated Learning assignment. 12 submitted the post rotation survey (85.7 %). Activated Learning enhanced GH education for 67 % and facilitated engagement in the local medical culture for 67 %. Qualitative analysis of discussion board posting demonstrated multiple areas of knowledge gain and analysis of free response survey items revealed 5 major themes supporting Activated Learning: guided learning, stimulation of discussion, shared interactions, cultural understanding, and knowledge of global healthcare systems. Increased interactivity emerged as the major theme for future improvement. The results of this study suggest that an Activated Learning program may enhance education, standardize curricular objectives across multiple sites and promote engagement in local medical culture, pathology and delivery

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... stop Loading... Watch Queue Queue __count__/__total__ It’s YouTube. Uninterrupted. Loading... Want music and videos with zero ... 35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health ...

Delayed hyperacute rejection in a patient who developed clostridium difficile infection after ABO-incompatible kidney transplantation

Directory of Open Access Journals (Sweden)

Gerald S Lipshutz

2010-11-01

Full Text Available Gerald S Lipshutz1, Elaine F Reed2, Phuong-Chi Pham3, Jeffrey M Miller4, Jennifer S Singer5, Gabriel M Danovitch6, Alan H Wilkinson6, Dean W Wallace7, Suzanne McGuire6, Phuong-Truc Pham8, Phuong-Thu Pham61Department of Surgery, Kidney and Pancreas Transplant Program, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 2Department of Pathology and Laboratory Medicine-Immunogenetics, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 3Department of Medicine, Nephrology Division, UCLA-Olive View Medical Center, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 4Department of Medicine, Hematology Oncology Division, UCLA-Olive View Medical Center, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 5Department of Surgery and Urology, Kidney and Pancreas Transplant Program, 6Department of Medicine, Nephrology Division, Kidney and Pancreas Transplant Program, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 7Department of Pathology and Laboratory Medicine, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 8Department of Science, Penn State University, Worthington-Scranton, Dunmore, PA, USAAbstract: Over the past decade ABO incompatible transplantation has emerged as an important potential source for increasing living kidney transplantation in selected transplant centers. Early reports suggest that patients who have elevated serum anti-blood group antibody titers (anti-A/B before transplantation and a rebound antibody production after antibody removal may be at high immunological risk. With currently available immune modulation protocols and immunosuppressive therapy, excellent short- and long-term patient and graft survival rates have been achieved even in those with high anti-A/B antibody titers before plasmapheresis or immunoadsorption. Nonetheless, acute infection with an organism possessing surface markers analogous to blood group antigens such as carbohydrate structures on

Development of aptamer based HIV-1 entry inhibitor prophylactic drugs

CSIR Research Space (South Africa)

London, G

2013-08-01

Full Text Available proliferation assay and mapped their epitopes on gp120 by site directed mutagenesis. UCLA1 and CSIR1.1 neutralized infectivity of 79 % and 84 % pseudotyped viruses, respectively. UCLA1, further inhibited > 60 % of clinical isolates. We noted that, aptamers...

The Physics and Applications of High Brightness Beams: Working Group C Summary on Applications to FELS

International Nuclear Information System (INIS)

Nuhn, Heinz-Dieter

2003-01-01

This is the summary of the activities in working group C, ''Application to FELs,'' which was based in the Bithia room at the Joint ICFA Advanced Accelerator and Beam Dynamics Workshop on July 1-6, 2002 in Chia Laguna, Sardinia, Italy. Working group C was small in relation to the other working groups at that workshop. Attendees include Enrica Chiadroni, University of Rome ape with an identical pulse length. ''La Sapienza'', Luca Giannessi, ENEA, Steve Lidia, LBNL, Vladimir Litvinenko, Duke University, Patrick Muggli, UCLA, Alex Murokh, UCLA, Heinz-Dieter Nuhn, SLAC, Sven Reiche, UCLA, Jamie Rosenzweig, UCLA, Claudio Pellegrini, UCLA, Susan Smith, Daresbury Laboratory, Matthew Thompson, UCLA, Alexander Varfolomeev, Russian Research Center, plus a small number of occasional visitors. The working group addressed a total of nine topics. Each topic was introduced by a presentation, which initiated a discussion of the topic during and after the presentation. The speaker of the introductory presentation facilitated the discussion. There were six topics that were treated in stand-alone sessions of working group C. In addition, there were two joint sessions, one with working group B, which included one topic, and one with working group C, which included two topics. The presentations that were given in the joint sessions are summarized in the working group summary reports for groups B and D, respectively. This summary will only discuss the topics that were addressed in the stand-alone sessions, including Start-To-End Simulations, SASE Experiment, PERSEO, ''Optics Free'' FEL Oscillators, and VISA II

DENTAL CAST STUDY OF ADULT PATIENTS WITH UNTREATED UNILATERAL CLEFT-LIP OR CLEFT-LIP AND PALATE IN INDONESIA COMPARED WITH SURGICALLY TREATED PATIENTS IN THE NETHERLANDS

NARCIS (Netherlands)

SPAUWEN, PHM; HARDJOWASITO, W; BOERSMA, J; LATIEF, BS

To determine differences in maxillary and dentoalveolar relationships between untreated and treated patients having unilateral clefts of the lip and alveolus (UCLA) or lip and palate (UCLP), dental cast assessments were done on 70 untreated adult Indonesian patients (UCLA-I, UCLP-I) and 67 Dutch

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... Health - Meriter 252,222 views 13:34 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health 268,713 ... views 5:27 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,186 views 5: ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... Little Stars 12,587 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health 264,219 views 11:08 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,651 views 5: ...

UCLA accelerator research and development

International Nuclear Information System (INIS)

Cline, D.B.

1992-01-01

This progress report covers work supported by the above DOE grant over the period November 1, 1991 to July 31, 1992. The work is a program of experimental and theoretical studies in advanced particle accelerator research and development for high energy physics applications. The program features research at particle beam facilities in the United States and includes research on novel high power sources, novel focussing systems (e.g. plasma lens), beam monitors, novel high brightness, high current gun systems, and novel flavor factories in particular the φ Factory

ATS-6 - UCLA fluxgate magnetometer

Science.gov (United States)

Mcpherron, R. L.; Coleman, P. J., Jr.; Snare, R. C.

1975-01-01

A summary of the design of the University of California at Los Angeles' fluxgate magnetometer is presented. Instrument noise in the bandwidth 0.001 to 1.0 Hz is of order 85 m gamma. The DC field of the spacecraft transverse to the earth-pointing axis is 1.0 + or - 21 gamma in the X direction and -2.4 + or - 1.3 gamma in the Y direction. The spacecraft field parallel to this axis is less than 5 gamma. The small spacecraft field has made possible studies of the macroscopic field not previously possible at synchronous orbit. At the 96 W longitude of Applications Technology Satellite-6 (ATS-6), the earth's field is typically inclined 30 deg to the dipole axis at local noon. Most perturbations of the field are due to substorms. These consist of a rotation in the meridian to a more radial field followed by a subsequent rotation back. The rotation back is normally accompanied by transient variations in the azimuthal field. The exact timing of these perturbations is a function of satellite location and the details of substorm development.

Profile of extended-release oxycodone/acetaminophen for acute pain

Directory of Open Access Journals (Sweden)

Bekhit MH

2015-10-01

Full Text Available Mary Hanna Bekhit1–51David Geffen School of Medicine, 2Ronald Reagan UCLA Medical Center, 3UCLA Ambulatory Surgery Center, 4UCLA Wasserman Eye Institute, 5UCLA Martin Luther King Community Hospital, University of California Los Angeles, Los Angeles, CA, USA Abstract: This article provides a historical and pharmacological overview of a new opioid analgesic that boasts an extended-release (ER formulation designed to provide both immediate and prolonged analgesia for up to 12 hours in patients who are experiencing acute pain. This novel medication, ER oxycodone/acetaminophen, competes with current US Food and Drug Administration (FDA-approved opioid formulations available on the market in that it offers two benefits concurrently: a prolonged duration of action, and multimodal analgesia through a combination of an opioid (oxycodone with a nonopioid component. Current FDA-approved combination analgesics, such as Percocet (oxycodone/acetaminophen, are available solely in immediate-release (IR formulations. Keywords: opioid, analgesic, xartemis, acute postsurgical pain, substance abuse, acetaminophen, extended release 

Far infrared fusion plasma diagnostics. Task 3A, Progress report, FY 1990

Energy Technology Data Exchange (ETDEWEB)

Luhmann, N.C. Jr.; Peebles, W.A.

1990-12-31

Over the last several years, reflectometry has grown in importance as a diagnostic for both steady-state density Profiles as well as for the investigation of density fluctuations and turbulence. As a diagnostic for density profile measurement, it is generally believed to be well understood in the tokamak environment. However, its use as a fluctuation diagnostic is hampered by a lack of quantitative experimental understanding of its wavenumber sensitivity and spatial resolution. Several researchers, have theoretically investigated these questions. However, prior to the UCLA laboratory investigation, no group has experimentally investigated these questions. Because of the reflectometer`s importance to the world effort in understanding plasma turbulence and transport, UCLA has, over the last year, made its primary Task IIIA effort the resolution of these questions. UCLA has taken the lead in a quantitative experimental understanding of reflectometer data as applied to the measurement of density fluctuations. In addition to this, work has proceeded on the design, construction, and installation of a reflectometer system on UCLA`s CCT tokamak. This effort will allow a comparison between the improved confinement regimes (H-mode) observed on both the DIII-D and CCT machines with the goal of achieving a physics understanding of the phenomena. Preliminary investigation of a new diagnostic technique to measure density profiles as a function of time has been initiated at UCLA. The technique promises to be a valuable addition to the range of available plasma diagnostics. Work on advanced holographic reflectometry technique as applied to fluctuation diagnostics has awaited a better understanding of the reflectometer signal itself as discussed above. Efforts to ensure the transfer of the diagnostic developments have continued with particular attention devoted to the preliminary design of a multichannel FIR interferometer for MST.

A comparison of functional outcomes in patients undergoing revision arthroscopic repair of massive rotator cuff tears with and without arthroscopic suprascapular nerve release

Directory of Open Access Journals (Sweden)

Savoie III FH

2016-10-01

Full Text Available Felix H Savoie III,1 Mark Zunkiewicz,2 Larry D Field,2 William H Replogle,3 Michael J O’Brien1 1Tulane Institute of Sports Medicine, Tulane University School of Medicine, New Orleans, LA, USA; 2Mississippi Sports Medicine and Orthopaedic Center, Jackson, MS, USA; 3Department of Family Medicine, University of Mississippi Medical Center, Jackson, MS, USA Purpose: This study was designed to compare functional outcomes in patients undergoing revision repair of massive rotator cuff tears (retracted medial to the glenoid with Goutallier Grade 4 atrophy and concomitant release of the suprascapular nerve to a similar group of patients with Grade 3 atrophy undergoing revision rotator cuff repair (RTCR without nerve release. We hypothesized that patients undergoing nerve release would have more favorable functional outcomes as measured by the Modified University of California at Los Angeles shoulder rating scale (UCLA. Patients and methods: Twenty-two patients underwent revision repair of massive rotator cuff tears with release of the suprascapular nerve at the suprascapular notch. We compared total preoperative, postoperative, and change in UCLA score in these patients to a similar group of 22 patients undergoing revision RTCR without suprascapular nerve release. Additionally, UCLA subscores between the two groups were compared preoperatively and at final follow-up. Results: The average preoperative UCLA score in the nerve-release group was 7.91, and final follow-up average was 27.86; average 3.05 grades of strength were recovered. In the comparison group, average preoperative UCLA score was 11.77, and final follow-up average was 29.09; average 1.32 grades of strength were recovered. The average preoperative UCLA score was significantly worse in the nerve-release group (P=0.007. The average postoperative UCLA score was not significantly different (P=0.590 between the groups, indicating a better improvement in the nerve-release group with significantly

Scoring of treatment-related late effects in prostate cancer

International Nuclear Information System (INIS)

Livsey, Jacqueline E.; Routledge, Jacqueline; Burns, Meriel; Swindell, Rick; Davidson, Susan E.; Cowan, Richard A.; Logue, John P.; Wylie, James P.

2002-01-01

Background and purpose: To assess the correlation between different general and organ specific quality of life and morbidity scoring methods in a cohort of men treated with radical radiotherapy for prostate cancer. Materials and methods: Men who had been treated with radical radiotherapy (50 Gy in 16 fractions over 21 days) for localized prostate cancer more than 3 years previously and who had no evidence of recurrent disease were invited to take part in the study. A total of 101 of 135 invited patients agreed and completed LENT/SOMA, UCLA Prostate Cancer Index, and 36 item RAND Health survey questionnaires. Results: The patients had comparable results with other published series with respect to the UCLA and SF-36 indices. There was significant correlation between the corresponding parts of the UCLA and LENT/SOMA scales (P<0.0005). However, for the same symptoms, a patient tended to score lower (worse) on the UCLA scale in comparison to LENT/SOMA. The relationship between the average LENT/SOMA score and maximum score was also not straightforward with each set of data revealing different information. Conclusions: The LENT/SOMA questions were, in the main, more wide-ranging and informative than the UCLA index. It is helpful to give both the overall and maximum LENT/SOMA scores to most efficiently use all of the data. There may need to be a further LENT/SOMA question to allow both symptoms of tenesmus and faecal urgency to be fully addressed

Astrobiology Education and Outreach: New Interdisciplinary Initiatives

Science.gov (United States)

Schultz, Greg

In 1998, UCLA was selected as one of the 11 initial members (5 of which are universities) of the NASA Astrobiology Institute. Concurrently, UCLA implemented a brand new General Education cluster course, GE 70ABC: ``Evolution of the Cosmos and Life,'' which is unique for several reasons. It is (a) interdisciplinary, introducing students to both the life and physical sciences, (b) team-taught by 4 distinguished professors, and 4 advanced graduate teaching fellows, (c) offered for (150) freshmen students exclusively, and (d) a year-long sequence, incorporating lectures, laboratory/discussion sections, field trips, and in the spring quarter, small satellite seminars led by the individual instructors on topics radiating from the cluster theme. Further information about GE 70ABC can be found at the course website (http://www.ess.ucla.edu/Cluster_TOC.html) and the website for UCLA's GE cluster courses (http://www.college.ucla.edu/ge/clusters.htm). This poster will outline the GE 70 content, and describe some of the course's materials, activities, assessment, and student characteristics. Additionally, focus will be placed on the GE 70C seminar course component called ``Life In the Cosmos,'' designed and offered by the poster author for the Spring 1999 quarter. This seminar features a student-centered approach - with lecturing minimized and active learning a key objective - and addresses the extraterrestrial life debate from historical and cultural perspectives as well as the current scientific approaches in astrobiology/bioastronomy.

Inheritance of seed coat color in sesame

Directory of Open Access Journals (Sweden)

Hernán Laurentin

2014-04-01

Full Text Available The objective of this work was to determine the inheritance mode of seed coat color in sesame. Two crosses and their reciprocals were performed: UCLA37 x UCV3 and UCLA90 x UCV3, of which UCLA37 and UCLA90 are white seed, and UCV3 is brown seed. Results of reciprocal crosses within each cross were identical: F1 seeds had the same phenotype as the maternal parent, and F2 resulted in the phenotype brown color. These results are consistent only with the model in which the maternal effect is the responsible for this trait. This model was validated by recording the seed coat color of 100 F2 plants (F3 seeds from each cross with its reciprocal, in which the 3:1 expected ratio for plants producing brown and white seeds was tested with the chi-square test. Sesame seed color is determined by the maternal genotype. Proposed names for the alleles participating in sesame seed coat color are: Sc1, for brown color; and Sc2, for white color; Sc1 is dominant over Sc2.

Spatio-Temporal Nonlinear Filtering With Applications to Information Assurance and Counter Terrorism

Science.gov (United States)

2011-11-14

George E. Tita . Geographical influences of an emerging network of gang rivalries, Physica A: Statistical Mechanics and its Applications, (10 2011...Short, P. J. Brantingham, A. L. Bertozzi, G. E. Tita . From the Cover: Dissipation and displacement of hotspots in reaction-diffusion models of crime...Mathematics, UCLA 8. George Tita (Collaborator), Professor of Criminology, Law, and Society, UCLA 9. Martin Short, CAM Assistant Professor in

User Language Specification

Science.gov (United States)

1977-06-30

Digital System Design based on Structural and Function Modeling. Computer Science Dept., UCLA, (UCLA-ENG-7488), 1975. [7] Hamlet, R. G. High-level...of libaries of pro- grams where each library represents a coherent set of data types and parameterized nodes which operate on those types. * Allow...following form: an optional minus sign, concatenated with an optional sequence of digits the first of which is nonzero, concatenated with a single

Proceedings of the 2016 Workshop on the Physics and Applications of High Brightness Beams

Science.gov (United States)

Cianchi, Alessandro; Ferrario, Massimo; Musumeci, Pietro; Rosenzweig, James

2017-09-01

We are proud to present the proceedings of the latest in the series of International Committee on Future Accelerators (ICFA)-endorsed workshops on the Physics and Applications of High Brightness Beams, which has been held at the Hotel Nacional in Havana, Cuba between March 28 and April 1, 2016. In total, 135 participants coming from 14 different countries attended this historic conference. In recognition of its pioneering role in the significant blossoming of relations between Cuba and the larger scientific community, this workshop also received the endorsement of UNESCO. The workshop organization was headed by co-chairs Massimo Ferrario (INFN-LNF) and James Rosenzweig (UCLA), with the essential and energetic contributions of local organizing committee chair Fidel Antonio Castro Smirnov (InSTEC, Havana). The workshop scientific agenda was developed under the care of program committee co-chairs Pietro Musumeci (UCLA) and Luca Serafini (INFN-Milano). The publication of the proceedings we present here was led by Alessandro Cianchi (Tor Vergata). Tangible contributions to the workshop infrastructure were received from UCLA, INFN-LNF, InSTEC, EuroNNAC2, and the US National Science Foundation. The workshop web site, which contains detailed information on the scientific agenda of the meeting, is found at https://conferences.pa.ucla.edu/hbb/.

On the possibility of a steady state tokamak

International Nuclear Information System (INIS)

Dawson, J.M.; Nunan, W.J.; Ma, S.

1994-01-01

This symposium is particularly honoring Tom for his guiding of the graduate program in plasma physics at Princeton. For this reason I thought it would be appropriate for me to speak about some work a graduate student of mine, Bill Nunan, is doing, at UCLA. In a real sense the UCLA graduate program in Plasma Physics has many roots in the Princeton program which Tom so skillfully guided. copyright American Institute of Physics 1994

STRUCTURAL BIOLOGY AND MOLECULAR MEDICINE RESEARCH PROGRAM (LSBMM)

International Nuclear Information System (INIS)

Eisenberg, David S.

2008-01-01

The UCLA-DOE Institute of Genomics and Proteomics is an organized research unit of the University of California, sponsored by the Department of Energy through the mechanism of a Cooperative Agreement. Today the Institute consists of 10 Principal Investigators and 7 Associate Members, developing and applying technologies to promote the biological and environmental missions of the Department of Energy, and 5 Core Technology Centers to sustain this work. The focus is on understanding genomes, pathways and molecular machines in organisms of interest to DOE, with special emphasis on developing enabling technologies. Since it was founded in 1947, the UCLA-DOE Institute has adapted its mission to the research needs of DOE and its progenitor agencies as these research needs have changed. The Institute started as the AEC Laboratory of Nuclear Medicine, directed by Stafford Warren, who later became the founding Dean of the UCLA School of Medicine. In this sense, the entire UCLA medical center grew out of the precursor of our Institute. In 1963, the mission of the Institute was expanded into environmental studies by Director Ray Lunt. I became the third director in 1993, and in close consultation with David Galas and John Wooley of DOE, shifted the mission of the Institute towards genomics and proteomics. Since 1993, the Principal Investigators and Core Technology Centers are entirely new, and the Institute has separated from its former division concerned with PET imaging. The UCLA-DOE Institute shares the space of Boyer Hall with the Molecular Biology Institute, and assumes responsibility for the operation of the main core facilities. Fig. 1 gives the organizational chart of the Institute. Some of the benefits to the public of research carried out at the UCLA-DOE Institute include the following: The development of publicly accessible, web-based databases, including the Database of Protein Interactions, and the ProLinks database of genomicly inferred protein function linkages

Far infrared fusion plasma diagnostics

Energy Technology Data Exchange (ETDEWEB)

Luhmann, N.C. Jr.; Peebles, W.A.

1990-01-01

Over the last several years, reflectometry has grown in importance as a diagnostic for both steady-state density Profiles as well as for the investigation of density fluctuations and turbulence. As a diagnostic for density profile measurement, it is generally believed to be well understood in the tokamak environment. However, its use as a fluctuation diagnostic is hampered by a lack of quantitative experimental understanding of its wavenumber sensitivity and spatial resolution. Several researchers, have theoretically investigated these questions. However, prior to the UCLA laboratory investigation, no group has experimentally investigated these questions. Because of the reflectometer's importance to the world effort in understanding plasma turbulence and transport, UCLA has, over the last year, made its primary Task IIIA effort the resolution of these questions. UCLA has taken the lead in a quantitative experimental understanding of reflectometer data as applied to the measurement of density fluctuations. In addition to this, work has proceeded on the design, construction, and installation of a reflectometer system on UCLA's CCT tokamak. This effort will allow a comparison between the improved confinement regimes (H-mode) observed on both the DIII-D and CCT machines with the goal of achieving a physics understanding of the phenomena. Preliminary investigation of a new diagnostic technique to measure density profiles as a function of time has been initiated at UCLA. The technique promises to be a valuable addition to the range of available plasma diagnostics. Work on advanced holographic reflectometry technique as applied to fluctuation diagnostics has awaited a better understanding of the reflectometer signal itself as discussed above. Efforts to ensure the transfer of the diagnostic developments have continued with particular attention devoted to the preliminary design of a multichannel FIR interferometer for MST.

Comparison of implant-abutment interface misfits after casting and soldering procedures.

Science.gov (United States)

Neves, Flávio Domingues das; Elias, Gisele Araújo; da Silva-Neto, João Paulo; de Medeiros Dantas, Lucas Costa; da Mota, Adérito Soares; Neto, Alfredo Júlio Fernandes

2014-04-01

The aim of this study was to compare vertical and horizontal adjustments of castable abutments after conducting casting and soldering procedures. Twelve external hexagonal implants (3.75 × 10 mm) and their UCLA abutments were divided according their manufacturer and abutment type: PUN (plastic UCLA, Neodent), PUC (plastic UCLA, Conexão), PU3i (plastic UCLA, Biomet 3i), and PUTN (plastic UCLA with Tilite milled base, Neodent). Three infrastructures of a fixed partial implant-supported bridge with 3 elements were produced for each group. The measurements of vertical (VM) and horizontal (HM) misfits were obtained via scanning electron microscopy after completion of casting and soldering. The corresponding values were determined to be biomechanically acceptable to the system, and the results were rated as a percentage. Statistical analysis establishes differences between groups by chi-square after procedures, and McNeman's test was applied to analyze the influence of soldering over casting (α ≤ .05). For the values of VM and HM, respectively, when the casting process was complete, it was observed that 83.25% and 100% (PUTN), 33.3% and 27.75% (PUN), 33.3% and 88.8% (PUC), 33.3% and 94.35% (PU3i) represented acceptable values. After completing the requisite soldering, acceptable values were 50% and 94.35% (PUTN), 16.6% and 77.7% (PUN), 38.55% and 77.7% (PUC), and 27.75% and 94.35% (PU3i). Within the limitations of this study, it can be concluded that the premachined abutments presented more acceptable VM values. The HM values were within acceptable limits before and after the soldering procedure for most groups. Further, the soldering procedure resulted in an increase of VM in all groups.

HIV-1 subtype C unproductively infects human cardiomyocytes in vitro and induces apoptosis mitigated by an anti-Gp120 aptamer.

Science.gov (United States)

Lopes de Campos, Walter R; Chirwa, Nthato; London, Grace; Rotherham, Lia S; Morris, Lynn; Mayosi, Bongani M; Khati, Makobetsa

2014-01-01

HIV-associated cardiomyopathy (HIVCM) is of clinical concern in developing countries because of a high HIV-1 prevalence, especially subtype C, and limited access to highly active antiretroviral therapy (HAART). For these reasons, we investigated the direct and indirect effects of HIV-1 subtype C infection of cultured human cardiomyocytes and the mechanisms leading to cardiomyocytes damage; as well as a way to mitigate the damage. We evaluated a novel approach to mitigate HIVCM using a previously reported gp120 binding and HIV-1 neutralizing aptamer called UCLA1. We established a cell-based model of HIVCM by infecting human cardiomyocytes with cell-free HIV-1 or co-culturing human cardiomyocytes with HIV-infected monocyte derived macrophages (MDM). We discovered that HIV-1 subtype C unproductively (i.e. its life cycle is arrested after reverse transcription) infects cardiomyocytes. Furthermore, we found that HIV-1 initiates apoptosis of cardiomyocytes through caspase-9 activation, preferentially via the intrinsic or mitochondrial initiated pathway. CXCR4 receptor-using viruses were stronger inducers of apoptosis than CCR5 utilizing variants. Importantly, we discovered that HIV-1 induced apoptosis of cardiomyocytes was mitigated by UCLA1. However, UCLA1 had no protective effective on cardiomyocytes when apoptosis was triggered by HIV-infected MDM. When HIV-1 was treated with UCLA1 prior to infection of MDM, it failed to induce apoptosis of cardiomyocytes. These data suggest that HIV-1 causes a mitochondrial initiated apoptotic cascade, which signal through caspase-9, whereas HIV-1 infected MDM causes apoptosis predominantly via the death-receptor pathway, mediated by caspase-8. Furthermore the data suggest that UCLA1 protects cardiomyocytes from caspase-mediated apoptosis, directly by binding to HIV-1 and indirectly by preventing infection of MDM.

Presentation on the Modeling and Educational Demonstrations Laboratory Curriculum Materials Center (MEDL-CMC): A Working Model and Progress Report

Science.gov (United States)

Glesener, G. B.; Vican, L.

2015-12-01

Physical analog models and demonstrations can be effective educational tools for helping instructors teach abstract concepts in the Earth, planetary, and space sciences. Reducing the learning challenges for students using physical analog models and demonstrations, however, can often increase instructors' workload and budget because the cost and time needed to produce and maintain such curriculum materials is substantial. First, this presentation describes a working model for the Modeling and Educational Demonstrations Laboratory Curriculum Materials Center (MEDL-CMC) to support instructors' use of physical analog models and demonstrations in the science classroom. The working model is based on a combination of instructional resource models developed by the Association of College & Research Libraries and by the Physics Instructional Resource Association. The MEDL-CMC aims to make the curriculum materials available for all science courses and outreach programs within the institution where the MEDL-CMC resides. The sustainability and value of the MEDL-CMC comes from its ability to provide and maintain a variety of physical analog models and demonstrations in a wide range of science disciplines. Second, the presentation then reports on the development, progress, and future of the MEDL-CMC at the University of California Los Angeles (UCLA). Development of the UCLA MEDL-CMC was funded by a grant from UCLA's Office of Instructional Development and is supported by the Department of Earth, Planetary, and Space Sciences. Other UCLA science departments have recently shown interest in the UCLA MEDL-CMC services, and therefore, preparations are currently underway to increase our capacity for providing interdepartmental service. The presentation concludes with recommendations and suggestions for other institutions that wish to start their own MEDL-CMC in order to increase educational effectiveness and decrease instructor workload. We welcome an interuniversity collaboration to

Validating the 11-Item Revised University of California Los Angeles Scale to Assess Loneliness Among Older Adults: An Evaluation of Factor Structure and Other Measurement Properties.

Science.gov (United States)

Lee, Joonyup; Cagle, John G

2017-11-01

To examine the measurement properties and factor structure of the short version of the Revised University of California Los Angeles (R-UCLA) loneliness scale from the Health and Retirement Study (HRS). Based on data from 3,706 HRS participants aged 65 + who completed the 2012 wave of the HRS and its Psychosocial Supplement, the measurement properties and factorability of the R-UCLA were examined by conducting an exploratory factor analysis (EFA) and the confirmatory factor analysis (CFA) on randomly split halves. The average score for the 11-item loneliness scale was 16.4 (standard deviation: 4.5). An evaluation of the internal consistency produced a Cronbach's α of 0.87. Results from the EFA showed that two- and three-factor models were appropriate. However, based on the results of the CFA, only a two-factor model was determined to be suitable because there was a very high correlation between two factors identified in the three-factor model, available social connections and sense of belonging. This study provides important data on the properties of the 11-item R-UCLA scale by identifying a two-factor model of loneliness: feeling isolated and available social connections. Our findings suggest the 11-item R-UCLA has good factorability and internal reliability. Copyright © 2017 American Association for Geriatric Psychiatry. Published by Elsevier Inc. All rights reserved.

Leon Knopoff (1926-2011)

Science.gov (United States)

Davis, Paul; Jackson, David; Gilbert, Freeman

2011-06-01

Leon Knopoff died at his home in Sherman Oaks, Calif., on 20 January 2011 at the age of 85. A man of wide-ranging talents, he had the rare distinction of being simultaneously a professor of physics, a professor of geophysics, and a research musicologist at the University of California, Los Angeles (UCLA). As an undergraduate he studied electrical engineering and obtained his Ph.D. in physics and mathematics at the California Institute of Technology (Caltech) in 1949. He was recruited to the Institute of Geophysics (now the Institute of Geophysics and Planetary Physics) at UCLA in 1950 by Louis Slichter, where he became a professor of geophysics in 1957 and of geophysics and physics in 1961. He became a research musicologist in the UCLA Institute of Ethnomusicology soon after it was formed in 1960. Other appointments included faculty positions at Miami University in Ohio (1948-1950) and Caltech (1962-1963) and visiting appointments at Cambridge, Karlsruhe, Harvard, Santiago, Trieste, and Venice.

Experimental and theoretical high energy physics research. Annual progress report, September 1, 1991--September 31, 1992

Energy Technology Data Exchange (ETDEWEB)

1992-10-01

Progress in the various components of the UCLA High-Energy Physics Research program is summarized, including some representative figures and lists of resulting presentations and published papers. Principal efforts were directed at the following: (I) UCLA hadronization model, PEP4/9 e{sup +}e{sup {minus}} analysis, {bar P} decay; (II) ICARUS and astroparticle physics (physics goals, technical progress on electronics, data acquisition, and detector performance, long baseline neutrino beam from CERN to the Gran Sasso and ICARUS, future ICARUS program, and WIMP experiment with xenon), B physics with hadron beams and colliders, high-energy collider physics, and the {phi} factory project; (III) theoretical high-energy physics; (IV) H dibaryon search, search for K{sub L}{sup 0} {yields} {pi}{sup 0}{gamma}{gamma} and {pi}{sup 0}{nu}{bar {nu}}, and detector design and construction for the FNAL-KTeV project; (V) UCLA participation in the experiment CDF at Fermilab; and (VI) VLPC/scintillating fiber R & D.

Experimental and theoretical high energy physics research

International Nuclear Information System (INIS)

1992-01-01

Progress in the various components of the UCLA High-Energy Physics Research program is summarized, including some representative figures and lists of resulting presentations and published papers. Principal efforts were directed at the following: (I) UCLA hadronization model, PEP4/9 e + e - analysis, bar P decay; (II) ICARUS and astroparticle physics (physics goals, technical progress on electronics, data acquisition, and detector performance, long baseline neutrino beam from CERN to the Gran Sasso and ICARUS, future ICARUS program, and WIMP experiment with xenon), B physics with hadron beams and colliders, high-energy collider physics, and the φ factory project; (III) theoretical high-energy physics; (IV) H dibaryon search, search for K L 0 → π 0 γγ and π 0 ν bar ν, and detector design and construction for the FNAL-KTeV project; (V) UCLA participation in the experiment CDF at Fermilab; and (VI) VLPC/scintillating fiber R ampersand D

Digitaalmälu seminaril räägiti veebisisu säilitamisest / Jaanus Kõuts, Tiiu Daniel, Elis Karpov

Index Scriptorium Estoniae

Kõuts, Jaanus, 1976-

2015-01-01

Ülevaade 28. jaanuaril Eesti Rahvusraamatukogus toimunud järjekorras kuuendast rahvusvahelisest seminarist sarjast Digitaalmälu (Digital Memory) pealkirjaga „Veebiarhiveerimise roll andmerikka ühiskonna ajaloo säilitamisel” (Web Archiving: Preserving the History of Data-Driven Society)

The Anopheles (Anopheles) Crucians Subgroup in the United States (Diptera: Culicidae)

Science.gov (United States)

1976-01-01

clans specimens in the Del -Mar-Va Peninsula (Buescher et al. J-920). The sig- nificance of these arbovirus isolations is discussed later. SYSTEMATIC...34EAH45", 5-VIII-1972, Rogers, 1L (UCLA), Belize: Sierra de Agua , IV-T.946, A. J. Walker, 29 (IJCLA). "BHA138", 1967, Mosq. Mid. Amer. 19 (UCLA), "BH366...highly acid Alabama swamp. The water had a high concentration of sulfate, sodium, potassium and ferrous ions as a result of contamination by a

The UCLA-Philippine Language Program, 1957-1966.

Science.gov (United States)

Bowen, J. Donald

This document discusses in detail the development and operation of a language program implemented in the Philippines, beginning in 1957, with the assistance of the University of California, Los Angeles, through the Rockefeller Foundation. The program faced a number of difficulties including a school system in the process of post-war rebuilding, a…

Plasma Confinement in the UCLA Electric Tokamak.

Science.gov (United States)

Taylor, Robert J.

2001-10-01

The main goal of the newly constructed large Electric Tokamak (R = 5 m, a = 1 m, BT 8 x 10^12 cm-3 when there is no MHD activity. The electron temperature, derived from the plasma conductivity is > 250 eV with a central electron energy confinement time > 350 msec in ohmic conditions. The sawteeth period is 50 msec. Edge plasma rotation is induced by plasma biasing via electron injection in an analogous manner to that seen in CCT(R.J. Taylor, M.L. Brown, B.D. Fried, H. Grote, J.R. Liberati, G.J. Morales, P. Pribyl, D. Darrow, and M. Ono. Phys. Rev Lett. 63 2365 1989.) and the neoclassical bifurcation is close to that described by Shaing et al(K.C. Shaing and E.C. Crume, Phys. Rev. Lett. 63 2369 (1989).). In the ohmic phase the confinement tends to be MHD limited. The ICRF heating eliminates the MHD disturbances. Under second harmonic heating conditions, we observe an internal confinement peaking characterized by doubling of the core density and a corresponding increase in the central electron temperature. Charge exchange data, Doppler data in visible H-alpha light, and EC radiation all indicate that ICRF heating works much better than expected. The major effort is focused on increasing the power input and controlling the resulting equilibrium. This task appears to be easy since our current pulses are approaching the 3 second mark without RF heating or current drive. Our initial experience with current profile control, needed for high beta plasma equilibrium, will be also discussed.

Surgical treatment of dislocated acromioclavicular syndesmolysis remains controversial

Directory of Open Access Journals (Sweden)

Slaviša Mihaljevič

2007-12-01

Full Text Available Background: Operative treatment of acromioclavicular (AC joint dislocations Allman-Tossy III type is controversial. There are more than 30 types of operative treatments described. At the Department of Traumatology of Celje General and Teaching Hospital (CGTH we operate the AC joint dislocation by the AC joint opened reduction and fixation using two Kirschner wires and additional figure of eight wire loop over the AC joint. The purpose of the analysis is to evaluate the results of acromioclavicular joint complete dislocation Allman-Tossy III type operative treatment.Patients and methods: In the 2-year period from July 1st 1997, to June 31st, 1999, at the Department of Traumatology of CGTH we operatively treated 59 injured persons with the AC joint dislocation. There were 55 men (93 % and 4 women (7 %. The average age was 40 years (from 20 to 72 years. 56 (95 % injured persons had the AC joint injury of Allman-Tossy III type. In first three weeks (early reconstruction we operated 45 injured persons (76.3 %. The applied material was removed after 8 weeks. 47 (79.7 % injured persons were re-examined at least one year after the injury (27 months in average; 14–39 months. The results were evaluated according to University of California at Los Angeles (UCLA scale for the shoulder function evaluation. The impact of factors on a good treatment result was presented by the odds ratio and uni-variant analysis calculation.Results: Out of 47 injured persons re-examined according to the UCLA scale at least one year after the injury there were 17 injured persons (36.2 % rated with an excellent result (UCLA 34– 35, 22 good (46.8 % (UCLA 28–33, 5 satisfactory (10.6 % (UCLA 21–27 and 3 bad (6.4 % (UCLA 0–20. In total we achieved 83 % of excellent and good results. The injured persons age did not significantly affect the treatment result. Complications occurred in 14 (29.8 % injured patients. If no complications were occurred the odds ratio for good

Wegener’s granulomatosis mimicking inflammatory bowel disease and presenting with chronic enteritis

Directory of Open Access Journals (Sweden)

Shahedi K

2013-10-01

Full Text Available Kamyar Shahedi,1,2 Ramy Magdy Hanna,1,2 Oleg Melamed,1,2 James Wilson2,31Department of Medicine Olive-View UCLA Medical Center, Sylmar, CA, 2David Geffen School of Medicine at UCLA, Los Angeles, CA, 3UCLA Medical Center-UCLA Stone Center, Los Angeles, CA, USAAbstract: Wegener’s granulomatosis, also known as anti-neutrophil cytoplasmic antibody (ANCA-associated vasculitis, is a small vessel vasculitis with primarily pulmonary, renal, and sinus disease manifestations. The prevalence of Wegener’s granulomatosis is three cases per 100,000 patients. Cardiovascular, neurologic, cutaneous, and joint manifestations have been reported in many case reports and case series. Gastrointestinal manifestations are less noted in Wegener’s granulomatosis, although they have been previously reported in the form of intestinal perforation and intestinal ischemia. Additionally, there are characteristic findings of vasculitis that are noted with active Wegener’s granulomatosis of the small bowel. We report a case of an elderly patient who presented with weight loss, diarrhea, and hematochezia. His symptoms were chronic and had lasted for more than 1 year before diagnosis. Inflammatory bowel disease or chronic enteritis due to Salmonella arizonae because of reptile exposure originally were suspected as etiologies of his presentation. The findings of proteinuria, renal failure, and pauci-immune glomerulonephritis on renal biopsy, in conjunction with an elevated c-ANCA titer, confirmed the diagnosis of Wegener’s granulomatosis with associated intestinal vasculitis. This case demonstrates an atypical presentation of chronic duodenitis and jejunitis secondary to Wegener’s granulomatosis, which mimicked inflammatory bowel disease.Keywords: ANCA-associated vasculitis, Wegener’s syndrome, pauci-immune glomerulonephritis, Salmonella arizonae, inflammatory bowel disease

Breaking the Attosecond, Angstrom and TV/m Field Barriers with Ultrafast Electron Beams

International Nuclear Information System (INIS)

Rosenzweig, J. B.; Andonian, G.; Fukasawa, A.; Hemsing, E.; Marcus, G.; Marinelli, A.; Musumeci, P.; O'Shea, B.; O'Shea, F.; Pellegrini, C.; Schiller, D.; Travish, G.; Bucksbaum, P.; Hogan, M.; Krejcik, Patrick; Ferrario, M.; Muggli, Patric

2010-01-01

Recent initiatives at UCLA concerning ultra-short, GeV electron beam generation have been aimed at achieving sub-fs pulses capable of driving X-ray free-electron lasers (FELs) in single-spike mode. This scheme uses very low charge beams, which may allow existing FEL injectors to produce few-100 attosecond pulses, with very high brightness. Towards this end, recent experiments at the Stanford X-ray FEL (LCLS, first of its kind, built with essential UCLA leadership) have produced ∼2 fs, 20 pC electron pulses. We discuss here extensions of this work, in which we seek to exploit the beam brightness in FELs, in tandem with new developments at UCLA in cryogenic undulator technology, to create compact accelerator/undulator systems that can lase below 0.15 Angst , or be used to permit 1.5 Angst operation at 4.5 GeV. In addition, we are now developing experiments which use the present LCLS fs pulses to excite plasma wakefields exceeding 1 TV/m, permitting a table-top TeV accelerator for frontier high energy physics applications. We discuss the experimental issues associated with this initiative.

Starppersonu komunikācijas veida saistība ar pusaudžu pašvērtējumu un vientulības izjūtu

OpenAIRE

Kreitūze, Ieva

2016-01-01

Pētījuma mērķis ir noskaidrot vai pusaudžu komunikācija ir saistīta ar pusaudžu pašvērtējumu un vientulības izjūtu. Pētījuma mērķa sasniegšanai tika izmantota Rozenberga pašvērtējuma skala, (Rosenberg Self-Esteem Scale, Rosenberg, 1965), UCLA vientulības skala, (The Revised UCLA Loneliness Scale, Russell, Peplau, & Cutrona, 1996). Komunikācijas izpētei tika izmantota Interpersonālās komunikācijas skala, (Interpersonal Communication Inventory, Millard & Bienvenu, 1971 Interpersonal Communicat...

SATURNUS: the UCLA infrared free-electron laser project

International Nuclear Information System (INIS)

Dodd, J.W.; Hartman, S.C.; Park, S.; Pellegrini, C.; Rosenzweig, J.B.; Smolin, J.A.; Hairapetian, G.; Kolonko, J.; Barletta, W.A.; Cline, D.B.; Favis, J.G.; Joshi, C.J.; Luhmann, N.C. Jr.; Ivanchenkov, S.N.; Khlebnikov, A.S.; Lachin, Y.Y.; Varfolomeev, A.A.

1991-01-01

A compact 20 MeV linac with an RF laser-driven electron gun will be used to drive a high-gain (10cm gain length), 10.6 μm wavelength FEL amplifier, operating in the SASE mode. Saturnus will mainly study FEL physics in the high-gain regime, including start-up from noise, optical guiding, sidebands, saturation, and superradiance, with emphasis on the effects important for future short wavelength operation of FEL's. The hybrid undulator was designed and built at the Kurchatov Inst. of Atomic Energy in the USSR. The primary magnetic flux is provided by C-shaped iron yokes, where between the poles thin blocks of neodymium-iron-boron magnets are placed to provide additional magnetic flux along the undulator axis. The field strength is adjusted by moving the thin Nd-Fe-B blocks on a set screw mount. The initial assembly will have forty periods, each 1.5 cm long. The gap distance between the yoke pole-pieces is fixed at 5 mm. The undulator field has been measured, yielding on an axis peak value of 6.6kGauss, which closely matches computer simulations

Longitudinal Long-term Magnetic Resonance Imaging and Clinical Follow-up After Single-Row Arthroscopic Rotator Cuff Repair: Clinical Superiority of Structural Tendon Integrity.

Science.gov (United States)

Heuberer, Philipp R; Smolen, Daniel; Pauzenberger, Leo; Plachel, Fabian; Salem, Sylvia; Laky, Brenda; Kriegleder, Bernhard; Anderl, Werner

2017-05-01

The number of arthroscopic rotator cuff surgeries is consistently increasing. Although generally considered successful, the reported number of retears after rotator cuff repair is substantial. Short-term clinical outcomes are reported to be rarely impaired by tendon retears, whereas to our knowledge, there is no study documenting long-term clinical outcomes and tendon integrity after arthroscopic rotator cuff repair. To investigate longitudinal long-term repair integrity and clinical outcomes after arthroscopic rotator cuff reconstruction. Case series; Level of evidence, 4. Thirty patients who underwent arthroscopic rotator cuff repair with suture anchors for a full-tendon full-thickness tear of the supraspinatus or a partial-tendon full-thickness tear of the infraspinatus were included. Two and 10 years after initial arthroscopic surgery, tendon integrity was analyzed using magnetic resonance imaging (MRI). The University of California, Los Angeles (UCLA) score and Constant score as well as subjective questions regarding satisfaction with the procedure and return to normal activity were used to evaluate short- and long-term outcomes. At the early MRI follow-up, 42% of patients showed a full-thickness rerupture, while 25% had a partial rerupture, and 33% of tendons remained intact. The 10-year MRI follow-up (129 ± 11 months) showed 50% with a total rerupture, while the other half of the tendons were partially reruptured (25%) or intact (25%). The UCLA and Constant scores significantly improved from preoperatively (UCLA total: 50.6% ± 20.2%; Constant total: 44.7 ± 10.5 points) to 2 years (UCLA total: 91.4% ± 16.0% [ P rotator cuff repair showed good clinical long-term results despite a high rate of retears. Nonetheless, intact tendons provided significantly superior clinical long-term outcomes, making the improvement of tendon healing and repair integrity important goals of future research efforts.

Law of Large Numbers: the Theory, Applications and Technology-based Education.

Science.gov (United States)

Dinov, Ivo D; Christou, Nicolas; Gould, Robert

2009-03-01

Modern approaches for technology-based blended education utilize a variety of recently developed novel pedagogical, computational and network resources. Such attempts employ technology to deliver integrated, dynamically-linked, interactive-content and heterogeneous learning environments, which may improve student comprehension and information retention. In this paper, we describe one such innovative effort of using technological tools to expose students in probability and statistics courses to the theory, practice and usability of the Law of Large Numbers (LLN). We base our approach on integrating pedagogical instruments with the computational libraries developed by the Statistics Online Computational Resource (www.SOCR.ucla.edu). To achieve this merger we designed a new interactive Java applet and a corresponding demonstration activity that illustrate the concept and the applications of the LLN. The LLN applet and activity have common goals - to provide graphical representation of the LLN principle, build lasting student intuition and present the common misconceptions about the law of large numbers. Both the SOCR LLN applet and activity are freely available online to the community to test, validate and extend (Applet: http://socr.ucla.edu/htmls/exp/Coin_Toss_LLN_Experiment.html, and Activity: http://wiki.stat.ucla.edu/socr/index.php/SOCR_EduMaterials_Activities_LLN).

An intensive primary-literature-based teaching program directly benefits undergraduate science majors and facilitates their transition to doctoral programs.

Science.gov (United States)

Kozeracki, Carol A; Carey, Michael F; Colicelli, John; Levis-Fitzgerald, Marc; Grossel, Martha

2006-01-01

UCLA's Howard Hughes Undergraduate Research Program (HHURP), a collaboration between the College of Letters and Science and the School of Medicine, trains a group of highly motivated undergraduates through mentored research enhanced by a rigorous seminar course. The course is centered on the presentation and critical analysis of scientific journal articles as well as the students' own research. This article describes the components and objectives of the HHURP and discusses the results of three program assessments: annual student evaluations, interviews with UCLA professors who served as research advisors for HHURP scholars, and a survey of program alumni. Students indicate that the program increased their ability to read and present primary scientific research and to present their own research and enhanced their research experience at UCLA. After graduating, they find their involvement in the HHURP helped them in securing admission to the graduate program of their choice and provided them with an advantage over their peers in the interactive seminars that are the foundation of graduate education. On the basis of the assessment of the program from 1998-1999 to 2004-2005, we conclude that an intensive literature-based training program increases student confidence and scientific literacy during their undergraduate years and facilitates their transition to postgraduate study.

Testbed for Multi-Wavelength Optical Code Division Multiplexing Based on Passive Linear Unitary Filters

National Research Council Canada - National Science Library

Yablonovitch, Eli

2000-01-01

.... The equipment purchased under this grant has permitted UCLA to purchase a number of broad-band optical components, including especially some unique code division multiplexing filters that permitted...

Resultados da cirurgia de latarjet no tratamento da instabilidade anterior traumática do ombro associada à erosão óssea da cavidade glenoidal - seguimento mínimo de um ano Results from latarjet surgery for treating traumatic anterior shoulder instability associated with bone erosion in the glenoid cavity, after minimum follow-up of one year

Directory of Open Access Journals (Sweden)

Roberto Yukio Ikemoto

2011-10-01

Full Text Available OBJETIVO: Avaliar o resultado da cirurgia de Latarjet para pacientes com luxação recidivante anterior do ombro com perda óssea maior que 25% da cavidade glenoidal. MÉTODO: Avaliamos 26 pacientes submetidos à cirurgia de Latarjet. O tempo médio de seguimento foi de 38 meses e a média etária, de 28 anos. Os pacientes foram avaliados quanto à amplitude de movimento e pelas escalas de Rowe e UCLA, no período pré-operatório como no período pós-operatório, radiografias do ombro para avaliar a presença de artrose, posição e consolidação do enxerto e posicionamento dos parafusos. A análise estatística foi utilizada para avaliar se haveria relação entre o número de episódios de luxação, presença de artrose, correlação entre artrose e limitação da rotação lateral. Comparar a diferença entre o arco de movimento do lado operado com o não acometido e avaliação funcional pré e pós-operatória das escalas de UCLA e Rowe. RESULTADOS: A elevação e rotação lateral foram estatisticamente inferiores do lado operado. A escala de UCLA e a de Rowe mostrou uma melhora estatisticamente significante dos resultados clínico-funcionais (P OBJECTIVE: Evaluate the results from the Latarjet procedure in patients with anterior recurrent dislocation of the shoulder who present bone loss of the glenoid cavity greater than 25%. METHODS: Twenty six male patients underwent the Latarjet procedure, The bone loss was evaluated by means of radiography using the Bernageau view and by means of CAT scan. The patients were evaluated with regard to range of motion, using the Rowe and UCLA scales, before and after the operation, and by radiographs to assess the presence of arthrosis, position and consolidation of the graft and positioning of the screws. Statistical analysis was used to assess whether there was any relationship between the number of episodes of dislocation and the presence of arthrosis, , and any relationship between arthrosis and

Mitchell Receives 2013 Ronald Greeley Early Career Award in Planetary Science: Citation

Science.gov (United States)

McKinnon, William B.

2014-07-01

The Greeley Early Career Award is named for pioneering planetary scientist Ronald Greeley. Ron was involved in nearly every major planetary mission from the 1970s until his death and was extraordinarily active in service to the planetary science community. Ron's greatest legacies, however, are those he mentored through the decades, and it is young scientists whose work and promise we seek to recognize. This year's Greeley award winner is Jonathan L. Mitchell, an assistant professor at the University of California, Los Angeles (UCLA). Jonathan received his Ph.D. from the University of Chicago, and after a postdoc at the Institute for Advanced Studies in Princeton, he joined the UCLA faculty, where he holds a joint appointment in Earth and space sciences and in atmospheric sciences.

Risk-benefit evaluation for large technological systems

International Nuclear Information System (INIS)

Okrent, D.

1979-01-01

The related topics of risk-benefit analysis, risk analysis, and risk-acceptance criteria (How safe is safe enough) are of growing importance. An interdisciplinary study on various aspects of these topics, including applications to nuclear power, was recently completed at the University of California, Los Angeles (UCLA), with the support of the National Science Foundation. In addition to more than 30 topical reports and various open-literature publications, a final report (UCLA-ENG-7777) to the study, titled ''A Generalized Evaluation Approach to Risk--Benefit for Large Technological Systems and Its Application to Nuclear Power'', was issued in early 1978. This article briefly summarizes portions of the final report dealing with general aspects of risk-benefit methodology, societal knowledge and perception of risk, and risk-acceptance criteria

Quality of life and psychosocial aspects in Greek patients with psoriasis: a cross-sectional study.

Science.gov (United States)

Kouris, Anargyros; Christodoulou, Christos; Stefanaki, Christina; Livaditis, Miltiadis; Tsatovidou, Revekka; Kouskoukis, Constantinos; Petridis, Athanasios; Kontochristopoulos, George

2015-01-01

Psoriasis is a common, long-term skin disease associated with high levels of psychological distress and a considerable adverse impact on life. The effects of psoriasis, beyond skin affliction, are seldom recognized and often undertreated. The aim of the study is to evaluate the quality of life, anxiety and depression, self-esteem and loneliness in patients with psoriasis. Eighty-four patients with psoriasis were enrolled in the study. The quality of life, depression and anxiety, loneliness and self-esteem of the patient were assessed using the Dermatology Life Quality Index, Hospital Anxiety and Depression Scale, the UCLA loneliness Scale (UCLA-Version 3) and Rosenberg's Self-esteem Scale, respectively. The Dermatology Quality of Life Index score among psoriasis patients was 12.61 ± 4.88. They had statistically significantly higher scores according to the Hospital Anxiety and Depression Scale -anxiety subscale (p=0.032)-compared with healthy volunteers. Moreover, a statistically significant difference was found between the two groups concerning the UCLA-scale (p=0.033) and RSES-scale (pself-esteem than male patients. Psoriasis is a distressing, recurrent disorder that significantly impairs quality of life. Therefore, the recognition and future management of psoriasis may require the involvement of multi-disciplinary teams to manage the physical, psychological and social aspects of the condition, as is the case for systemic, long-term conditions.

A high-density SNP linkage scan with 142 combined subtype ADHD sib pairs identifies linkage regions on chromosomes 9 and 16.

Science.gov (United States)

Asherson, P; Zhou, K; Anney, R J L; Franke, B; Buitelaar, J; Ebstein, R; Gill, M; Altink, M; Arnold, R; Boer, F; Brookes, K; Buschgens, C; Butler, L; Cambell, D; Chen, W; Christiansen, H; Feldman, L; Fleischman, K; Fliers, E; Howe-Forbes, R; Goldfarb, A; Heise, A; Gabriëls, I; Johansson, L; Lubetzki, I; Marco, R; Medad, S; Minderaa, R; Mulas, F; Müller, U; Mulligan, A; Neale, B; Rijsdijk, F; Rabin, K; Rommelse, N; Sethna, V; Sorohan, J; Uebel, H; Psychogiou, L; Weeks, A; Barrett, R; Xu, X; Banaschewski, T; Sonuga-Barke, E; Eisenberg, J; Manor, I; Miranda, A; Oades, R D; Roeyers, H; Rothenberger, A; Sergeant, J; Steinhausen, H-C; Taylor, E; Thompson, M; Faraone, S V

2008-05-01

As part of the International Multi-centre ADHD Genetics project we completed an affected sibling pair study of 142 narrowly defined Diagnostic and Statistical Manual of Mental Disorders, fourth edition combined type attention deficit hyperactivity disorder (ADHD) proband-sibling pairs. No linkage was observed on the most established ADHD-linked genomic regions of 5p and 17p. We found suggestive linkage signals on chromosomes 9 and 16, respectively, with the highest multipoint nonparametric linkage signal on chromosome 16q23 at 99 cM (log of the odds, LOD=3.1) overlapping data published from the previous UCLA (University of California, Los Angeles) (LOD>1, approximately 95 cM) and Dutch (LOD>1, approximately 100 cM) studies. The second highest peak in this study was on chromosome 9q22 at 90 cM (LOD=2.13); both the previous UCLA and German studies also found some evidence of linkage at almost the same location (UCLA LOD=1.45 at 93 cM; German LOD=0.68 at 100 cM). The overlap of these two main peaks with previous findings suggests that loci linked to ADHD may lie within these regions. Meta-analysis or reanalysis of the raw data of all the available ADHD linkage scan data may help to clarify whether these represent true linked loci.

The LLNL/UCLA high gradient inverse free electron laser

Energy Technology Data Exchange (ETDEWEB)

Moody, J. T.; Musumeci, P.; Anderson, G.; Anderson, S.; Betts, S.; Fisher, S.; Gibson, D.; Tremaine, A.; Wu, S. [Department of Physics and Astronomy, UCLA, Los Angeles California, 90095 (United States); Lawrence Livermore National Laboratory (United States)

2012-12-21

We describe the Inverse Free Electron Accelerator currently under construction at Lawrence Livermore National Lab. Upon completion of this accelerator, high brightness electrons generated in the photoinjector blowout regime and accelerated to 50 MeV by S-band accelerating sections will interact with > 4 TW peak power Ti:Sapphire laser in a highly tapered 50 cm undulator and experience an acceleration gradient of > 200 MeV/m. We present the final design of the accelerator as well as the results of start-to-end simulations investigating preservation of beam quality and tolerances involved with this accelerator.

OceanGLOBE: an Outdoor Research and Environmental Education Program for K-12 Students

Science.gov (United States)

Perry, R. B.; Hamner, W. M.

2006-12-01

OceanGLOBE is an outdoor environmental research and education program for upper elementary, middle and high school students, supplemented by online instructional materials that are available without charge to any educator. OceanGLOBE was piloted in 1995 with support from a National Science Foundation Teacher Enhancement project, "Leadership in Marine Science" (award no.ESI-9454413 to UCLA). Continuing support by a second NSF Teacher Enhancement project (award no. ESI-9819424 to UCLA) and by COSEE-West (NSF awards OCE-215506 to UCLA and OCE-0215497 to USC) has enabled OceanGLOBE to expand to a growing number of schools and to provide an increasingly robust collection of marine science instructional materials on its website, http://www.msc.ucla.edu/oceanglobe/ OceanGLOBE provides a mechanism for students to conduct inquiry-based, hands-on marine science research, providing experiences that anchor the national and state science content standards learned in the classroom. Students regularly collect environmental and biological data from a beach site over an extended period of time. In the classroom they organize, graph and analyze their data, which can lead to a variety of student-created science products. Beach research is supported by instructional marine science materials on the OceanGLOBE website. These online materials also can be used in the classroom independent of the field component. Annotated PowerPoint slide shows explain research protocols and provide marine science content. Field guides and photographs of marine organisms (with emphasis on the Southern California Bight) and a growing collection of classroom investigations (applicable to any ocean location) support the science content presented in the beach research program and slide shows. In summary, OceanGLOBE is a comprehensive learning package grounded in hands-on, outdoor marine science research project in which students are the principal investigators. By doing scientific work repetitively over an

Epilepsy Surgery for Individuals with TSC

Science.gov (United States)

... this video dated June 1, 2017, UCLA pediatric neurosurgeon Aria Fallah, MD, discusses the surgical treatment of ... the epilepsy surgery team, which includes the epileptologist, neurosurgeon, neuroradiologists and neuropsychologists, reviews all the collected data ...

Deployable Ka-Band Reflectarray, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — Tyvak, in collaboration with UCLA, proposes a novel approach to the challenge of creating a large reflector for Ka-band high data rate links. We propose to attach...

Vecāku audzināšanas stila saistība ar pusaudžu vientulības izjūtu

OpenAIRE

Vlasova, Iveta

2013-01-01

Pētījuma jautājums: Vai starp mātes audzināšanas stilu un vientulības līmeni pusaudžiem pastāv saistība? Pētījuma dalībnieki. Viena izlase, pēc pieejamības principa. Dalībnieku vecums: 12-16 gadi, 31 meitene, 23 zēni. Dzīvojoši pilnās ģimenēs. Pētījuma metode. 1.Lieto, lai noteiktu kopējo vientulības izjūtas līmeni, tika izmantota Vientulības skala (UCLA Loneliness Scale/UCLA LS/, VERSION 3; Russel, D.W. 1996).– visu jautājumu summa. 2.Vecāku audzināšanas stila aptauja (Parental...

Case Report of Acute Traumatic Rotator Cuff Tear Treatment in Traditional Korean Medicine

Directory of Open Access Journals (Sweden)

Jeong-Hwan Lee

2011-12-01

Full Text Available Objectives: There is no report on treatment of acute traumatic rotator cuff tear in Traditional Korean Medicine. We reported Traditional Korean Treatment for pain relief and better movement of acute traumatic rotator cuff tear. Methods: Shoulder MRI was used to confirm the diagnosis of tear of rotator cuff. The patient was treated with Traditional Korean Methods (Acupuncture, Herbal medicine, Pharmacopuncture for 6 months. We evaluated the patient through VAS (Visual Analogue Scale, UCLA shoulder scale, ROM (Range of motion and Shoulder MRI. Results: After 6 months of treatment, the patient's VAS was decreased whereas UCLA score and Shoulder ROM were increased. Rotator cuff tear was repaired on Shoulder MRI images. Conclusions: In acute traumatic rotator cuff tear, Korean Traditional Treatment is good method for pain relief and better movement.

Treatment of complex acute proximal humerus fractures using hemiarthroplasty Tratamento das fraturas complexas agudas da extremidade proximal do úmero com o uso de hemiartroplastia

Directory of Open Access Journals (Sweden)

Bruno Lobo Brandão

2013-01-01

Full Text Available OBJECTIVE: Evaluate the clinical and radiological results of hemiarthroplasty for treatment of complex proximal humerus fractures. METHODS: Sixty-seven patients were included, with follow-up of 12 to 62 months. Mean age was 65 years (44 to 88, and 47 patients were female (70%. Clinical assessment was performed using the University of California Los Angeles score (UCLA and measurement of range of motion (ROM according to the American Academy of Orthopaedic Surgeons criteria. A standardized radiological evaluation was conducted, with special attention to healing and position of tuberosities. Patients were divided into two groups: A (anatomical healing of tuberosities and B (without anatomical healing of tuberosities. Statistical analyses were performed using the t test. Level of significance was set at p OBJETIVO: Avaliar os resultados funcionais e radiográficos dos pacientes submetidos à hemiartroplastia para tratamento das fraturas complexas da extremidade proximal do úmero. MÉTODOS: Foram incluídos 67 pacientes, com seguimento que variou entre 12 e 62 meses. A média de idade foi de 65 anos (44 a 88 e 47 pacientes eram do sexo feminino (70%. Os pacientes foram avaliados clinicamente por meio da avaliação da amplitude de movimentos (ADM e do escore funcional da University of California Los Angeles (UCLA. A avaliação radiográfica foi feita de forma padronizada com divisão dos pacientes em dois grupos: A (consolidação do tubérculo maior em posição anatômica e B (ausência de consolidação anatômica do tubérculo maior. Na análise estatística consideramos significativos os achados com p < 0,05. RESULTADOS: A pontuação média do UCLA foi de 26 pontos, com média de oito pontos para dor e 64 pacientes satisfeitos subjetivamente (96%. Na avaliação da amplitude de movimento (ADM ativa encontramos uma média de 104º de flexão anterior e 36º de rotação lateral. No grupo A, com 33 pacientes, encontramos uma média de 122º de

Laser Enhanced System for Ultra-Fine Microstructure Formation

National Research Council Canada - National Science Library

Chen, Ray T

2002-01-01

.... High-speed polymer-based EO modulator arrays and polymer-based optical true-time delay modules have been built through the existing programs involving UT Austin (Chen), USC (Steier), UCLA (Fetterman) and Univ. of Washington (Dalton...

Finnish Kalevala and Estonian Kalevipoeg / Jaan Puhvel

Index Scriptorium Estoniae

Puhvel, Jaan, 1932-

2003-01-01

Tõlgitud kogumikust: The world of the Kalevala : essays in celebration of the 150 year jubilee of the publication of the Finnish national epic / ed. Kai Laitinen. Los Angeles : UCLA Centre for the Study of Folklore & Mythology, 1987

University of Maryland component of the Center for Multiscale Plasma Dynamics: Final Technical Report

Energy Technology Data Exchange (ETDEWEB)

Dorland, William [University of Maryland

2014-11-18

The Center for Multiscale Plasma Dynamics (CMPD) was a five-year Fusion Science Center. The University of Maryland (UMD) and UCLA were the host universities. This final technical report describes the physics results from the UMD CMPD.

Quality of life psychosocial characteristics in Greek patients with leg ulcers: a case control study.

Science.gov (United States)

Kouris, Anargyros; Armyra, Kalliopi; Christodoulou, Christos; Sgontzou, Themis; Karypidis, Dimitrios; Kontochristopoulos, George; Liordou, Fotini; Zakopoulou, Nikoletta; Zouridaki, Eftychia

2016-10-01

Chronic leg ulcers are a public health problem that can have a significant impact on the patient's physical, socioeconomic and psychological status. The aim of this study is to evaluate the quality of life, anxiety and depression, self-esteem and loneliness in patients suffering from leg ulcers. A total of 102 patients were enrolled in the study. The quality of life, anxiety and depression, self-esteem and loneliness of the patient were assessed using the Dermatology Life Quality Index (DLQI), Hospital Anxiety and Depression Scale (HADS), Rosenberg's Self-esteem Scale (RSES) and the UCLA Loneliness Scale (UCLA-Version 3), respectively. The mean DLQI score was 13·38 ± 2·59, suggesting a serious effect on the quality of life of patients. Those with leg ulcers had statistically significant higher scores according to the HADS-total scale (P = 0·031) and HADS-anxiety subscale (P = 0·015) compared with healthy volunteers. Moreover, a statistically significant difference was found between the two groups concerning the UCLA-scale (P = 0·029). Female patients presented with a higher score of anxiety (P = 0·027) and social isolation (P = 0·048), and worse quality of life (P = 0·018) than male patients. A severe quality of life impairment was documented, reflecting a significant psychosocial impact on patients with leg ulcers. © 2014 The Authors. International Wound Journal © 2014 Medicalhelplines.com Inc and John Wiley & Sons Ltd.

Kate Steinitz, Librarian, Artist, Scholar; Being a Thirteen-Part Tribute to One Whose Verve Has Enlivened Some Eight Decades on Two Continents

Science.gov (United States)

Wilson Libr Bull, 1970

1970-01-01

Personal reminiscences about the Dada artist, expert on Leonardo da Vinci, and librarian at the UCLA Library of Vinciana by museum directors, scholars, and friends. Includes selected bibliography of her works, a chronology, poems, sketches, and photographs. (JS)

Fulltext PDF

Indian Academy of Sciences (India)

ductor Field Effect Transistors (MOSFETs), in a chip exceeds a billion. ..... A group led by B Jalali in the University of California at. Los Angeles, (UCLA) ... i-n structure guides the light. External ... Microstructures, Clarendon Press, Oxford, 2003.

Review of the Scientific Evidence of Using Population Normative Values for Post-Concussive Computerized Neurocognitive Assessments

Science.gov (United States)

2016-02-10

R, Virginia Commonwealth University  Dr. Chris Giza, Professor of Pediatric Neurology and Neurosurgery, UCLA Brain Injury Research Center October...Sara Higgins , MPH Analyst, Grant Thornton LLP Kendal Brown, MBA Management Analyst, Information Innovators, Inc. Margaret Welsh Management

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,353 views 5: ... Little Stars 13,224 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... University (NEOMED) 26,879 views 5:39 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... Little Stars 13,224 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,988 views 5: ... University (NEOMED) 26,434 views 5:39 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,056 views 5: ... Little Stars 12,980 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,668 views 5: ... Little Stars 12,587 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 13:34 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... University (NEOMED) 27,094 views 5:39 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,898 views 5: ... Little Stars 12,759 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,934 views 5: ... Little Stars 12,759 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,941 views 5: ... Little Stars 12,759 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,015 views 5: ... Little Stars 12,759 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,044 views 5: ... University (NEOMED) 26,562 views 5:39 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 5:39 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... Before Death 17,437 views 5:27 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,915 views 5: ... Little Stars 12,759 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Parkinson's Disease Videos

Medline Plus

Full Text Available ... of Exercise or Exercise Programs Are Recommended? Natalie Diaz, MD, Harbor-UCLA Medical Center: “Ententiendo el Párkinson” ... How Can Caregivers Help with Freezing Episodes? Adolfo Diaz, PTA, NPF - National Parkinson Foundation OHSU - Parkinson's Disease: ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,972 views 5: ... Little Stars 12,759 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,036 views 5: ... Little Stars 12,759 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 13:34 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,175 views 5: ... Jester 160,437 views New 12:43 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,958 views 5: ... Tammy Ziegler 144,925 views 5:08 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,612 views 5: ... Little Stars 12,587 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 5:27 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... Health - Meriter 253,329 views 13:34 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 4:24 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,738 views 5: ... Little Stars 12,680 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Parkinson's Disease Videos

Medline Plus

Full Text Available ... Expert Briefings: Caring for a Person with Late Stage Parkinson's Expert Briefings: Impulsive and Compulsive Behaviors in ... Surgery? CareMAP: Managing Caregiver Stress CareMAP: End-of-Life Care Natalie Diaz, MD, Harbor-UCLA Medical Center: “ ...

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... views 12:07 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 63,703 views 5: ... 24. RileyKidsVideo 210,660 views 4:24 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

Comparison of trauma on survivors of sexual assault and intimate ...

African Journals Online (AJOL)

2014-06-20

Jun 20, 2014 ... Neuroscience and Human. Behavior, United States. 4Department of Nursing. Science, North-West. University, Mafikeng Campus,. South Africa. 5Department of Psychology,. UCLA-Semel Institute for. Neuroscience and Human. Behavior, United States. Correspondence to: Mashudu Davhana-Maselesele.

Resultados do tratamento cirúrgico da artropatia degenerativa do manguito rotador utilizando hemiartroplastia-CTA® Results of surgical treatment of denerative arthropathy of the rotator cuff using hemiarthroplasty-CTA®

Directory of Open Access Journals (Sweden)

Rômulo Brasil Filho

2012-02-01

Full Text Available OBJETIVO: Avaliar os resultados da artroplastia parcial de ombro tipo CTA® para o tratamento da artropatia degenerativa do manguito. MÉTODOS: De dezembro de 2006 a junho de 2009, 23 ombros de 23 pacientes foram submetidos à artroplastia parcial tipo CTA® para o tratamento de artropatia por lesão do manguito rotador. O tempo de seguimento pós-operatório variou de seis a 35 meses. A idade média foi de 74,1 anos. Houve predomínio do sexo feminino em 78,3% dos casos. O membro direito foi acometido em 18 pacientes. Todos os pacientes foram submetidos, sem melhora dos sintomas, ao tratamento fisioterápico prévio por pelo menos seis meses e foram submetidos à cirurgia pela mesma equipe cirúrgica. Nenhum dos pacientes havia realizado cirurgia prévia no ombro afetado. A avaliação dos pacientes no seguimento pós-operatório seguiu os critérios do escore da UCLA. RESULTADOS: Verificou-se melhora da dor em todos pacientes após a artroplastia. Pelo escore da UCLA, a média de pontos em relação à dor foi de 9,22 (variando de 10 a oito. Quanto à função, a média foi de seis (10 a dois. Encontramos nesses pacientes média de 2,39 na flexão frontal ativa (quatro a zero. Na força de flexão frontal a média foi de 4,09 com máxima de cinco e mínima de três. A média de pontos do escore da UCLA foi de 26,52. Noventa e cinco porcento dos pacientes ficaram satisfeitos com a cirurgia. CONCLUSÃO: A artroplastia parcial de ombro tipo CTA® tem resultados satisfatórios no tratamento da artropatia degenerativa do manguito rotador e apresenta baixa taxa de complicação.OBJECTIVE: To assess results of CTA® partial shoulder arthroplasty for treatment of degenerative arthropathy of the rotator cuff. METHODS: Between December 2006 and June 2009, 23 shoulders of 23 patients were submitted to CTA® type partial shoulder arthroplasty for treatment of arthropathy secondary to rotator cuff injury. Post-operative follow up time ranged from 6 to 35

Theoretical and Experimental Studies in Accelerator Physics

Energy Technology Data Exchange (ETDEWEB)

Rosenzweig, James [Univ. of California, Los Angeles, CA (United States). Dept. of Physics and Astronomy

2017-03-08

This report describes research supported by the US Dept. of Energy Office of High Energy Physics (OHEP), performed by the UCLA Particle Beam Physics Laboratory (PBPL). The UCLA PBPL has, over the last two decades-plus, played a critical role in the development of advanced accelerators, fundamental beam physics, and new applications enabled by these thrusts, such as new types of accelerator-based light sources. As the PBPL mission is broad it is natural that it has been grown within the context of the accelerator science and technology stewardship of the OHEP. Indeed, steady OHEP support for the program has always been central to the success of the PBPL; it has provided stability, and above all has set the over-arching themes for our research directions, which have producing over 500 publications (>120 in high level journals). While other agency support has grown notably in recent years, permitting more vigorous pursuit of the program, it is transient by comparison. Beyond permitting program growth in a time of flat OHEP budgets, the influence of other agency missions is found in push to adapt advanced accelerator methods to applications, in light of the success the field has had in proof-of-principle experiments supported first by the DoE OHEP. This three-pronged PBPL program — advanced accelerators, fundamental beam physics and technology, and revolutionary applications — has produced a generation of students that have had a profound affect on the US accelerator physics community. PBPL graduates, numbering 28 in total, form a significant population group in the accelerator community, playing key roles as university faculty, scientific leaders in national labs (two have been named Panofsky Fellows at SLAC), and vigorous proponents of industrial application of accelerators. Indeed, the development of advanced RF, optical and magnet technology at the PBPL has led directly to the spin-off company, RadiaBeam Technologies, now a leading industrial accelerator firm

Tenotomia com ou sem tenodese da cabeça longa do bíceps no reparo artroscópico do manguito rotador Tenotomy with or without tenodesis of the long head of the biceps for arthroscopic repair of the rotator cuff

Directory of Open Access Journals (Sweden)

Roberto Yukio Ikemoto

2012-01-01

Full Text Available OBJETIVO: Comparação dos resultados funcionais nos pacientes submetidos à tenotomia com ou sem tenodese da CLB associada ao reparo da lesão do manguito rotador por visão artroscópica, com seguimento superior a dois anos. MÉTODO: Estudo retrospectivo não randomizado, com nível de evidência III, em que foram revisados os prontuários e realizada reavaliação clínica de 77 pacientes com lesão da cabeça longa do bíceps, sendo que 55 foram submetidos à tenotomia sem tenodese e 22 à tenotomia com a tenodese, com seguimento ambulatorial maior que dois anos. Foram avaliados idade, dominância, lado operado, tamanho das lesões classificadas por Gartsman, arco do movimento pré e pós-operatório, presença ou ausência do sinal do Popeye, dor na corredeira bicipital, avaliação segundo a escala University of California at Los Angeles e Elbow Strength Index. RESULTADOS: O UCLA médio total da amostra foi de 16,92 (8 a 25 para 31,45 (13 a 35 (p OBJECTIVE: To compare the functional results among patients un dergoing tenotomy with or without tenodesis of the long head of the biceps associated with arthroscopic repair of rotator cuff in juries, with a minimum two-year follow-up. METHOD: This was a retrospective non-randomized trial with evidence level III, in which the medical files of 77 patients with lesions of the long head of the biceps were reviewed and clinically reassessed. Among these, 55 patients underwent tenotomy without tenodesis and 22 underwent tenotomy with tenodesis, with outpatient follow-up for at least two years. The age, dominant side, operated side, lesion size using the Gartsman classification, pre and postoperative range of mo tion, presence or absence of the Popeye sign, pain in the bicipital groove and assessments using the University of California at Los Angeles (UCLA score and the elbow strength index. RESULTS: The mean UCLA score of the sample went from 16.92 (range: 8 to 25 to 31.45 (range: 13 to 35 (p < 0

Willard Libby, Radiocarbon, and Carbon Dating

Science.gov (United States)

age determination in archaeology, geology, geophysics, and other branches of science". 1 Edited of California, Los Angeles,2 where he founded the UCLA Environmental Science and Engineering (ESE Libby, Chemistry: Berkeley and Los Angeles 3 Edited excerpt from Environmental Science and Engineering

Phi factories

International Nuclear Information System (INIS)

Anon.

1990-01-01

Plans for 'phi factories' gathered momentum with a recent workshop at UCLA. These machines, high luminosity electron-positron colliders working near the phi resonance at 1020 MeV, have been proposed at Laboratories in Europe, the US, Japan and the USSR

An Evaluation of Computer-Aided Instruction in an Introductory Biostatistics Course.

Science.gov (United States)

Forsythe, Alan B.; Freed, James R.

1979-01-01

Evaluates the effectiveness of computer assisted instruction for teaching biostatistics to first year students at the UCLA School of Dentistry. Results do not demonstrate the superiority of CAI but do suggest that CAI compares favorably to conventional lecture and programed instruction methods. (RAO)

The Function of Neuroendocrine Cells in Prostate Cancer

Science.gov (United States)

2015-06-20

University of Rochester Medical Center School of Medicine and Dentistry , Rochester, NY. Corresponding Authors: Jiaoti Huang, UCLA David Geffen School of...facilities, etc.): Z. Li, Y. Sun, X. Chen, J. Squires Analysis and interpretation of data (e.g., statistical analysis, biostatistics , computational

Ultra-Short Electron Beam Compression and Phase Locking Using an Inverse Free Electron Laser Interaction in the THz Regime

International Nuclear Information System (INIS)

Moody, J. T.; Musumeci, P.; Scoby, C. M.; To, H.; Marcoux, C.

2010-01-01

The concept of a THz-based IFEL compressor at the UCLA Pegasus photoinjector laboratory is explored. A 3.5 MeV sub-picosecond electron beam generated in the photoinjector blowout regime can be compressed to femtosecond timescales by a THz IFEL interaction.

CONTRIBUTIONS OF 20TH CENTURY WOMEN TO PHYSICS

Science.gov (United States)

Annotated Photo Gallery In Her Own Words Some Physics History 500+ Books and Articles Field Editors Physical Society, the University of California, UCLA Physics and Astronomy Department, the Laboratories of , Vera Atomic, Molecular, and Optical Physics Bonnelle, Christiane Bramley, Jenny Cauchois, Yvette Connes

UCLA High Speed, High Volume Laboratory Network for Infectious Diseases

Science.gov (United States)

2008-04-01

of Human Influenza A( H1N2 ) Reassortant Viruses during the 2001–2002 Influenza Season. Journal Infectious Diseases 2002;186:1490–1493...X, Smith CB, Mungall BA, Lindstrom SE, Hall HE, Subbarao K, et al. Intercontinental circulation of human influenza A( H1N2 ) reas- sortant viruses...numerous samples containing highly pathologic avian influenza and other select agents (dual-use). With FY07 (available), FY08 (available) and FY 09

UCLA Intermediate Energy Nuclear and Particle Physics Research: Final Report

Energy Technology Data Exchange (ETDEWEB)

Nefkens, B M.K. [Principal Investigator, ed.; Goetz, J; Lapik, A; Korolija, M; Prakhov, S; Starostin, A [ed.

2011-05-18

This project covers the following research: (a) Investigations into the structure of the proton and neutron. This is done by investigating the different resonance states of nucleons with beams of tagged, polarized photons, linearly as well as circularly, incident on polarized hydrogen/deuterium targets and measuring the production of {pi}{sup 0}, 2{pi}{sup }0, 3{pi}{sup 0}, {eta} , {eta}', {omega}, etc. The principal detector is the Crystal Ball multiphoton spectrometer which has an acceptance of nearly 4 . It has been moved to the MAMI accelerator facility of the University of Mainz, Germany. We investigate the conversion of electromagnetic energy into mesonic matter and conversely. (b) We investigate the consequences of applying the "standard" symmetries of isospin, G-parity, charge conjugation, C, P, T, and chirality using rare and forbidden decays of light mesons such as the {eta} ,{eta}' and {omega}. We also investigate the consequences of these symmetries being slightly broken symmetries. We do this by studying selected meson decays using the Crystal Ball detector. (c) We determine the mass, or more precisely the mass difference of the three light quarks (which are inputs to Quantum Chromodynamics) by measuring the decay rate of specially selected {eta} and {eta}' decay modes, again we use the Crystal Ball. (d)We have started a new program to search for the 33 missing cascade baryons using the CLAS detector at the Thomas Jefferson Laboratory. Cascade resonances are very special: they have double strangeness and are quite narrow. This implies that they can be discovered by the missing mass technique in photoproduction reactions such as in {gamma}p{yields}{Xi}{sup}K{sup +}K{sup +}. The cascade program is of particular importance for the upgrade to 12 GeV of the CLAS detector and for design of the Hall D at JLab. (e) Finally, we are getting more involved in a new program to measure the hadronic matter form factor of complex nuclei, in particular the "neutron skin" of {sup 208}Pb, which is of great interest to astroparticle physics for determining the properties of neutron stars. Processes of study are coherent and noncoherent 0 photoproduction. The Crystal Ball is uniquely suited for these studies because of the large acceptance, good direction and energy resolution and it is an inclusive detector for the {pi}{sup 0} final state and exclusive for background such as 2 {pi}{sup 0}.

Physical acoustics at UCLA in the study of superfluid helium

International Nuclear Information System (INIS)

Rudnick, I.

1976-01-01

The theory of sound propagation in superfluid helium is reviewed. The theory of first, second, fourth and third sound is considered. A simple approximate derivation of the velocity of third sound is given and the Doppler shift of first, second, third and fourth sound is discussed. Experimental aspects of first, second, third and fourth sound are considered in turn. For first sound consideration is given to first-sound transducers, cavitation in liquid helium and velocity at the lambda transition. Second-sound transducers and the velocity of second sound at the lambda transition are discussed. Experimental aspects of third-sound transducers, the velocity and attenuation of third sound, the critical velocity of superfluid films and the thickness of a moving film are then discussed. Various aspects of fourth sound are considered. (B.R.H.)

UCLA High Speed, High Volume Laboratory Network for Infectious Diseases

National Research Council Canada - National Science Library

Layne, Scott P

2008-01-01

Background. Government agencies and expert panels have recognized the need for laboratories capable of analyzing tens of thousands of biological samples per day that have hundreds of times more capability than at present...

UCLA program in reactor studies: The ARIES tokamak reactor study

International Nuclear Information System (INIS)

1991-01-01

The ARIES research program is a multi-institutional effort to develop several visions of tokamak reactors with enhanced economic, safety, and environmental features. The aims are to determine the potential economics, safety, and environmental features of a range of possible tokamak reactors, and to identify physics and technology areas with the highest leverage for achieving the best tokamak reactor. Four ARIES visions are currently planned for the ARIES program. The ARIES-1 design is a DT-burning reactor based on ''modest'' extrapolations from the present tokamak physics database and relies on either existing technology or technology for which trends are already in place, often in programs outside fusion. ARIES-2 and ARIES-4 are DT-burning reactors which will employ potential advances in physics. The ARIES-2 and ARIES-4 designs employ the same plasma core but have two distinct fusion power core designs; ARIES-2 utilize the lithium as the coolant and breeder and vanadium alloys as the structural material while ARIES-4 utilizes helium is the coolant, solid tritium breeders, and SiC composite as the structural material. Lastly, the ARIES-3 is a conceptual D- 3 He reactor. During the period Dec. 1, 1990 to Nov. 31, 1991, most of the ARIES activity has been directed toward completing the technical work for the ARIES-3 design and documenting the results and findings. We have also completed the documentation for the ARIES-1 design and presented the results in various meetings and conferences. During the last quarter, we have initiated the scoping phase for ARIES-2 and ARIES-4 designs

The Consumer Protection Clinical Course at UCLA School of Law

Science.gov (United States)

Bergman, Paul

1978-01-01

The Consumer Protection clinical course, in which case supervision is provided by government agency personnel, is described. Implications are considered regarding the necessity and emphasis of a seminar component, and the usefulness of clinical courses in teaching substantive law as well as lawyering skills. (LBH)

Arthroscopic fixation of acute acromioclavicular joint disruption with TightRope™: Outcome and complications after minimum 2 (2-5) years follow-up.

Science.gov (United States)

Zhang, Li-Feng; Yin, Bo; Hou, Su; Han, Bing; Huang, De-Fa

2017-01-01

To evaluate the midterm results of arthroscopic reconstruction of acute acromioclavicular (AC) joint disruption using TightRope™ system. We retrospectively assess the results of 24 patients of acute AC joint dislocation who were operated using TightRope system. Constant and University of California, Los Angeles (UCLA) scores and coracoclavicular distance were calculated pre- and postoperatively. Data was entered into MS excel and analyzed using the SPSS version 17. The mean follow-up was 39.45 months. Constant and UCLA scores were significantly increased postoperatively. Six patients had partial loss of reduction within 3-6 months and two patients had a failure of construct. Constant score was significantly lower in these patients. TightRope reconstruction of the AC joint is a reproducible and safe alternative to many other techniques of AC joint reconstruction. Early subluxation remains a concern and may reflect the need for technique modification.

Far-infrared fusion plasma diagnostics. Task IIIA. Final report

International Nuclear Information System (INIS)

Luhmann, N.C. Jr.

1986-01-01

The Task IIIA program at UCLA has been concerned with the development of innovative yet practical plasma diagnostic systems capable of providing detailed information essential to the success of the fusion program but not presently available within the fusion community. Historically, this has involved an initial development in the laboratory, followed by a test of feasibility on the Microtor tokamak prior to transfer of the technique/instrument to main line fusion devices. Strong emphasis has been placed upon the far-infrared (FIR) spectral region where novel diagnostic systems and technology have been developed and then distributed throughout the fusion program. The major diagnostics under development have been the measurement of plasma microturbulence and coherent modes via multichannel cw collective Thomson scattering, and the application of phase/polarization imaging techniques to provide accurate and detailed (>20 channel) electron density and current profiles not presently available using conventional methods. The eventual transfer of the above techniques to main line fusion devices is, of course, a major goal of the UCLA development program. The multichannel scattering development at UCLA was efficiently transferred to TEXT a few years ago. The apparatus has been employed to investigate the strong spectral and spatial asymmetries in the microturbulence uncovered through the unique multichannel and spatial scanning capabilities of the system. The scattering apparatus has also produced evidence for the ion pressure gradient driven eta/sub i/ modes thought responsible for anomalous transport in the edge regions of tokamak plasmas, as well as providing insight into the wave-wave coupling processes between various plasma modes

Evaluation of functional results from shoulders after arthroscopic repair of complete rotator cuff tears associated with traumatic anterior dislocation

Directory of Open Access Journals (Sweden)

Glaydson Gomes Godinho

2016-04-01

Full Text Available OBJECTIVE: To evaluate the clinical outcome of arthroscopic rotator cuff fixation and, when present, simultaneous repair of the Bankart lesion caused by traumatic dislocation; and to assess whether the size of the rotator cuff injury caused by traumatic dislocation has any influence on the postoperative clinical outcomes. METHODS: Thirty-three patients with traumatic shoulder dislocation and complete rotator cuff injury, with at least two years of follow up, were retrospectively evaluated. For analysis purposes, the patients were divided into groups: presence of fixed Bankart lesion or absence of this lesion, and rotator cuff lesions smaller than 3.0 cm (group A or greater than or equal to 3.0 cm (group B. All the patients underwent arthroscopic repair of the lesions and were evaluated postoperatively by means of the UCLA (University of California at Los Angeles score and strength measurements. RESULTS: The group with Bankart lesion repair had a postoperative UCLA score of 33.96, while the score of the group without Bankart lesion was 33.7, without statistical significance (p = 0.743. Group A had a postoperative UCLA score of 34.35 and group B, 33.15, without statistical significance (p = 0.416. CONCLUSION: The functional outcomes of the patients who only presented complete rotator cuff tearing after traumatic shoulder dislocation, which underwent arthroscopic repair, were similar to the outcomes of those who presented an associated with a Bankart lesion that was corrected simultaneously with the rotator cuff injury. The extent of the original rotator cuff injury did not alter the functional results in the postoperative evaluation.

Elderly patient refractory to multiple pain medications successfully treated with integrative East–West medicine

Directory of Open Access Journals (Sweden)

Bill Tu

2008-07-01

Full Text Available Bill Tu, Michael Johnston, Ka-Kit HuiUCLA Center for East–West Medicine, Department of Internal Medicine, UCLA David Geffen School of Medicine, Los Angeles, CA, USABackground: Polypharmacy is a common and serious problem in the elderly today. Few solutions have been effective in reducing its incidence.Case summary: An 87-year-old female with a history of osteoarthritis and spinal stenosis presented with a five month history of severe right hip pain. She had been seen by multiple specialists and hospitalized many times. During these encounters, she was prescribed a long list of pain medications. However, these medications did not improve her pain and added to her risk of adverse drug events. After exhausting traditional Western medical therapies, she received a referral to the UCLA Center for East–West Medicine. There, clinicians treated her with a nonpharmacological integrative East-West medicine approach that included acupuncture, dry needling of trigger points, and education on self-acupressure. Her pain began improving and she was able to cut back on analgesic use under physician supervision. Ultimately, she improved to the point where she was able to discontinue all of her pain medications. Symptomatic relief was evidenced by improvement in health-related quality of life (HRQOL.Conclusions: This case study suggests that integrative East–West medicine may have the potential to reduce the incidence of polypharmacy in elderly patients presenting with pain conditions and improve their quality of life.Keywords: polypharmacy, pain, osteoarthritis, acupuncture, complementary and alternative medicine, integrative medicine, adverse drug reaction, elderly

Statistics Online Computational Resource for Education

Science.gov (United States)

Dinov, Ivo D.; Christou, Nicolas

2009-01-01

The Statistics Online Computational Resource (http://www.SOCR.ucla.edu) provides one of the largest collections of free Internet-based resources for probability and statistics education. SOCR develops, validates and disseminates two core types of materials--instructional resources and computational libraries. (Contains 2 figures.)

The role of academic libraries in facilitating institutional ...

African Journals Online (AJOL)

This paper discusses the implications of the University of Dar es Salaam Institutional Transformation Programme (ITP) on information services provision at Muhimbili University College of Health Sciences (MUCHS) and University College of Lands and Architectural Studies (UCLAS) libraries. The paper is based on a ...

DORS: DDC Online Retrieval System.

Science.gov (United States)

Liu, Songqiao; Svenonius, Elaine

1991-01-01

Describes the Dewey Online Retrieval System (DORS), which was developed at the University of California, Los Angeles (UCLA), to experiment with classification-based search strategies in online catalogs. Classification structures in automated information retrieval are discussed; and specifications for a classification retrieval interface are…

Ecologic and geographic distributions of the vascular plants of southern Nye County, and adjacent parts of Clark, Lincoln, and Esmeralda Counties, Nevada. [Based on collections made in 1970

Energy Technology Data Exchange (ETDEWEB)

Beatley, J. C.

1971-01-01

A catalog is compiled of the vascular plants indiginous to Nye, Clark, Lincoln, and Esmeralda Counties of Nevada based on collections made in 1970. This compilation is an update of previous collections in these areas and is a supplement to report, UCLA--12-705. (ERB)

Relation between Assertiveness, Academic Self-Efficacy, and Psychosocial Adjustment among International Graduate Students.

Science.gov (United States)

Poyrazli, Senel; Arbona, Consuelo; Nora, Amaury; McPherson, Robert; Pisecco, Stewart

2002-01-01

Rathus Assertiveness Schedule, Academic Self-Efficacy Scale, The Inventory for Student Adjustment Strain, and UCLA Loneliness Scale were used to examine a total of 122 graduate international students. Findings indicate that English proficiency, assertiveness, and academic self-efficacy contributed uniquely to the variance in students' general…

Ethnic Minority Entrepreneurs in the International Carpet Trade

DEFF Research Database (Denmark)

Rezaei, Shahamak; Dana, Leo-Paul; Light, Ivan

2013-01-01

The paper discusses the pre-modern bazaar and the authors (Shahamak Rezaei Roskilde University, Ivan Light UCLA, Léo-Paul Dana Groupe Sup de Co Montpellier Business School - Montpellier Research in Management) observe changes in the sector as Persian carpets can now be sourced from new entrants...

Exploration of Problematic Internet Use and Loneliness among Distance Education Students

Science.gov (United States)

Ozgur, Hasan; Demiralay, Tülay; Demiralay, Ilkay

2014-01-01

The current study investigated the relationship between problematic Internet use and levels of loneliness among 311 distance education students. "The Problematic Internet Use Scale" and "UCLA-Loneliness Scale III" were used to collect the data. Independentsamples t-test and one-way ANOVA were conducted to examine the…

Alternative Families and Children: Implications for Education.

Science.gov (United States)

Alexander, Jannette; Eiduson, Bernice T.

1980-01-01

Since 1973, the UCLA Family Styles Project has studied a sample of nontraditional Caucasian families (single mothers, social contract families, communal families) plus a comparison group of conventional nuclear families. Findings are reported on parents' personal/social values and changes in childrearing practices. Implications for education are…

Death from Fungus in the Soil

Centers for Disease Control (CDC) Podcasts

2012-12-17

Dr. Shira Shafir, Assistant Professor of Epidemiology at the UCLA Fielding School of Public Health, discusses her study about fungus found in soil.  Created: 12/17/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 12/18/2012.

Kalevala tõht eesti eeposele / Jaan Puhvel

Index Scriptorium Estoniae

Puhvel, Jaan, 1932-

2007-01-01

F. R. Kreutzwaldi "Kalevipoeg" ja E. Lönnroti "Kalevala". Ilmunud: The Impact of the Kalevala on the Estonian Epic. - The World of the Kalevala: Essays in Celebration of the Publication of the Finnish National Epic. Los Angeles : UCLA Folklore and Mythology Publications, 1987, lk. 56-65

Microwave modeling of laser plasma interactions. Final report

International Nuclear Information System (INIS)

1983-08-01

For a large laser fusion targets and nanosecond pulse lengths, stimulated Brillouin scattering (SBS) and self-focusing are expected to be significant problems. The goal of the contractual effort was to examine certain aspects of these physical phenomena in a wavelength regime (lambda approx.5 cm) more amenable to detailed diagnostics than that characteristic of laser fusion (lambda approx.1 micron). The effort was to include the design, fabrication and operation of a suitable experimental apparatus. In addition, collaboration with Dr. Neville Luhmann and his associates at UCLA and with Dr. Curt Randall of LLNL, on analysis and modelling of the UCLA experiments was continued. Design and fabrication of the TRW experiment is described under ''Experiment Design'' and ''Experimental Apparatus''. The design goals for the key elements of the experimental apparatus were met, but final integration and operation of the experiment was not accomplished. Some theoretical considerations on the interaction between Stimulated Brillouin Scattering and Self-Focusing are also presented

The Particle-in-Cell and Kinetic Simulation Software Center

Science.gov (United States)

Mori, W. B.; Decyk, V. K.; Tableman, A.; Fonseca, R. A.; Tsung, F. S.; Hu, Q.; Winjum, B. J.; An, W.; Dalichaouch, T. N.; Davidson, A.; Hildebrand, L.; Joglekar, A.; May, J.; Miller, K.; Touati, M.; Xu, X. L.

2017-10-01

The UCLA Particle-in-Cell and Kinetic Simulation Software Center (PICKSC) aims to support an international community of PIC and plasma kinetic software developers, users, and educators; to increase the use of this software for accelerating the rate of scientific discovery; and to be a repository of knowledge and history for PIC. We discuss progress towards making available and documenting illustrative open-source software programs and distinct production programs; developing and comparing different PIC algorithms; coordinating the development of resources for the educational use of kinetic software; and the outcomes of our first sponsored OSIRIS users workshop. We also welcome input and discussion from anyone interested in using or developing kinetic software, in obtaining access to our codes, in collaborating, in sharing their own software, or in commenting on how PICKSC can better serve the DPP community. Supported by NSF under Grant ACI-1339893 and by the UCLA Institute for Digital Research and Education.

Ergenlerde Ana-Babaya Bağlanma Örüntüsünün Benlik Saygısı ve Yalnızlık ile İlişkisi

OpenAIRE

Kaya, Şule

2017-01-01

Bu çalışmada ergenlerin ana babalarına bağlanma biçimlerinin benlik saygısı ve yalnızlık üzerinde etkisi olup olmadığının incelenmesi amaçlanmıştır. Çalışmaya Özel Sultan Fatih Lisesi 9, 10, ve 11. sınıflarında öğrenim görmekte olan 50 kız, 50 erkek öğrenci katılmıştır. Araştırmada Ana Babaya Bağlanma Ölçeği (Parental Bonding Instrument, PBI), CSEI (Coopersmith Seif Esteem lnventory) Coopersmith Benlik Saygısı Ölçeği’ nin 25 maddelik kısa formu, UCLA Yalnızlık Ölçeği (UCLA Loneliness Scale) k...

ARTHROSCOPIC TREATMENT OF ACROMIOCLAVICULAR JOINT DISLOCATION BY TIGHT ROPE TECHNIQUE (ARTHREX®)

Science.gov (United States)

GÓmez Vieira, Luis Alfredo; Visco, Adalberto; Daneu Fernandes, Luis Filipe; GÓmez Cordero, Nicolas Gerardo

2015-01-01

Presenting the arthroscopic treatment by Tight Rope - Arthrex® system for acute acromioclavicular dislocation and to evaluate results obtained with this procedure. Methods: Between August 2006 and May 2007, 10 shoulders of 10 patients with acute acromioclavicular dislocation were submitted to arthroscopic repair using the Tight Rope - Arthrex® system. Minimum follow-up was 12 months, with a mean of 15 months. Age ranged from 26 to 42, mean 34 years. All patients were male. Radiology evaluation was made by trauma series x-ray. The patients were assisted in the first month weekly and after three months after the procedure. Clinical evaluation was based on the University of California at Los Angeles (UCLA) criteria. Results: All patients were satisfied after the arthroscopic procedure and the mean UCLA score was 32,5. Conclusion: The arthroscopic treatment by Tight Rope – Arthrex® system for acute acromioclavicular dislocation showed to be an efficient technique. PMID:26998453

Strategies for Using Peer-Assisted Learning Effectively in an Undergraduate Bioinformatics Course

Science.gov (United States)

Shapiro, Casey; Ayon, Carlos; Moberg-Parker, Jordan; Levis-Fitzgerald, Marc; Sanders, Erin R.

2013-01-01

This study used a mixed methods approach to evaluate hybrid peer-assisted learning approaches incorporated into a bioinformatics tutorial for a genome annotation research project. Quantitative and qualitative data were collected from undergraduates who enrolled in a research-based laboratory course during two different academic terms at UCLA.…

Struggles and Solutions for Streaming Video in the Online Classroom

Science.gov (United States)

Fruin, Christine

2012-01-01

The upcoming round of exemptions to the Digital Millennium Copyright Act of 1998 anticircumvention provision and the questions raised by the copyright infringement lawsuit filed against the against University of California, Los Angeles (UCLA) for its streaming video practices illustrate the problematic state of the law concerning the digitization…

75 FR 82127 - Culturally Significant Objects Imported for Exhibition Determinations: “Central Nigeria Unmasked...

Science.gov (United States)

2010-12-29

... River Valley,'' imported from abroad for temporary exhibition within the United States, are of cultural... also determine that the exhibition or display of the exhibit objects at the Fowler Museum at UCLA, Los... Museum of African Art, Smithsonian Institution, Washington, DC, from on or about September 14, 2011...

The Study of the Intramolecular Heavy Atom Effect in 9,10-Dichlorophenanthrene and 1,2,3,4-Tetrachloronaphthalene Using PMDR Techniques.

Science.gov (United States)

1978-06-30

Inc . , 1974. 4. C. T. u n , Thesis , UCLA, 1974. 5. N. A. El-Sayed, Acta Phys. Polonica , XXXIV , 649(1968). 6. N. A. El-Sayed , Proceedings for the m...See Refs. 11 ,15 A. de Groot and 3. H. van der Waals, Physica 19, 1128 (1963). L

Early Behavioral Intervention to Improve Social Communication Function in Infants with TSC

Science.gov (United States)

2016-10-01

Disability (ID) using the...infant to complete the JASPER intervention at the UCLA site, acquired during our Social Scenes Paradigm (see Figures 1 & 2). The plot demonstrates that...Theory in Intellectual and Developmental Disabilities San Diego, CA • Jeste, S.S., (2016). Can rare disorders pave the way to

Acute stress among adolescents and female rape victims measured by ASC-Kids: a pilot study.

Science.gov (United States)

Nilsson, Doris; Nordenstam, Carin; Green, Sara; Wetterhall, Annika; Lundin, Tom; Svedin, Carl Göran

2015-01-01

Rape is considered a stressful trauma and often with durable consequences. How the aftermath of rape is for young adolescents' girls considering acute stress is an overlooked field and remains to be studied. In this study, we wanted to investigate acute stress among adolescent victims of rape and the psychometric properties of the Acute Stress Checklist for Children (ASC-Kids). A clinical sample (n = 79) of raped girls, 13-17 years old who had turned to a special rape victim unit for treatment, answered the ASC-Kids. ASC-Kids was also given to a group of minor stressed, non-raped adolescents in the same age range (n = 154) together with the University of California at Los Angeles Post-traumatic Stress Disorder Reaction Index (UCLA PTSD RI), and the Sense of Coherence Scale 13 (SOC-13). The scores from the groups were compared and showed significant differences in mean values on all the diagnostic criteria of acute stress disorder. In the clinical group, 36.7% obtained full ASD criteria. ASC-Kids could discriminate well between groups. Cronbach's alpha was found to be excellent, and the correlation between the UCLA PTSD RI and ASC-Kids found to be good; both ASC-Kids and UCLA PTSD RI had a good and moderate negative correlation with SOC-13. Adolescent female rape victims were shown to have a very high level of acute stress, and the ASC-Kids was found to have sound psychometrics and can be a valuable screening instrument to support clinicians in their assessments of an indication of adolescents after potentially stressful events such as rape.

Clinical outcomes of arthroscopic single and double row repair in full thickness rotator cuff tears.

Science.gov (United States)

Ji, Jong-Hun; Shafi, Mohamed; Kim, Weon-Yoo; Kim, Young-Yul

2010-07-01

There has been a recent interest in the double row repair method for arthroscopic rotator cuff repair following favourable biomechanical results reported by some studies. The purpose of this study was to compare the clinical results of arthroscopic single row and double row repair methods in the full-thickness rotator cuff tears. 22 patients of arthroscopic single row repair (group I) and 25 patients who underwent double row repair (group II) from March 2003 to March 2005 were retrospectively evaluated and compared for the clinical outcomes. The mean age was 58 years and 56 years respectively for group I and II. The average follow-up in the two groups was 24 months. The evaluation was done by using the University of California Los Angeles (UCLA) rating scale and the shoulder index of the American Shoulder and Elbow Surgeons (ASES). In Group I, the mean ASES score increased from 30.48 to 87.40 and the mean ASES score increased from 32.00 to 91.45 in the Group II. The mean UCLA score increased from the preoperative 12.23 to 30.82 in Group I and from 12.20 to 32.40 in Group II. Each method has shown no statistical clinical differences between two methods, but based on the sub scores of UCLA score, the double row repair method yields better results for the strength, and it gives more satisfaction to the patients than the single row repair method. Comparing the two methods, double row repair group showed better clinical results in recovering strength and gave more satisfaction to the patients but no statistical clinical difference was found between 2 methods.

[Mobile-phone e-mail use, social networks, and loneliness among Japanese high school students].

Science.gov (United States)

Ogata, Yasuko; Izumi, Yukiko; Kitaike, Tadashi

2006-07-01

The purposes of this study were to assess the loneliness of Japanese high school students who own and use a mobile phone, to clarify the relationships between students' loneliness and their social network and frequency of use of e-mail feature, and to demonstrate relationships with a student's social network and recognition of the benefits and drawbacks of mobile phone use. The participants were 227 students from two classes in each grade of a high school in the Kanto region of Japan. Participants answered a questionnaire covering the UCLA Loneliness Scale as well as questions pertaining to the circumstances of use of their mobile phones, their social networks (e.g., number of friends), and their perceptions of the benefits and drawbacks of mobile phone use. The questionnaires of students owning a mobile phone were analyzed. Total scores for the UCLA Loneliness Scale were calculated, and factor analysis was performed for the benefits and drawbacks. A total of 220 questionnaires were returned, for which 94.1 percent of respondents owned a mobile phone. The percentages of male and female respondents were 58% and 42%. Chronbach's alpha for the UCLA Loneliness Scale (total score) was 0.87, a result similar to previous studies with high school and university students. Factor analysis revealed five factors associated with the benefits and drawbacks of mobile phone use. Multiple-regression analysis showed that 42.9% of the variance in "frequency of e-mail use" was explained by grade level, frequency of mobile phone use, and two of the five factors from the benefits and drawbacks ("difficulty of communication," and "possible sleep loss due to nighttime e-mailing"). Stepwise multiple-regression analysis revealed that 24.4% of the variance in UCLA Loneliness Score was explained by gender, the frequency of e-mail use, the number of friends and the presence/absence of a girlfriend or boyfriend. Presence of an active social network and frequent e-mailing by mobile phone reduced

Wavelength scaling of the two-plasmon decay and stimulated Raman-scattering instabilities. Annual progress report, September 10, 1981-September 9, 1982

International Nuclear Information System (INIS)

Chen, F.F.; Joshi, C.; Ebrahim, N.A.

1983-03-01

This report contains description of the joint work done by the UCLA-Yale Users' Group at NLUF, LLE Rochester on the two plasmon decay and stimulated Raman scattering instabilities at 0.35 μm laser wavelength. A brief summary of the theoretical work on how SBS influences SRS is also given

Turkish Adolescents' Conflict Resolution Strategies toward Peers and Parents as a Function of Loneliness

Science.gov (United States)

Ciftci, Ayse; Demir, Ayhan; Bikos, Lynette Heim

2008-01-01

This study investigated the effect of loneliness on the conflict resolution strategies of adolescents toward their friends, mothers, and fathers. High school students (N = 180) from 8 different schools in Ankara, Turkey, completed the UCLA Loneliness Scale and Conflict Resolution Questionnaire with respect to their friends, mothers, and fathers.…

Confident in Their College Prep

Science.gov (United States)

Torres, Amanda

2016-01-01

Every year, the Higher Education Research Institute (HERI) at UCLA conducts The Freshman Survey, a national longitudinal study that covers a wide range of student characteristics--from secondary school achievement and activities to educational and career plans to values, attitudes, beliefs, and self concept. To identify the academic and personal…

Translational Researchers' Perceptions of Data Management Practices and Data Curation Needs: Findings from a Focus Group in an Academic Health Sciences Library

Science.gov (United States)

Bardyn, Tania P.; Resnick, Taryn; Camina, Susan K.

2012-01-01

How translational researchers use data is becoming an important support function for libraries to understand. Libraries' roles in this increasingly complex area of Web librarianship are often unclearly defined. The authors conducted two focus groups with physicians and researchers at an academic medical center, the UCLA David Geffen School of…

Alternative Dispute Resolution : A Viable Method for Settling Government Contract Disputes

Science.gov (United States)

1993-06-01

Estoppel : Using Preclusion to Shape Procedural Choices," 63 Tulane Law Review 20, 1988. Murray, "Lawyers and Alternative Dispute Resolution Success," 14...1988. Shell, "Res Judicata and Collateral Estoppel Effects of Commercial Arbitration," 35 UCLA Law Review 623, 1988. Shell, "The Role of Public Law in

Playing on the Right Side of the Brain: An Interview with Allan N. Schore

Science.gov (United States)

American Journal of Play, 2017

2017-01-01

Allan N. Schore has served on the clinical faculty of the Department of Psychiatry and Biobehavioral Sciences at UCLA's David Geffen School of Medicine since 1996 and has maintained a private clinical practice for more than four decades. He has contributed significant research to the disciplines of interpersonal neurobiology, affective…

Estudo prospectivo e comparativo dos resultados funcionais após reparo aberto e artroscópico das lesões do manguito rotador Prospective and comparative study on functional outcomes after open and arthroscopic repair of rotator cuff tears

Directory of Open Access Journals (Sweden)

Marco Antônio de Castro Veado

2011-10-01

Full Text Available OBJETIVO: Avaliar prospectivamente o resultado cirúrgico dos pacientes submetidos ao reparo das lesões do manguito rotador por via aberta e artroscópica, quanto ao aspecto funcional, clínico e por exame de ultrassonografia (US, além de comparar a ocorrência de reruptura. MÉTODOS: Foram operados 60 pacientes pelo mesmo cirurgião, sendo 29 pacientes por via aberta e 31 por via artroscópica para reparo das lesões completas do manguito rotador (MR, entre agosto de 2007 e fevereiro de 2009 no Hospital Governador Israel Pinheiro (HGIP e Hospital Mater Dei (HMD em Belo Horizonte, MG. Os pacientes foram avaliados funcionalmente através do escore da UCLA feito no pré e no pós-operatório e exames de ressonância magnética realizados no pré-operatório. Todos os pacientes foram reavaliados com um período mínimo de 12 meses de pós-operatório, quando foi realizado também exame de US. RESULTADOS: Dos 29 pacientes operados por via aberta, 27 (93,1% apresentaram resultados bons/excelentes, com UCLA médio de 32 no pós-operatório. O seguimento médio foi de 14 meses. Três pacientes apresentaram reruptura ao US, sendo que um deles permaneceu assintomático. Dos 31 pacientes operados por via artroscópica, 29 (93,5% apresentaram resultados bons/excelentes, com UCLA médio de 33 no pós-operatório. O seguimento médio foi de 19 meses. Dois pacientes apresentaram reruptura, sendo que um deles permaneceu assintomático, e um paciente evoluiu com soltura de âncora com resultado insatisfatório. CONCLUSÃO: O reparo das lesões do manguito rotador apresenta bons resultados tanto por via aberta como artroscópica, com resultados funcionais semelhantes entre os grupos, bem como a taxa de reruptura.OBJECTIVE: To prospectively assess the surgical results from patients undergoing repairs to rotator cuff injuries via open and arthroscopic procedures, with regard to functional and clinical features, and by means of ultrasound examinations, and to

Using Calibrated Peer Review to Teach Basic Research Skills

Science.gov (United States)

Bracke, Marianne S.; Graveel, John G.

2014-01-01

Calibrated Peer Review (CPR) is an online tool being used in the class Introduction to Agriculture and Purdue University (AGR 10100) to integrate a writing and research component (http://cpr.molsci.ucla.edu/Home.aspx). Calibrated Peer Review combines the ability to create writing intensive assignments with an introduction to the peer-review…

Loneliness among University Students: Predictive Power of Sex Roles and Attachment Styles on Loneliness

Science.gov (United States)

Ilhan, Tahsin

2012-01-01

This study examined the predictive power of sex roles and attachment styles on loneliness. A total of 188 undergraduate students (114 female, and 74 male) from Gazi University completed the Bem Sex Role Inventory, UCLA Loneliness Scale, and Relationship Scales Questionnaire. Hierarchic Multiple Regression analysis and t-test were used to test…

Deadly Parasite in Raccoons

Centers for Disease Control (CDC) Podcasts

2011-08-18

Dr. Shira Shafir, Assistant Professor in the Department of Epidemiology at the UCLA School of Public Health, discusses a study about roundworms in raccoons and their effect on the environment.  Created: 8/18/2011 by National Center for Emerging Zoonotic and Infectious Diseases (NCEZID).   Date Released: 8/18/2011.

Nine Unpublished Texts in the Collection of the British Museum

Czech Academy of Sciences Publication Activity Database

Alivernini, Sergio

-, č. 1 (2017) E-ISSN 1540-8760 Institutional support: RVO:68378009 Keywords : Sumerian * Ur III * administrative texts Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings) https://cdli.ucla.edu/files/ publications /cdlb2017_001.pdf

California: A Case Study in the Loss of Affirmative Action. A Policy Report

Science.gov (United States)

Gandara, Patricia

2012-01-01

This paper briefly reviews the various efforts undertaken by the University of California to maintain diversity in the institution, and especially at its highly competitive flagship campuses, UCLA and Berkeley, in the face of the loss of affirmative action during the mid-1990s. It demonstrates the continuing decline in representation of…

Birth Cohort Changes in Chinese College Students' Loneliness and Social Support

Science.gov (United States)

Xin, Sufei; Xin, Ziqiang

2016-01-01

With the dramatic recent changes in Chinese society, Chinese college students' average levels of loneliness and social support might also have changed across their birth cohorts. The present cross-temporal meta-analysis of 56 studies (N = 21,541) found that Chinese college students' scores on the UCLA Loneliness Scale (Version 3) increased…

College Student Experiences Questionnaire: Norms for the Fourth Edition

Science.gov (United States)

Gonyea, Robert M.; Kish, Kelly A.; Kuh, George D.; Muthiah, Richard N.; Thomas, Auden D.

2003-01-01

The College Student Experiences Questionnaire (CSEQ) was developed by UCLA Professor Emeritus Dr. C. Robert Pace in the 1970s. First administered by Dr. Pace in 1979, the CSEQ Research Program formally moved its operations to Indiana University's Center for Postsecondary Research and Planning in 1994, under the direction of Chancellor's Professor…

The journeys of a film phenomenologist : An interview with Vivian Sobchack on being and becoming

NARCIS (Netherlands)

Hanich, Julian

2017-01-01

In this interview Vivian Sobchack, a leading film phenomenologist worldwide and Professor Emerita at UCLA, looks back at her career as a film and media scholar. She relates how she first wanted to become a novelist – as well as an astronomer – before academia and the study of film attracted her

Identity, Aesthetics, Objects

Science.gov (United States)

Guerra, Gustavo

2006-01-01

In September 1990 UCLA's Wright Art Gallery opened an exhibition entitled Chicano Art: Resistance and Affirmation 1965-1985 (now usually referred to as CARA). While CARA was one of several national events displaying nonmainstream art, it was also distinctive in its politics of self-representation. The artists participating in CARA insisted that…

The Prediction of Gender and Attachment Styles on Shame, Guilt, and Loneliness

Science.gov (United States)

Akbag, Muge; Imamoglu, Seval Erden

2010-01-01

The purpose of this study is to examine the predictive power of attachment styles and gender on negative social emotions such as shame, guilt, and loneliness. The sample consists of 360 (183 female, 177 male) students attending to different departments of Marmara University. The Relationships Questionnaire, Guilt-Shame Scale, and UCLA Loneliness…

Syllabus for Privacy and Information Technology, Fall 2017, UCLA Information Studies

OpenAIRE

Borgman, Christine L.

2017-01-01

Privacy is a broad topic that covers many disciplines, stakeholders, and concerns. This course addresses the intersection of privacy and information technology, surveying a wide array of topics of concern for research and practice in the information fields. Among the topics covered are the history and changing contexts of privacy; privacy risks and harms; law, policies, and practices; privacy in searching for information, in reading, and in libraries; surveillance, networks, and privacy by de...

UCLA space-time area law model: A persuasive foundation for hadronization

International Nuclear Information System (INIS)

Abachi, S.; Buchanan, C.; Chien, A.; Chun, S.; Hartfiel, B.

2007-01-01

From the studies of rates and distributions of heavy quark (c,b) mesons we have developed additional evidence that hadron formation, at least in the simplest environment of e + e - collisions, is dominantly controlled by a space-time area law (''STAL''), an approach suggested by both non-perturbative QCD and relativistic string models. From the dynamics of heavy quarks whose classical space-time world-lines deviate significantly from the light-cone, we report the exact calculation of the relevant space-time area and the derivation of a Lorentz invariant variable, z eff , which reduces to the light-cone momentum fraction z for low mass quarks. Using z eff in the exponent of our fragmentation function in place of z, we find persuasive agreement with L=0,1 charmed and bottom meson data as well as for u,d,s L=0 states. Presuming STAL to be a valid first-order description for all these meson data, we find the scale of other possible second-order effects to be limited to ∝20% or less of the observed rates. The model favors a b-quark mass of ∝4.5 GeV. (orig.)

Artropatia de manguito: o que esperar do resultado funcional da artroplastia reversa?

Directory of Open Access Journals (Sweden)

Rodrigo Caldonazzo Fávaro

2015-10-01

Full Text Available resumo Objetivo: Avaliar o resultado funcional da artroplastia reversa, suas complicações e relações com os tipos de lesões. Métodos: Foram tratados 27 ombros, de 26 mulheres e um homem. Os pacientes foram avalia dos pela escala funcional de UCLA. O modelo de implantes usado foi o Delta Xtend Depuy(r. As lesões foram classificadas segundo Seebauer para o grau de artropatia e Nerot para o notching. Resultado: Aidade média foi de 77,4 (67-89, o seguimento foi de 25,8 meses (6-51, o UCLA pré era de 10,1 (6-15 e o UCLA pós foi de 29,8 (22-35, com uma melhoria estatisticamente signi ficativa (p < 0,001. Pela classificação de Seebauer, cinco eram 1B, 19 eram 2 A e três eram 2 B. Tivemos 15 complicacões (55,5%, o notching foi o mais comum e ocorreu em 14 pacientes, nove deles grau I e cinco grau II, mas nenhum deles gerou instabilidade. Apenas uma paci ente (3,7% teve complicação maior, com luxacão no pós-operatório imediato. Dois pacientes (7,4% alegaram que não repetiriam o procedimento. Uma paciente (3,7% foi submetida a revisão. Conclusão: A artroplastia reversa mostrou-se uma excelente opção para o tratamento de pacientes com artropatia do manguito rotador com baixo índice de complicações maio res. O notching é uma complicação frequente, mas que na maioria dos casos não apresenta repercussão clínica

Development of quality metrics for ambulatory pediatric cardiology: Transposition of the great arteries after arterial switch operation.

Science.gov (United States)

Baker-Smith, Carissa M; Carlson, Karina; Ettedgui, Jose; Tsuda, Takeshi; Jayakumar, K Anitha; Park, Matthew; Tede, Nikola; Uzark, Karen; Fleishman, Craig; Connuck, David; Likes, Maggie; Penny, Daniel J

2018-01-01

To develop quality metrics (QMs) for the ambulatory care of patients with transposition of the great arteries following arterial switch operation (TGA/ASO). Under the auspices of the American College of Cardiology Adult Congenital and Pediatric Cardiology (ACPC) Steering committee, the TGA/ASO team generated candidate QMs related to TGA/ASO ambulatory care. Candidate QMs were submitted to the ACPC Steering Committee and were reviewed for validity and feasibility using individual expert panel member scoring according to the RAND-UCLA methodology. QMs were then made available for review by the entire ACC ACPC during an "open comment period." Final approval of each QM was provided by a vote of the ACC ACPC Council. Patients with TGA who had undergone an ASO were included. Patients with complex transposition were excluded. Twelve candidate QMs were generated. Seven metrics passed the RAND-UCLA process. Four passed the "open comment period" and were ultimately approved by the Council. These included: (1) at least 1 echocardiogram performed during the first year of life reporting on the function, aortic dimension, degree of neoaortic valve insufficiency, the patency of the systemic and pulmonary outflows, the patency of the branch pulmonary arteries and coronary arteries, (2) neurodevelopmental (ND) assessment after ASO; (3) lipid profile by age 11 years; and (4) documentation of a transition of care plan to an adult congenital heart disease (CHD) provider by 18 years of age. Application of the RAND-UCLA methodology and linkage of this methodology to the ACPC approval process led to successful generation of 4 QMs relevant to the care of TGA/ASO pediatric patients in the ambulatory setting. These metrics have now been incorporated into the ACPC Quality Network providing guidance for the care of TGA/ASO patients across 30 CHD centers. © 2017 Wiley Periodicals, Inc.

Metabolic profiling of follistatin overexpression: a novel therapeutic strategy for metabolic diseases

Directory of Open Access Journals (Sweden)

Singh R

2018-03-01

Full Text Available Rajan Singh,1,2 Shehla Pervin,1,2 Se-Jin Lee,3,4 Alan Kuo,5 Victor Grijalva,6 John David,7 Laurent Vergnes,8 Srinivasa T Reddy1,6 1Department of Obstetrics and Gynecology, UCLA School of Medicine, Los Angeles, CA, USA; 2Division of Endocrinology and Metabolism, Charles R. Drew University of Medicine and Science, Los Angeles, CA, USA; 3The Jackson Laboratory for Genomic Medicine, Farmington, CT, USA; 4Department of Genetics and Genome Sciences, University of Connecticut School of Medicine, CT, USA; 5Department of Biology, California State University Dominguez Hills, CA, USA; 6Department of Molecular and Medical Pharmacology, UCLA School of Medicine, Los Angeles, CA, USA; 7Department of Comparative Medicine, Pfizer Inc, San Diego, CA, USA; 8Department of Human Genetics, UCLA School of Medicine, Los Angeles, CA, USA Background: Follistatin (Fst promotes brown adipocyte characteristics in adipose tissues.Methods: Abdominal fat volume (CT scan, glucose clearance (GTT test, and metabolomics analysis (mass spectrometry of adipose tissues from Fst transgenic (Fst-Tg and wild type (WT control mice were analyzed. Oxygen consumption (Seahorse Analyzer and lipidomics (gas chromatography was analyzed in 3T3-L1 cells.Results: Fst-Tg mice show significant decrease in abdominal fat content, increased glucose clearance, improved plasma lipid profiles and significant changes in several conventional metabolites compared to the WT mice. Furthermore, overexpression of Fst in 3T3-L1 cells resulted in up regulation of key brown/beige markers and changes in lipidomics profiles. Conclusion: Fst modulates key factors involved in promoting metabolic syndrome and could be used for therapeutic intervention. Keywords: follistatin, transgenic, adipocyte, fibroblast growth factor 21, AdipoQ

Clinical outcomes of arthroscopic single and double row repair in full thickness rotator cuff tears

Directory of Open Access Journals (Sweden)

Ji Jong-Hun

2010-01-01

Full Text Available Background: There has been a recent interest in the double row repair method for arthroscopic rotator cuff repair following favourable biomechanical results reported by some studies. The purpose of this study was to compare the clinical results of arthroscopic single row and double row repair methods in the full-thickness rotator cuff tears. Materials and Methods: 22 patients of arthroscopic single row repair (group I and 25 patients who underwent double row repair (group II from March 2003 to March 2005 were retrospectively evaluated and compared for the clinical outcomes. The mean age was 58 years and 56 years respectively for group I and II. The average follow-up in the two groups was 24 months. The evaluation was done by using the University of California Los Angeles (UCLA rating scale and the shoulder index of the American Shoulder and Elbow Surgeons (ASES. Results: In Group I, the mean ASES score increased from 30.48 to 87.40 and the mean ASES score increased from 32.00 to 91.45 in the Group II. The mean UCLA score increased from the preoperative 12.23 to 30.82 in Group I and from 12.20 to 32.40 in Group II. Each method has shown no statistical clinical differences between two methods, but based on the sub scores of UCLA score, the double row repair method yields better results for the strength, and it gives more satisfaction to the patients than the single row repair method. Conclusions: Comparing the two methods, double row repair group showed better clinical results in recovering strength and gave more satisfaction to the patients but no statistical clinical difference was found between 2 methods.

Long-Term Effects of Adderall XR in ADHD

Directory of Open Access Journals (Sweden)

J Gordon Millichap

2005-06-01

Full Text Available The long-term tolerability and effectiveness of extended release mixed amphetamine salts (Adderall XR in children with attention deficit hyperactivity disorder (ADHD were evaluated in a 24-month, multicenter, open-label extension of 2 placebo-controlled studies at UCLA, Massachusetts General Hospital, UC-Irvine, Maitland, FL, and Shire Pharmaceutical, Wayne, PA.

The Use of Print Materials in the Internet Age: A Comparative Study of Academic Library Circulation Patterns

Science.gov (United States)

Haley, Daniel Joseph

2010-01-01

The circulation records from 1997/98 to 2007/08 for UCLA and from 2000/01 to 2007/08 for Pasadena City College (PCC) were analyzed to examine patterns in the use of print materials during a period of increasingly available online digital information resources. The analysis included examinations of longitudinal circulation patterns broken down by…

High Energy Physics. Hearing before the Subcommittee on Science of the Committee on Science, Space, and Technology, U.S. House of Representatives, One Hundred Third Congress, Second Session, January 26, 1994

International Nuclear Information System (INIS)

Anon.

1994-01-01

This hearing considers the future of high energy physics in the USA. Testimony is from the following: J. Gibbons, OSTP; R. Eisenstein, Physics Division, NSF; M Krebs, Director of Energy Research, DOE; J. Peoples, FNAL; R. Peccei, UCLA; F.S. Merritt, Enrico Fermi Institute, University of Chicago; S. Wojcicki, Stanford, High Energy Physics Advisory Panel

Experimental and theoretical high energy physics research. Annual grant progress report (FDP), January 15, 1993--January 14, 1993

Energy Technology Data Exchange (ETDEWEB)

Cline, D.B.

1993-10-01

Progress on seven tasks is reported. (I)UCLA hadronization model, antiproton decay, PEP4/9 e{sup +}e{sup {minus}} analysis: In addition to these topics, work on CP and CPT phenomenology at a {phi} factory and letters of support on the hadronization project are included. (II)ICARUS detector and rare B decays with hadron beams and colliders: Developments are summarized and some typcial events as shown; in addition, the RD5 collaboration at CERN and the asymmetric {phi} factory project are sketched. (III)Theoretical physics: Feynman diagram calculations in gauge theory; supersymmetric standard model; effects of quantum gravity in breaking of global symmetries; models of quark and lepton substructure; renormalized field theory; large-scale structure in the universe and particle-astrophysics/early universe cosmology. (IV)H dibaryon search at BNL, kaon experiments (E799/KTeV) at Fermilab: Project design and some scatterplots are given. (V)UCLA participation in the experiment CDF at Fermilab. (VI)Detectors for hadron physics at ultrahigh energy colliders: Scintillating fiber and visible light photon counter research. (VII)Administrative support and conference organization.

Evaluation of the clinical-functional results from repairing extensive rotator cuff injury with inclusion of the tendon of the long head of the biceps

Directory of Open Access Journals (Sweden)

Roberto Yukio Ikemoto

2013-04-01

Full Text Available OBJECTIVES: To assess the outcomes of the arthroscopic margin convergence of the posterior cuff to the biceps tendon. METHODS: From October 2003 to December 2007, 20 patients with massive rotator cuff tear which include the rotator interval were treated with arthroscopic margin convergence of the posterior cuff to biceps tendon. Sixteen patients were female and four were male. The mean age was 58.95 years old. The dominant side was affected in 16 cases (80%. The outcomes were analysed according to the UCLA Score with a minimum follow-up period of two years. RESULTS: The UCLA score improved, on average, 14 points (p < 0.001. Six patients had excellent results; nine good; three fair and two poor results. The mean improvement of forward flexion was 33º (p < 0.001, 3º of external rotation (p < 0.396 and two vertebral levels for internal rotation (p < 0.025. CONCLUSION: The arthroscopic margin convergence of the posterior cuff to the biceps tendon leads to satisfactory results.

Operational characteristics of pediatric radiology: Image display stations

International Nuclear Information System (INIS)

Taira, R.K.

1987-01-01

The display of diagnostic images is accomplished in the UCLA Pediatric Radiology Clinical Radiology Imaging System (CRIS) using 3 different types of digital viewing stations. These include a low resolution station with six 512 x 512 monitors, a high resolution station with three 1024 x 1024 monitors, and a very high resolution workstation with two 2048 x 2048 monitors. The display stations provide very basic image processing manipulations including zoom and scroll, contrast enhancement, and contrast reversal. The display stations are driven by a computer system which is dedicated for clinical use. During times when the clinical computer is unavailable (maintenance or system malfunction), the 512 x 512 workstation can be switched to operate from a research PACS system in the UCLA Image Processing Laboratory via a broadband communication network. Our initial clinical implementation involves digital viewing for pediatric radiology conferences. Presentation of inpatient cases use the six monitor 512 x 512 multiple viewing station. Later stages of the clinical implementation involve the use of higher resolution displays for the purpose of primary diagnosis from video displays

Experimental and theoretical high energy physics research

International Nuclear Information System (INIS)

Cline, D.B.

1993-01-01

Progress on seven tasks is reported. (I)UCLA hadronization model, antiproton decay, PEP4/9 e + e - analysis: In addition to these topics, work on CP and CPT phenomenology at a φ factory and letters of support on the hadronization project are included. (II)ICARUS detector and rare B decays with hadron beams and colliders: Developments are summarized and some typcial events as shown; in addition, the RD5 collaboration at CERN and the asymmetric φ factory project are sketched. (III)Theoretical physics: Feynman diagram calculations in gauge theory; supersymmetric standard model; effects of quantum gravity in breaking of global symmetries; models of quark and lepton substructure; renormalized field theory; large-scale structure in the universe and particle-astrophysics/early universe cosmology. (IV)H dibaryon search at BNL, kaon experiments (E799/KTeV) at Fermilab: Project design and some scatterplots are given. (V)UCLA participation in the experiment CDF at Fermilab. (VI)Detectors for hadron physics at ultrahigh energy colliders: Scintillating fiber and visible light photon counter research. (VII)Administrative support and conference organization

Going Back to School: An Interview with Mike Rose

Science.gov (United States)

Adams, Peter

2017-01-01

Mike Rose is a professor in the UCLA Graduate School of Education and Information Studies. He has taught in a wide range of educational settings - from elementary school to adult literacy and job training programs--and has directed an Educational Opportunity (EOP) tutorial center. He is an author and member of the National Academy of Education and…

An Interview with Barbara Keogh: Observations of Her Career and the Role of Context in Understanding Children with Disabilities

Science.gov (United States)

Chamberlain, Steven P.

2011-01-01

Barbara Keogh is a true Californian. She was born in Glendale, received her education and professional training in California colleges and universities, and has been a professor at the University of California, Los Angeles (UCLA) for more than 40 years, where she is now Emerita. She is a licensed clinical psychologist and has worked as a…

Largest College Endowments, 2011

Science.gov (United States)

Chronicle of Higher Education, 2012

2012-01-01

Of all endowments valued at more than $250-million, the UCLA Foundation had the highest rate of growth over the previous year, at 49 percent. This article presents a table of the largest college endowments in 2011. The table covers the "rank," "institution," "market value as of June 30, 2011," and "1-year change" of institutions participating in…

Forty Years of Doing Second Language Testing, Curriculum, and Research: So What?

Science.gov (United States)

Brown, James Dean

2017-01-01

I started out as a budding English as a second language (ESL) teacher in 1976 at UCLA where I went through the M.A. TESL (Teaching English as a Second Language) and Applied Linguistics Ph.D. programs. Sadly, those two programs were "disestablished" in 2014, which provides a stark lesson to any departments that think they are hot stuff…

Final Environmental Impact Statement. Disposal and Reuse of George Air Force Base, California. Volume 2. Public Comments and Responses, Appendices

Science.gov (United States)

1992-03-01

mbemehim ~du feildes Twoa 9.9 93~ Imposes GaO meji amy Imo eaudepoGa eaadeeedaus of ,eadaed at ueme G mu gdauw asadarnasimn hi Gam0’ Tbe I* bkt iddea...Southwest Gas Corporation The Nature Conservancy The Sun D-12 George AFO Disposal and Reuse FEIS Unlversky o Callornim Los Angels (uCLA) URS Consultads Vector

An Investigation of Southwestern Area Principals and the Enactment of Crisis Plans in High Schools

Science.gov (United States)

Parker, Kerry L.

2012-01-01

The purpose of this study was to identify what southwestern area high school principals reported as the enactment of school crisis plans as described in the Center for Mental Health in Schools at UCLA (CMHS, 2008), "Resource Aid: Responding to a Crisis at School." The conceptual framework guiding the study was an adaptation of the Crisis…

Report of the group on beam-beam effects in circular colliders

International Nuclear Information System (INIS)

Furman, M.A.

1991-05-01

We present a summary of the discussions and conclusions of the working group on beam-beam effects for circular colliders. This group was part of the larger beam-beam dynamics group at the 7th ICFA Workshop on Beam Dynamics, on the subject ''Beam-Beam and Beam-Radiation Interactions,'' held at UCLA, May 13--16, 1991. 15 refs

The Cultural Twilight

Science.gov (United States)

Treuer, David

2011-01-01

In this paper, the author begins by saying how privileged he feels to be included in the celebration of the American Indian Culture and Research Journal (AICRJ) and to toast forty years of American Indian studies at UCLA. He looks back over the field of Native American literature and criticism, then peeks at the present, and last, makes some…

Tratamento artroscópico da luxação acromio-clavicular pelo método "tight rope" (arthrex® Arthroscopic treatment of acromioclavicular joint dislocation by tight rope technique (arthrex®

Directory of Open Access Journals (Sweden)

Luis Alfredo Gómez Vieira

2009-02-01

Full Text Available OBJETIVO: Apresentar a técnica cirúrgica artroscópica pelo método "Tight Rope" e a avaliação dos resultados com esta técnica no tratamento da luxação acrômio-clavicular aguda. MÉTODOS: entre agosto de 2006 e maio de 2007, 10 ombros de 10 pacientes com luxação acrômio-clavicular aguda foram submetidos a tratamento artroscópcio pela técnica Tight Rope-Arthrex®. O seguimento mínimo foi de 12 meses, com média de 15 meses. A idade variou de 26 e 42 anos com média de 34 anos. Todos os pacientes eram do sexo masculino. Todos os pacientes foram atendidos na fase aguda da lesão sendo avaliados por radiologia simples (série trauma. Os pacientes foram acompanhados semanalmente no primeiro mês e a cada três meses após o procedimento artroscópico. A avaliação clínica foi feita por meio dos critérios da University of Califórnia at Los Angeles (UCLA. RESULTADOS: Todos os pacientes operados agudamente encontravam-se satisfeitos com os resultados do tratamento cirúrgico artroscópico com uma média de 32,5 pontos na escala de avaliação da UCLA. CONCLUSÃO: O tratamento artroscópico da luxação acrômio-clavicular aguda pelo método "Tight Rope" é uma técnica cirúrgica minimamente invasiva que mostrou-se eficiente para o tratamento destas lesões.OBJECTIVE: Presenting the arthroscopic treatment by Tight Rope - Arthrex® system for acute acromioclavicular dislocation and to evaluate results obtained with this procedure. METHODS: Between August 2006 and May 2007, 10 shoulders of 10 patients with acute acromioclavicular dislocation were submitted to arthroscopic repair using the Tight Rope - Arthrex® system. Minimum follow-up was 12 months, with a mean of 15 months. Age ranged from 26 to 42, mean 34 years. All patients were male. Radiology evaluation was made by trauma series x-ray. The patients were assisted in the first month weekly and after three months after the procedure. Clinical evaluation was based on the University

Numerical modeling of first experiments on PbLi MHD flows in a rectangular duct with foam-based SiC flow channel insert

Energy Technology Data Exchange (ETDEWEB)

Smolentsev, S., E-mail: sergey@fusion.ucla.edu [University of California, Los Angeles (United States); Courtessole, C.; Abdou, M.; Sharafat, S. [University of California, Los Angeles (United States); Sahu, S. [Institute of Plasma Research (India); Sketchley, T. [University of California, Los Angeles (United States)

2016-10-15

Highlights: • Numerical studies were performed as a pre-experimental analysis to the experiment on MHD PbLi flows in a rectangular duct with a flow channel insert (FCI). • Dynamic testing of foam-based SiC foam-based CVD coated FCI has been performed using MaPLE facility at UCLA. • Two physical models were proposed to explain the experimental results and 3D and 2D computations performed using COMSOL, HIMAG and UCLA codes. • The obtained results suggest that more work on FCI development, fabrication and testing has to be done to assure good hermetic properties before the implementation in a fusion device. - Abstract: A flow channel insert (FCI) is the key element of the DCLL blanket concept. The FCI serves as electrical and thermal insulator to reduce the MHD pressure drop and to decouple the temperature-limited ferritic structure from the flowing hot lead-lithium (PbLi) alloy. The main focus of the paper is on numerical computations to simulate MHD flows in the first experiments on PbLi flows in a stainless steel rectangular duct with a foam-based silicon carbide (SiC) FCI. A single uninterrupted long-term (∼6500 h) test has recently been performed on a CVD coated FCI sample in the flowing PbLi in a magnetic field up to 1.5 T at the PbLi temperature of 300 °C using the MaPLE loop at UCLA. An unexpectedly high MHD pressure drop measured in this experiment suggests that a PbLi ingress into the FCI occurred in the course of the experiment, resulting in degradation of electroinsulating FCI properties. The ingress through the protective CVD layer was further confirmed by the post-experimental microscopic analysis of the FCI. The numerical modeling included 2D and 3D computations using HIMAG, COMSOL and a UCLA research code to address important flow features associated with the FCI finite length, fringing magnetic field, rounded FCI corners and also to predict changes in the MHD pressure drop in the unwanted event of a PbLi ingress. Two physical

Reparo artroscópico das lesões completas isoladas do subescapular Arthroscopic repair of complete, isolated lesions of the subscapularis tendon

Directory of Open Access Journals (Sweden)

Niso Eduardo Balsini

2008-12-01

Full Text Available OBJETIVO: Avaliar o resultado retrospectivo de 12 pacientes submetidos ao reparo artroscópico de lesões completas isoladas do tendão do subescapular com seguimento mínimo de um ano. MÉTODOS: De 11 de abril de 2002 a 24 de setembro de 2004, realizou-se o reparo artroscópico de lesões completas do manguito rotador em 95 pacientes no Instituto Balsini. Pacientes com subescapular lesado somavam 31; 12 lesões isoladas compunham o grupo de estudo. Foram reavaliados com seguimento mínimo de um ano da cirurgia, considerando grau de elevação anterior ativa, escala da UCLA e satisfação do paciente. RESULTADOS: A elevação anterior ativa pré-operatória atingiu a média de 102º, o grau de elevação anterior ativa pós-operatória obteve a média de 175º. O ganho médio na elevação anterior ativa foi de 73º (p OBJECTIVE: To evaluate the retrospective result of 12 patients submitted to arthroscopic repair of complete, isolated lesions of the subscapularis tendon with minimum follow-up of one year. METHODS: From April 11, 2002 to September 24, 2004, the authors performed the arthroscopic repair of complete rotator cuff lesions in 95 patients at the Balsini Institute. Patients with lesioned subscapularis amounted to 31, and 12 isolated lesions were included in the study group. They were re-analyzed with a minimum follow-up of one year after surgery to evaluate the degree of active anterior elevation, according to the UCLA scale and to patient satisfaction. RESULTS: Pre-operative active anterior elevation had a mean of 102º, and the degree of active anterior elevation after surgery presented a mean of 175º. The mean gain in active anterior elevation was 73º (p < 0.0001. Preoperative UCLA had a mean of 15.25 score points, and after surgery, a mean of 31.66 score points. The mean UCLA index was 16 score points (p < 0.0001; 10 excellent results, one good, and one poor. Satisfactory results: 10, unsatisfactory: 1. CONCLUSION: 1 The

Avaliação funcional do reparo artroscópico das lesões completas do manguito rotador associado a acromioplastia Functional evaluation of arthroscopic repairs of complete rotator cuff tears associated to acromioplasty

Directory of Open Access Journals (Sweden)

Marco Antonio de Castro Veado

2008-12-01

Full Text Available OBJETIVO: Realizar avaliação funcional dos pacientes portadores de lesão completa do MR que foram submetidos ao reparo artroscópico associados à acromioplastia. MÉTODOS: Trata-se de um estudo retrospectivo realizado com pacientes submetidos a tratamento cirúrgico artroscópico para reparo da lesão do MR. Foram incluídos os pacientes operados entre junho/2000 e outubro/2004 nos Hospitais Mater Dei e Felício Rocho, em Belo Horizonte. Dos 102 pacientes submetidos à reconstrução, 11 foram retirados por não cumprirem os critérios de inclusão, sendo o número final igual a 91 ombros em 91 pacientes. A avaliação funcional foi realizada pela escala UCLA (Universidade da Califórnia em Los Angeles e pelo teste Simples. RESULTADOS: Na avaliação pós-operatória em 35 pacientes, os resultados foram considerados excelentes (38,4%; em 47, bons (51,6%; seis, regulares (6,6%; e três, ruins (3,3%. Desse modo, 82 (90,1% pacientes foram avaliados como tendo obtido resultado bom ou excelente e nove como regulares ou ruins, sendo estes insatisfatórios. CONCLUSÃO: O reparo artroscópico do manguito rotador, associado a acromioplastia, apresentou resultado funcional excelente ou bom, na maioria dos pacientes, quando avaliados pelo método funcional da UCLA.OBJECTIVE: To perform a function evaluation of patients with complete rotator cuff tears that were submitted to arthroscopic repair associated to acromioplasty. METHODS: This is a retrospective study made with patients submitted to arthroscopic surgical treatment to repair rotator cuff tears. Patients included were operated on from June 2000 to October 2004 at the Mater Dei and Felício Rocho Hospitals, in Belo Horizonte. Of the 102 patients submitted to reconstruction, 11 were removed from the study because they did not meet the inclusion criteria, and so the final number of the series was 91 shoulders of 91 patients. The functional evaluation scale was the UCLA scale and the simple test was

Elastic p-4He scattering near 1 GeV

International Nuclear Information System (INIS)

Wallace, S.J.; Alexander, Y.

1977-02-01

New 1.029 GeV p- 4 He data from an Argonne-UCLA-Minnesota collaboration are in excellent agreement with existing multiple diffraction theory predictions. The theoretical calculation includes spin and isospin dependence of the Δ intermediate state process that fills the first diffraction minimum. The recently normalized Saclay data and the older Brookhaven data disagree with our calculation and the new data

Vacuum design for a superconducting mini-collider

International Nuclear Information System (INIS)

Barletta, W.A.; Monteiro, S.

1991-01-01

The phi factory (Superconducting Mini-Collider or SMC) proposed for construction at UCLA is a single storage ring with circulating currents of 2 A each of electrons and positrons. The small circumference exacerbates the difficulties of handling the gas load due to photodesorption from the chamber walls. The authors analyze the vacuum system for the phi factory to specify design choices

Interactions Between IGFBP-3 and Nuclear Receptors in Prostate Cancer Apoptosis

Science.gov (United States)

2009-01-01

Genova, Italy . September 2008. 14 Conclusions Thus, we conclude that IGFBP-3 is a potent apoptosis inducer with potential implications in...11780 Pecan Way Loma Linda, CA 92354 Ph: (909) 799-1510 E-mail: kukwhalee@mednet.ucla.edu Present Position Assistant...Metabolism Utilizing IGFBP-3 KO mice. GRS/IGF 4th International Congress. Genova, Italy . September 2008. Poster presentations Lee, K.-W

WANDERER IN THE MIST: THE SEARCH FOR INTELLIGENCE, SURVEILLANCE, AND RECONNAISSANCE (ISR) STRATEGY

Science.gov (United States)

2017-06-01

the production of over 383,000 photographic prints to support various intelligence , mapping, and 15...WANDERER IN THE MIST: THE SEARCH FOR INTELLIGENCE , SURVEILLANCE, AND RECONNAISSANCE (ISR) STRATEGY BY MAJOR RYAN D. SKAGGS, USAF...program from the University of California at Los Angeles (UCLA) in 2004. He is a career intelligence officer with over 13 years of experience across a

Materials data base and design equations for the UCLA solid breeder blanket

International Nuclear Information System (INIS)

Sharafat, S.; Amodeo, R.; Ghoniem, N.M.

1986-01-01

The need for a complete and coherent material data base for fusion reactor systems has been an important issue for some time now. Since the choices for materials used in fusion reactors are becoming more apparent, it is important to be able to quickly access this data to facilitate reactor design. The philosophy of a data base is one of expansion and modification. This will lead to a constantly growing collection of most recently acquired information. Based on this philosophy special care has been given to the structure, the accessibility and ease of modification. The data base is developed primarily for use on Personal Computers (PC's). In Section 10.2. materials and properties investigated for this blanket study are listed. Section 10.3. is a list of phenomenological equations and mathematical fits for all materials and properties considered. Section 10.4. describes the authors efforts to develop a swelling equations based on the few experimental data points available for breeder materials. In Section 10.5. the sintering phenomena for ceramics is investigated

Materials data base and design equations for the UCLA solid breeder blanket

International Nuclear Information System (INIS)

Sharafat, S.; Amodeo, R.; Ghoniem, N.M.

1986-02-01

The materials and properties investigated for this blanket study are listed. The phenomenological equations and mathematical fits for all materials and properties considered are given. Efforts to develop a swelling equation based on the few experimental data points available for breeder materials are described. The sintering phenomena for ceramics is investigated

DREW-UCLA Breast Cancer Research and Training Program: Molecular/Cellular Pathogenesis Model

Science.gov (United States)

2007-03-01

RHS1764-9209568) were designed corresponding to nucleotides 575 to 595 of the coding region (gccctggccgtgctagacaat) of Homo sapiens ERBB2 transcript...variant 1, mRNA sequence (NM_004448, NCBI database), and 2896 to 2917 of the coding region (gctgaactggtgtatgcagatt) of Homo sapiens ERBB2, transcript...responsible for alanine transport. Springer Apoptosis (2007) 12:593–612 599 * T ra n sp o rt V el o ci ty (n m o l/m g p ro te in /m in ) 0.0 0.5 1.0

The Outlook of Workforce Development in Community Colleges. UCLA Community College Bibliography

Science.gov (United States)

Zarkesh, Maryam

2004-01-01

The 2004 State of the Union address included an announcement that $250 million was being allocated to community colleges for workforce development programs. This indication of support was good news in light of the recent trends for level funding or cutting back on educational programs, and demonstrates the perceived benefits of workforce…

A summary of the results from the UCLA OGO-5 fluxgate magnetometer

Science.gov (United States)

Coleman, P. J., Jr.; Russell, C. T.

1973-01-01

The OGO-5 fluxgate magnetometer experiment (E-14) was designed to measure the vector magnetic field over the full range of the OGO-5 orbit. Thus, it had a dynamic range of + or - 64,000 gamma yet it maintained a precision of + or - 1/16 gamma at all times. This enabled a broad spectrum of problems to be attached. Studies of the magnetospheric waves, currents, waves-particle interactions, pitch angle distributions and wave normal directions were made. The structure of the magnetopause, the magnetotail, and bow shock were probed, waves and discontinuities in the solar wind were examined and the various phases of substorms were examined in depth.

Musica de la Frontera: Research Note on the UCLA Frontera Digital Archive

Science.gov (United States)

Romero, Robert Chao

2005-01-01

The Frontera Digital Archive is an impressive and invaluable research tool for multidisciplinary scholars of Chicana/o studies and Latin American studies. The archive preserves rare Mexican vernacular musical recordings and provides convenient access to these recordings via Internet.

Center for Multiscale Plasma Dynamics: Report on Activities (UCLA/MIT), 2009-2010

Energy Technology Data Exchange (ETDEWEB)

Carter, Troy Alan [Univ. of California, Los Angeles, CA (United States)

2014-10-03

The final “phaseout” year of the CMPD ended July 2010; a no cost extension was requested until May 2011 in order to enable the MIT subcontract funds to be fully utilized. Research progress over this time included verification and validation activities for the BOUT and BOUT++ code, studies of spontaneous reconnection in the VTF facility at MIT, and studies of the interaction between Alfv´en waves and drift waves in LAPD. The CMPD also hosted the 6th plasma physics winter school in 2010 (jointly with the NSF frontier center the Center for Magnetic Self-Organization, significant funding came from NSF for this most recent iteration of theWinter School).

Earthquake and ambient vibration monitoring of the steel-frame UCLA factor building

Science.gov (United States)

Kohler, M.D.; Davis, P.M.; Safak, E.

2005-01-01

Dynamic property measurements of the moment-resisting steel-frame University of California, Los Angeles, Factor building are being made to assess how forces are distributed over the building. Fourier amplitude spectra have been calculated from several intervals of ambient vibrations, a 24-hour period of strong winds, and from the 28 March 2003 Encino, California (ML = 2.9), the 3 September 2002 Yorba Linda, California (ML = 4.7), and the 3 November 2002 Central Alaska (Mw = 7.9) earthquakes. Measurements made from the ambient vibration records show that the first-mode frequency of horizontal vibration is between 0.55 and 0.6 Hz. The second horizontal mode has a frequency between 1.6 and 1.9 Hz. In contrast, the first-mode frequencies measured from earthquake data are about 0.05 to 0.1 Hz lower than those corresponding to ambient vibration recordings indicating softening of the soil-structure system as amplitudes become larger. The frequencies revert to pre-earthquake levels within five minutes of the Yorba Linda earthquake. Shaking due to strong winds that occurred during the Encino earthquake dominates the frequency decrease, which correlates in time with the duration of the strong winds. The first shear wave recorded from the Encino and Yorba Linda earthquakes takes about 0.4 sec to travel up the 17-story building. ?? 2005, Earthquake Engineering Research Institute.

PACS war room for global teleradiology

Science.gov (United States)

Chen, Doris T.; Ho, Bruce K. T.; Chao, Woodrew; Taira, Ricky K.; Kangarloo, Hooshang

1995-05-01

UCLA is beginning teleradiology projects in Latin America, Asian Pacific, and the U.S. The UCLA teleradiology system communicates with remote imaging centers through a T1 based WAN and satellite technology. A network management center, i.e., PACS war room, with graphical user interface allows the system manager to monitor and control different elements of the system through various levels of abstraction from one location. The network manager software can monitor the activities of both hardware and software devices in the remote imaging centers, LAN and WAN performance, telearchiving and teleaccess pattern. Telearchiving can be monitored by graphically indicating large image movements between jukeboxes and over LAN or WAN. Once the teleradiology system is configured, the image flow pattern in a teleradiology center is predictable. Manual intervention of these teleradiology system functions is easily done through menu control in the war room display. A centralized network management with the global view of a teleradiology system has been developed. It can give commands to the elements of the system to tune the system for efficient utilization of the system resources. These managerial functions scale with the teleradiology system which is expandable to include many more potential remote imaging centers.

Patient-based cultural competency curriculum for pre-health professionals.

Science.gov (United States)

Melamed, Esther; Wyatt, Lacey E; Padilla, Tony; Ferry, Robert J

2008-01-01

The diverse US population requires medical cultural competency education for health providers throughout their pre-professional and professional years. We present a curriculum to train pre-health professional undergraduates by combining classroom education in the humanities and cross-cultural communication skills with volunteer clinical experiences at the University of California, Los Angeles (UCLA) hospital. The course was open to a maximum of 15 UCLA junior and senior undergraduate students with a pre-health or humanities major and was held in the spring quarters of 2002--2004. The change in students' knowledge of cultural competency was evaluated using the Provider's Guide to Quality and Culture Quiz (QCQ) and through students' written assignments and evaluations. Trainees displayed a statistically significant improvement in scores on the QCQ. Participants' written assignments and subjective evaluations confirmed an improvement in awareness and a high motivation to continue learning at the graduate level. This is the first evaluated undergraduate curriculum that integrates interdisciplinary cultural competency training with patient volunteering in the medical field. The didactic, volunteering, and writing components of the course comprise a broadly applicable tool for training future health care providers at other institutions.

Functional evaluation of patient after arthroscopic repair of rotator cuff tear.

Science.gov (United States)

Kumar, Rohit; Jadhav, Umesh

2014-06-01

Rotator cuff tear is a common problem either after trauma or after degenerative tear in old age group. Arthroscopic repair is the current concept of rotator cuff repair. Here, we are trying to evaluate the functional outcome after arthroscopic repair of full thickness rotator cuff tear (single row) in Indian population. Twenty five patients (14 males and 11 females) who underwent arthroscopic repair of full thickness rotator cuff tear at a single institution were included in the study. Postoperatively patient's shoulder was rated according to UCLA score, pain was graded according to the visual analog score. The range of motion was analysed and documented. The mean age of the patients were 50.48 years. The preoperative VAS score mode was 7 and post operative VAS was 1 (p value fair in 12% (n = 3), excellent in 8% (n = 2) and poor results were seen in none of the patients. The mean UCLA improved from a score of 15.84 to 30.28 with a p value advantages, hence we used a single row repair considering the Indian population and the cost effectiveness of the surgery with good to excellent results.

Effect of cyclic load on vertical misfit of prefabricated and cast implant single abutment

Science.gov (United States)

DE JESUS TAVAREZ, Rudys Rodolfo; BONACHELA, Wellington Cardoso; XIBLE, Anuar Antônio

2011-01-01

Objective The purpose of this in vitro study was to evaluate misfit alterations at the implant/abutment interface of external and internal connection implant systems when subjected to cyclic loading. Material and Methods Standard metal crowns were fabricated for 5 groups (n=10) of implant/abutment assemblies: Group 1, external hexagon implant and UCLA cast-on premachined abutment; Group 2, internal hexagon implant and premachined abutment; Group 3, internal octagon implant and prefabricated abutment; Group 4, external hexagon implant and UCLA cast-on premachined abutment; and Group 5, external hexagon implant and Ceraone abutment. For groups 1, 2, 3 and 5, the crowns were cemented on the abutments and in group 4 crowns were screwed directly on the implant. The specimens were subjected to 500,000 cycles at 19.1 Hz of frequency and non-axial load of 133 N in a MTS 810 machine. The vertical misfit (μm) at the implant/abutment interface was evaluated before (B) and after (A) application of the cyclic loading. Data were analyzed statistically by using two-away ANOVA and Tukey’s post-hoc test (pabutment connection may develop a role on the vertical misfit at the implant/abutment interface. PMID:21437464

Influence of abutment type and esthetic veneering on preload maintenance of abutment screw of implant-supported crowns.

Science.gov (United States)

Delben, Juliana Aparecida; Barão, Valentim Adelino Ricardo; Dos Santos, Paulo Henrique; Assunção, Wirley Gonçalves

2014-02-01

The effect of veneering materials on screw joint stability remains inconclusive. Thus, this study evaluated the preload maintenance of abutment screws of single crowns fabricated with different abutments and veneering materials. Sixty crowns were divided into five groups (n = 12): UCLA abutment in gold alloy with ceramic (group GC) and resin (group GR) veneering, UCLA abutment in titanium with ceramic (group TiC) and resin (group TiR) veneering, and zirconia abutment with ceramic veneering (group ZiC). Abutment screws made of gold were used with a 35 Ncm insertion torque. Detorque measurements were obtained initially and after mechanical cycling. Data were analyzed by ANOVA and Fisher's exact test at a significance level of 5%. For the initial detorque means (in Ncm), group TiC (21.4 ± 1.78) exhibited statistically lower torque maintenance than groups GC (23.9 ± 0.91), GR (24.1 ± 1.34), and TiR (23.2 ± 1.33) (p abutment type and veneering material. More irregular surfaces in the hexagon area of the castable abutments were observed. The superiority of any veneering material concerning preload maintenance was not established. © 2013 by the American College of Prosthodontists.

[Thinking about vertigo effectiveness evaluation methods in clinical research of Chinese medicine].

Science.gov (United States)

Liu, Hong-mei; Li, Tao

2014-10-01

Vertigo is a kind of patients' subjective feelings. The severity of vertigo is closely related to many factors. But we are short of a well accepted quantitative evaluation method capable of accurately and comprehensively evaluating vertigo in clinics. Reducing the onset of vertigo, enhancing the re- covery of equilibrium function, and improving the quality of life of vertigo patients should be taken as the focus of evaluating therapeutic effects. As for establishing a Chinese medical effectiveness evaluation system for vertigo, we believe we should distinguish different "diseases". We could roughly identify it as systemic vertigo and non-systemic vertigo. For systemic vertigo, the efficacy of vertigo could be comprehensively evaluated by UCLA vertigo questionnaire or dizziness handicap inventory combined with equilibrium function testing indices. But for non-systemic vertigo, the efficacy of vertigo could be comprehensively evaluated by taking UCLA vertigo questionnaire or dizziness handicap inventory as main efficacy indices. Secondly, we should analyze different reasons for vertigo, choose symptoms and signs in line with vertigo features as well as with Chinese medical theories, and formulate corresponding syndrome effectiveness standards according to different diseases. We should not simply take syndrome diagnosis standards as efficacy evaluation standards.

Development of Long-Pulse Heating and Current Drive Actuators and Operational Techniques Compatible with a High-Z Divertor and First Wall

Energy Technology Data Exchange (ETDEWEB)

Wang, Guiding [Univ. of California, Los Angeles, CA (United States)

2017-11-02

Accurate measurement of the edge electron density profile is essential to optimizing antenna coupling and assessment of impurity contamination in studying long-pulse plasma heating and current drive in fusion devices. Measurement of the edge density profile has been demonstrated on the US fusion devices such as C-Mod, DIII-D, and TFTR amongst many devices, and has been used for RF loading and impurity modeling calculations for many years. University of Science and Technology of China (USTC) has recently installed a density profile reflectometer system on the EAST fusion device at the Institute of Plasma Physics, Chinese Academy of Sciences in China based on the University of California Los Angeles (UCLA)-designed reflectometer system on the DIII-D fusion device at General Atomics Company in San Diego, California. UCLA has been working with USTC to optimize the existing microwave antenna, waveguide system, microwave electronics, and data analysis to produce reliable edge density profiles. During the past budget year, progress has been made in all three major areas: effort to achieve reliable system operations under various EAST operational conditions, effort to optimize system performance, and effort to provide quality density profiles into EAST’s database routinely.

Institutional solid waste management practices in developing countries. A case study of three academic institutions in Tanzania

Energy Technology Data Exchange (ETDEWEB)

Mbuligwe, Stephen E. [Faculty of Lands and Environmental Engineering, Department of Environmental Engineering, University College of Lands and Architectural Studies UCLAS, PO Box 35176, Dar es Salaam (Tanzania, United Republic of)

2002-05-01

This paper reports on institutional solid waste management in three Tanzanian institutions. It is noted that there are indeed advantages in managing solid waste at institutional level because of the institutions' unique characteristics that also influence their waste management needs. The paper outlines findings from a yearlong study on institutional solid waste management at three institutions: University of Dar es Salaam (UDSM), University College of Lands and Architectural Studies (UCLAS) and Water Resources Institute (WRI). Surveys and field investigations, including on-site waste measurements and questionnaire surveys were done at UDSM, UCLAS and WRI. The study has revealed, among other things, that per capita waste generation rates, W{sub G} vary between staff and students within each institution as well as among the three institutions. The composition of the waste was found to be predominantly organic in nature, suggesting a strong resource recovery potential in terms of animal feed or production of biogas through anaerobic digestion. Additionally, the W{sub G} was found to vary in line with changes in institutional activities like normal studies, examinations and holidays. The study has shown that resource recovery could greatly enhance solid waste management at the case study institutions.

Outcome and Structural Integrity of Rotator Cuff after Arthroscopic Treatment of Large and Massive Tears with Double Row Technique: A 2-Year Followup

Directory of Open Access Journals (Sweden)

Ignacio Carbonel

2013-01-01

Full Text Available Purpose. The purpose of this study was to evaluate the functional outcome and the tendon healing after arthroscopic double row rotator cuff repair of large and massive rotator cuff tears. Methods. 82 patients with a full-thickness large and massive rotator cuff tear underwent arthroscopic repair with double row technique. Results were evaluated by use of the UCLA, ASES, and Constant questionnaires, the Shoulder Strength Index (SSI, and range of motion. Follow-up time was 2 years. Magnetic resonance imaging (MRI studies were performed on each shoulder preoperatively and 2 years after repair. Results. 100% of the patients were followed up. UCLA, ASES, and Constant questionnaires showed significant improvement compared with preoperatively (P<0.001. Range of motion and SSI in flexion, abduction, and internal and external rotation also showed significant improvement (P<0.001. MRI studies showed 24 cases of tear after repair (29%. Only 8 cases were a full-thickness tear. Conclusions. At two years of followup, in large and massive rotator cuff tears, an arthroscopic double row rotator cuff repair technique produces an excellent functional outcome and structural integrity.

Generalized Disjunctions in (Infinitary) Structural Consequence Relations

Czech Academy of Sciences Publication Activity Database

Cintula, Petr; Noguera, C.

2012-01-01

Roč. 18, č. 3 (2012), s. 442-443 ISSN 1079-8986. [Logic Colloquium 2011. 11.07.2011-16.07.2011, Barcelona] R&D Projects: GA MŠk(CZ) 1M0545 Institutional research plan: CEZ:AV0Z10300504 Keywords : Abstract Algebraic Logic * Generalized disjunction * Proof by cases properties * Consequence relations Subject RIV: BA - General Mathematics http://www.math.ucla.edu/~asl/bsl/1803- toc .htm

Biomarker-Based Prediction Models for Response to Treatment in Systemic Sclerosis-Related Interstitial Lung Disease

Science.gov (United States)

2017-10-01

important inflammatory proteins (a total of 59 proteins) were determined by Myriad Rule Based Medicine . The initial quality control analysis has been...National Institute of Child Health and Human Development UCLA Clinical and Translational Science Institute PREVIOUS, CURRENT AND PENDING...Commitment: No Salary Support* Supporting Agency: NIH/NIAMS - R01-AR062056 (Subcontract from Baylor College of Medicine ) Name and Address of the Funding

The Mediator Effect of Loneliness between Perceived Social Competence and Cyber Bullying in Turkish Adolescents

OpenAIRE

Sarıçam, Hakan; Yaman, Erkan; Çelik, İsmail

2016-01-01

The purpose of this research was to examine whether loneliness might play a mediating role between perceived social competence and cyberbullying in Turkish adolescents. The participants were 326 high school students who completed a questionnaire package that included the Cyberbullying Scale, the Perceived Social Competence Scale, and the UCLA Loneliness Scale. Relationships between loneliness, social competence and cyberbullying were tested using Pearson Product Moment Correlation Coefficient...

Problematic Internet Usage and Immune Function

OpenAIRE

Reed, P.; Vile, R.; Osborne, L.A.; Romano, M.; Truzoli, R.

2015-01-01

Problematic internet use has been associated with a variety of psychological comorbidities, but it relationship with physical illness has not received the same degree of investigation. The current study surveyed 505 participants online, and asked about their levels of problematic internet usage (Internet Addiction Test), depression and anxiety (Hospital Anxiety and Depression Scales), social isolation (UCLA Loneliness Questionnaire), sleep problems (Pittsburgh Sleep Quality Index), and their ...

Wafer Scale Union.

Science.gov (United States)

1992-05-31

injected from the emitter 𔄀D. Olego, T. Y. Chang. E. Silberg . E. A. Caridi. and A Pinczuk. AppI into the base, which results in a large electron current...Environmental Chemistry Division, Brook- haven National Laboratory. From 1977 to 1980 he was a postdoctoral re- B. Bobbs, photograph and biography not available...at the time of publica- search associate in the Chemistry Department at UCLA. tion. ......

Bone integration capability of nanopolymorphic crystalline hydroxyapatite coated on titanium implants

OpenAIRE

Ogawa, Takahiro; Yamada,Masahiro; Ueno,; Tsukimura,Naoki; Ikeda,; Nakagawa,; Hori,; Suzuki,

2012-01-01

Masahiro Yamada*, Takeshi Ueno*, Naoki Tsukimura, Takayuki Ikeda, Kaori Nakagawa, Norio Hori, Takeo Suzuki, Takahiro OgawaLaboratory of Bone and Implant Sciences, The Weintraub Center for Reconstructive Biotechnology, Division of Advanced Prosthodontics, Biomaterials and Hospital Dentistry, UCLA School of Dentistry, Los Angeles, CA, USA *These authors contributed equally to this workAbstract: The mechanism by which hydroxyapatite (HA)-coated titanium promotes bone–implant integratio...

Antithrombotic strategies in patients undergoing percutaneous coronary intervention for acute coronary syndrome

Directory of Open Access Journals (Sweden)

Son V Pham

2010-09-01

Full Text Available Son V Pham1, Phuong-Chi T Pham2, Phuong-Mai T Pham3, Jeffrey M Miller4, Phuong-Thu T Pham5, Phuong-Anh T Pham61Bay Pines VA Medical Center, Department of Cardiology, Bay Pines, FL, USA; 2Department of Medicine, Nephrology Division, UCLA-Olive View Medical Center, 3Department of Medicine, Greater Los Angeles VA Medical Center, 4Department of Medicine, Hematology-Oncology Division, UCLA-Olive View Medical Center, 5Department of Medicine, Nephrology Division, Kidney and Pancreas Transplant Program, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 6Mercy General Hospital, Heart and Vascular Institute, Department of Cardiology, Sacramento, CA, USAAbstract: In patients undergoing percutaneous coronary intervention (PCI for acute coronary syndrome (ACS, both periprocedural acute myocardial infarction and bleeding complications have been shown to be associated with early and late mortality. Current standard antithrombotic therapy after coronary stent implantation consists of lifelong aspirin and clopidogrel for a variable period depending in part on the stent type. Despite its well-established efficacy in reducing cardiac-related death, myocardial infarction, and stroke, dual antiplatelet therapy with aspirin and clopidogrel is not without shortcomings. While clopidogrel may be of little beneficial effect if administered immediately prior to PCI and may even increase major bleeding risk if coronary artery bypass grafting is anticipated, early discontinuation of the drug may result in insufficient antiplatelet coverage with thrombotic complications. Optimal and rapid inhibition of platelet activity to suppress ischemic and thrombotic events while minimizing bleeding complications is an important therapeutic goal in the management of patients undergoing percutaneous coronary intervention. In this article we present an overview of the literature on clinical trials evaluating the different aspects of antithrombotic therapy in patients

Screening strategies and predictive diagnostic tools for the development of new-onset diabetes mellitus after transplantation: an overview

Directory of Open Access Journals (Sweden)

Pham PT

2012-10-01

Full Text Available Phuong-Thu T Pham,1 Kari L Edling,2 Harini A Chakkera,3 Phuong-Chi T Pham,4 Phuong-Mai T Pham51Department of Medicine, Nephrology Division, Kidney Transplant Program, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 2Department of Medicine, Division of Endocrinology, Diabetes and Hypertension, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 3Department of Medicine, Nephrology Division Kidney Transplant Program, Mayo Clinic Hospital, Phoenix, AZ, USA; 4Department of Medicine, Nephrology Division, UCLA-Olive View Medical Center, Sylmar, CA, USA; 5Department of Medicine, Greater Los Angeles, Veterans Administration Health Care System, CA, USAAbstract: New-onset diabetes mellitus after transplantation (NODAT is a serious and common complication following solid organ transplantation. NODAT has been reported in 2% to 53% of all solid organ transplants. Kidney transplant recipients who develop NODAT have variably been reported to be at increased risk of fatal and nonfatal cardiovascular events and other adverse outcomes including infection, reduced patient survival, graft rejection, and accelerated graft loss compared with those who do not develop diabetes. Limited clinical studies in liver, heart, and lung transplants similarly suggested that NODAT has an adverse impact on patient and graft outcomes. Early detection and management of NODAT must, therefore, be integrated into the treatment of transplant recipients. Studies investigating the best screening or predictive tool for identifying patients at risk for developing NODAT early after transplantation, however, are lacking. We review the clinical predictive values of fasting plasma glucose, oral glucose tolerance test, and A1C in assessing the risk for NODAT development and as a screening tool. Simple diabetes prediction models that incorporate clinical and/or metabolic risk factors (such as age, body mass index, hypertriglyceridemia, or metabolic syndrome are also

TREATMENT FOR ACUTE PHARYNGITIS AND TONSILLOPHARYNGITIS AMONG SICKLY CHILDREN

Directory of Open Access Journals (Sweden)

G.A. Samsygina

2007-01-01

Full Text Available Among the sickly children, pharyngitis and tonsillopharyngitis are quite often accompanied by pain and scratch in a throat, which is anguished for a child themselves and causes parents to worry. In the therapy for the indicated pathology, a certain place is held by a local antibiotic fusafungine. In the article, the author studies the effects of fusafungine on tonsillitis/tonsillopharyngitis and pharyngitis, running with pain in a throat, among the sickly children aged between 3 and 15. The research was carried on in 42 centers of different Russian regions and became a part of the multicentered research according to «Chibis» program. 2,609 children were examined, 1,907 of who Received fusafungine and 702 children did not. Among 78,1% of the children, the authors noted the phenomena of pharyngitis, rhinopharyngitis and acute tonsillopharyngitis. As the research showed the symptoms of rhinopharyngitis and tonsillopharync gitis were reliably arrested much faster, when applying fusafungine, thus, the clinical effects mostly emerged after 4th–5th day of the therapy. The acquired data allowed one to recommend the inclusion of fusafungine into the therapy for acute rhinopharyngitis, pharyngitis and tonsillopharyngitis among the sickly children.Key words: rhinopharyngitis, pharyngitis, tonsillopharyngitis, fusafungine, children, treatment.

Tests of industrial ethylene-propylene rubber high voltage cable for cryogenic use

CERN Document Server

Balhan, B; Goddard, B; Muratori, G; Otwinowski, S; Rieubland, Jean Michel; Wang, H; CERN. Geneva. SPS and LEP Division

1999-01-01

At the beginning of 1999 UCLA has received a prototype High Voltage Cryogenic Cable supplied fee of charge by Pirelli. The cable is intended for more than ten years of service at 100 kV D.C. and liquid argon temperature. Thecable uses an all welded construction, whichi is axially tight and free of ionizable voids. The cable was submitted to a number of mechanical and electrical tests as described below.

Measurement of observables in the pion-nucleon system and investigation of charge symmetry in 3H and 3He

International Nuclear Information System (INIS)

Sadler, M.E.; Isenhower, L.D.

1990-01-01

The LAMPF experiments have been performed in collaboration with UCLA, George Washington University, various groups at Los Alamos, and Catholic University. This paper discusses: a complete set of observables in the pion-nucleon system in the momentum interval 400-700 MeV/c; differential cross sections at low energy for pion-nucleon charge exchange; and elastic and inelastic scattering of π ± on 3 H and 3 He

Vector Fluxgate Magnetometer (VMAG) Development for DSX

Science.gov (United States)

2010-06-03

AFRL-RV-HA-TR-2010-1056 Vector Fluxgate Magnetometer (VMAG) Development for DSX Mark B. Moldwin UCLA Institute of Geophysics... Fluxgate Magnetometer (VMAG) Development for DSX 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 62601F 6. AUTHOR(S) Mark B. Moldwin 5d. PROJECT...axis fluxgate magnetometer for the AFRL-mission. The instrument is designed to measure the medium-Earth orbit geomagnetic field with precision of 0.1

American Indian Access to Department of Defense Facilities: Source Documents and Bibliography (Legacy Resource Management Program)

Science.gov (United States)

1993-09-01

who under the terms of the Archeological and Historic Preservation Act must respond within 48 hours of notification. The DCA may render an immediate...1965 The Surviving Chumash. UCLA Archaeological Survey Annual Reports 65:277-302. Grant, Campbell 1973a Chuirash: Introduction. In R.F. Heizer , ed...Coastal Chumash. In R.F. Heizer , et., California. Volume 8, Handbook of North American"Indians, William C. Sturtevant, General Editor. Washington

TiO2 micro-nano-hybrid surface to alleviate biological aging of UV-photofunctionalized titanium

OpenAIRE

Iwasa F; Tsukimura N; Sugita Y, Kanuru RK; Kubo K; Hasnain H; Att W; Ogawa T

2011-01-01

Fuminori Iwasa1, Naoki Tsukimura1, Yoshihiko Sugita1, Rajita Kodali Kanuru1, Katsutoshi Kubo1, Hafiz Hasnain1, Wael Att1,2, Takahiro Ogawa11Laboratory of Bone and Implant Sciences (LBIS), The Weintraub Center for Reconstructive Biotechnology, Division of Advanced Prosthodontics, Biomaterials and Hospital Dentistry, UCLA School of Dentistry, Los Angeles, CA, USA; 2Department of Prosthodontics, Dental School, Albert-Ludwigs University, Freiburg, GermanyAbstract: Bioactivity and osteoconductivit...

Time domain structures in a colliding magnetic flux rope experiment

Science.gov (United States)

Tang, Shawn Wenjie; Gekelman, Walter; Dehaas, Timothy; Vincena, Steve; Pribyl, Patrick

2017-10-01

Electron phase-space holes, regions of positive potential on the scale of the Debye length, have been observed in auroras as well as in laboratory experiments. These potential structures, also known as Time Domain Structures (TDS), are packets of intense electric field spikes that have significant components parallel to the local magnetic field. In an ongoing investigation at UCLA, TDS were observed on the surface of two magnetized flux ropes produced within the Large Plasma Device (LAPD). A barium oxide (BaO) cathode was used to produce an 18 m long magnetized plasma column and a lanthanum hexaboride (LaB6) source was used to create 11 m long kink unstable flux ropes. Using two probes capable of measuring the local electric and magnetic fields, correlation analysis was performed on tens of thousands of these structures and their propagation velocities, probability distribution function and spatial distribution were determined. The TDS became abundant as the flux ropes collided and appear to emanate from the reconnection region in between them. In addition, a preliminary analysis of the permutation entropy and statistical complexity of the data suggests that the TDS signals may be chaotic in nature. Work done at the Basic Plasma Science Facility (BaPSF) at UCLA which is supported by DOE and NSF.

Quality of Life and Psychosocial Implications in Patients with Hidradenitis Suppurativa.

Science.gov (United States)

Kouris, Anargyros; Platsidaki, Eftychia; Christodoulou, Christos; Efstathiou, Vasiliki; Dessinioti, Clio; Tzanetakou, Vasiliki; Korkoliakou, Panagiota; Zisimou, Chrisa; Antoniou, Christina; Kontochristopoulos, George

2016-01-01

Hidradenitis suppurativa (HS) is a long-term skin disorder associated with high levels of psychological distress and significant life impact. To evaluate the quality of life, depression, anxiety, loneliness, and self-esteem in patients with HS. Ninety-four patients with HS were enrolled in the study. The quality of life, depression, anxiety, loneliness, and self-esteem of the patients were assessed using the Dermatology Life Quality Index (DLQI), the Hospital Anxiety and Depression Scale (HADS), the UCLA Loneliness Scale (UCLA-Version 3), and the Rosenberg Self-Esteem Scale (RSES), respectively. The DLQI mean score was 11.43 ± 6.61 in patients with HS. The patients with HS presented statistically significantly higher anxiety (6.41 ± 3.31 vs. 5.00 ± 1.59, p loneliness and social isolation scores (42.86 ± 8.63 vs. 35.57 ± 6.17, p < 0.001) and lower self-esteem scores (18.91 ± 1.79 vs. 19.77 ± 2.53, p = 0.008) than the healthy controls. HS is a distressing, recurrent disease that impairs quality of life. We can suggest services that allow an integrated approach, which includes psychosocial support, offering the patients relief from isolation and an opportunity to share common experiences. © 2017 S. Karger AG, Basel.

Fracture resistance of abutment screws made of titanium, polyetheretherketone, and carbon fiber-reinforced polyetheretherketone

Directory of Open Access Journals (Sweden)

Eduardo Aloisio Fleck NEUMANN

2014-08-01

Full Text Available Fractured abutment screws may be replaced; however, sometimes, the screw cannot be removed and the entire implant must be surgically removed and replaced. The aim of this study was to compare the fracture resistance of abutment retention screws made of titanium, polyetheretherketone (PEEK and 30% carbon fiber-reinforced PEEK, using an external hexagonal implant/UCLA-type abutment interface assembly. UCLA-type abutments were fixed to implants using titanium screws (Group 1, polyetheretherketone (PEEK screws (Group 2, and 30% carbon fiber-reinforced PEEK screws (Group 3. The assemblies were placed on a stainless steel holding apparatus to allow for loading at 45o off-axis, in a universal testing machine. A 200 N load (static load was applied at the central point of the abutment extremity, at a crosshead speed of 5 mm/minute, until failure. Data was analyzed by ANOVA and Tukey’s range test. The titanium screws had higher fracture resistance, compared with PEEK and 30% carbon fiber-reinforced PEEK screws (p 0.05. Finally, visual analysis of the fractions revealed that 100% of them occurred at the neck of the abutment screw, suggesting that this is the weakest point of this unit. PEEK abutment screws have lower fracture resistance, in comparison with titanium abutment screws.

Fracture resistance of abutment screws made of titanium, polyetheretherketone, and carbon fiber-reinforced polyetheretherketone.

Science.gov (United States)

Neumann, Eduardo Aloisio Fleck; Villar, Cristina Cunha; França, Fabiana Mantovani Gomes

2014-01-01

Fractured abutment screws may be replaced; however, sometimes, the screw cannot be removed and the entire implant must be surgically removed and replaced. The aim of this study was to compare the fracture resistance of abutment retention screws made of titanium, polyetheretherketone (PEEK) and 30% carbon fiber-reinforced PEEK, using an external hexagonal implant/UCLA-type abutment interface assembly. UCLA-type abutments were fixed to implants using titanium screws (Group 1), polyetheretherketone (PEEK) screws (Group 2), and 30% carbon fiber-reinforced PEEK screws (Group 3). The assemblies were placed on a stainless steel holding apparatus to allow for loading at 45o off-axis, in a universal testing machine. A 200 N load (static load) was applied at the central point of the abutment extremity, at a crosshead speed of 5 mm/minute, until failure. Data was analyzed by ANOVA and Tukey's range test. The titanium screws had higher fracture resistance, compared with PEEK and 30% carbon fiber-reinforced PEEK screws (p 0.05). Finally, visual analysis of the fractions revealed that 100% of them occurred at the neck of the abutment screw, suggesting that this is the weakest point of this unit. PEEK abutment screws have lower fracture resistance, in comparison with titanium abutment screws.

Is overprotection a different construct of social support?

Directory of Open Access Journals (Sweden)

Victoria Permuy

2014-07-01

Full Text Available The aim of this article is to contribute to a better definition of the overprotection construct. More specifically, it aims at establishing whether or not it can be considered just an excess of social support. To do this, two instruments, OPSA and UCLA-SSI, developed from different perspectives on the issue, were translated and adapted from English into Spanish. Analysis performed on a diverse sample of 436 subjects show a good reliability of scores obtained with the Spanish versions, as much on the OPSA test (α = .82 with the full format and α = .81 with the short one as on the two selected subscales of the UCLA-SSI test (α = .88 with Need/ Want Support subscale, and α = .90 with the Support Received subscale. The relationship among the different measurements was analyzed in a typical sample of 50 recent myocardial infarction patients, as usual in this field. Results suggest that overprotection differs both in quality and quantity from given social support, but it is however related to needed social support. This new finding seems to indicate that those individuals who are more in need of social support could indeed be the more overprotected ones. Clinical and educational implications of the results are discussed.

POSTEROSUPERIOR SURGICAL ACCESS ROUTE FOR TREATMENT OF ACROMIOCLAVICULAR DISLOCATIONS: RESULTS FROM 84 SURGICAL CASES.

Science.gov (United States)

Dal Molin, Danilo Canesin; Ribeiro, Fabiano Rebouças; Filho, Rômulo Brasil; Filardi, Cantídio Salvador; Tenor, Antonio Carlos; Stipp, Willian Nandi; Petros, Rodrigo Souto Borges

2012-01-01

To evaluate the results from surgical treatment of 84 cases of acute acromioclavicular dislocation, using a posterosuperior access route. Eighty-four cases of acute acromioclavicular dislocation (grade III in the Allman-Tossy classification) operated between November 2002 and May 2010 were evaluated. The patients' mean age was 34 years. The diagnoses were made using clinical and radiographic evaluations. The patients were operated by the same surgical team, within three weeks of the date of the trauma, using a posterosuperior approach to the shoulder to access the top of the base of the coracoid process for placement of two anchors, which were used in reducing the dislocation. The minimum follow-up was 12 months. The postoperative clinical-radiographic evaluation was done using the modified Karlsson criteria and the University of California at Los Angeles (UCLA) score. 92.8% of the 84 patients treated presented good or excellent results, and 7.2% presented fair or poor results, using the UCLA assessment score. According to the modified Karlsson criteria, 76.2% were assessed as grade A, 17.9% as grade B and 5.9% as grade C. The posterosuperior access route to the shoulder is a new option for accessing the coracoid process and treating acromioclavicular dislocation, with clinical and radiographic results equivalent to those in the literature.

A SOLIDÃO EM UTILIZADORES PORTUGUESES DO FACEBOOK

Directory of Open Access Journals (Sweden)

Paula Cristina Simões da Silva de Castro Reis

2016-08-01

Full Text Available Resumo Sendo o Facebook a rede social mais utilizada no nosso país, a pretensão deste estudo é compreender se esta atividade interfere nas amizades pessoais dos seus utilizadores, contribuindo para que os indivíduos se distanciem uns dos outros, conduzindo ao isolamento e, consequentemente, à solidão. Assim, torna-se pertinente avaliar se os indivíduos que passam mais tempo nas redes sociais percecionam níveis mais elevados de solidão, comparativamente aos que despendem menos tempo. A população deste estudo é constituída por utilizadores do Facebook, de nacionalidade portuguesa, com mais de 18 anos, sendo a amostra aleatória simples e constituída por 201 elementos de ambos os sexos. Foram aplicados um questionário sociodemográfico, um questionário relacionado com a utilização do Facebook e a Escala de Solidão da UCLA- Revised UCLA Loneliness Scale. Os dados mais significativos deste estudo prendem-se com um perfil de utilizador encontrado, bem como a constatação de maiores níveis de solidão em utilizadores que despendem mais tempo no Facebook.

UCLA program in theory and modeling of edge physics and plasma material interaction

International Nuclear Information System (INIS)

Conn, R.W.; Najmabadi, F.; Grossman, A.; Merriman, B.; Day, M.

1992-01-01

Our research activity in edge plasma modeling is directed towards understanding edge plasma behavior and towards innovative solutions for controlling the edge plasma as well as the design and operation of impurity control, particle exhaust. and plasma facing components. During the last nine months, substantial progress was made in many areas. The highlights are: (A) Development of a second-generation edge-plasma simulation code (Section II); (B) Development of models for gas-target divertors, including a 1 1/2-D fluid model for plasma and Monte Carlo neutral-transport simulations (Section III); and (C) Utilization of the RF ponderomotive force and electrostatic biasing to distribute the heat load on a larger area of the divertor plate, and the development of analytical and numerical transport models that include both ponderomotive and electrostatic potentials

International Conference on Multiscale Methods and Partial Differential Equations.

Energy Technology Data Exchange (ETDEWEB)

Thomas Hou

2006-12-12

The International Conference on Multiscale Methods and Partial Differential Equations (ICMMPDE for short) was held at IPAM, UCLA on August 26-27, 2005. The conference brought together researchers, students and practitioners with interest in the theoretical, computational and practical aspects of multiscale problems and related partial differential equations. The conference provided a forum to exchange and stimulate new ideas from different disciplines, and to formulate new challenging multiscale problems that will have impact in applications.

Effect of cyclic load on vertical misfit of prefabricated and cast implant single abutment

OpenAIRE

de Jesus Tavarez, Rudys Rodolfo; Bonachela, Wellington Cardoso; Xible, Anuar Antônio

2011-01-01

OBJECTIVES: The purpose of this in vitro study was to evaluate misfit alterations at the implant/abutment interface of external and internal connection implant systems when subjected to cyclic loading. MATERIAL AND METHODS: Standard metal crowns were fabricated for 5 groups (n=10) of implant/abutment assemblies: Group 1, external hexagon implant and UCLA cast-on premachined abutment; Group 2, internal hexagon implant and premachined abutment; Group 3, internal octagon implant and prefabricate...

A high luminosity superconducting mini collider for Phi meson production and particle beam physics

International Nuclear Information System (INIS)

Pellegrini, C.; Robin, D.; Cline, D.; Kolonko, J.; Anderson, C.; Barletta, W.; Chargin, A.; Cornacchia, M.; Dalbacka, G.; Halbach, K.; Lueng, E.; Kimball, F.; Madura, D.; Patterson, L.

1991-01-01

A 510MeV electron-positron collider has been proposed at UCLA to study particle beam physics and Phi-Meson physics, at luminosities larger than 10 32 cm -2 s -1 . The collider consists of a single compact superconducting storage ring (SMC), with bending field of 4 T and a current larger than 1 A. The authors discuss the main characteristics of this system and its major technical components: superconducting dipoles, RF, vacuum, injection

Characterization and evolution of dermal filaments from patients with Morgellons disease

OpenAIRE

Middelveen, Marianne J; Mayne, Peter J; Kahn, Douglas G; Stricker, Raphael B

2013-01-01

Marianne J Middelveen,1 Peter J Mayne,1 Douglas G Kahn,2 Raphael B Stricker11International Lyme and Associated Diseases Society, Bethesda, MD, USA; 2Department of Pathology, Olive View–UCLA Medical Center, Sylmar, CA, USAAbstract: Morgellons disease is an emerging skin disease characterized by formation of dermal filaments associated with multisystemic symptoms and tick-borne illness. Some clinicians hypothesize that these often colorful dermal filaments are textile fibers, either s...

Droplet Combustion and Non-Reactive Shear-Coaxial Jets with Transverse Acoustic Excitation

Science.gov (United States)

2012-06-01

for this. Recent studies at UCLA and at NASA Glenn Research Center by Dattarajan et al. [20, 21] have focused on methanol droplet combustion...via Trek PZD2000A high-voltage amplifiers, to each piezo-siren. The waveform generators output signals were locked in frequency. However, their phase...1.3. Verify the wire on Channel 1 of the Tenma oscilloscope (Model No. 72-6800) comes from the output voltage monitor on the Trek -1 amplifier

Documented Evidence of Employment Discrimination & Its Effects on LGBT People

OpenAIRE

Sears, Brad; Mallory, Christy

2011-01-01

Although sexual orientation and gender identity have no relationship to workplace performance, during the past four decades a large body of research using a variety of methodologies has consistently documented high levels of discrimination against lesbians, gay men, bisexuals and transgendered (LGBT) people at work. Evidence of discrimination has been reviewed and summarized in two recent reports by the Williams Institute at UCLA School of Law: a 2009 report focused on discrimination in the p...

INFORMACION ASIMETRICA Y ACTIVOS ESPECIFICOS EN LA AGRICULTURA ORGANICA: UNA INTERPRETACION NEOINSTITUCIONAL

OpenAIRE

Alejua, Hilda Yelitza; Lopez, Ricardo Castillo

2005-01-01

INFORMACION ASIMETRICA Y ACTIVOS ESPECIFICOS EN LA AGRICULTURA ORGANICA: UNA INTERPRETACION NEOINSTITUCIONAL Hilda Alejua y Ricardo Castillo Docentes Investigadores del Decanato de Ingeniería Agronómica de la Universidad Centroccidental Lisandro Alvarado UCLA. Venezuela , Introducción: El objetivo de la presente investigación es analizar las posibles consecuencias de la información asimétrica y los activos específicos en las actividades económicas relacionada...

Fighting Proliferation New Concerns for the Nineties,

Science.gov (United States)

1996-09-01

assuming this dominates the error in measuring material unaccounted for [ MUFI ) and with a material-balance calculation done once a year, the absolute value...defenses, the Soviet economy, and the Salvadoran land-reform program. Dr Blair, who earned a BA in mathematics from the University of Tennessee and a PhD...California, Berkeley; and UCLA. Dr Weiss is the author of numerous technical papers on various aspects of applied mathematics , especially automatic control

The Art of Life: An Ancient Idea and Its Survival

Directory of Open Access Journals (Sweden)

Tieleman, Teun

2008-06-01

Full Text Available Teun Tieleman (UCLA / Utrecht University surveys the history of the philosophical notion of the ‘art of life’, starting from its originator Socrates and his ancient successors down to its role among present-day philosophers. Apart from Socrates, special attention is given to the Stoics, Nietzsche and Foucault. The way in which the notion was (redefined and functioned throughout the history of philosophy reveals an exceptionally fruitful interplay between continuity and originality.

Trygve Haavelmo and the Emergence of Causal Calculus

Science.gov (United States)

2014-06-01

Department, Los Angeles, CA, 90095-1596, USA ; e-mail: judea@cs.ucla.edu. c© Cambridge University Press 2014 1 Published online: 10 June 2014...Is this employer guilty of gender discrimination? Formally, each query Qi ∈ Q should be computable from a fully speci- fied theoretical model M in...Pearl, 2006) and cyclic (Phiromswad and Hoover, 2013) models. The instrumental inequality (Pearl, 2009a, p. 279) and tight bounds on the binary Roy

Multichannel far-infrared phase imaging for fusion plasmas

International Nuclear Information System (INIS)

Young, P.E.; Neikirk, D.P.; Tong, P.P.; Rutledge, D.B.; Luhmann, N.C. Jr.

1985-01-01

A 20-channel far-infrared imaging interferometer system has been used to obtain single-shot density profiles in the UCLA Microtor tokamak. This system differs from conventional multichannel interferometers in that the phase distribution produced by the plasma is imaged onto a single, monolithic, integrated microbolometer linear detector array and provides significantly more channels than previous far-infrared interferometers. The system has been demonstrated to provide diffraction-limited phase images of dielectric targets

Affect Labeling: A Promising New Approach for Mitigating PTSD

Science.gov (United States)

2016-02-12

effects and contraindications (Becker et al., 2004). Barriers associated with pharmacological treatments are equal if not greater and include resistance...0056 20 MRI scanning. (2) Ps must not have been claustrophobic in order to be able to complete all fMRI procedures. (3) Ps must not have been...aversive combat stimuli. Image Acquisition. Imaging data were acquired via a Siemens Tim Trio 3 tesla MRI scanner at the UCLA Staglin Center for

Hollow cathode for positive ion sources

International Nuclear Information System (INIS)

Schechter, D.E.; Kim, J.; Tsai, C.C.

1979-01-01

Development to incorporate hollow cathodes into high power ion sources for neutral beam injection systems is being pursued. Hollow tube LaB 6 -type cathodes, similar to a UCLA design, have been constructed and tested in several ORNL ion source configurations. Results of testing include arc discharge parameters of >1000 and 500 amps for 0.5 and 10 second pulse lengths, respectively. Details of cathode construction and additional performance results are discussed

Estimating cigarette tax avoidance and evasion: evidence from a national sample of littered packs.

Science.gov (United States)

Barker, Dianne C; Wang, Shu; Merriman, David; Crosby, Andrew; Resnick, Elissa A; Chaloupka, Frank J

2016-10-01

A number of recent studies document the proportion of all cigarette packs that are 'contraband' using discarded packs to measure tax avoidance and evasion, which we call tax non-compliance. To date, academic studies using discarded packs focused on relatively small geographical areas such as a city or a neighbourhood. We visited 160 communities across 38 US states in 2012 and collected data from littered cigarette packs as part of the State and Community Tobacco Control (SCTC) Research Initiative and the Bridging the Gap Community Obesity Measures Project (BTG-COMP). Data collectors were trained in a previously tested littered pack data collection protocol. Field teams collected 2116 packs with cellophane across 132 communities. We estimate a national tax non-compliance rate of 18.5% with considerable variation across regions. Suburban areas had lower non-compliance than urban areas as well as areas with high and low median household income areas compared with middle income areas. We present the first academic national study of tax non-compliance using littered cigarette packs. We demonstrate the feasibility of meaningful large-scale data collection using this methodology and document considerable variation in tax non-compliance across areas, suggesting that both policy differences and geography may be important in control of illicit tobacco use. Given the geography of open borders among countries with varying tax rates, this simple methodology may be appropriate to estimate tax non-compliance in countries that use tax stamps or other pack markings, such as health warnings. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

Videoarthroscopic treatment of glenohumeral osteoarthritis Tratamento Videoartroscópico da Osteoartrite Glenoumeral

Directory of Open Access Journals (Sweden)

Glaydson Gomes Godinho

2013-01-01

Full Text Available OBJECTIVE: To evaluate possible benefits obtained through the use of surgical videoarthroscopy in the management of glenohumeral osteoarthritis. METHODS: We evaluated 37 patients (38 shoulders who underwent through surgical videoarthroscopy in the period between November 1999 and May 2009 (minimum follow-up of two years. Twenty five patients attend for revaluation and thirteen were interviewed by telephonic contact. Functional assessments were performed (UCLA, Constant, and measurement of range of motion -ROM-, as well as pre and post surgical radiographics. We evaluated the influence of the following factors in the final results: the presence of chondral lesions, joint space narrowing, osteophyte presence, associated injuries (rotator cuff torn or instability, and follow-up. Among those patients interviewed by phone we evaluated the satisfaction level and if they would submit themselves again to the surgical procedure. RESULTS: It was observed significant gain towards to the function (UCLA and the internal rotation, as well as the association between dissatisfaction and pre surgical joint space reduced. Among the operated patients, 84% were satisfied with the results and 86.6% would repeat the procedure. CONCLUSION: Surgical videoarthroscopy presents a relevant role in management of the glenohumeral osteoarthritis, providing improvement of functional results and high levels of satisfaction. OBJETIVO: Avaliar possíveis benefícios obtidos mediante o uso da videoartroscopia cirúrgica no tratamento da osteoartrite glenoumeral. MÉTODOS: Avaliamos 37 pacientes (38 ombros submetidos à vídeoartroscopia cirúrgica no período compreendido entre novembro de 1999 e maio de 2009 (seguimento mínimo de dois anos. Compareceram para reavaliação 25 pacientes e 13 foram entrevistados por contato telefônico. Foram feitas avaliações funcionais (UCLA, Constant, e aferição da Amplitude de Movimento *[ADM], assim como estudo radiográfico pré e p

How smartphone usage correlates with social anxiety and loneliness

Directory of Open Access Journals (Sweden)

Yusong Gao

2016-07-01

Full Text Available Introduction: Early detection of social anxiety and loneliness might be useful to prevent substantial impairment in personal relationships. Understanding the way people use smartphones can be beneficial for implementing an early detection of social anxiety and loneliness. This paper examines different types of smartphone usage and their relationships with people with different individual levels of social anxiety or loneliness. Methods: A total of 127 Android smartphone volunteers participated in this study, all of which have agreed to install an application (MobileSens on their smartphones, which can record user’s smartphone usage behaviors and upload the data into the server. They were instructed to complete an online survey, including the Interaction Anxiousness Scale (IAS and the University of California Los Angeles Loneliness Scale (UCLA-LS. We then separated participants into three groups (high, middle and low based on their scores of IAS and UCLA-LS, respectively. Finally, we acquired digital records of smartphone usage from MobileSens and examined the differences in 105 types of smartphone usage behaviors between high-score and low-score group of IAS/UCLA-LS. Results: Individuals with different scores on social anxiety or loneliness might use smartphones in different ways. For social anxiety, compared with users in low-score group, users in high-score group had less number of phone calls (incoming and outgoing (Mann-Whitney U = 282.50∼409.00, p U = 388.50, p < 0.01. Discussion: The results show that individuals with social anxiety or loneliness receive less incoming calls and use healthy applications more frequently, but they do not show differences in outgoing-call-related features. Individuals with higher levels of social anxiety also receive less SMSs and use camera apps less frequently, while lonely individuals tend to use system, beautify, browser and social media (RenRen apps more frequently. Conclusion: This paper finds that

How smartphone usage correlates with social anxiety and loneliness.

Science.gov (United States)

Gao, Yusong; Li, Ang; Zhu, Tingshao; Liu, Xiaoqian; Liu, Xingyun

2016-01-01

Early detection of social anxiety and loneliness might be useful to prevent substantial impairment in personal relationships. Understanding the way people use smartphones can be beneficial for implementing an early detection of social anxiety and loneliness. This paper examines different types of smartphone usage and their relationships with people with different individual levels of social anxiety or loneliness. A total of 127 Android smartphone volunteers participated in this study, all of which have agreed to install an application (MobileSens) on their smartphones, which can record user's smartphone usage behaviors and upload the data into the server. They were instructed to complete an online survey, including the Interaction Anxiousness Scale (IAS) and the University of California Los Angeles Loneliness Scale (UCLA-LS). We then separated participants into three groups (high, middle and low) based on their scores of IAS and UCLA-LS, respectively. Finally, we acquired digital records of smartphone usage from MobileSens and examined the differences in 105 types of smartphone usage behaviors between high-score and low-score group of IAS/UCLA-LS. Individuals with different scores on social anxiety or loneliness might use smartphones in different ways. For social anxiety, compared with users in low-score group, users in high-score group had less number of phone calls (incoming and outgoing) (Mann-Whitney U = 282.50∼409.00, p social media (RenRen) (Mann-Whitney >U = 388.50, p social anxiety or loneliness receive less incoming calls and use healthy applications more frequently, but they do not show differences in outgoing-call-related features. Individuals with higher levels of social anxiety also receive less SMSs and use camera apps less frequently, while lonely individuals tend to use system, beautify, browser and social media (RenRen) apps more frequently. This paper finds that there exists certain correlation among smartphone usage and social anxiety and

Nuclear systems and testing programs for ITER. Progress report for FY 1998

International Nuclear Information System (INIS)

1998-01-01

The effort during this performance period focused on a number of TBWG activities (including test module design and analysis) that were identified and agreed upon (in the presence of the ITER Director and Deputy Director) at TBWG-4. These include: (a) DEMO test module design and performance analysis under pulsed operation; (b) Test program operation plan; (c) Test port design and analysis; (d) Decay heat calculations and safety analysis; (e) Further discussion among the parties to define collaboratory on R and D for the test program as well as possible collaboration on the construction and operation of test articles; (f) Remote handling and ancillary equipment; (g) Criteria for qualifying a blanket module or submodule for actual insertion and testing in ITER; (h) Definition of test module instrumentation and verification of capability to perform in the ITER fusion environment (magnetic field, radiation, heating, etc.); and (i) Analysis to show that the results to be obtained from the test modules as designed can be extrapolated to DEMO and reactor conditions (e.g., higher wall loads and the need to demonstrate tritium self-sufficiency). The main achievements during this performance period include: (1) updating and finalizing the US DDDs for the ITER Blanket Program to form part of the ITER Final Design Report (FDR). Specific revisions were in response to the minimal lithium volume test blanket design requirements and safety impact and (2) evaluating the feasibility of the US test program, including instrumentation and the benefits of the ITER test program. Details of this assessment, including solid breeder and liquid breeder blanket test plans, are documented in UCLA-IFNT-13 (attached). In addition, dose mapping calculations were performed for the ITER Building, including equipment and layout of coolant pipes/heat exchangers. A report on ITER Building dose calculations was sent to UD ITER management and to the Garching Task Coordinator in April, 1998. The report

How smartphone usage correlates with social anxiety and loneliness

Science.gov (United States)

Liu, Xiaoqian; Liu, Xingyun

2016-01-01

Introduction: Early detection of social anxiety and loneliness might be useful to prevent substantial impairment in personal relationships. Understanding the way people use smartphones can be beneficial for implementing an early detection of social anxiety and loneliness. This paper examines different types of smartphone usage and their relationships with people with different individual levels of social anxiety or loneliness. Methods: A total of 127 Android smartphone volunteers participated in this study, all of which have agreed to install an application (MobileSens) on their smartphones, which can record user’s smartphone usage behaviors and upload the data into the server. They were instructed to complete an online survey, including the Interaction Anxiousness Scale (IAS) and the University of California Los Angeles Loneliness Scale (UCLA-LS). We then separated participants into three groups (high, middle and low) based on their scores of IAS and UCLA-LS, respectively. Finally, we acquired digital records of smartphone usage from MobileSens and examined the differences in 105 types of smartphone usage behaviors between high-score and low-score group of IAS/UCLA-LS. Results: Individuals with different scores on social anxiety or loneliness might use smartphones in different ways. For social anxiety, compared with users in low-score group, users in high-score group had less number of phone calls (incoming and outgoing) (Mann-Whitney U = 282.50∼409.00, p U = 388.50, p < 0.01). Discussion: The results show that individuals with social anxiety or loneliness receive less incoming calls and use healthy applications more frequently, but they do not show differences in outgoing-call-related features. Individuals with higher levels of social anxiety also receive less SMSs and use camera apps less frequently, while lonely individuals tend to use system, beautify, browser and social media (RenRen) apps more frequently. Conclusion: This paper finds that there exists

Does Participation in Sports Affect Osteoarthritic Progression After Periacetabular Osteotomy?

Science.gov (United States)

Hara, Daisuke; Hamai, Satoshi; Fukushi, Jun-Ichi; Kawaguchi, Ken-Ichi; Motomura, Goro; Ikemura, Satoshi; Komiyama, Keisuke; Nakashima, Yasuharu

2017-09-01

Periacetabular osteotomy (PAO) is an effective treatment for symptomatic acetabular dysplasia. However, whether postoperative participation in sports leads to progression of the Kellgren-Lawrence (KL) grade of osteoarthritis (OA) in these patients is unclear. To investigate (1) participation in sports before and after PAO and (2) whether postoperative participation in sports leads to progression of the KL grade. Case-control study; Level of evidence, 3. The authors retrospectively reviewed data on 161 patients (183 hips) who underwent PAO for symptomatic acetabular dysplasia with preoperative KL grade 1 or 2 between 1998 and 2011. The mean age at the time of surgery was 42.0 ± 10.9 years (range, 12-64 years), and the mean follow-up duration was 100 months (range, 13-180 months). Data included participation in sports, the University of California, Los Angeles (UCLA) activity scale score, age at the time of surgery, body mass index, follow-up duration, history of treatment for developmental hip dislocations, Merle d'Aubigné-Postel score, Oxford Hip Score, center-edge angle, and KL grade. Univariate and multivariate analyses were applied to determine which factors were associated with progression to KL grade 3 or 4 after PAO. The number of patients who participated in sports significantly increased from 50 (31.1%) preoperatively to 89 (55.3%) postoperatively. The mean UCLA score significantly increased from 4.7 ± 2.1 preoperatively to 5.5 ± 2.0 postoperatively. The KL grade progressed to grade 3 or 4 in 16 hips, including 4 hips that underwent conversion to total hip arthroplasty. No significant differences were found in postoperative participation in sports (89 hips [53.3%] vs 11 hips [68.8%], respectively; P = .24) and the UCLA score (5.6 ± 2.0 vs 5.1 ± 2.0, respectively; P = .30) between hips with KL grade 1 or 2 and KL grade 3 or 4. A multivariate analysis revealed that no factors, including postoperative participation in sports, were significantly

Critical Shoulder Angle and Acromial Index Do Not Influence 24-Month Functional Outcome After Arthroscopic Rotator Cuff Repair.

Science.gov (United States)

Lee, Merrill; Chen, Jerry Yongqian; Liow, Ming Han Lincoln; Chong, Hwei Chi; Chang, Paul; Lie, Denny

2017-11-01

Recent studies have shown a correlation between scapular geometry and the development of atraumatic rotator cuff tears. However, a paucity of literature is available on the effects of critical shoulder angle (CSA) and acromial index (AI) on functional outcomes after arthroscopic rotator cuff repair. Hypothesis/Purpose: The purpose was to investigate the influence of CSA and AI on 24-month functional outcomes after arthroscopic rotator cuff repair. The hypothesis was that a larger CSA or AI would result in poorer postoperative outcomes. Cohort study; Level of evidence, 3. The study included 147 patients who underwent arthroscopic double-row rotator cuff repair for radiologically documented full-thickness supraspinatus tears. An independent reviewer measured the CSA and AI on preoperative radiographs. These patients were prospectively enrolled and were evaluated preoperatively as well as at 3, 6, 12, and 24 months postoperatively. Functional outcome was assessed with the Constant Shoulder Score (CSS), Oxford Shoulder Score (OSS), and University of California at Los Angeles (UCLA) Shoulder Rating Scale. The patients were first divided based on CSA: (1) ≤35° (control CSA) and (2) >35° (increased CSA); and then based on AI: (1) ≤0.7 and (2) >0.7. The Student unpaired t test, Pearson chi-square test, and Pearson correlation were performed to examine the influence of CSA and AI on postoperative functional outcome scores. At 6 months of follow-up, the CSS, OSS, and UCLA Shoulder Rating Scale were 10 ± 1, 4 ± 2, and 3 ± 1 points poorer in the increased CSA group compared with the control CSA group ( P = .005, P = .030, and P = .035, respectively). These scores were not significantly different between both AI groups. By 24 months of follow-up, all outcome scores were comparable between both CSA groups as well as between both AI groups. No significant correlation was found between either CSA or AI when compared with CSS, OSS, or UCLA Shoulder Rating Scale at 24

Targeting myeloid-derived suppressor cells augments antitumor activity against lung cancer

Directory of Open Access Journals (Sweden)

Srivastava MK

2012-10-01

Full Text Available Minu K Srivastava,1,2 Li Zhu,1,2 Marni Harris-White,2 Min Huang,1–3 Maie St John,1,3 Jay M Lee,1,3 Ravi Salgia,4 Robert B Cameron,1,3,5 Robert Strieter,6 Steven Dubinett,1–3 Sherven Sharma1–31Department of Medicine, UCLA Lung Cancer Research Program, David Geffen School of Medicine at UCLA, Los Angeles, CA, 2Molecular Gene Medicine Laboratory, Veterans Affairs Greater Los Angeles Healthcare System, Los Angeles, CA, 3Jonsson Comprehensive Cancer Center, David Geffen School of Medicine at UCLA, Los Angeles, CA, 4Department of Medicine, University of Chicago, Chicago, IL, 5Department of Surgery, Veterans Affairs Greater Los Angeles Healthcare System, Los Angeles, CA, 6Department of Medicine, University of Virginia, Charlottesville, VA, USAAbstract: Lung cancer evades host immune surveillance by dysregulating inflammation. Tumors and their surrounding stromata produce growth factors, cytokines, and chemokines that recruit, expand, and/or activate myeloid-derived suppressor cells (MDSCs. MDSCs regulate immune responses and are frequently found in malignancy. In this review the authors discuss tumor-MDSC interactions that suppress host antitumor activities and the authors' recent findings regarding MDSC depletion that led to improved therapeutic vaccination responses against lung cancer. Despite the identification of a repertoire of tumor antigens, hurdles persist for immune-based anticancer therapies. It is likely that combined therapies that address the multiple immune deficits in cancer patients will be required for effective therapy. MDSCs play a major role in the suppression of T-cell activation and they sustain tumor growth, proliferation, and metastases. Regulation of MDSC recruitment, differentiation or expansion, and inhibition of the MDSC suppressive function with pharmacologic agents will be useful in the control of cancer growth and progression. Pharmacologic agents that regulate MDSCs may be more effective when combined with

The results of arthroscopic versus mini-open repair for rotator cuff tears at mid-term follow-up

Directory of Open Access Journals (Sweden)

Ibrahim Khalid A

2007-12-01

Full Text Available Abstract Background To prospectively evaluate patients who underwent a "mini-open" repair versus a completely arthroscopic technique for small to large size rotator cuff tears. Methods Fifty-two patients underwent "mini-open" or all arthroscopic repair of a full thickness tear of the rotator cuff. Patients who complained of shoulder pain and/or weakness and who had failed a minimum of 6 weeks of physical therapy and had at least one sub-acromial injection were surgical candidates. Pre and post-operative clinical evaluations included the following: 1 demographics; 2 Simple Shoulder Test (SST; 3 University of California, Los Angeles (UCLA rating scale; 4 visual analog pain assessment (VAS; and 5 pre-op SF12 assessment. Descriptive analysis was performed for patient demographics and for all variables. Pre and post outcome scores, range of motion and pain scale were compared using paired t-tests. Analysis of variance (ANOVA was used to evaluate any effect between dependent and independent variables. Significance was set at p is less than or equal to 0.05. Results There were 31 females and 21 males. The average follow-up was 50.6 months (27 – 84 months. The average age was similar between the two groups [arthroscopic x = 55 years/mini-open x = 58 years, p = 0.7]. Twenty-seven patients underwent arthroscopic repair and 25 underwent repair with a mini-open incision. The average rotator cuff tear size was 3.1 cm (range: 1–5 centimeters. There was no significant difference in tear size between the two groups (arthroscopic group = 2.9 cm/mini-open group = 3.2 cm, p = 0.3. Overall, there was a significant improvement from pre-operative status in shoulder pain, shoulder function as measured on the Simple Shoulder test and UCLA Shoulder Form. Visual analog pain improved, on average, 4.4 points and the most recent Short Shoulder Form and UCLA scores were 8 and 26 respectively. Both active and passive glenohumeral joint range of motion improved

Routine Laboratory Blood Tests May Diagnose Significant Fibrosis in Liver Transplant Recipients with Chronic Hepatitis C: A 10 Year Experience

OpenAIRE

Sheen, Victoria; Nguyen, Heajung; Jimenez, Melissa; Agopian, Vatche; Vangala, Sitaram; Elashoff, David; Saab, Sammy

2016-01-01

Background and Aims: The aims of our study were to determine whether routine blood tests, the aspartate aminotransferase (AST) to Platelet Ratio Index (APRI) and Fibrosis 4 (Fib-4) scores, were associated with advanced fibrosis and to create a novel model in liver transplant recipients with chronic hepatitis C virus (HCV). Methods: We performed a cross sectional study of patients at The University of California at Los Angeles (UCLA) Medical Center who underwent liver transplantation for HCV. ...

Typologies of loneliness, living alone and social isolation and their associations with physical and mental health.

OpenAIRE

Smith, Kimberley; Victor, C

2018-01-01

The relationship between living alone, loneliness and social isolation and how they are associated with health remains contentious. We sought to explore typologies based on shared experiences of loneliness, social isolation and living alone using Latent Class Analysis and determine how these groups may differ in terms of their physical and mental health. We used Wave 7 of the English Longitudinal Study of Ageing (n=7032, mean age 67.3) and responses to the UCLA loneliness scale, household com...

Student Experiences of "Soul Healing" in Music and Dance Performance Courses at The University of California, Los Angeles

OpenAIRE

Rann, Lara Diane

2015-01-01

This dissertation illuminates students’ experiences of “soul healing” through the cultivation of spirituality, self-love/ self-knowledge, mentorship, and community in the context of two UCLA courses: the Music and Dance of Ghana World Music Performance Ensemble, taught by master drummer Kobla Ladzekpo of the Anlo-Ewe ethnic group in Ghana, West Africa, and “Advanced Hip Hop,” taught by “street dance” pioneer and choreographer Rennie Harris, of Philadelphia, PA. My definition of soul healing ...

Droplet Combustion and Non-Reactive Shear-Coaxial Jets with and without Transverse Acoustic Excitation

Science.gov (United States)

2012-01-01

node, there is no droplet deflection, but there is limited evidence for this. Recent studies at UCLA and at NASA Glenn Research Center by Dattarajan et...generator supplied continuous sine wave signals, which were amplified via Trek PZD2000A high-voltage amplifiers, to each piezo-siren. The waveform...1.3. Verify the wire on Channel 1 of the Tenma oscilloscope (Model No. 72-6800) comes from the output voltage monitor on the Trek -1 amplifier and the

Loneliness and depression in the elderly: the role of social network

OpenAIRE

Domènech Abella, Joan; Lara, Elvira; Rubio Valera, Maria; Olaya Guzmán, Beatriz; Moneta, María Victoria; Rico Uribe, Laura Alejandra; Ayuso Mateos, José Luis; Mundó Blanch, Jordi; Haro Abad, Josep Maria

2017-01-01

PURPOSE: Loneliness and depression are associated, in particular in older adults. Less is known about the role of social networks in this relationship. The present study analyzes the influence of social networks in the relationship between loneliness and depression in the older adult population in Spain. METHODS: A population-representative sample of 3535 adults aged 50 years and over from Spain was analyzed. Loneliness was assessed by means of the three-item UCLA Loneliness Scale. Social net...

Presheath profiles in simulated tokamak edge plasmas

International Nuclear Information System (INIS)

LaBombard, B.; Conn, R.W.; Hirooka, Y.; Lehmer, R.; Leung, W.K.; Nygren, R.E.; Ra, Y.; Tynan, G.

1988-04-01

The PISCES plasma surface interaction facility at UCLA generates plasmas with characteristics similar to those found in the edge plasmas of tokamaks. Steady state magnetized plasmas produced by this device are used to study plasma-wall interaction phenomena which are relevant to tokamak devices. We report here progress on some detailed investigations of the presheath region that extends from a wall surface into these /open quotes/simulated tokamak/close quotes/ edge plasma discharges along magnetic field lines

Invoking Agency: Talking About Racial Diversity and Campus Climate on Social Media

OpenAIRE

Tanksley, Tiera chantè; Lopez, Vanessa; Martinez, Francisca

2017-01-01

The 2015-2016 Undergraduate Research Partnership Initiative (URPI) study explored students’ use of social media to engage in discussion of racial/ethnic diversity and campus climate. The purpose of the study was to better understand how students utilize social media to talk about issues of racial/ethnic diversity and campus climate to inform how UCLA might capitalize on social media use to promote a safe, welcoming and empowering campus environment. Eighteen interviews and an in-depth content...

Use of grafts in rotator cuff re-rupture.

Science.gov (United States)

Jiménez-Martín, A; Santos-Yubero, F J; Najarro-Cid, F J; Navarro-Martínez, S; Zurera-Carmona, M; Pérez-Hidalgo, S

2016-01-01

Rotator cuff re-ruptures appear in 38-65% of cases. In order to reduce this rate, many studies have been performed using different types of biomaterial for purely mechanical aims (re-inforce the suture) and/or biological agents (growth factor transporterts). The aim of this study is to review 22 cases treated with xenografts and analyse various current alternatives. A descriptive and retrospective study was conducted using the variables of age, sex, laterality, time of surgery, involvement in MRI, number of anchors, and final mobility results on the Constant and the University of California Los Angeles (UCLA) validated scales. The study included 22 patients, with a mean age of 51.7±4.6 years. A mean of 2 anchors were used and 13 patients were treated with a porcine intestinal submucosa implant, 6 with equine pericardium, and 3 with porcine dermis. Final results were: 37.6±13 points for the Constant test, and 16.9±3.9 points on the UCLA scale. The follow up was 36±10.2 months. In our experience, xenografts could provide good functional results and they would be a surgical alternative to tendon transfers in cases of massive tears. Further studies should be conducted with other biomaterials. Copyright © 2016 SECOT. Publicado por Elsevier España, S.L.U. All rights reserved.

Teaching Planetary Science as Part of the Search for Extraterrestrial Intelligence (SETI)

Science.gov (United States)

Margot, Jean-Luc; Greenberg, Adam H.

2017-10-01

In Spring 2016 and 2017, UCLA offered a course titled "EPSS C179/279 - Search for Extraterrestrial Intelligence: Theory and Applications". The course is designed for advanced undergraduate students and graduate students in the science, technical, engineering, and mathematical fields. Each year, students designed an observing sequence for the Green Bank telescope, observed known planetary systems remotely, wrote a sophisticated and modular data processing pipeline, analyzed the data, and presented their results. In 2016, 15 students participated in the course (9U, 5G; 11M, 3F) and observed 14 planetary systems in the Kepler field. In 2017, 17 students participated (15U, 2G; 10M, 7F) and observed 10 planetary systems in the Kepler field, TRAPPIST-1, and LHS 1140. In order to select suitable targets, students learned about planetary systems, planetary habitability, and planetary dynamics. In addition to planetary science fundamentals, students learned radio astronomy fundamentals, collaborative software development, signal processing techniques, and statistics. Evaluations indicate that the course is challenging but that students are eager to learn because of the engrossing nature of SETI. Students particularly value the teamwork approach, the observing experience, and working with their own data. The next offering of the course will be in Spring 2018. Additional information about our SETI work is available at seti.ucla.edu.

Final Report DOE Grant No. DE-FG03-01ER54617 Computer Modeling of Microturbulence and Macrostability Properties of Magnetically Confined Plasmas

Energy Technology Data Exchange (ETDEWEB)

Jean-Noel Leboeuf

2004-03-04

OAK-B135 We have made significant progress during the past grant period in several key areas of the UCLA and national Fusion Theory Program. This impressive body of work includes both fundamental and applied contributions to MHD and turbulence in DIII-D and Electric Tokamak plasmas, and also to Z-pinches, particularly with respect to the effect of flows on these phenomena. We have successfully carried out interpretive and predictive global gyrokinetic particle-in-cell calculations of DIII-D discharges. We have cemented our participation in the gyrokinetic PIC effort of the SciDAC Plasma Microturbulence Project through working membership in the Summit Gyrokinetic PIC Team. We have continued to teach advanced courses at UCLA pertaining to computational plasma physics and to foster interaction with students and junior researchers. We have in fact graduated 2 Ph. D. students during the past grant period. The research carried out during that time has resulted in many publications in the premier plasma physics and fusion energy sciences journals and in several invited oral communications at major conferences such as Sherwood, Transport Task Force (TTF), the annual meetings of the Division of Plasma Physics of the American Physical Society, of the European Physical Society, and the 2002 IAEA Fusion Energy Conference, FEC 2002. Many of these have been authored and co-authored with experimentalists at DIII-D.

Final Report DOE Grant No. DE-FG03-01ER54617 Computer Modeling of Microturbulence and Macrostability Properties of Magnetically Confined Plasmas

International Nuclear Information System (INIS)

Jean-Noel Leboeuf

2004-01-01

OAK-B135 We have made significant progress during the past grant period in several key areas of the UCLA and national Fusion Theory Program. This impressive body of work includes both fundamental and applied contributions to MHD and turbulence in DIII-D and Electric Tokamak plasmas, and also to Z-pinches, particularly with respect to the effect of flows on these phenomena. We have successfully carried out interpretive and predictive global gyrokinetic particle-in-cell calculations of DIII-D discharges. We have cemented our participation in the gyrokinetic PIC effort of the SciDAC Plasma Microturbulence Project through working membership in the Summit Gyrokinetic PIC Team. We have continued to teach advanced courses at UCLA pertaining to computational plasma physics and to foster interaction with students and junior researchers. We have in fact graduated 2 Ph. D. students during the past grant period. The research carried out during that time has resulted in many publications in the premier plasma physics and fusion energy sciences journals and in several invited oral communications at major conferences such as Sherwood, Transport Task Force (TTF), the annual meetings of the Division of Plasma Physics of the American Physical Society, of the European Physical Society, and the 2002 IAEA Fusion Energy Conference, FEC 2002. Many of these have been authored and co-authored with experimentalists at DIII-D

Evaluation of a Structured Predeparture Orientation at the David Geffen School of Medicine's Global Health Education Programs.

Science.gov (United States)

Herbst de Cortina, Sasha; Arora, Gitanjli; Wells, Traci; Hoffman, Risa M

2016-03-01

Given the lack of a standardized approach to medical student global health predeparture preparation, we evaluated an in-person, interactive predeparture orientation (PDO) at the University of California Los Angeles (UCLA) to understand program strengths, weaknesses, and areas for improvement. We administered anonymous surveys to assess the structure and content of the PDO and also surveyed a subset of students after travel on the utility of the PDO. We used Fisher's exact test to evaluate the association between prior global health experience and satisfaction with the PDO. One hundred and five students attended the PDO between 2010 and 2014 and completed the survey. One hundred and four students (99.0%) reported learning new information. Major strengths included faculty mentorship (N = 38, 19.7%), opportunities to interact with the UCLA global health community (N = 34, 17.6%), and sharing global health experiences (N = 32, 16.6%). Of students surveyed after their elective, 94.4% (N = 51) agreed or strongly agreed that the PDO provided effective preparation. Students with prior global health experience found the PDO to be as useful as students without experience (92.7% versus 94.4%, P = 1.0). On the basis of these findings, we believe that a well-composed PDO is beneficial for students participating in global health experiences and recommend further comparative studies of PDO content and delivery. © The American Society of Tropical Medicine and Hygiene.

Evaluation of the results from partial arthroplasty for treating shoulder osteoarthrosis

Directory of Open Access Journals (Sweden)

Alberto Naoki Miyazaki

2013-04-01

Full Text Available OBJECTIVE: In this study we aim at statistically evaluating the results of the surgical treatment of the osteoarthrosis of the shoulder (OAS with partial shoulder arthroplasty (PSA and at correlating them with the several variables involved. METHODS: In this study we evaluated 36 shoulders of 31 patients with OAS who underwent treatment with PSA in the Grupo de Ombro e Cotovelo (Group of Shoulders and Elbows of the Department of Traumatology and Orthopedics of the Faculdade de Ciências Médicas da Santa Casa de São Paulo - Pavillion Fernandinho Simonsen between January, 1989 and November, 2010. Patients who underwent PSA and who had a post-operative follow-up of at least 12 months were included in the study. RESULTS: After the surgery the range of elevation, external rotation, internal rotation and the UCLA scale improved (with average differences of 35º, 27º, 4ºand 17 points, respectively, with a significant level of 5% (p < 0.05. For the same level of significance, the relation between a satisfactory UCLA and two variables was found: patients with maximum age of 60 years old at the moment of the surgery and patients that underwent tenotomy of the long head of biceps. CONCLUSION: Patients under 60 who underwent surgery and patients who underwent tenotomy of the long head of biceps achieved better results.

Rotator cuff injury in patients over the age of 65 years: evaluation of function, integrity and strength

Directory of Open Access Journals (Sweden)

Marco Antonio de Castro Veado

2015-06-01

Full Text Available OBJECTIVE: To retrospectively evaluate the results from patients who underwent arthroscopic treatment for rotator cuff injuries, among those aged over 65 years, observing integrity, function and strength.METHODS: Thirty-five shoulders were operated between July 2005 and July 2010, and 28 shoulders were re-evaluated regarding elevation strength and external rotation, using a digital dynamometer. Integrity was evaluated by means of ultrasound examinations. The patients, whose mean age was 70.54 years (ranging from 65 to 82 years, were followed up for a minimum of 26 months and mean of 51.18 months (ranging from 26 to 82 months. To evaluate function, the UCLA score, the Simple Shoulder Test (SST and a visual analog scale (VAS for pain were used.RESULTS: In analyzing the ultrasound scans, it was observed that the integrity of the rotator cuff was maintained in 75% of the cases at the end of the follow-up, along with the improvement in the UCLA score, which evolved from 17.46 to 32.39, i.e. excellent and good results in 89.28%. The mean SST and VAS indices were 9.86 and 1.5 respectively.CONCLUSION: Arthroscopic surgery to repair rotator cuff injuries in patients over the age of 65 years leads to improved function and pain relief, with maintenance of the integrity of the repair. The data on muscle strength were inconclusive.

A Model for Community-Based Pediatric Oral Heath: Implementation of an Infant Oral Care Program

Directory of Open Access Journals (Sweden)

Francisco J. Ramos-Gomez

2014-01-01

Full Text Available The Affordable Care Act (ACA mandates risk assessments, preventive care, and evaluations based on outcomes. ACA compliance will require easily accessible, cost-effective care models that are flexible and simple to establish. UCLA has developed an Infant Oral Care Program (IOCP in partnership with community-based organizations that is an intervention model providing culturally competent perinatal and infant oral care for underserved, low-income, and/or minority children aged 0–5 and their caregivers. In collaboration with the Venice Family Clinic's Simms/Mann Health and Wellness Center, UCLA Pediatrics, Women, Infants, and Children (WIC, and Early Head Start and Head Start programs, the IOCP increases family-centered care access and promotes early utilization of dental services in nontraditional, primary care settings. Emphasizing disease prevention, management, and care that is sensitive to cultural, language, and oral health literacy challenges, IOCP patients achieve better oral health maintenance “in health” not in “disease modality”. IOCP uses interprofessional education to promote pediatric oral health across multiple disciplines and highlights the necessity for the “age-one visit”. This innovative clinical model facilitates early intervention and disease management. It sets a new standard of minimally invasive dental care that is widely available and prevention focused, with high retention rates due to strong collaborations with the community-based organizations serving these vulnerable, high-risk children.

A model for community-based pediatric oral heath: implementation of an infant oral care program.

Science.gov (United States)

Ramos-Gomez, Francisco J

2014-01-01

The Affordable Care Act (ACA) mandates risk assessments, preventive care, and evaluations based on outcomes. ACA compliance will require easily accessible, cost-effective care models that are flexible and simple to establish. UCLA has developed an Infant Oral Care Program (IOCP) in partnership with community-based organizations that is an intervention model providing culturally competent perinatal and infant oral care for underserved, low-income, and/or minority children aged 0-5 and their caregivers. In collaboration with the Venice Family Clinic's Simms/Mann Health and Wellness Center, UCLA Pediatrics, Women, Infants, and Children (WIC), and Early Head Start and Head Start programs, the IOCP increases family-centered care access and promotes early utilization of dental services in nontraditional, primary care settings. Emphasizing disease prevention, management, and care that is sensitive to cultural, language, and oral health literacy challenges, IOCP patients achieve better oral health maintenance "in health" not in "disease modality". IOCP uses interprofessional education to promote pediatric oral health across multiple disciplines and highlights the necessity for the "age-one visit". This innovative clinical model facilitates early intervention and disease management. It sets a new standard of minimally invasive dental care that is widely available and prevention focused, with high retention rates due to strong collaborations with the community-based organizations serving these vulnerable, high-risk children.

Mobile clouds exploiting distributed resources in wireless, mobile and social networks

CERN Document Server

Fitzek, Frank H P

2013-01-01

Includes a preface written by Professor Leonard Kleinrock, Distinguished Professor of Computer Science, UCLA, USA This book discusses and explores the concept of mobile cloud, creating an inspiring research space for exploiting opportunistic resource sharing, and covering from theoretical research approaches to the development of commercially profitable ideas. A mobile cloud is a cooperative arrangement of dynamically connected communication nodes sharing opportunistic resources. In this book, authors provide a comprehensive and motivating overview of this rapidly emerging technology. The b

SSRL photocathode RF gun test stand

International Nuclear Information System (INIS)

Hernandez, M.; Baltay, M.; Boyce, A.

1995-01-01

A photocathode RF gun test stand designed for the production and study of high brightness electron beams will be constructed at SSRL. The beam will be generated from a laser driven third generation photocathode RF gun being developed in collaboration with BNL, LBL, and UCLA. The 3-5 [MeV] beam from the gun will be accelerated using a SLAC three meter S-band accelerator section, in order to achieve the desired low emittance beam, emittance compensation with solenoidal focusing will be employed

HUBUNGAN ANTARA KESEPIAN DAN KECENDERUNGAN NARSISISTIK PADA PENGGUNA JEJARING SOSIAL MEDIA INSTAGRAM

OpenAIRE

Kembaren Dianelia Reginanta Sembiring

2017-01-01

This study aims to investigate the relationship between loneliness and narcissistic tendencies on social network Instagram users. The population in this study is the users of social network Instagram for at least 6 months, aged 18-24 years, has a minimum of 90 photos on their instagram account, actively access instagram account  for once until twice a day. Snowball sampling is used in this study, with the participation of 65 participants. Measurement instrument used in this study were UCLA Lo...

Genomewide clonal analysis of lethal mutations in the Drosophila melanogaster eye: comparison of the X chromosome and autosomes.

Science.gov (United States)

Call, Gerald B; Olson, John M; Chen, Jiong; Villarasa, Nikki; Ngo, Kathy T; Yabroff, Allison M; Cokus, Shawn; Pellegrini, Matteo; Bibikova, Elena; Bui, Chris; Cespedes, Albert; Chan, Cheryl; Chan, Stacy; Cheema, Amrita K; Chhabra, Akanksha; Chitsazzadeh, Vida; Do, Minh-Tu; Fang, Q Angela; Folick, Andrew; Goodstein, Gelsey L; Huang, Cheng R; Hung, Tony; Kim, Eunha; Kim, William; Kim, Yulee; Kohan, Emil; Kuoy, Edward; Kwak, Robert; Lee, Eric; Lee, JiEun; Lin, Henry; Liu, H-C Angela; Moroz, Tatiana; Prasad, Tharani; Prashad, Sacha L; Patananan, Alexander N; Rangel, Alma; Rosselli, Desiree; Sidhu, Sohrab; Sitz, Daniel; Taber, Chelsea E; Tan, Jingwen; Topp, Kasey; Tran, PhuongThao; Tran, Quynh-Minh; Unkovic, Mary; Wells, Maggie; Wickland, Jessica; Yackle, Kevin; Yavari, Amir; Zaretsky, Jesse M; Allen, Christopher M; Alli, Latifat; An, Ju; Anwar, Abbas; Arevalo, Sonia; Ayoub, Danny; Badal, Shawn S; Baghdanian, Armonde; Baghdanian, Arthur H; Baumann, Sara A; Becerra, Vivian N; Chan, Hei J; Chang, Aileen E; Cheng, Xibin A; Chin, Mabel; Chong, Fleurette; Crisostomo, Carlyn; Datta, Sanjit; Delosreyes, Angela; Diep, Francie; Ekanayake, Preethika; Engeln, Mark; Evers, Elizabeth; Farshidi, Farzin; Fischer, Katrina; Formanes, Arlene J; Gong, Jun; Gupta, Riju; Haas, Blake E; Hahm, Vicky; Hsieh, Michael; Hui, James Z; Iao, Mei L; Jin, Sophia D; Kim, Angela Y; Kim, Lydia S-H; King, Megan; Knudsen-Robbins, Chloe; Kohanchi, David; Kovshilovskaya, Bogdana; Ku, Amy; Kung, Raymond W; Landig, Mark E L; Latterman, Stephanie S; Lauw, Stephanie S; Lee, Daniel S; Lee, Joann S; Lei, Kai C; Leung, Lesley L; Lerner, Renata; Lin, Jian-ya; Lin, Kathleen; Lim, Bryon C; Lui, Crystal P Y; Liu, Tiffany Q; Luong, Vincent; Makshanoff, Jacob; Mei, An-Chi; Meza, Miguel; Mikhaeil, Yara A; Moarefi, Majid; Nguyen, Long H; Pai, Shekhar S; Pandya, Manish; Patel, Aadit R; Picard, Paul D; Safaee, Michael M; Salame, Carol; Sanchez, Christian; Sanchez, Nina; Seifert, Christina C; Shah, Abhishek; Shilgevorkyan, Oganes H; Singh, Inderroop; Soma, Vanessa; Song, Junia J; Srivastava, Neetika; StaAna, Jennifer L; Sun, Christie; Tan, Diane; Teruya, Alison S; Tikia, Robyn; Tran, Trinh; Travis, Emily G; Trinh, Jennifer D; Vo, Diane; Walsh, Thomas; Wong, Regan S; Wu, Katherine; Wu, Ya-Whey; Yang, Nkau X V; Yeranosian, Michael; Yu, James S; Zhou, Jennifer J; Zhu, Ran X; Abrams, Anna; Abramson, Amanda; Amado, Latiffe; Anderson, Jenny; Bashour, Keenan; Beyer, Elsa; Bookatz, Allen; Brewer, Sarah; Buu, Natalie; Calvillo, Stephanie; Cao, Joseph; Chan, Amy; Chan, Jenny; Chang, Aileen; Chang, Daniel; Chang, Yuli; Chen, YiBing; Choi, Joo; Chou, Jeyling; Dang, Peter; Datta, Sumit; Davarifar, Ardy; Deravanesian, Artemis; Desai, Poonam; Fabrikant, Jordan; Farnad, Shahbaz; Fu, Katherine; Garcia, Eddie; Garrone, Nick; Gasparyan, Srpouhi; Gayda, Phyllis; Go, Sherrylene; Goffstein, Chad; Gonzalez, Courtney; Guirguis, Mariam; Hassid, Ryan; Hermogeno, Brenda; Hong, Julie; Hong, Aria; Hovestreydt, Lindsay; Hu, Charles; Huff, Devon; Jamshidian, Farid; Jen, James; Kahen, Katrin; Kao, Linda; Kelley, Melissa; Kho, Thomas; Kim, Yein; Kim, Sarah; Kirkpatrick, Brian; Langenbacher, Adam; Laxamana, Santino; Lee, Janet; Lee, Chris; Lee, So-Youn; Lee, ToHang S; Lee, Toni; Lewis, Gemma; Lezcano, Sheila; Lin, Peter; Luu, Thanh; Luu, Julie; Marrs, Will; Marsh, Erin; Marshall, Jamie; Min, Sarah; Minasian, Tanya; Minye, Helena; Misra, Amit; Morimoto, Miles; Moshfegh, Yasaman; Murray, Jessica; Nguyen, Kha; Nguyen, Cynthia; Nodado, Ernesto; O'Donahue, Amanda; Onugha, Ndidi; Orjiakor, Nneka; Padhiar, Bhavin; Paul, Eric; Pavel-Dinu, Mara; Pavlenko, Alex; Paz, Edwin; Phaklides, Sarah; Pham, Lephong; Poulose, Preethi; Powell, Russell; Pusic, Aya; Ramola, Divi; Regalia, Kirsten; Ribbens, Meghann; Rifai, Bassel; Saakyan, Manyak; Saarikoski, Pamela; Segura, Miriam; Shadpour, Farnaz; Shemmassian, Aram; Singh, Ramnik; Singh, Vivek; Skinner, Emily; Solomin, Daniel; Soneji, Kosha; Spivey, Kristin; Stageberg, Erika; Stavchanskiy, Marina; Tekchandani, Leena; Thai, Leo; Thiyanaratnam, Jayantha; Tong, Maurine; Toor, Aneet; Tovar, Steve; Trangsrud, Kelly; Tsang, Wah-Yung; Uemura, Marc; Vollmer, Emily; Weiss, Emily; Wood, Damien; Wu, Joy; Wu, Sophia; Wu, Winston; Xu, Qing; Yamauchi, Yuki; Yarosh, Will; Yee, Laura; Yen, George; Banerjee, Utpal

2007-10-01

Using a large consortium of undergraduate students in an organized program at the University of California, Los Angeles (UCLA), we have undertaken a functional genomic screen in the Drosophila eye. In addition to the educational value of discovery-based learning, this article presents the first comprehensive genomewide analysis of essential genes involved in eye development. The data reveal the surprising result that the X chromosome has almost twice the frequency of essential genes involved in eye development as that found on the autosomes.

Partial response to proton pump inhibitor therapy for GERD: observational study of patient characteristics, burden of disease, and costs in the USA

OpenAIRE

St?lhammar, Nils-Olov; Spiegel, Brennan M; Granstedt L?fman, Helena; Karlsson, Maria; Wahlqvist, Peter; N?sdal, J?rgen; Nelson, M Todd; Despi?gel, Nicolas

2012-01-01

Nils-Olov Stålhammar,1 Brennan M Spiegel,2,3 Helena Granstedt Löfman,1 Maria Karlsson,1 Peter Wahlqvist,1 Jørgen Næsdal,4 M Todd Nelson,5 Nicolas Despiégel61Payer Evidence, AstraZeneca R&D, Mölndal, Sweden; 2Department of Gastroenterology, VA Greater Los Angeles Healthcare System, 3David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 4Medical Department, AstraZeneca R&D, Mölndal, Sweden; 5Late Phase...

Longitudinal phase space characterization of the blow-out regime of rf photoinjector operation

OpenAIRE

J. T. Moody; P. Musumeci; M. S. Gutierrez; J. B. Rosenzweig; C. M. Scoby

2009-01-01

Using an experimental scheme based on a vertically deflecting rf deflector and a horizontally dispersing dipole, we characterize the longitudinal phase space of the beam in the blow-out regime at the UCLA Pegasus rf photoinjector. Because of the achievement of unprecedented resolution both in time (50 fs) and energy (1.0 keV), we are able to demonstrate some important properties of the beams created in this regime such as extremely low longitudinal emittance, large temporal energy chirp, and ...

76 FR 48176 - Notice of Inventory Completion: Fowler Museum at UCLA, Los Angeles, CA

Science.gov (United States)

2011-08-08

...; Tohono O'odham Nation of Arizona; and the Zuni Tribe of the Zuni Reservation, New Mexico. The Salt River... Indian Reservation, Arizona; and Tohono O'odham Nation of Arizona (hereinafter referred to as ``The Four...

76 FR 36148 - Notice of Inventory Completion: Fowler Museum at UCLA, Los Angeles, CA

Science.gov (United States)

2011-06-21

... in consultation with representatives of the Bear River Band of the Rohnerville Rancheria, California... notice. The Bear River Band of the Rohnerville Rancheria, California, and the Blue Lake Rancheria... Historic Medical Museum. A search of the Wellcome archives produced no documentation directly related to...

Far-infrared laser scattering from spontaneous and driven fluctuations in the UCLA microtor tokamak

International Nuclear Information System (INIS)

Lee, P.; Luhmann, N.C.; Park, H. Jr.; Peebles, W.A.; Taylor, R.J.; Xu, Ying; Yu, C.X.

1982-01-01

A far-infrared (FIR) laser scattering system for the study of tokamak density fluctuations is described. Recent scattering data from low frequency microturbulence in high density (n >= 5 x 10 13 cm -3 ) microtor discharges are presented. In addition, the first observation and identification of internal modes generated during ICRF heating are described. The latter study directly conforms to fast wave mode conversion theory in a two-ion species plasma. In particular, the first internal observation of mode converted ion Bernstein waves in a tokamak plasma has been made. (author)

The UCLA hadronization model and Pt correlation study at √s = 29 GeV

International Nuclear Information System (INIS)

Chun, Sebong.

1989-01-01

With only longitudinal phase space, a linear confining quark potential, and Clebsch-Gordon coefficients, the authors demonstrate remarkable agreement with a large body of data. This involves only two parameters of a modified Lund symmetric fragmentation function a, b and three coherent lengths: the number of hadrons over which the transverse momentum P t is required to be compensated, the degree of the spin correlation between a diquark and its partner anti-diquark in baryon and anti-baryon production, and the degree of suppression of successive mesons created between a baryon and anti-baryon (which comes from the uncertainty principle). These coherent lengths have a common fundamental characteristic, namely, the propagation length of information along the chain of produced hadrons. As a separate effort to probe the propagation length of P t , we studied the correlations in momentum transverse to the event jet-axis for neighboring particles close in rapidity, which reflect the tendency of back-to-back production of the hadron pairs. He found indications of interesting correlations, but that a larger data sample is needed for definitive understanding of the area

Community College Faculty Retention: Examining Burnout, Stress, and Job Satisfaction. UCLA Community College Bibliography

Science.gov (United States)

McJunkin, Kyle Stewart

2005-01-01

Recent literature on faculty departure from community colleges has focused primarily on faculty retirement. Less research has been conducted on turnover related to stress and faculty burnout, particularly at the community college level. In order to shed some light on this subject, the citations in this annotated bibliography focus on the…

Resultado da reparação do manguito rotador em lesões do tipo C1 e C2 de Snyder, considerando fumantes e não fumantes Outcome of rotator cuff repair in Snyder type C1 and C2 lesions, considering smokers and nonsmokers

Directory of Open Access Journals (Sweden)

Sérgio Correa Pinto Júnior

2010-01-01

Full Text Available OBJETIVO: Avaliar a influência do tabagismo nos resultados cirúrgicos do reparo das lesões completas do manguito rotador tipos C1 e C2 de Snyder. MÉTODOS: Foram avaliados 166 pacientes que haviam sido submetidos a tratamento cirúrgico para lesão completa do manguito rotador tipo C1 e C2 de Snyder, entre junho de 2002 a dezembro de 2006. Foram considerados critérios de inclusão um seguimento mínimo de 24 meses e ausência de cirurgias prévias no ombro acometido. Excluíram-se os pacientes que apresentavam outras lesões associadas. Foram avaliados os paciente fumantes e não fumantes de acordo com os critérios da Organização Mundial da Saúde (OMS. Houve predomínio de pacientes do sexo feminino (119 em relação ao masculino (47, e a idade média foi de 57 anos (38 a 78. Do total de 166 pacientes avaliados, foram considerados fumantes 21 pacientes e não fumantes 145. Os resultados finais foram avaliados pelos critérios da UCLA (University of California at Los Angeles e a análise estatística foi feita pelo programa Epi Info®. RESULTADOS: Pelos critérios da UCLA, os pacientes fumantes tiveram uma média final de 32,6 pontos, enquanto os não fumantes de 33,8. Na análise estatística pós-operatória houve diferença entre os dois grupos, com os pacientes não fumantes tendo melhor resultado final. CONCLUSÃO: O tabagismo interfere no resultado final das reparações de lesões pequenas e médias do manguito rotador.OBJECTIVE: To evaluate the influence of smoking on the results of surgical repair of complete lesions of the rotator cuff Snyder types C1 and C2. METHODS: We studied 166 patients who had undergone surgical treatment for complete lesion of the rotator cuff Snyder type C1 and C2, from June 2002 to December 2006. Inclusion criteria were a minimum follow-up period of 24 months and the absence of previous surgery on the affected shoulder. Patients with other associated injuries were excluded. We evaluated the smoking and

Resultado funcional do tratamento artroscópico da instabilidade do ombro sem a lesão do lábio da glenóide Functional results of arthroscopic treatment of shoulder instability without glenoid labral lesion

Directory of Open Access Journals (Sweden)

Waldo Lino Júnior

2007-07-01

Full Text Available OBJETIVO: Tratar a instabilidade anterior e ântero-inferior do ombro sem lesão do lábio da glenóide por via artroscópica por meio de capsulorrafia térmica e fechamento do espaço rotador e avaliar os resultados quanto à estabilidade e à melhora funcional. MÉTODOS: Entre janeiro de 1998 e junho de 2002, 11 pacientes foram submetidos a esse procedimento, imobilizados por cinco semanas e após tratados por fisioterapia. Todos os pacientes foram avaliados no pré e pós-operatório pelas escalas de Neer, Rower e UCLA e, no pós-operatório, pela escala de ASES. RESULTADOS: Durante o período de seguimento entre 46 e 97 meses média de 75,54 meses todos os ombros permaneceram estáveis. Comparando-se a evolução do pré ao pós-operatório, houve melhora de acordo com a escala de Neer, na qual nenhum paciente apresentou resultado satisfatório no pré-operatório e oito tiveram resultado satisfatório no pós-operatório. Segundo a escala de Rowe, a média pré-operatória foi de 36,8 e, no pós-operatório, de 81,6 pontos. Conforme a escala da UCLA, a média no pré-operatório foi de 23,45 e, no pós-operatório, de 31,18 pontos. De acordo com todas essas escalas houve melhora estatisticamente significativa (p = 0,05. A escala da ASES mostrou média pós-operatória de 77,2 pontos. CONCLUSÃO: O procedimento artroscópico analisado confere estabilidade e melhora funcional.OBJECTIVE: Anterior and anterior-lower instability of the shoulder without a glenoid labral lesion was arthroscopically treated by thermal capsulorrhaphy and closing of the rotator space, and results were evaluated for stability and functional improvement. METHODS: From January 1998 to June 2002, 11 patients were submitted to this procedure, immobilized for five weeks, and then treated by physiotherapy. All patients were evaluated pre- and post-operatively by the Neer, Rower, and UCLA scale, and in the post-operative period, by the ASES scale. RESULTS: During the follow

Via de acesso cirúrgico posterossuperior para o tratamento das luxações acromioclaviculares: resultados de 84 casos operados Posterosuperior surgical access route for treatment of acromioclavicular dislocations: results from 84 surgical cases

Directory of Open Access Journals (Sweden)

Danilo Canesin Dal Molin

2012-10-01

Full Text Available OBJETIVO: Avaliar os resultados do tratamento cirúrgico de 84 luxações acromioclaviculares agudas com a utilização da via de acesso posterossuperior do ombro. MÉTODOS: Foram avaliados 84 casos de luxações acromioclaviculares agudas grau III da classificação de Allman-Tossy operados de novembro de 2002 a maio de 2010. A média de idade dos pacientes foi de 34 anos. O diagnóstico foi realizado por avaliação clínica e radiográfica. Os pacientes foram operados pela mesma equipe cirúrgica em até três semanas da data do trauma realizando-se a via de acesso posterossuperior do ombro com acesso ao topo da base do processo coracoide para colocação de duas âncoras utilizadas na redução da luxação. O seguimento mínimo foi de 12 meses. A avaliação clínica-radiográfica pós-operatória foi realizada pelos critérios de Karlsson modificados e do escore da Universidade da Califórnia em Los Angeles (UCLA. RESULTADOS: Dos 84 pacientes operados, 92,8% apresentavam resultados bons ou excelentes e 7,2% de resultados regulares ou fracos pelo escore de avaliação da UCLA. Pelos critérios de Karlsson modificados 76,2% foram avaliados como grau A, 17,9% como grau B e 5,9% como grau C. CONCLUSÃO: A VIA de acesso posterossuperior do ombro é uma nova opção para acesso ao processo coracoide e tratamento das luxações acromioclaviculares, com resultados clínicos e radiográficos equivalentes aos da literatura.OBJECTIVE: To evaluate the results from surgical treatment of 84 cases of acute acromioclavicular dislocation, using a posterosuperior access route. METHODS: Eighty-four cases of acute acromioclavicular dislocation (grade III in the Allman-Tossy classification operated between November 2002 and May 2010 were evaluated. The patients' mean age was 34 years. The diagnoses were made using clinical and radiographic evaluations. The patients were operated by the same surgical team, within three weeks of the date of the trauma, using a

Tratamento artroscópico da luxação acromioclavicular aguda com âncoras Arthroscopic treatment of acute acromioclavicular joint dislocation using suture anchors

Directory of Open Access Journals (Sweden)

Leonardo Muntada Cavinatto

2011-01-01

Full Text Available OBJETIVO: Apresentar os resultados clínicos e radiográficos de uma série de casos com diagnóstico de Luxação Acromioclavicular (LAC Aguda, tratados através da fixação coracoclavicular com âncoras por via artroscópica. MÉTODO: Vinte pacientes apresentando LAC com menos de 30 dias de evolução foram operados pela técnica da estabilização coracoclavicular com âncoras por via artroscópica. Duas âncoras metálicas com dois fios cada, foram inseridas no coracóide. Os fios foram amarrados sobre a clavícula passando por túneis transósseos claviculares. Para a avaliação radiográfica, foi utilizada a medida comparativa da distância coracoclavicular com o lado contralateral e a avaliação funcional através dos escores de Constant e UCLA o seguimento foi de seis meses. RESULTADO: Dos vinte casos inicialmente selecionados, seis necessitaram de novo procedimento cirúrgico e foram excluídos do estudo. Dos quatorze pacientes restantes, apenas dois mantiveram redução da articulação acromioclavicular, enquanto os demais apresentaram algum grau de desvio no decorrer da evolução. Desconsiderando os pacientes excluídos, os escores de Constant e UCLA tiveram média 94,79 (82-100 e, 32,64 (26-35, respectivamente. CONCLUSÃO: A técnica apresentou um alto índice de perda da redução ao longo da evolução de seis meses. A avaliação funcional apresentou resultado satisfatório com escore médio elevado de Evidência: Nível de Evidência: Nível III, estudo retrospectivo.OBJECTIVE: To present the clinical and radiographic results of a case series of patients with acute acromioclavicular dislocation (AAD treated by arthroscopic coracoclavicular fixation with suture anchors. METHOD: Twenty patients with AAD with less than 30 days since the injury were submitted to a coracoclavicular stabilization procedure using 2 suture anchors placed at the base of the coracoid process. Each suture anchor was connected to 2 strands of No.2

Reparação artroscópica de lesões pequenas e médias do tendão do músculo supraespinal: avaliação dos resultados clínico-funcionais após dois anos de seguimento Arthroscopic repair of the small and medium tears of the supraspinatus muscle tendon: evaluation of the clinical and functional outcomes after two years of follow-up

Directory of Open Access Journals (Sweden)

Roberto Yukio Ikemoto

2012-01-01

Full Text Available OBJETIVO: Avaliar os resultados clínico-funcionais das reparações artroscópicas de lesões pequenas e médias do tendão do músculo supraespinal. MÉTODOS: Foram avaliados, retrospectivamente, 129 casos de lesões isoladas pequenas ou médias do tendão do músculo supraespinal. O tempo médio de dor foi de 29 meses. A amplitude articular média era de 136º de elevação ativa, 48º de rotação lateral, rotação medial no nível T12 e a escala funcional pré-operatória da UCLA foi, em média, de 17 pontos. Em todos os casos foi possível o reparo completo da lesão. RESULTADOS: A pontuação pela escala funcional da UCLA no período pós-operatório foi, em média, de 32 pontos. O tempo médio de seguimento foi de 39 meses. Setenta e cinco casos (58% tiveram resultados excelentes e 42 (32%, bons. A elevação ativa final teve a média de 156º, com ganho médio de 20º, e a rotação lateral final foi, em média, de 57º, com ganho médio de 9º, ambos estatisticamente significativos (P OBJECTIVE: To evaluate the clinical and functional outcomes from arthroscopic repairs on small and medium-sized tears of the supraspinatus muscle tendon. METHODS: 129 cases of isolated small and medium tears of the supraspinatus muscle tendon were evaluated retrospectively. The average duration of pain was 29 months. The average joint range of motion comprised active elevation of 136º, lateral rotation of 58º and medial rotation at T12 level; and the preoperative functional UCLA score averaged 17 points. In all the cases, complete repair could be achieved. RESULTS: The average score on the UCLA functional scale in the postoperative period was 32 points. The average length of follow-up was 39 months. Seventy-five cases (58% had excellent results and 42 (32% had good results. The average final active elevation was 156º with an average gain of 20º, and the average final lateral rotation was 57º with an average gain of 9º. Both of these were

Prosthetic management of malpositioned implant using custom cast abutment

Science.gov (United States)

Chatterjee, Aishwarya; Ragher, Mallikarjuna; Patil, Sanket; Chatterjee, Debopriya; Dandekeri, Savita; Prabhu, Vishnu

2015-01-01

Two cases are reported with malpositioned implants. Both the implants were placed 6–7 months back. They had osseointegrated well with the surrounding bone. However, they presented severe facial inclination. Case I was restored with custom cast abutment with an auto polymerizing acrylic gingival veneer. Case II was restored with custom cast UCLA type plastic implant abutment. Ceramic was directly fired on the custom cast abutments. The dual treatment strategy resulted in functional and esthetic restorations despite facial malposition of the implants. PMID:26538957

Nano-biotechnology for biomedical and diagnostic research

CERN Document Server

Zahavy, Eran; Yitzhaki, Shmuel

2011-01-01

The title ""Nano Biotechnology for Biomedical and Diagnostics Research"" will address research aspects related to nanomaterial in imaging and biological research, nanomaterials as a biosensing tool, DNA nanotechnology, nanomaterials for drug delivery, medicinal and therapeutic application and cytotoxicity of nanomaterials. These topics will be covered by 16 different manuscripts. Amongst the authors that will contribute to the book are major scientific leaders such as S. Weiss - UCLA, I. Willner, and G. Golomb -- HUJI, S. Esener - UCSD, E.C. Simmel - Tech. Univ. Munchen, I. Medintz -- NRL, N.

Communication nets stochastic message flow and delay

CERN Document Server

Kleinrock, Leonard

2007-01-01

Considerable research has been devoted to the formulation and solution of problems involving flow within connected networks. Independent of these surveys, an extensive body of knowledge has accumulated on the subject of queues, particularly in regard to stochastic flow through single-node servicing facilities. This text combines studies of connected networks with those of stochastic flow, providing a basis for understanding the general behavior and operation of communication networks in realistic situations.Author Leonard Kleinrock of the Computer Science Department at UCLA created the basic p

Genomewide Clonal Analysis of Lethal Mutations in the Drosophila melanogaster Eye: Comparison of the X Chromosome and Autosomes

Science.gov (United States)

Call, Gerald B.; Olson, John M.; Chen, Jiong; Villarasa, Nikki; Ngo, Kathy T.; Yabroff, Allison M.; Cokus, Shawn; Pellegrini, Matteo; Bibikova, Elena; Bui, Chris; Cespedes, Albert; Chan, Cheryl; Chan, Stacy; Cheema, Amrita K.; Chhabra, Akanksha; Chitsazzadeh, Vida; Do, Minh-Tu; Fang, Q. Angela; Folick, Andrew; Goodstein, Gelsey L.; Huang, Cheng R.; Hung, Tony; Kim, Eunha; Kim, William; Kim, Yulee; Kohan, Emil; Kuoy, Edward; Kwak, Robert; Lee, Eric; Lee, JiEun; Lin, Henry; Liu, H-C. Angela; Moroz, Tatiana; Prasad, Tharani; Prashad, Sacha L.; Patananan, Alexander N.; Rangel, Alma; Rosselli, Desiree; Sidhu, Sohrab; Sitz, Daniel; Taber, Chelsea E.; Tan, Jingwen; Topp, Kasey; Tran, PhuongThao; Tran, Quynh-Minh; Unkovic, Mary; Wells, Maggie; Wickland, Jessica; Yackle, Kevin; Yavari, Amir; Zaretsky, Jesse M.; Allen, Christopher M.; Alli, Latifat; An, Ju; Anwar, Abbas; Arevalo, Sonia; Ayoub, Danny; Badal, Shawn S.; Baghdanian, Armonde; Baghdanian, Arthur H.; Baumann, Sara A.; Becerra, Vivian N.; Chan, Hei J.; Chang, Aileen E.; Cheng, Xibin A.; Chin, Mabel; Chong, Fleurette; Crisostomo, Carlyn; Datta, Sanjit; Delosreyes, Angela; Diep, Francie; Ekanayake, Preethika; Engeln, Mark; Evers, Elizabeth; Farshidi, Farzin; Fischer, Katrina; Formanes, Arlene J.; Gong, Jun; Gupta, Riju; Haas, Blake E.; Hahm, Vicky; Hsieh, Michael; Hui, James Z.; Iao, Mei L.; Jin, Sophia D.; Kim, Angela Y.; Kim, Lydia S-H.; King, Megan; Knudsen-Robbins, Chloe; Kohanchi, David; Kovshilovskaya, Bogdana; Ku, Amy; Kung, Raymond W.; Landig, Mark E. L.; Latterman, Stephanie S.; Lauw, Stephanie S.; Lee, Daniel S.; Lee, Joann S.; Lei, Kai C.; Leung, Lesley L.; Lerner, Renata; Lin, Jian-ya; Lin, Kathleen; Lim, Bryon C.; Lui, Crystal P. Y.; Liu, Tiffany Q.; Luong, Vincent; Makshanoff, Jacob; Mei, An-Chi; Meza, Miguel; Mikhaeil, Yara A.; Moarefi, Majid; Nguyen, Long H.; Pai, Shekhar S.; Pandya, Manish; Patel, Aadit R.; Picard, Paul D.; Safaee, Michael M.; Salame, Carol; Sanchez, Christian; Sanchez, Nina; Seifert, Christina C.; Shah, Abhishek; Shilgevorkyan, Oganes H.; Singh, Inderroop; Soma, Vanessa; Song, Junia J.; Srivastava, Neetika; Sta.Ana, Jennifer L.; Sun, Christie; Tan, Diane; Teruya, Alison S.; Tikia, Robyn; Tran, Trinh; Travis, Emily G.; Trinh, Jennifer D.; Vo, Diane; Walsh, Thomas; Wong, Regan S.; Wu, Katherine; Wu, Ya-Whey; Yang, Nkau X. V.; Yeranosian, Michael; Yu, James S.; Zhou, Jennifer J.; Zhu, Ran X.; Abrams, Anna; Abramson, Amanda; Amado, Latiffe; Anderson, Jenny; Bashour, Keenan; Beyer, Elsa; Bookatz, Allen; Brewer, Sarah; Buu, Natalie; Calvillo, Stephanie; Cao, Joseph; Chan, Amy; Chan, Jenny; Chang, Aileen; Chang, Daniel; Chang, Yuli; Chen, YiBing; Choi, Joo; Chou, Jeyling; Dang, Peter; Datta, Sumit; Davarifar, Ardy; Deravanesian, Artemis; Desai, Poonam; Fabrikant, Jordan; Farnad, Shahbaz; Fu, Katherine; Garcia, Eddie; Garrone, Nick; Gasparyan, Srpouhi; Gayda, Phyllis; Go, Sherrylene; Goffstein, Chad; Gonzalez, Courtney; Guirguis, Mariam; Hassid, Ryan; Hermogeno, Brenda; Hong, Julie; Hong, Aria; Hovestreydt, Lindsay; Hu, Charles; Huff, Devon; Jamshidian, Farid; Jen, James; Kahen, Katrin; Kao, Linda; Kelley, Melissa; Kho, Thomas; Kim, Yein; Kim, Sarah; Kirkpatrick, Brian; Langenbacher, Adam; Laxamana, Santino; Lee, Janet; Lee, Chris; Lee, So-Youn; Lee, ToHang S.; Lee, Toni; Lewis, Gemma; Lezcano, Sheila; Lin, Peter; Luu, Thanh; Luu, Julie; Marrs, Will; Marsh, Erin; Marshall, Jamie; Min, Sarah; Minasian, Tanya; Minye, Helena; Misra, Amit; Morimoto, Miles; Moshfegh, Yasaman; Murray, Jessica; Nguyen, Kha; Nguyen, Cynthia; Nodado, Ernesto; O'Donahue, Amanda; Onugha, Ndidi; Orjiakor, Nneka; Padhiar, Bhavin; Paul, Eric; Pavel-Dinu, Mara; Pavlenko, Alex; Paz, Edwin; Phaklides, Sarah; Pham, Lephong; Poulose, Preethi; Powell, Russell; Pusic, Aya; Ramola, Divi; Regalia, Kirsten; Ribbens, Meghann; Rifai, Bassel; Saakyan, Manyak; Saarikoski, Pamela; Segura, Miriam; Shadpour, Farnaz; Shemmassian, Aram; Singh, Ramnik; Singh, Vivek; Skinner, Emily; Solomin, Daniel; Soneji, Kosha; Spivey, Kristin; Stageberg, Erika; Stavchanskiy, Marina; Tekchandani, Leena; Thai, Leo; Thiyanaratnam, Jayantha; Tong, Maurine; Toor, Aneet; Tovar, Steve; Trangsrud, Kelly; Tsang, Wah-Yung; Uemura, Marc; Vollmer, Emily; Weiss, Emily; Wood, Damien; Wu, Joy; Wu, Sophia; Wu, Winston; Xu, Qing; Yamauchi, Yuki; Yarosh, Will; Yee, Laura; Yen, George; Banerjee, Utpal

2007-01-01

Using a large consortium of undergraduate students in an organized program at the University of California, Los Angeles (UCLA), we have undertaken a functional genomic screen in the Drosophila eye. In addition to the educational value of discovery-based learning, this article presents the first comprehensive genomewide analysis of essential genes involved in eye development. The data reveal the surprising result that the X chromosome has almost twice the frequency of essential genes involved in eye development as that found on the autosomes. PMID:17720911

Quality indicators for the diagnosis and antibiotic treatment of acute respiratory tract infections in general practice

DEFF Research Database (Denmark)

Saust, Laura Trolle; Bjerrum, Lars; Arpi, Magnus

2017-01-01

Objective: To develop quality indicators for the diagnosis and antibiotic treatment of acute respiratory tract infections, tailored to the Danish general practice setting. Design: A RAND/UCLA Appropriateness Method was used. Setting: General practice. Subjects: A panel of nine experts, mainly...... general practitioners, was asked to rate the relevance of 64 quality indicators for the diagnosis and antibiotic treatment of acute respiratory tract infections based on guidelines. Subsequently, a face-to-face meeting was held to resolve misinterpretations and to achieve consensus. Main outcome measures...

Frontiers in Neuromorphics Workshop

Science.gov (United States)

2017-04-14

of the project to the date of this printing . List the papers, including journal references, in the following categories: (b) Papers published in... intelligence .  Their  startup  company developed optimized hardware and software for deep‐learning/ neural‐networks, and  showed that through optimization we...Title: Accelerating Artificial Intelligence at Cloud Scale 10:30AM-11:00AM BREAK 11:00AM-11:30AM Dr. Wentai Liu – UCLA Title: Memristors

[Personality traits and the feeling of loneliness of women treated for infertility].

Science.gov (United States)

Bidzan, Mariola; Podolska, Magdalena; Bidzan, Leszek; Smutek, Jerzy

2011-07-01

Assessing the feeling of loneliness of women treated because of infertility compared to women without any procreation problems, and verifying, whether there is a correlation with the presented personality traits. 26 women treated for infertility (in accordance with the officially recognized criteria) in the Obstetrics and Women Health Clinic at the Medical University in Gdańsk, and 25 women not experiencing any procreation problems, were included into the study The research tools included a self-constructed sociodemographic questionnaire, the Minnesota Multiphasic Personality Inventory (MMPI) and the UCLA Loneliness Scale by D. Russell, L. Peplau, C. Cytron. There are significant differences among the investigated groups in terms of the following personality dimensions: Masculinity - Femininity Paranoia, Psychasthenia, Schizophrenia and the Social Introversion Scale. Women treated because of infertility scored higher in all these scales, their results remained within the norm though. The studied groups demonstrated different relations between the MMPI scales and the UCLA scales results. Women treated due to infertility have a personality profile similar to women without any procreation problems. Only the group whose profiles exhibited some pathological features demonstrated symptoms of worse adaptation to life, a tendency to experience a higher psychological discomfort and higher psychological stress, higher level of anxiety related to being assessed by others, and greater difficulties in accepting the role of a female. As far as the sense of loneliness was concerned women treated due to infertility did not differ significantly from the ones without procreation problems.

Central Limit Theorem: New SOCR Applet and Demonstration Activity

Science.gov (United States)

Dinov, Ivo D.; Christou, Nicolas; Sanchez, Juana

2011-01-01

Modern approaches for information technology based blended education utilize a variety of novel instructional, computational and network resources. Such attempts employ technology to deliver integrated, dynamically linked, interactive content and multifaceted learning environments, which may facilitate student comprehension and information retention. In this manuscript, we describe one such innovative effort of using technological tools for improving student motivation and learning of the theory, practice and usability of the Central Limit Theorem (CLT) in probability and statistics courses. Our approach is based on harnessing the computational libraries developed by the Statistics Online Computational Resource (SOCR) to design a new interactive Java applet and a corresponding demonstration activity that illustrate the meaning and the power of the CLT. The CLT applet and activity have clear common goals; to provide graphical representation of the CLT, to improve student intuition, and to empirically validate and establish the limits of the CLT. The SOCR CLT activity consists of four experiments that demonstrate the assumptions, meaning and implications of the CLT and ties these to specific hands-on simulations. We include a number of examples illustrating the theory and applications of the CLT. Both the SOCR CLT applet and activity are freely available online to the community to test, validate and extend (Applet: http://www.socr.ucla.edu/htmls/SOCR_Experiments.html and Activity: http://wiki.stat.ucla.edu/socr/index.php/SOCR_EduMaterials_Activities_GeneralCentralLimitTheorem). PMID:21833159

[Shoulder joint pain of rotator cuff injury treated with electroacupuncture and Mulligan's mobilization: a randomized controlled trial].

Science.gov (United States)

Wang, Yanwu; Wang, Chongmin; Chen, Huade; Ye, Xinmiao

2018-01-12

To verify the clinical therapeutic effects on shoulder joint pain of rotator cuff injury treated with electroacupuncture (EA) and Mulligan's mobilization. A total of 120 patients of shoulder joint pain of rotator cuff injury were randomized into an EA group, a rehabilitation group and a combined therapy group, 40 cases in each one. In the EA group, EA was applied to Jianzhen (SI 9), Jianliao (TE 14), Jianyu (LI 15), Tianzong (SI 11), Jianqian (extra) and Binao (LI 14) in the affected side. Of these acupoints, Jianliao (TE 14) and Jianyu (LI 15), Jianzhen (SI 9) and Tianzong (SI 11) were stimulated with Han 's electric apparatus. In the rehabilitation group, Mulligan's mobilization was used, including scapular mobilization, static joint mobilization and dynamic joint mobilization. In the combined therapy group, EA was used in combination with Mulligan mobilization. The treatment was given once a day in each group, 5 sessions a week, totally for 6 weeks. The pain intensity of shoulder joint (VAS), the University of California at Los Angeles shoulder rating scale (UCLA) and the range of motion (ROM) of shoulder joint were evaluated before and 6 weeks after treatment separately. The adverse reactions were recorded in each group. VAS scores were all reduced, UCLA scores increased and ROM improved after treatment as compared with those before treatment in the patients of the three groups (all P joint pain of rotator cuff injury, better than the simple application of either EA or Mulligan's mobilization.

The Tyndall Petition: Bridging the Gap between Academia and the General Public

Science.gov (United States)

Duong, K.; Ong, J.

2017-12-01

Climatepedia is a student-founded organization with a mission to communicate climate science to a broad audience. Since its inception in 2011, Climatepedia has grown from a UCLA club to a transitioning 501(c)(3) non-profit organization with members from UCLA, UC Irvine, Yale University, Duke University, UC Santa Barbara, and the University of Pennsylvania. Our main project is the Tyndall Petition (http://www.climatepedia.org/home/tyndallpetition) - the largest online climate petition of its kind - which features nearly 700 signatories who agree that human-induced climate change is an urgent and real issue. Our signatories are PhD level experts with a research focus in climate science or a highly related field. Each signatory has their own profile page that links to other signatories within our network. The Tyndall Petition can be used as a tool to bring transparency to the climate experts that support our statement. In this way, we hope to inform the general audience about the strong scientific consensus about climate change. We also seek to improve climate literacy through exposure to diverse research topics related to climate change. The Tyndall Petition can serve as a mechanism to connect signatories to regional climate issues and the communities affected by these issues. In parallel, Climatepedia administers a Student Certificate Program that trains college students to become climate literate, gain skills in climate communication, and support the growth of the Tyndall Petition.

Evaluating teaching methods: validation of an evaluation tool for hydrodissection and phacoemulsification portions of cataract surgery.

Science.gov (United States)

Smith, Ronald J; McCannel, Colin A; Gordon, Lynn K; Hollander, David A; Giaconi, JoAnn A; Stelzner, Sadiqa K; Devgan, Uday; Bartlett, John; Mondino, Bartly J

2014-09-01

To develop and assess the validity of an evaluation tool to assess quantitatively the hydrodissection and phacoemulsification portions of cataract surgery performed by residents. Case series. Jules Stein Eye Institute, Olive View-UCLA Medical Center, and Veterans Administration Medical Center, Los Angeles, California, USA. The UCLA ophthalmology faculty members were surveyed and the literature was reviewed to develop a grading tool consisting of 15 questions to evaluate surgical technique, including questions from the Global Rating Assessment of Skills in Intraocular Surgery and from the International Council of Ophthalmology's Ophthalmology Surgical Competency Assessment Rubric. Video clips of the hydrodissection and phacoemulsification portions of cataract surgery performed by 1 postgraduate year 2 (PGY2) resident, 1 PGY3 resident, 2 PGY4 residents, and an advanced surgeon were independently graded in a masked fashion by an 8-member faculty panel. Eleven of the 15 questions had a significant association with surgical experience level (Pinstrument handling, flow of operation, and nucleus rotation. Nucleus cracking also had low variability. Less directly visible tasks, especially 3-dimensional tasks, had wider interobserver variability. Surgical performance can be validly measured using an evaluation tool. Improved videography and studies to identify the best questions for evaluating each step of cataract surgery may help ophthalmic educators more precisely measure training outcomes for improving teaching interventions. No author has a financial or proprietary interest in any material or method mentioned. Published by Elsevier Inc.

Balance, dizziness and proprioception in patients with chronic whiplash associated disorders complaining of dizziness: A prospective randomized study comparing three exercise programs.

Science.gov (United States)

Treleaven, Julia; Peterson, Gunnel; Ludvigsson, Maria Landén; Kammerlind, Ann-Sofi; Peolsson, Anneli

2016-04-01

Dizziness and unsteadiness are common symptoms following a whiplash injury. To compare the effect of 3 exercise programs on balance, dizziness, proprioception and pain in patients with chronic whiplash complaining of dizziness. A sub-analysis of a randomized study. One hundred and forty subjects were randomized to either a physiotherapist-guided neck-specific exercise (NSE), physiotherapist-guided neck-specific exercise, with a behavioural approach (NSEB) or prescription of general physical activity (PPA) group. Pre intervention, 3, 6 and 12 months post baseline they completed the University of California Los Angeles Dizziness Questionnaire (UCLA-DQ), Visual Analogue Scales (VAS) for, dizziness at rest and during activity and physical measures (static and dynamic clinical balance tests and head repositioning accuracy (HRA)). There were significant time by group differences with respect to dizziness during activity and UCLA-Q favouring the physiotherapy led neck specific exercise group with a behavioural approach. Within group analysis of changes over time also revealed significant changes in most variables apart from static balance. Between and within group comparisons suggest that physiotherapist led neck exercise groups including a behavioural approach had advantages in improving measures of dizziness compared with the general physical activity group, although many still complained of dizziness and balance impairment. Future studies should consider exercises specifically designed to address balance, dizziness and cervical proprioception in those with persistent whiplash. Crown Copyright © 2015. Published by Elsevier Ltd. All rights reserved.

Cross-cultural adaptation and validation of the Foot Function Index for use in German-speaking patients with foot complaints.

Science.gov (United States)

Naal, Florian D; Impellizzeri, Franco M; Huber, Martin; Rippstein, Pascal F

2008-12-01

The purpose of this study was to cross-culturally adapt the Foot Function Index (FFI) for use in German-speaking patients with foot complaints. The FFI was adapted for the German language according to the recommended forward/backward translation protocol. The following metric properties were assessed in 53 consecutive patients (mean age, 57.2 years; 39 women) undergoing foot surgery at our department: feasibility, reliability (intraclass correlation coefficient ICC), internal consistency (Cronbach's alpha, CA), and construct validity (correlation with the Short Form (SF-36), a VAS assessing pain, a VAS assessing function, and the University of California at Los Angeles (UCLA) activity scale. The German FFI (FFI-D) comprised 18 items separated into a pain and a disability subscale. Completion of the FFI-D was feasible. The reliability and the internal consistency were both excellent with an ICC of 0.98 and a CA of 0.97 for the total score. We found moderate to high correlations between the FFI-D and the physical related SF-36 domains (r = -0.43 to -0.80), the VAS pain (r = 0.81), the VAS function (r = 0.77), and the UCLA (r = -0.52). Correlation coefficients between the FFI-D and the mental health related SF-36 domains were significantly lower (r = -0.08 to -0.32; p validity. The German version of the FFI is a reliable and valid questionnaire for the self-assessment of pain and disability in German-speaking patients with foot complaints.

Functional evaluation of repairs to circumferential labral lesions of the glenoid - Case series

Directory of Open Access Journals (Sweden)

Alexandre Tadeu do Nascimento

Full Text Available ABSTRACT OBJECTIVE: To evaluate the clinical results among patients undergoing arthroscopic repair of circumferential labral lesions. METHODS: This was a retrospective study on 10 patients who underwent arthroscopic repair to circumferential labral lesions of the shoulder, between September 2012 and September 2015. The patients were evaluated by means of the Carter-Rowe score, DASH score, UCLA score, visual analog scale (VAS for pain and Short-Form 36 (SF36. The average age at surgery was 29.6 years. The mean follow-up was 27.44 months (range: 12-41.3. RESULTS: The mean score was 16 points for DASH; 32 points for UCLA, among which six patients (60% had excellent results, three (30% good and one (10% poor; 1.8 points for VAS, among which nine patients (90% had minor pain and one (10% moderate pain; 79.47 for SF-36; and 92.5 for Carter-Rowe, among which nine patients (90% had excellent results and one (10% good. Joint degeneration was present in one case (10%, of grade 1. We did not observe any significant complications, except for grade 1 glenohumeral arthrosis, which one patient developed after the operation. CONCLUSION: Arthroscopic repair of circumferential labral lesions of the shoulder through use of absorbable anchors is effective, with improvements in all scores applied, and it presents low complication rates. Cases associated with glenohumeral dislocation have lower long-term residual pain.

Identification of the hikikomori syndrome of social withdrawal: Psychosocial features and treatment preferences in four countries.

Science.gov (United States)

Teo, Alan R; Fetters, Michael D; Stufflebam, Kyle; Tateno, Masaru; Balhara, Yatan; Choi, Tae Young; Kanba, Shigenobu; Mathews, Carol A; Kato, Takahiro A

2015-02-01

Hikikomori, a form of social withdrawal first reported in Japan, may exist globally but cross-national studies of cases of hikikomori are lacking. To identify individuals with hikikomori in multiple countries and describe features of the condition. Participants were recruited from sites in India, Japan, Korea and the United States. Hikikomori was defined as a 6-month or longer period of spending almost all time at home and avoiding social situations and social relationships, associated with significant distress/impairment. Additional measures included the University of California, Los Angeles (UCLA) Loneliness Scale, Lubben Social Network Scale (LSNS-6), Sheehan Disability Scale (SDS) and modified Cornell Treatment Preferences Index. A total of 36 participants with hikikomori were identified, with cases detected in all four countries. These individuals had high levels of loneliness (UCLA Loneliness Scale M = 55.4, SD = 10.5), limited social networks (LSNS-6 M = 9.7, SD = 5.5) and moderate functional impairment (SDS M = 16.5, SD = 7.9). Of them 28 (78%) desired treatment for their social withdrawal, with a significantly higher preference for psychotherapy over pharmacotherapy, in-person over telepsychiatry treatment and mental health specialists over primary care providers. Across countries, participants with hikikomori had similar generally treatment preferences and psychosocial features. Hikikomori exists cross-nationally and can be assessed with a standardized assessment tool. Individuals with hikikomori have substantial psychosocial impairment and disability, and some may desire treatment. © The Author(s) 2014.

Fenestrated Transcatheter ASD Closure in Adults with Diastolic Dysfunction and/or Pulmonary Hypertension: Case Series and Review of the Literature.

Science.gov (United States)

Abdelkarim, Ayman; Levi, Daniel S; Tran, Bao; Ghobrial, Joanna; Aboulhosn, Jamil

2016-12-01

This study aims to evaluate the safety and efficacy of transcatheter fenestrated ASD closure and to summarize the literature regarding the published techniques and outcomes of transcatheter partial ASD closure. Patients with left ventricular diastolic dysfunction (LVDD) or right ventricular (RV) dysfunction and/or pulmonary hypertension (PHT) may suffer untoward consequences of complete closure of an ostium secundum atrial septal defect (ASD). Therefore, for patients that fall under these categories we suggest partial occlusion of the defect, which may be better tolerated than complete defect closure. After obtaining IRB approval, a search for patients that have undergone percutaneous ASD closure was performed in the Ahmanson/UCLA Adult Congenital Heart Disease Center database to identify which patients received a fenestrated ASD closure device. Eight consecutive patients ranging between 22 and 83 years of age (mean 48 years) with PHT and/or LVDD or RV dysfunction who underwent fenestrated transcatheter ASD closure at UCLA were identified. None of the subjects experienced complications related to the procedure. Postprocedure clinical evaluation showed improvement in symptoms and exercise capacity. Available follow-up transthoracic echocardiography data (mean 4 months, range 0-20 months) demonstrated patent fenestrations in four of eight patients. None of the patients had thromboembolic or infectious complications and there were no device migrations, erosions or embolizations. Partial ASD occlusion in patients with diastolic dysfunction or RV dysfunction and/or PHT is safe and may be better tolerated than complete ASD closure in selected patients. © 2016 Wiley Periodicals, Inc.

Treatment of Partial Rotator Cuff Tear with Ultrasound-guided Platelet-rich Plasma

Directory of Open Access Journals (Sweden)

Vetrivel Chezian Sengodan

2017-01-01

Full Text Available Background: The treatment of symptomatic partial rotator cuff tear has presented substantial challenge to orthopaedic surgeons as it can vary from conservative to surgical repair. Researches have established the influence of platelet rich plasma in healing damaged tissue. Currently very few data are available regarding the evidence of clinical and radiological outcome of partial rotator cuff tear treated with ultrasound guided platelet rich plasma injection in English literature. Materials and Methods: 20 patients with symptomatic partial rotator cuff tears were treated with ultrasound guided platelet rich plasma injection. Before and after the injection of platelet rich plasma scoring was done with visual analogue score, Constant shoulder score, and UCLA shoulder score at 8 weeks and third month. A review ultrasound was performed 8 weeks after platelet rich plasma injection to assess the rotator cuff status. Results: Our study showed statistically significant improvements in 17 patients in VAS pain score, constant shoulder score and UCLA shoulder score. No significant changes in ROM were noted when matched to the contra-lateral side (P < 0.001 at the 3 month follow-up. The study also showed good healing on radiological evaluation with ultrasonogram 8 weeks after platelet rich plasma injection. Conclusion: Ultrasound guided platelet rich plasma injection for partial rotator cuff tears is an effective procedure that leads to significant decrease in pain, improvement in shoulder functions, much cost-effective and less problematic compared to a surgical treatment.

Are the good functional results from arthroscopic repair of massive rotator cuff injuries maintained over the long term?

Directory of Open Access Journals (Sweden)

Alberto Naoki Miyazaki

2016-02-01

Full Text Available ABSTRACT OBJECTIVE: To evaluate whether the good and excellent functional results from arthroscopic repair of massive rotator cuff tears are maintained over the long term. METHODS: From the sample of the study conducted by our group in 2006, in which we evaluated the functional results from arthroscopic repair of massive rotator cuff tears, 35 patients were reassessed, 8 years after the first evaluation. The inclusion criteria were that these patients with massive rotator cuff tears operated by means of an arthroscopic technique, who participated in the previous study and achieved good or excellent outcomes according to the UCLA criteria. Patients whose results were not good or excellent in the first evaluation according to the UCLA criteria were excluded. RESULTS: Among the 35 patients reassessed, 91% of them continued to present good and excellent results (40% excellent and 51% good, while 3% presented fair results and 6% poor results. The time interval between the first and second evaluations was 8 years and the minimum length of follow-up since the immediate postoperative period was 9 years (range: 9-17 years, with an average of 11.4 years. CONCLUSION: The good and excellent results from arthroscopic repair of massive rotator cuff tears were mostly maintained (91%, with the same level of function and satisfaction, even though 8 years had passed since the first assessment, with a follow-up period averaging 11.4 years.

New developments in oral contraception: clinical utility of estradiol valerate/dienogest (Natazia® for contraception and for treatment of heavy menstrual bleeding: patient considerations

Directory of Open Access Journals (Sweden)

Nelson AL

2012-12-01

Full Text Available Anita L NelsonObstetrics and Gynecology, David Geffen School of Medicine at UCLA, Harbor UCLA Medical Center, Torrance, California, USAAbstract: Natazia® is a new oral contraceptive with estradiol valerate and dienogest in a unique multiphasic formulation that includes a shortened hormone-free interval. This new formulation has been approved for both contraception and also as a treatment for heavy menstrual bleeding in women who desire to use oral contraceptives as their method of birth control. It is marketed in the US as Natazia® and elsewhere as Qlaira®. This article will review the properties of each of the major new features of this pill: estradiol used in place of ethinyl estradiol, dienogest as the progestin, and the unique dosing pattern of this product. It will also summarize the results of the pivotal clinical trials of contraceptive effectiveness, bleeding patterns, safety and tolerability. The lessons learned from the clinical trials about the effectiveness of this formulation in the treatment of excessive menstrual bleeding will be summarized. Also, results of trials comparing this new pill to other popular formulations for "menstrually-related" symptoms and for potential female sexual dysfunction related to use of oral contraceptives will be presented. This review will suggest how all this information might be used to counsel women about how to use this pill most successfully.Keywords: oral contraceptives, estradiol valerate, dienogest, heavy menstrual bleeding, menorrhagia, dynamic dosing

Creating a new generation of pediatric dentists: a paradigm shift in training.

Science.gov (United States)

Ramos-Gomez, Francisco J; Silva, Daniela Rodrigues P; Law, Clarice S; Pizzitola, Rebecca L; John, Brendan; Crall, James J

2014-12-01

The University of California, Los Angeles (UCLA) School of Dentistry has implemented a Health Resources and Services Administration-funded program to prepare dentists for the complex and comprehensive needs of pediatric patients within rapidly changing demographics and a paradigm shift in dentistry. Traditional dental education has focused on how to respond to oral disease, whereas UCLA's program shifts the paradigm to emphasize early assessment, risk-based prevention, and disease management. A holistic approach to dental care that considers social and environmental determinants is used with minimally invasive techniques for restorative care. To support this change, pediatric dental residents receive traditional training combined with new didactics, advocacy opportunities, and applied learning experiences at community-based organizations. These new elements teach residents to recognize the causal factors of disease and to identify interventions that promote oral health at the individual, family, community, and policy level. Consequently, they are better prepared to treat a diverse group of patients who historically have faced the greatest burden of disease as well as an increased number of barriers to accessing oral health care; these consist of low-income, minority, and/or pediatric populations including children with special health needs. The program's ultimate goal is for residents to deploy these skills in treating vulnerable populations and to demonstrate greater interest in collaborating with non-dental health providers and community organizations to increase access to dental services in private or public health practice settings.

Self-instructional "virtual pathology" laboratories using web-based technology enhance medical school teaching of pathology.

Science.gov (United States)

Marchevsky, Alberto M; Relan, Anju; Baillie, Susan

2003-05-01

Second-year medical students have traditionally been taught pulmonary pathophysiology at the University of California-Los Angeles (UCLA) School of Medicine using lectures, discussion groups, and laboratory sessions. Since 1998, the laboratory sessions have been replaced by 4 interactive, self-instructional sessions using web-based technology and case-based instruction. This article addresses nature of transformation that occurred from within the course in response to the infusion of new technologies. The vast majority of the course content has been digitized and incorporated into the website of the Pathophysiology of Disease course. The teaching histological slides have been photographed digitally and organized into "cases" with clinical information, digital images and text, and audio descriptions. The students study the materials from these cases at their own pace in 2 "virtual pathology" laboratory, with a few instructors supervising the on-site sessions. The students discuss additional cases available on the website in 2 other laboratory sessions supervised by a pulmonologist and a pathologist. Marked improvement in student participation and satisfaction was seen with the use of web-based instruction. Attendance at laboratory sessions, where the students had previously been required to bring their own microscopes to study histological slides at their own pace, increased from approximately 30% to 40% of the class in previous years to almost 100%. Satisfaction surveys showed progressive improvement over the past 4 years, as various suggestions were implemented. The value of web-based instruction of pathology at the UCLA School of Medicine is discussed.

Cloud feedback studies with a physics grid

Energy Technology Data Exchange (ETDEWEB)

Dipankar, Anurag [Max Planck Institute for Meteorology Hamburg; Stevens, Bjorn [Max Planck Institute for Meteorology Hamburg

2013-02-07

During this project the investigators implemented a fully parallel version of dual-grid approach in main frame code ICON, implemented a fully conservative first-order interpolation scheme for horizontal remapping, integrated UCLA-LES micro-scale model into ICON to run parallely in selected columns, and did cloud feedback studies on aqua-planet setup to evaluate the classical parameterization on a small domain. The micro-scale model may be run in parallel with the classical parameterization, or it may be run on a "physics grid" independent of the dynamics grid.

Safety research needs for carbide and nitride fueled LMFBR's. Final report

International Nuclear Information System (INIS)

Kastenberg, W.E.

1975-01-01

The results of a study initiated at UCLA during the academic year 1974--1975 to evaluate and review the potential safety related research needs for carbide and nitride fueled LMFBR's are presented. The tasks included the following: (1) Review Core and primary system designs for any significant differences from oxide fueled reactors, (2) Review carbide (and nitride) fuel element irradiation behavior, (3) Review reactor behavior in postulated accidents, (4) Examine analytical methods of accident analysis to identify major gaps in models and data, and (5) Examine post accident heat removal. (TSS)

Image acquisition for the pediatric radiology PACS module

International Nuclear Information System (INIS)

Ho, B.K.; Morioka, C.; Mankovich, N.J.; Stewart, B.; Huang, H.K.

1987-01-01

The prototype PACS module implemented at UCLA's pediatric radiology section has multi-modality access to image data from any of the three types of sources: digital modalities (i.e. CT, MR, and DSA), the Fuji Computed Radiography unit (FCR), and laser film digitizers. An interface unit was built to facilitate real-time data transfer from the FCR to the VAX11/750 which serves as the PACS host computer. The design of the interface unit, methods for linking to digital modalities, and characteristics of two film digitizers are described

Suppression pool dynamics. Annual report, 1 July 1976--30 June 1977

International Nuclear Information System (INIS)

Chan, C.K.; Chiou, H.H.; Lee, B.K.C.; Dhir, V.K.; Liu, C.Y.; Catton, I.

1978-02-01

The work performed at UCLA to study the transient thermal-hydraulic phenomena induced by the motion of submerged air and steam bubbles in a boiling water reactor (BWR) pressure suppression pool, following a loss-of-coolant accident is described. The air transients, which include vent clearing, bubble growth, and pool swelling, were investigated by a series of air-water tests. These tests were performed in a cylindrical plexiglas test chamber. Gas was injected downward through different-diameter pipes, placed in the middle of the test chamber, which was filled with water at room temperature

Elementary quantum mechanics

CERN Document Server

Saxon, David S

2012-01-01

Based on lectures for an undergraduate UCLA course in quantum mechanics, this volume focuses on the formulas of quantum mechanics rather than applications. Widely used in both upper-level undergraduate and graduate courses, it offers a broad self-contained survey rather than in-depth treatments.Topics include the dual nature of matter and radiation, state functions and their interpretation, linear momentum, the motion of a free particle, Schrödinger's equation, approximation methods, angular momentum, and many other subjects. In the interests of keeping the mathematics as simple as possible, m

Elementary induction on abstract structures

CERN Document Server

Moschovakis, Yiannis N

2008-01-01

Hailed by the Bulletin of the American Mathematical Society as ""easy to use and a pleasure to read,"" this research monograph is recommended for students and professionals interested in model theory and definability theory. The sole prerequisite is a familiarity with the basics of logic, model theory, and set theory.The author, Professor of Mathematics at UCLA and Emeritus Professor of Mathematics,University of Athens, Greece, begins with a focus on the theory of inductive and hyperelementary sets. Subsequent chapters advance to acceptable structures and countable acceptable structures, concl

Norwegians led the way in training wartime weather officers

Science.gov (United States)

Levin, Sheldon M.

The physics majors at The University of California at Los Angeles (UCLA) were fond of “Big Joe,” as he was called behind his back. There was an air of boyishness about him when playing in the annual faculty-student softball game. Yet Dr. Joseph Kaplan (Figure 1) could be formal and imposing when discussing a thesis or a research project. He had been the popular chairman of the Physics Department since 1936, when he was 34. The pipe clenched between his teeth was ever present, even when he was sliding into third base.

Measurement of $\\Delta^{++}$(1232) production in hadronic Z decays

CERN Document Server

Abreu, P; Adye, T; Agasi, E; Ajinenko, I; Aleksan, Roy; Alekseev, G D; Allport, P P; Almehed, S; Alvsvaag, S J; Amaldi, Ugo; Amato, S; Andreazza, A; Andrieux, M L; Antilogus, P; Anykeyev, V B; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barate, R; Bardin, Dimitri Yuri; Barker, G J; Baroncelli, A; Bärring, O; Barrio, J A; Bartl, Walter; Bates, M J; Battaglia, Marco; Baubillier, M; Baudot, J; Becks, K H; Begalli, M; Beillière, P; Belokopytov, Yu A; Benvenuti, Alberto C; Berggren, M; Bertrand, D; Bianchi, F; Bigi, M; Bilenky, S M; Billoir, P; Bloch, D; Blume, M; Blyth, S; Bocci, V; Bolognese, T; Bonesini, M; Bonivento, W; Booth, P S L; Borisov, G; Bosio, C; Bosworth, S; Botner, O; Bouquet, B; Bourdarios, C; Bowcock, T J V; Bozzo, M; Branchini, P; Brand, K D; Brenke, T; Brenner, R A; Bricman, C; Brillault, L; Brown, R C A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschmann, P; Buys, A; Caccia, M; Calvi, M; Camacho-Rozas, A J; Camporesi, T; Canale, V; Canepa, M; Cankocak, K; Cao, F; Carena, F; Carrilho, P; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Cerrito, L; Chabaud, V; Charpentier, P; Chaussard, L; Chauveau, J; Checchia, P; Chelkov, G A; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Cindro, V; Collins, P; Contreras, J L; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Dahl-Jensen, Erik; Dahm, J; D'Almagne, B; Dam, M; Damgaard, G; Daum, A; Dauncey, P D; Davenport, Martyn; Da Silva, W; Defoix, C; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; De Boeck, H; de Boer, Wim; De Brabandere, S; De Clercq, C; La Vaissière, C de; De Lotto, B; De Min, A; De Paula, L S; De Saint-Jean, C; Dijkstra, H; Di Ciaccio, Lucia; Djama, F; Dolbeau, J; Dönszelmann, M; Doroba, K; Dracos, M; Drees, J; Drees, K A; Dris, M; Dufour, Y; Dupont, F; Edsall, D M; Ehret, R; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Elsing, M; Engel, J P; Ershaidat, N; Erzen, B; Espirito-Santo, M C; Falk, E; Fassouliotis, D; Feindt, Michael; Ferrer, A; Filippas-Tassos, A; Firestone, A; Fischer, P A; Föth, H; Fokitis, E; Fontanelli, F; Formenti, F; Franek, B J; Frenkiel, P; Fries, D E C; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gandelman, M; García, C; García, J; Gaspar, C; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerber, J P; Gibbs, M; Gokieli, R; Golob, B; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Graziani, E; Grosdidier, G; Gunnarsson, P; Günther, M; Guy, J; Haedinger, U; Hahn, F; Hahn, M; Hahn, S; Hajduk, Z; Hallgren, A; Hamacher, K; Hao, W; Harris, F J; Hedberg, V; Henriques, R P; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Higón, E; Hilke, Hans Jürgen; Hill, T S; Holmgren, S O; Holt, P J; Holthuizen, D J; Houlden, M A; Hrubec, Josef; Huet, K; Hultqvist, K; Ioannou, P; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, L B; Jönsson, P E; Joram, Christian; Juillot, P; Kaiser, M; Kapusta, F; Karlsson, M; Karvelas, E; Katsanevas, S; Katsoufis, E C; Keränen, R; Khomenko, B A; Khovanskii, N N; King, B J; Kjaer, N J; Klein, H; Klovning, A; Kluit, P M; Köhne, J H; Köne, B; Kokkinias, P; Koratzinos, M; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Kramer, P H; Krammer, Manfred; Kreuter, C; Królikowski, J; Kronkvist, I J; Krumshtein, Z; Krupinski, W; Kubinec, P; Kucewicz, W; Kurvinen, K L; Lacasta, C; Laktineh, I; Lamblot, S; Lamsa, J; Lanceri, L; Lane, D W; Langefeld, P; Lapin, V; Last, I; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Legan, C K; Leitner, R; Lemoigne, Y; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Liko, D; Lindner, R; Lipniacka, A; Lippi, I; Lörstad, B; Lokajícek, M; Loken, J G; López, J M; López-Fernandez, A; López-Aguera, M A; Loukas, D; Lutz, P; Lyons, L; Maehlum, G; Maio, A; Malychev, V; Mandl, F; Marco, J; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Maron, T; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; Medbo, J; Meroni, C; Meyer, W T; Michelotto, M; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Møller, R; Mönig, K; Monge, M R; Morettini, P; Müller, H; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Naraghi, F; Navarria, Francesco Luigi; Navas, S; Negri, P; Némécek, S; Neumann, W; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nieuwenhuizen, M; Nikolaenko, V; Niss, P; Nomerotski, A; Normand, Ainsley; Oberschulte-Beckmann, W; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Paganini, P; Paganoni, M; Pagès, P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Passeri, A; Pegoraro, M; Pernegger, H; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Piana, G; Pierre, F; Pimenta, M; Pindo, M; Plaszczynski, S; Podobrin, O; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Prest, M; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Reale, M; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Renton, P B; Resvanis, L K; Richard, F; Richardson, J; Rídky, J; Rinaudo, G; Ripp, I; Romero, A; Roncagliolo, I; Ronchese, P; Roos, L; Rosenberg, E I; Rosso, E; Roudeau, Patrick; Rovelli, T; Rückstuhl, W; Ruhlmann-Kleider, V; Ruiz, A; Rybicki, K; Rybin, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sánchez, J; Sannino, M; Schneider, H; Schyns, M A E; Sciolla, G; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seitz, A; Sekulin, R L; Shellard, R C; Siccama, I; Siegrist, P; Simonetti, S; Simonetto, F; Sissakian, A N; Sitár, B; Skaali, T B; Smadja, G; Smirnova, O G; Smith, G R; Sosnowski, R; Souza-Santos, D; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stanescu, C; Stapnes, Steinar; Stavitski, I; Stepaniak, K; Stichelbaut, F; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tavernet, J P; Chikilev, O G; Tilquin, A; Timmermans, J; Tkatchev, L G; Todorov, T; Toet, D Z; Tomaradze, A G; Tomé, B; Tortora, L; Tranströmer, G; Treille, D; Trischuk, W; Tristram, G; Trombini, A; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tyndel, M; Tzamarias, S; Überschär, B; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, C; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Vilanova, D; Vincent, P; Vitale, L; Vlasov, E; Vodopyanov, A S; Vrba, V; Wahlen, H; Walck, C; Waldner, F; Weierstall, M; Weilhammer, Peter; Wetherell, Alan M; Wicke, D; Wickens, J H; Wielers, M; Wilkinson, G R; Williams, W S C; Winter, M; Witek, M; Woschnagg, K; Yip, K; Yushchenko, O P; Zach, F; Zacharatou-Jarlskog, C; Zaitsev, A; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zhigunov, V P; Zimin, N I; Zito, M; Zontar, D; Zuberi, R; Zucchelli, G C; Zumerle, G

1995-01-01

A measurement of the \\Delta^{++}(1232) inclusive production in hadronic decays of the Z at LEP is presented, based on 1.3 million hadronic events collected~ by the DELPHI~ detector in the 1994 LEP running~ period. The DELPHI ring imaging Cherenkov counters are used for identifying hadrons. The average \\Delta^{++}(1232) multiplicity per hadronic event is 0.079 \\pm 0.015 which is more than a factor of two below the JETSET, HERWIG and UCLA model predictions. It agrees with a recently proposed universal mass dependence of particle production rates in e^{+}e^- annihilations.

Reconstrução coracoclavicular com enxerto tendíneo na luxação acromioclavicular crônica Coracoclavicular reconstruction using tendinous graft for chronic acromioclavicular joint dislocation

Directory of Open Access Journals (Sweden)

Jorge Henrique Assunção

2011-01-01

Full Text Available OBJETIVO: Apresentar os resultados radiográficos e funcionais de pacientes submetidos ao tratamento da luxação acromioclavicular crônica com reconstrução dos ligamentos coracoclaviculares com enxerto de tendão semitendíneo. MÉTODO: Quinze pacientes, entre abril de 2007 e junho de 2008, foram submetidos a reconstrução dos ligamentos coracoclaviculares com enxerto tendíneo. Dois pacientes foram excluídos do estudo por seguimento inadequado. Treze pacientes foram seguidos clinicamente e radiograficamente, em média, por 16 meses (12-26 meses. Os pacientes foram submetidos a avaliação clinica pré e pós-operatória, utilizando os escores Constant e UCLA. Radiografias pré e pós-operatórias foram comparadas. RESULTADOS: Neste grupo de 13 pacientes com seguimento mínimo de um ano, o escore Constant variou de 60,9 (26-88 na avaliação pré-operatória para 87 (60-98 na última avaliação no período pós-operatório. O escore UCLA foi de 16,8 (11-27 no pré operatório para 33 (29-35 na avaliação pós-operatória (p=0,001. No controle radiográfico com um ano de pós-operatório, encontramos 12 pacientes (92% com a distância coracoclavicular igual comparando o ombro operado ao contralateral. Todos os ombros operados apresentavam-se sem translação na direção antero-posterior no perfil axilar. CONCLUSÃO: O resultado funcional e radiográfico foi muito satisfatório nos pacientes submetidos à reconstrução das luxações acromioclaviculares crônicas, com baixo indice de recidiva. Nivel de Evidência IV, série de casos.OBJECTIVE: The aim of this study is to present the radiographic and functional results of patients undergoing treatment for chronic acromioclavicular dislocation with coracoclavicular ligament reconstruction using tendon graft. METHOD: Between 2007 and 2008, fifteen patients with chronic Rockwood type III through V acromioclavicular joint dislocations underwent reconstruction of the coracoclavicular ligaments

Avaliação dos resultados da artroplastia parcial de ombro para tratamento da artropatia por lesão do manguito rotador Evaluating the results of partial shoulder arthroplasty for the treatment of arthropathy due to rotator cuff lesion

Directory of Open Access Journals (Sweden)

Sérgio Luiz Checchia

2008-06-01

Full Text Available OBJETIVO: Avaliar os resultados obtidos com a artroplastia parcial de ombro para o tratamento da artropatia por lesão do manguito rotador. MÉTODOS: No período de junho de 1989 a março de 2004, 11 ombros de 11 pacientes foram submetidos a artroplastia parcial de ombro para o tratamento de artropatia por LMR. O tempo de seguimento variou de 27 a 183 meses, com média de 69 meses. A idade média foi de 69,1 anos, variando de 44 a 78 anos. Houve predomínio do sexo feminino em 90,9% dos casos (10 pacientes. O membro dominante foi acometido em 10 pacientes. Os métodos escolhidos para avaliação dos pacientes, no seguimento pós-operatório, basearam-se nos critérios da UCLA; no índice de satisfação dos pacientes em relação ao alívio da dor; e no método de avaliação de objetivos limitados, proposto por Neer et al. RESULTADOS: O índice de satisfação dos pacientes em relação ao alívio da dor foi de 81,8%. Com o método de avaliação da UCLA, observamos média de 22,7 pontos. Por meio do método de avaliação de objetivos limitados, proposto por Neer et al, obtivemos seis pacientes com resultados satisfatórios e cinco insatisfatórios. CONCLUSÃO: A artroplastia parcial de ombro para o tratamento da artropatia por lesão do manguito rotador promove alívio do quadro doloroso e permite alguma melhora na função do membro para realização das atividades diárias; entretanto, é uma técnica que leva a altos índices de resultados insatisfatórios.OBJECTIVE: To evaluate the results achieved with partial arthroplasty of the shoulder to treat arthropathy due to rotator cuff lesion. METHODS: From June 1989 to March 2004, 11 shoulders of 11 patients were submitted to partial arthroplasty of the shoulder to treat an arthropathy due to rotator cuff lesion. Follow-up time varied from 27 to 182 months, with a mean of 69 months. Mean age was 69.1 years, ranging from 44 to 78 years. There was a predominance of the female gender, in 90.9% of

Evidence-Based Social Skills Training for Adolescents with Autism Spectrum Disorders: The UCLA PEERS Program

Science.gov (United States)

Laugeson, Elizabeth A.; Frankel, Fred; Gantman, Alexander; Dillon, Ashley R.; Mogil, Catherine

2012-01-01

The present study examines the efficacy and durability of the PEERS Program, a parent-assisted social skills group intervention for high-functioning adolescents with ASD. Results indicate that teens receiving PEERS significantly improved their social skills knowledge, social responsiveness, and overall social skills in the areas of social…

MO-E-BRC-02: MRI-Guided Online Adaptive Radiotherapy: The UCLA Approach to Quality Management

Energy Technology Data Exchange (ETDEWEB)

Lamb, J. [University of California, Los Angeles (United States)

2016-06-15

Online adaptive radiation therapy has the potential to ensure delivery of optimal treatment to the patient by accounting for anatomical and potentially functional changes that occur from one fraction to the next and over the course of treatment. While on-line adaptive RT (ART) has been a topic of many publications, discussions, and research, it has until very recently remained largely a concept and not a practical implementation. However, recent advances in on-table imaging, use of deformable image registration for contour generation and dose tracking, faster and more efficient plan optimization, as well as fast quality assurance method has enabled the implementation of ART in the clinic in the past couple of years. The introduction of these tools into routine clinical use requires many considerations and progressive knowledge to understand how processes that have historically taken hours/days to complete can now be done in less than 30 minutes. This session will discuss considerations to perform real time contouring, planning and patient specific QA, as well as a practical workflow and the required resources. Learning Objectives: To understand the difficulties, challenges and available technologies for online adaptive RT. To understand how to implement online adaptive therapy in a clinical environment and to understand the workflow and resources required. To understand the limitations and sources of uncertainty in the online adaptive process I have research funding from ViewRay Inc. and Philips Medical Systems.; R. Kashani, I have research funding from ViewRay Inc. and Philips Medical Systems.; X. Li, Research supported by Elekta Inc.

MO-E-BRC-02: MRI-Guided Online Adaptive Radiotherapy: The UCLA Approach to Quality Management

International Nuclear Information System (INIS)

Lamb, J.

2016-01-01

Online adaptive radiation therapy has the potential to ensure delivery of optimal treatment to the patient by accounting for anatomical and potentially functional changes that occur from one fraction to the next and over the course of treatment. While on-line adaptive RT (ART) has been a topic of many publications, discussions, and research, it has until very recently remained largely a concept and not a practical implementation. However, recent advances in on-table imaging, use of deformable image registration for contour generation and dose tracking, faster and more efficient plan optimization, as well as fast quality assurance method has enabled the implementation of ART in the clinic in the past couple of years. The introduction of these tools into routine clinical use requires many considerations and progressive knowledge to understand how processes that have historically taken hours/days to complete can now be done in less than 30 minutes. This session will discuss considerations to perform real time contouring, planning and patient specific QA, as well as a practical workflow and the required resources. Learning Objectives: To understand the difficulties, challenges and available technologies for online adaptive RT. To understand how to implement online adaptive therapy in a clinical environment and to understand the workflow and resources required. To understand the limitations and sources of uncertainty in the online adaptive process I have research funding from ViewRay Inc. and Philips Medical Systems.; R. Kashani, I have research funding from ViewRay Inc. and Philips Medical Systems.; X. Li, Research supported by Elekta Inc.

UCLA at TREC 2014 Clinical Decision Support Track: Exploring Language Models, Query Expansion, and Boosting

Science.gov (United States)

2014-11-01

qualitative benet to the retrieved results compared to lower and higher boost factors. 3 Query terms Comments right lower quadrant abdominal pain ... pain for hours, decreased appetite, and enlarged appendix on abdominal ultrasound. Table 1 describes the query terms for an example patient summary. The...the diagnostic process. For example, pediatric cases, women of child- bearing age, and geriatic populations each have a distinct set of possible

TU-CD-BRD-04: UCLA Experience, with Focus On Developing Metrics and Using RO-ILS

International Nuclear Information System (INIS)

Beron, P.

2015-01-01

It has long been standard practice in radiation oncology to report internally when a patient’s treatment has not gone as planned and to report events to regulatory agencies when legally required. Most potential errors are caught early and never affect the patient. Quality assurance steps routinely prevent errors from reaching the patient, and these “near misses” are much more frequent than treatment errors. A growing number of radiation oncology facilities have implemented incident learning systems to report and analyze both errors and near misses. Using the term “incident learning” instead of “event reporting” emphasizes the need to use these experiences to change the practice and make future errors less likely and promote an educational, non-punitive environment. There are challenges in making such a system practical and effective. Speakers from institutions of different sizes and practice environments will share their experiences on how to make such a system work and what benefits their clinics have accrued. Questions that will be addressed include: How to create a system that is easy for front line staff to access How to motivate staff to report How to promote the system as positive and educational and not punitive or demeaning How to organize the team for reviewing and responding to reports How to prioritize which reports to discuss in depth How not to dismiss the rest How to identify underlying causes How to design corrective actions and implement change How to develop useful statistics and analysis tools How to coordinate a departmental system with a larger risk management system How to do this without a dedicated quality manager Some speakers’ experience is with in-house systems and some will share experience with the AAPM/ASTRO national Radiation Oncology Incident Learning System (RO-ILS). Reports intended to be of value nationally need to be comprehensible to outsiders; examples of useful reports will be shown. There will be ample time set aside for audience members to contribute to the discussion. Learning Objectives: Learn how to promote the use of an incident learning system in a clinic. Learn how to convert “event reporting” into “incident learning”. See examples of practice changes that have come out of learning systems. Learn how the RO-ILS system can be used as a primary internal learning system. Learn how to create succinct, meaningful reports useful to outside readers. Gary Ezzell chairs the AAPM committee overseeing RO-ILS and has received an honorarium from ASTRO for working on the committee reviewing RO-ILS reports. Derek Brown is a director of http://TreatSafely.org . Brett Miller has previously received travel expenses and an honorarium from Varian. Phillip Beron has nothing to report

TU-CD-BRD-04: UCLA Experience, with Focus On Developing Metrics and Using RO-ILS

Energy Technology Data Exchange (ETDEWEB)

Beron, P. [University of California, Los Angeles (United States)

2015-06-15

It has long been standard practice in radiation oncology to report internally when a patient’s treatment has not gone as planned and to report events to regulatory agencies when legally required. Most potential errors are caught early and never affect the patient. Quality assurance steps routinely prevent errors from reaching the patient, and these “near misses” are much more frequent than treatment errors. A growing number of radiation oncology facilities have implemented incident learning systems to report and analyze both errors and near misses. Using the term “incident learning” instead of “event reporting” emphasizes the need to use these experiences to change the practice and make future errors less likely and promote an educational, non-punitive environment. There are challenges in making such a system practical and effective. Speakers from institutions of different sizes and practice environments will share their experiences on how to make such a system work and what benefits their clinics have accrued. Questions that will be addressed include: How to create a system that is easy for front line staff to access How to motivate staff to report How to promote the system as positive and educational and not punitive or demeaning How to organize the team for reviewing and responding to reports How to prioritize which reports to discuss in depth How not to dismiss the rest How to identify underlying causes How to design corrective actions and implement change How to develop useful statistics and analysis tools How to coordinate a departmental system with a larger risk management system How to do this without a dedicated quality manager Some speakers’ experience is with in-house systems and some will share experience with the AAPM/ASTRO national Radiation Oncology Incident Learning System (RO-ILS). Reports intended to be of value nationally need to be comprehensible to outsiders; examples of useful reports will be shown. There will be ample time set aside for audience members to contribute to the discussion. Learning Objectives: Learn how to promote the use of an incident learning system in a clinic. Learn how to convert “event reporting” into “incident learning”. See examples of practice changes that have come out of learning systems. Learn how the RO-ILS system can be used as a primary internal learning system. Learn how to create succinct, meaningful reports useful to outside readers. Gary Ezzell chairs the AAPM committee overseeing RO-ILS and has received an honorarium from ASTRO for working on the committee reviewing RO-ILS reports. Derek Brown is a director of http://TreatSafely.org . Brett Miller has previously received travel expenses and an honorarium from Varian. Phillip Beron has nothing to report.

A portable approach for PIC on emerging architectures

Science.gov (United States)

Decyk, Viktor

2016-03-01

A portable approach for designing Particle-in-Cell (PIC) algorithms on emerging exascale computers, is based on the recognition that 3 distinct programming paradigms are needed. They are: low level vector (SIMD) processing, middle level shared memory parallel programing, and high level distributed memory programming. In addition, there is a memory hierarchy associated with each level. Such algorithms can be initially developed using vectorizing compilers, OpenMP, and MPI. This is the approach recommended by Intel for the Phi processor. These algorithms can then be translated and possibly specialized to other programming models and languages, as needed. For example, the vector processing and shared memory programming might be done with CUDA instead of vectorizing compilers and OpenMP, but generally the algorithm itself is not greatly changed. The UCLA PICKSC web site at http://www.idre.ucla.edu/ contains example open source skeleton codes (mini-apps) illustrating each of these three programming models, individually and in combination. Fortran2003 now supports abstract data types, and design patterns can be used to support a variety of implementations within the same code base. Fortran2003 also supports interoperability with C so that implementations in C languages are also easy to use. Finally, main codes can be translated into dynamic environments such as Python, while still taking advantage of high performing compiled languages. Parallel languages are still evolving with interesting developments in co-Array Fortran, UPC, and OpenACC, among others, and these can also be supported within the same software architecture. Work supported by NSF and DOE Grants.

Quantification of design margins and safety factors based on the prediction uncertainty in tritium production rate from fusion integral experiments of the USDOE/JAERI collaborative program on fusion blanket neutronics

International Nuclear Information System (INIS)

Youssef, M.Z.; Konno, C.; Maekawa, F.; Ikeda, Y.; Kosako, K.; Nakagawa, M.; Mori, T.; Maekawa, H.

1995-01-01

Several fusion integral experiments were performed within a collaboration between the USA and Japan on fusion breeder neutronics aimed at verifying the prediction accuracy of key neutronics parameters in a fusion reactor blanket based on current neutron transport codes and basic nuclear databases. The focus has been on the tritium production rate (TRP) as an important design parameter to resolve the issue of tritium self-sufficiency in a fusion reactor. In this paper, the calculational and experimental uncertainties (errors) in local TPR in each experiment performed i were interpolated and propagated to estimate the prediction uncertainty u i in the line-integrated TPR and its standard deviation σ i . The measured data are based on Li-glass and NE213 detectors. From the quantities u i and σ i , normalized density functions (NDFs) were constructed, considering all the experiments and their associated analyses performed independently by the UCLA and JAERI. Several statistical parameters were derived, including the mean prediction uncertainties u and the possible spread ±σ u around them. Design margins and safety factors were derived from these NDFs. Distinction was made between the results obtained by UCLA and JAERI and between calculational results based on the discrete ordinates and Monte Carlo methods. The prediction uncertainties, their standard deviations and the design margins and safety factors were derived for the line-integrated TPR from Li-6 T 6 , and Li-7 T 7 . These parameters were used to estimate the corresponding uncertainties and safety factor for the line-integrated TPR from natural lithium T n . (orig.)

SME-type carbapenem-hydrolyzing class A beta-lactamases from geographically diverse Serratia marcescens strains.

Science.gov (United States)

Queenan, A M; Torres-Viera, C; Gold, H S; Carmeli, Y; Eliopoulos, G M; Moellering, R C; Quinn, J P; Hindler, J; Medeiros, A A; Bush, K

2000-11-01

Three sets of carbapenem-resistant Serratia marcescens isolates have been identified in the United States: 1 isolate in Minnesota in 1985 (before approval of carbapenems for clinical use), 5 isolates in Los Angeles (University of California at Los Angeles [UCLA]) in 1992, and 19 isolates in Boston from 1994 to 1999. All isolates tested produced two beta-lactamases, an AmpC-type enzyme with pI values of 8.6 to 9.0 and one with a pI value of approximately 9.5. The enzyme with the higher pI in each strain hydrolyzed carbapenems and was not inhibited by EDTA, similar to the chromosomal class A SME-1 beta-lactamase isolated from the 1982 London strain S. marcescens S6. The genes encoding the carbapenem-hydrolyzing enzymes were cloned in Escherichia coli and sequenced. The enzyme from the Minnesota isolate had an amino acid sequence identical to that of SME-1. The isolates from Boston and UCLA produced SME-2, an enzyme with a single amino acid change relative to SME-1, a substitution from valine to glutamine at position 207. Purified SME enzymes from the U. S. isolates had beta-lactam hydrolysis profiles similar to that of the London SME-1 enzyme. Pulsed-field gel electrophoresis analysis revealed that the isolates showed some similarity but differed by at least three genetic events. In conclusion, a family of rare class A carbapenem-hydrolyzing beta-lactamases first described in London has now been identified in S. marcescens isolates across the United States.

SME-Type Carbapenem-Hydrolyzing Class A β-Lactamases from Geographically Diverse Serratia marcescens Strains

Science.gov (United States)

Queenan, Anne Marie; Torres-Viera, Carlos; Gold, Howard S.; Carmeli, Yehuda; Eliopoulos, George M.; Moellering, Robert C.; Quinn, John P.; Hindler, Janet; Medeiros, Antone A.; Bush, Karen

2000-01-01

Three sets of carbapenem-resistant Serratia marcescens isolates have been identified in the United States: 1 isolate in Minnesota in 1985 (before approval of carbapenems for clinical use), 5 isolates in Los Angeles (University of California at Los Angeles [UCLA]) in 1992, and 19 isolates in Boston from 1994 to 1999. All isolates tested produced two β-lactamases, an AmpC-type enzyme with pI values of 8.6 to 9.0 and one with a pI value of approximately 9.5. The enzyme with the higher pI in each strain hydrolyzed carbapenems and was not inhibited by EDTA, similar to the chromosomal class A SME-1 β-lactamase isolated from the 1982 London strain S. marcescens S6. The genes encoding the carbapenem-hydrolyzing enzymes were cloned in Escherichia coli and sequenced. The enzyme from the Minnesota isolate had an amino acid sequence identical to that of SME-1. The isolates from Boston and UCLA produced SME-2, an enzyme with a single amino acid change relative to SME-1, a substitution from valine to glutamine at position 207. Purified SME enzymes from the U.S. isolates had β-lactam hydrolysis profiles similar to that of the London SME-1 enzyme. Pulsed-field gel electrophoresis analysis revealed that the isolates showed some similarity but differed by at least three genetic events. In conclusion, a family of rare class A carbapenem-hydrolyzing β-lactamases first described in London has now been identified in S. marcescens isolates across the United States. PMID:11036019

¿La edad avanzada del paciente es una contraindicación para la reparación artroscópica del manguito rotador? [Is advanced age a contraindication for rotator cuff arthroscopic repair?

Directory of Open Access Journals (Sweden)

Ignacio Tanoira

2014-02-01

Full Text Available Re­su­men Objetivo: evaluar la evolución posoperatoria de una serie de pacientes mayores de 80 años sometidos a cirugía artroscópica para reparar el manguito rotador. Materiales­y­Métodos Entre junio de 2004 y marzo de 2007, se evaluó a 20 pacientes de 80 años o más, a los que se les realizó una reparación artroscópica del manguito rotador. Todos habían recibido tratamiento conservador que no fue eficaz. En el seguimiento, se emplearon los puntajes de UCLA, Constant y QuickDASH, y la escala analógica visual para el dolor, la función y la calidad de vida. Resultados El seguimiento promedio fue de 28 meses (rango 24-48. El puntaje de UCLA fue de 10,4 preoperatorio y 28,6 posoperatorio (p<0,05. el puntaje de Constant mejoró de 31,5 antes de la cirugía a 69,3 después de ella (p <0,05. El puntaje de QuickDASH mostró una mejoría de 33 a 16 puntos en el posoperatorio (p <0,05. La escala analógica visual para el dolor preoperatorio arrojó 8 puntos y, en el posoperatorio, se obtuvo un promedio de 2,2 puntos (p <0,05. No hubo complicaciones. Conclusiones En esta serie de reparación del manguito rotador en personas mayores de 80 años, se obtuvieron mejoras significativas en todos los pacientes.

Arthroscopic repair of anterosuperior rotator cuff tears: in-continuity technique vs. disruption of subscapularis-supraspinatus tear margin: comparison of clinical outcomes and structural integrity between the two techniques.

Science.gov (United States)

Kim, Sung-Jae; Jung, Min; Lee, Jae-Hoo; Kim, Chul; Chun, Yong-Min

2014-12-17

The purpose of this study was to compare the clinical outcomes and structural integrity after two techniques of arthroscopic anterosuperior rotator cuff repair: in continuity and disruption of the tear margin. This study included fifty-nine patients who underwent arthroscopic repair of an anterosuperior rotator cuff tear that was done either by disrupting the margin between the subscapularis and supraspinatus tears (Group A) or by performing the repair in continuity without disrupting the margin (Group B). Clinical outcomes were assessed on the basis of a visual analog scale (VAS) pain score, subjective shoulder value (SSV), American Shoulder and Elbow Surgeons (ASES) score, University of California at Los Angeles (UCLA) shoulder score, and active range of motion of the shoulder. Subscapularis strength was assessed with use of the modified belly-press test. Magnetic resonance arthrography (MRA) or computed tomographic arthrography (CTA) was performed at six months after surgery to assess the structural integrity of the repair. At the two-year follow-up evaluation, VAS pain scores, SSVs, ASES scores, UCLA shoulder scores, subscapularis strength, and active range of motion improved significantly in both groups compared with preoperatively (p tears of the rotator cuff, the technique of in-continuity repair did not produce better clinical outcomes or structural integrity than the technique involving disruption of the tear margin. If the muscle in an anterosuperior rotator cuff tear is of good quality, it does not appear to matter whether the tear margin between the subscapularis and supraspinatus is preserved or disrupted. Copyright © 2014 by The Journal of Bone and Joint Surgery, Incorporated.

Functional and radiological evaluation of acute acromioclavicular dislocation treated with anchors without eyelet: comparison with other techniques

Directory of Open Access Journals (Sweden)

Alexandre Tadeu do Nascimento

Full Text Available ABSTRACT OBJECTIVE: To assess the repair results of acromioclavicular dislocations (ACJD grades III and V, with anchors without eyelet, when compared with other techniques, and to evaluate factors that can affect the final result. METHODS: A retrospective study of 36 patients with ACJD grades III and V in the Rockwood classification, 12 treated with anchors without eyelet, 11 with one tightrope, six with two tightropes, and six with subcoracoid cerclage, operated from September 2012 to February 2015. Patients were assessed radiographically and through DASH, UCLA, the visual analog scale of pain (VAS and the Short-Form 36 (SF-36. Surgical time and the possible influence of some factors in the outcome were also assessed. RESULTS: The mean DASH score was 6.7; UCLA, 32.9; VAS, 1.2; and SF-36, 79.47. Radiographically, the final mean measurement was 9.93 mm, with no statistical difference between the groups. The mean surgical time for Group I was 31 min; Group II, 19 min; Group III, 29 min; and Group IV, 59 min. There was a significant difference between Groups II and IV when compared with the study group. The initial and immediate post-operative ACJD measurements ACJD were correlated with the final measure. CONCLUSION: The repair of acute ACJD with anchors without eyelet is as effective as the other methods, with significantly shorter operative time when compared with the subcoracoid cerclage technique. The final radiological result is influenced by the coracoclavicular initial distance and the immediate postoperative measurement.

Integration of the informal sector into municipal solid waste management in the Philippines - What does it need?

Energy Technology Data Exchange (ETDEWEB)

Paul, Johannes G., E-mail: jp.aht.p3@gmail.com [GIZ-AHT Project Office SWM4LGUs, c/o DENR, Iloilo City (Philippines); Arce-Jaque, Joan [GIZ-AHT Project Office SWM4LGUs, c/o DENR, Iloilo City (Philippines); Ravena, Neil; Villamor, Salome P. [General Service Office, City Government, Iloilo City (Philippines)

2012-11-15

The integration of the informal sector into municipal solid waste management is a challenge many developing countries face. In Iloilo City, Philippines around 220 tons of municipal solid waste are collected every day and disposed at a 10 ha large dumpsite. In order to improve the local waste management system the Local Government decided to develop a new Waste Management Center with integrated landfill. However, the proposed area is adjacent to the presently used dumpsite where more than 300 waste pickers dwell and depend on waste picking as their source of livelihood. The Local Government recognized the hidden threat imposed by the waste picker's presence for this development project and proposed various measures to integrate the informal sector into the municipal solid waste management (MSWM) program. As a key intervention a Waste Workers Association, called USWAG Calahunan Livelihood Association Inc. (UCLA) was initiated and registered as a formal business enterprise in May 2009. Up to date, UCLA counts 240 members who commit to follow certain rules and to work within a team that jointly recovers wasted materials. As a cooperative they are empowered to explore new livelihood options such as the recovery of Alternative Fuels for commercial (cement industry) and household use, production of compost and making of handicrafts out of used packages. These activities do not only provide alternative livelihood for them but also lessen the generation of leachate and Greenhouse Gases (GHG) emissions from waste disposal, whereby the life time of the proposed new sanitary landfill can be extended likewise.

A pilot study of regenerative therapy using controlled release of recombinant human fibroblast growth factor for patients with pre-collapse osteonecrosis of the femoral head.

Science.gov (United States)

Kuroda, Yutaka; Asada, Ryuta; So, Kazutaka; Yonezawa, Atsushi; Nankaku, Manabu; Mukai, Kumi; Ito-Ihara, Toshiko; Tada, Harue; Yamamoto, Michio; Murayama, Toshinori; Morita, Satoshi; Tabata, Yasuhiko; Yokode, Masayuki; Shimizu, Akira; Matsuda, Shuichi; Akiyama, Haruhiko

2016-08-01

We evaluated the safety and clinical outcomes of a single local administration of gelatin hydrogel impregnated with recombinant human fibroblast growth factor (rhFGF)-2 for the treatment of the precollapse stage of osteonecrosis of the femoral head (ONFH). Patients with ONFH (precollapse stage ≤2) received a single local administration of 800 μg of rhFGF-2-impregnated gelatin hydrogel and were followed up for one year. The surgery was performed using a minimally invasive technique involving a 1-cm skin incision, and walking was allowed from day one postoperatively. The primary outcomes included occurrence of adverse events and complications. The secondary outcomes included changes in the Harris hip scores, visual analog scale for pain scores, University of California, Los Angeles (UCLA) activity scores, and radiological images. We included ten patients, of which five experienced 14 adverse events, including one complication from spinal anesthesia. However, patients completely recovered from all adverse events. The mean clinical scores significantly improved by one year postoperatively compared with the pre-operative scores (before vs. after: visual analog score for pain, 21.2 vs. 5.3 mm; UCLA activity score, 5.5 vs. 6.6; Harris hip score, 81.0 vs. 96.9 points). There was only one case of femoral head collapse; however, this occurred in a hip with extensive necrosis. Stage progression and collapse did not occur in the other nine cases. Computed tomography confirmed bone regeneration in the femoral heads. Clinical application of rhFGF-2-impregnated gelatin hydrogel for patients with precollapse ONFH was feasible and safe.

Treatment of adolescents with morbid obesity with bariatric procedures and anti-obesity pharmacological agents

Directory of Open Access Journals (Sweden)

Um SS

2011-12-01

Full Text Available Scott S Um1, Wendelin Slusser2, Daniel A DeUgarte11Department of Surgery, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA; 2Department of Pediatrics, David Geffen School of Medicine at UCLA, Los Angeles, CA, USAAbstract: Adolescent obesity is a growing health concern that can have immense physical and psychological impact. Treatment of morbidly obese adolescents should include a multidisciplinary team to address medical comorbidities, diet, physical activity, mental health, and behavior modification. Anti-obesity pharmacologic agents have a limited role in the treatment of adolescents because of concerns with side effects, safety, and efficacy. Orlistat (GlaxoSmithKline, Moon Township, PA is the only approved medication for weight-loss in adolescents. However, it is associated with gastrointestinal side effects and its long-term efficacy is unknown. Bariatric surgery is the most effective therapy to treat morbid obesity. However, adolescents must meet rigorous criteria and have appropriate cognitive, psychological, and social clearance before being considered for surgical intervention. Gastric bypass remains the gold standard bariatric operation. The adjustable gastric band is not FDA-approved for use in patients under 18 years of age. Sleeve gastrectomy is a promising procedure for adolescents because it avoids an intestinal bypass and the implantation of a foreign body. Prospective longitudinal assessment of bariatric surgery procedures is required to determine long-term outcomes. In this manuscript, we review the treatment options, efficacy, and impact on quality of life for morbidly obese adolescents.Keywords: bariatric surgery, morbid obesity, weight loss, adolescent

Convex Clustering: An Attractive Alternative to Hierarchical Clustering

Science.gov (United States)

Chen, Gary K.; Chi, Eric C.; Ranola, John Michael O.; Lange, Kenneth

2015-01-01

The primary goal in cluster analysis is to discover natural groupings of objects. The field of cluster analysis is crowded with diverse methods that make special assumptions about data and address different scientific aims. Despite its shortcomings in accuracy, hierarchical clustering is the dominant clustering method in bioinformatics. Biologists find the trees constructed by hierarchical clustering visually appealing and in tune with their evolutionary perspective. Hierarchical clustering operates on multiple scales simultaneously. This is essential, for instance, in transcriptome data, where one may be interested in making qualitative inferences about how lower-order relationships like gene modules lead to higher-order relationships like pathways or biological processes. The recently developed method of convex clustering preserves the visual appeal of hierarchical clustering while ameliorating its propensity to make false inferences in the presence of outliers and noise. The solution paths generated by convex clustering reveal relationships between clusters that are hidden by static methods such as k-means clustering. The current paper derives and tests a novel proximal distance algorithm for minimizing the objective function of convex clustering. The algorithm separates parameters, accommodates missing data, and supports prior information on relationships. Our program CONVEXCLUSTER incorporating the algorithm is implemented on ATI and nVidia graphics processing units (GPUs) for maximal speed. Several biological examples illustrate the strengths of convex clustering and the ability of the proximal distance algorithm to handle high-dimensional problems. CONVEXCLUSTER can be freely downloaded from the UCLA Human Genetics web site at http://www.genetics.ucla.edu/software/ PMID:25965340

Unsteady jet-slug dynamics

International Nuclear Information System (INIS)

Kang, S.W.

1977-01-01

The present analysis treats the transient load characteristics at the wet-well bottom during the vent-clearing event under loss-of-coolant accident conditions. A conceptual model is introduced wherein the liquid-jet inertia and the net momentum-efflux are the two dominant physical factors. The derived load-history equations were found to be functions of the vent-clearing characteristics and of the jet-decay mode in the liquid pool. The theoretical results obtained by a physical modelling of these phenomena appear to agree reasonably well with the available data from UCLA and from LLL 1 / 5 -scale experiments

Recovery Act - LADWP Smart Grid Regional Demonstration Program Final Technical Report

Energy Technology Data Exchange (ETDEWEB)

Chiu, Sungly [Los Angeles Department of Water and Power, CA (United States); Vohra, Surendra [Los Angeles Department of Water and Power, CA (United States); Abdelshehid, Emil [Los Angeles Department of Water and Power, CA (United States); Szucs, David G. [National Energy Technology Lab. (NETL), Albany, OR (United States)

2016-09-30

LADWP collaborated with its project partners to carry out this demonstration in the designated areas to include two university campuses – the University of California, Los Angeles (UCLA) and the University of Southern California (USC) – surrounding neighborhoods, City of Los Angeles facilities, and LADWP power system test labs. The last project partner, Jet Propulsion Laboratory (JPL) was responsible for the cyber security aspects of the project. The program’s use cases provided insightful information to understand triggers for customers, distributors, and generators to adapt their behavior which aid in reducing system demands and costs, increasing energy efficiency, and increasing grid reliability.

Development of Tandem, Double-Focusing, Electron Impact, Gas Source Mass Spectrometer for Measurement of Rare Double-Substituted Isotoplogues in Geochemistry

Energy Technology Data Exchange (ETDEWEB)

Young, Edward D. [University of California, Los Angeles, CA (United States)

2015-07-30

This project culminated in construction and delivery of the world’s first large-radius gas-source isotope ratio mass spectrometer that permits unparalleled analyses of the stable isotopic composition of methane gas. The instrument, referred to as the “Panorama” and installed at UCLA in March 2015, can now be used to determine the relative abundances of rare isotopic species of methane that serve as tracers of temperature of formation and/or subsequent processing of gas. With this technology we can begin to delineate different sources and sinks of methane isotopically in ways not possible until now.

CTR plasma engineering studies

International Nuclear Information System (INIS)

Miley, G.H.

1990-01-01

The main focus of the work by the Fusion Plasma Engineering Group at the University during the prior contract year involved a study of fusion ash (helium) effects on burn efficiency and on potential ways to control ash buildup. This work has wide application to a variety of fusion reactor concepts, but the immediate application for the present work is in the ARIES tokamak reactor design study now being undertaken by a national design team headed by the UCLA. The examples presented here largely deal with the ARIES-I design which is a D-T device operating in the first instability regime

Final Report: 8th International Symposium on Neutron Capture Therapy (NCT) for Cancer, May 15, 1998 - May 15, 1999

International Nuclear Information System (INIS)

Hawthorne, M.F.

1999-01-01

The 8th International Symposium on Neutron Capture Therapy for Cancer (8th ISNCTC) was held in La Jolla, CA on Sept. 13-18, 1998. This biennial meeting of the International Society for Neutron Capture Therapy (ISNCT) was hosted by Society President M.F. Hawthorne (UCLA Dept. of Chemistry and Biochemistry). The Symposium brought together scientists (300 registrants from 21 countries) from diverse fields to report the latest developments in NCT. Topics of the 275 papers presented (30 plenary lectures, 81 oral presentations, and 164 posters) included the physics of neutron sources, chemistry of tumor-targeting agents, dosimetry, radiobiological studies, and clinical applications

2016 FACET-II Science Workshop Summary Report

Energy Technology Data Exchange (ETDEWEB)

Hogan, Mark J., ed.

2017-07-19

The second in a series of FACET-II Science Workshops was held at SLAC National Accelerator Laboratory on October 17-19, 2016 [1]. The workshop drew thirty-five participants from eighteen different institutions including CERN, DESY, Ecole Polytechnique, FNAL, JAI, LBNL, LLNL, Radiabeam, Radiasoft, SLAC, Stony Brook, Strathclyde, Tech-X, Tsinghua, UC Boulder, UCLA and UT Austin. The 2015 workshop [2, 3] helped prioritize research directions for FACET-II. The 2016 workshop was focused on understanding what improvements are needed at the facility to support the next generation of experiments. All presentations are linked to the workshop website as a permanent record.

Surface-plasmon enhanced photoemission of a silver nano-patterned photocathode

Science.gov (United States)

Zhang, Z.; Li, R.; To, H.; Andonian, G.; Pirez, E.; Meade, D.; Maxson, J.; Musumeci, P.

2017-09-01

Nano-patterned photocathodes (NPC) take advantage of plasmonic effects to resonantly increase absorption of light and localize electromagnetic field intensity on metal surfaces leading to surface-plasmon enhanced photoemission. In this paper, we report the status of NPC research at UCLA including in particular the optimization of the dimensions of a nanohole array on a silver wafer to enhance plasmonic response at 800 nm light, the development of a spectrally-resolved reflectivity measurement setup for quick nanopattern validation, and of a novel cathode plug to enable high power tests of NPCs on single crystal substrates in a high gradient radiofrequency gun.

Identificación de ectoparásitos en Oso melero (Tamandua tetradactyla), Estado Lara, Venezuela

OpenAIRE

Forlano R, María; Mujica L, Franklin; Gallardo Y, Johanmary; Rodríguez L, José

2013-01-01

Objetivo. Identificar especies de ectoparásitos encontrados parasitando naturalmente un Oso melero, el cual fue encontrado muriendo en una vía cercana al pueblo de Bobare, estado Lara, Venezuela. Materiales y métodos. Al ingresar el animal a la sala de anatomía del DCV-UCLA para ser sometido a la técnica de taxidermia, se procedió a revisar a través de la palpación toda la superficie corporal del Oso, con la finalidad de tomar muestras de ectoparásitos presentes en el hospedador; los especíme...

Recent designs for advanced fusion reactor blankets

International Nuclear Information System (INIS)

Sze, D.K.

1994-06-01

A series of reactor design studies based on the Tokamak configuration have been carried out under the direction of Professor Robert Conn of UCLA. They are called ARIES-1 through 4 and PULSAR 1 and 2. The key mission of these studies is to evaluate the attractiveness of fusion assuming different degrees of advancement in either physics or engineering development. Also, the requirements of engineering and physics systems for a pulsed reactor were evaluated by the PULSAR design studies. This paper discusses the directions and conclusions of the blanket and related engineering systems for those design studies

Explicit prediction of ice clouds in general circulation models

Science.gov (United States)

Kohler, Martin

1999-11-01

Although clouds play extremely important roles in the radiation budget and hydrological cycle of the Earth, there are large quantitative uncertainties in our understanding of their generation, maintenance and decay mechanisms, representing major obstacles in the development of reliable prognostic cloud water schemes for General Circulation Models (GCMs). Recognizing their relative neglect in the past, both observationally and theoretically, this work places special focus on ice clouds. A recent version of the UCLA - University of Utah Cloud Resolving Model (CRM) that includes interactive radiation is used to perform idealized experiments to study ice cloud maintenance and decay mechanisms under various conditions in term of: (1) background static stability, (2) background relative humidity, (3) rate of cloud ice addition over a fixed initial time-period and (4) radiation: daytime, nighttime and no-radiation. Radiation is found to have major effects on the life-time of layer-clouds. Optically thick ice clouds decay significantly slower than expected from pure microphysical crystal fall-out (taucld = 0.9--1.4 h as opposed to no-motion taumicro = 0.5--0.7 h). This is explained by the upward turbulent fluxes of water induced by IR destabilization, which partially balance the downward transport of water by snowfall. Solar radiation further slows the ice-water decay by destruction of the inversion above cloud-top and the resulting upward transport of water. Optically thin ice clouds, on the other hand, may exhibit even longer life-times (>1 day) in the presence of radiational cooling. The resulting saturation mixing ratio reduction provides for a constant cloud ice source. These CRM results are used to develop a prognostic cloud water scheme for the UCLA-GCM. The framework is based on the bulk water phase model of Ose (1993). The model predicts cloud liquid water and cloud ice separately, and which is extended to split the ice phase into suspended cloud ice (predicted

Association between patients’ beliefs and oral antidiabetic medication adherence in a Chinese type 2 diabetic population [Corrigendum

Directory of Open Access Journals (Sweden)

Wu P

2016-09-01

Full Text Available Wu P, Liu N. Patient Prefer Adherence. 2016;10:1161–1167. On page 1163, Table 1, the copyright statement “Use of the MMAS-8 is protected by US copyright laws. A license agreement to use the scale is available from: Donald E. Morisky, ScD, ScM, MSPH, Professor, Department of Community Health Sciences, UCLA School of Public Health, 650 Charles E. Young Drive South, Los Angeles, CA 90095-1772, dmorisky@gmail.com” was not included in the Note section. On page 1166, Acknowledgment section, the acknowledgment was “The authors thank the staff at the Department of Endocrinology, the First People’s Hospital of Changzhou, for their assistance and cooperation with the studies. We thank Doctor Honghong Yao, Department of Pharmacology, Medical School of Southeast University, Nanjing, Jiangsu, People’s Republic of China, for her assistance.” however it should have been “The authors thank the staff at the Department of Endocrinology, the First People’s Hospital of Changzhou, for their assistance and cooperation with the studies. We thank Doctor Honghong Yao, Department of Pharmacology, Medical School of Southeast University, Nanjing, Jiangsu, People’s Republic of China, for her assistance. The authors thank Professor Donald E. Morisky, Department of Community Health Sciences, UCLA Fielding School of Public Health, Los Angeles, United States, for granting them to use the copyrighted MMAS-8. Professor Donald E. Morisky has worked his entire career in developing the very important instrument for medication-taking behavior measure. Permission to use the MMAS scales is required.33–35 Reproduction and distribution of the MMAS is protected by US copyright laws. A license agreement to use the scale is available from: Donald E. Morisky, ScD, ScM, MSPH, Professor, Department of Community Health Sciences, UCLA School of Public Health, 650 Charles E. Young Drive South, Los Angeles, CA 90095-1772, dmorisky@gmail.com.” On page 1167, References

A Prospective Randomized Trial of Functional Outcomes Following Rotator Cuff Repair With and Without Acromioplasty

Science.gov (United States)

Tetteh, Elizabeth; Hussey, Kristen Elizabeth; Abrams, Geoffrey D.; Gupta, Anil K.; Dhawan, Aman; Karas, Vasili; Cole, Brian J.; Romeo, Anthony A.; Verma, Nikhil N.

2013-01-01

Objectives: The purpose of this study is to report the clinical outcomes of patients undergoing an arthroscopic rotator cuff repair with and without acromioplasty at a minumul of two year follow-up. Methods: Patients undergoing arthroscopic repair of full thickness rotator cuff tears were randomized into acromioplasty or non-acromioplasty groups. Pre-operatively, validated outcome scores including the Simple Shoulder Test (SST), American Shoulder and Elbow Surgeons score (ASES), UCLA score, and SF-12 health assessment were collected along with physical examination including range of motion and dynamometer strength testing. Pre-operative imaging was also reviewed to classify the acromial morphology, acromial angle, and lateral acromial angulation. Intra-operative data including tear size, repair configuration, and concomitant procedures were recorded. Postoperatively, data was collected at 6 weeks, 6 months, one year and at two years. Results are reported as mean ± standard deviation. Student’s t-test was utilized for statistical analysis with an alpha value of 0.05 set as significant. Results: Sixty-one patients completed surveys pre- and post-operatively at a mean 2.6 years. All patients had at least two year follow-up. Thirty-five patients with an average age of 58.4 years (range 44.4 - 74.7) were randomized to the acromioplasty group (22 male, 13 female) and 26 patients with a mean age of 58.2 years (range 42.9-77.0) to the non-acromioplasty group (17 male, 9 female). All outcome scores improved significantly (p < 0.05) in both groups from pre- to post-operatively at two year follow-up. In the acromioplasty group, improvements were observed for SST (5.6 ± 2.7 to 10.7 ± 1.7), ASES (53.5 ± 16.8 to 91.0 ± 13.5) and UCLA (10.7 ± 3.1 to 17.9 ± 30.0) scores. In the non-acromioplasty group, SST increased from 5.6 ± 3.1 to 10.5 ± 2.2; ASES from 58.9 ± 19.1 to 93.5 ± 10.8, and UCLA from 12.0 ± 2.8 to 17.4 ± 3.7. There was no statistical difference in

Arthroscopic treatment for intratendinous rotator cuff tear results in satisfactory clinical outcomes and structural integrity.

Science.gov (United States)

Cheon, Sang Jin; Lee, Hyo Yeol; Jeon, Woong Ki

2018-04-20

This study aimed to evaluate the clinical outcomes and structural integrity of arthroscopic repair of intratendinous rotator cuff tear. Patients who were diagnosed with an intratendinous tear but in whom conservative treatment failed were selected and underwent arthroscopic repair. Between 2008 and 2014, a total of 30 patients (6 men, 24 women; mean age, 59 ± 3.7 years) met the inclusion criteria and were followed up. The mean follow-up period was 26.3 ± 0.7 months. The results were evaluated using the University of California at Los Angeles (UCLA) score, the Society of the American Shoulder and Elbow Surgeons rating scale (ASES) questionnaire, and the visual analog scale (VAS) and range of motion (ROM) were measured preoperatively and at final follow-up. Magnetic resonance imaging (MRI) was performed preoperatively and at 6.7 ± 0.2 months postoperatively. Postoperative MRI was performed on 27 out of 30 patients and analysed using the Sugaya classification. Corresponding to the preoperative MRI findings, arthroscopic findings of intratendinous tears were observed in all 30 patients. The mean active forward elevation ROM was 137.3° ± 15.4° before surgery and 168.8° ± 15.2° at the final follow-up. The internal and external rotations at abduction were 31.7° ± 5.1° and 63.0° ± 11.6° before surgery, respectively, and 60.5° ± 8.0° and 75.2° ± 10.8° after surgery, respectively. The UCLA score improved from of 20.1 ± 7.4 points preoperative to 28.4 ± 5.5 points at the final follow-up. The ASES score improved from 55.7 ± 15.3 points preoperative to 82.6 ± 9.7 points postoperatively. The VAS for pain score decreased from 6.4 ± 1.2 points preoperative to 1.6 ± 0.9 points postoperative. Satisfactory outcomes (excellent/good) in terms of UCLA and ASES scores were observed in 29 of 30 patients. Based on Sugaya classification, grades I, II, and III structural integrities were observed in 9

Placental-mediated increased cytokine response to lipopolysaccharides: a potential mechanism for enhanced inflammation susceptibility of the preterm fetus

Directory of Open Access Journals (Sweden)

Ross MG

2012-07-01

Full Text Available Julie L Boles,1 Michael G Ross,1 Ron Beloosesky,2 Mina Desai,1 Louiza Belkacemi11Department of Obstetrics and Gynecology, Harbor-UCLA Medical Center, Los Angeles Biomedical Research Institute at Harbor-UCLA, David Geffen School of Medicine at UCLA, University of California, Los Angeles, Torrance, CA, USA; 2Department of Obstetrics and Gynecology, Rambam Medical Center, Haifa, IsraelBackground: Cerebral palsy is a nonprogressive motor impairment syndrome that has no effective cure. The etiology of most cases of cerebral palsy remains unknown; however, recent epidemiologic data have demonstrated an association between fetal neurologic injury and infection/inflammation. Maternal infection/inflammation may be associated with the induction of placental cytokines that could result in increased fetal proinflammatory cytokine exposure, and development of neonatal neurologic injury. Therefore, we sought to explore the mechanism by which maternal infection may produce a placental inflammatory response. We specifically examined rat placental cytokine production and activation of the Toll-like receptor 4 (TLR4 pathway in response to lipopolysaccharide exposure at preterm and near-term gestational ages.Methods: Preterm (e16 or near-term (e20 placental explants from pregnant rats were treated with 0, 1, or 10 µg/mL lipopolysaccharide. Explant integrity was assessed by lactate dehydrogenase assay. Interleukin-6 and tumor necrosis alpha levels were determined using enzyme-linked immunosorbent assay kits. TLR4 and phosphorylated nuclear factor kappa light chain enhancer of activated B cells (NFκB protein expression levels were determined by Western blot analysis.Results: At both e16 and e20, lactate dehydrogenase levels were unchanged by treatment with lipopolysaccharide. After exposure to lipopolysaccharide, the release of interleukin-6 and tumor necrosis alpha from e16 placental explants increased by 4-fold and 8–9-fold, respectively (P < 0.05 versus

Autism Spectrum Disorder Reclassified: A Second Look at the 1980s Utah/UCLA Autism Epidemiologic Study

Science.gov (United States)

Miller, Judith S.; Bilder, Deborah; Farley, Megan; Coon, Hilary; Pinborough-Zimmerman, Judith; Jenson, William; Rice, Catherine E.; Fombonne, Eric; Pingree, Carmen B.; Ritvo, Edward; Ritvo, Riva-Ariella; McMahon, William M.

2013-01-01

The purpose of the present study was to re-examine diagnostic data from a state-wide autism prevalence study (n = 489) conducted in the 1980s to investigate the impact of broader diagnostic criteria on autism spectrum disorder (ASD) case status. Sixty-four (59%) of the 108 originally "Diagnosed Not Autistic" met the current ASD case definition.…

Autism Spectrum Disorder Reclassified: A Second Look at the 1980s Utah/UCLA Autism Epidemiologic Study

Science.gov (United States)

Miller, Judith S.; Farley, Megan; Coon, Hilary; Pinborough-Zimmerman, Judith; Jenson, William; Rice, Catherine E.; Fombonne, Eric; Pingree, Carmen B.; Ritvo, Edward; Ritvo, Riva-Ariella; McMahon, William M.

2015-01-01

The purpose of the present study was to re-examine diagnostic data from a state-wide autism prevalence study (n = 489) conducted in the 1980s to investigate the impact of broader diagnostic criteria on autism spectrum disorder (ASD) case status. Sixty-four (59 %) of the 108 originally “Diagnosed Not Autistic” met the current ASD case definition. The average IQ estimate in the newly identified group (IQ = 35.58; SD = 23.01) was significantly lower than in the original group (IQ = 56.19 SD = 21.21; t = 5.75; p autism with intellectual disability. The current analysis puts this historic work into context and highlights differences in ascertainment between epidemiological studies performed decades ago and those of today. PMID:22696195

Initial liquid metal magnetohydrodynamic thin film flow experiments in the MeGA-loop facility at UCLA

International Nuclear Information System (INIS)

Morley, N.B.; Gaizer, A.A.; Tillack, M.S.; Abdou, M.A.

1995-01-01

Free surface thin film flows of liquid metal were investigated experimentally in the presence of a coplanar magnetic field. This investigation was performed in a new magnetohydrodynamic (MHD) flow facility, the MeGA-loop, utilizing a low melting temperature lead-bismuth alloy as the working metal. Owing to the relatively low magnetic field produced by the present field coil system, the ordinary hydrodynamic and low MHD interaction regimes only were investigated. At the high flow speeds necessary for self cooling, the importance of a well designed and constructed channel becomes obvious. Partial MHD drag, increasing the film height, is observed as Haβ 2 becomes greater than unity. MHD laminarization of the turbulent film flows is observed when Haβ/Re>0.002, but fully laminar flow was not reached. Suggestions for facility upgrades to achieve greater MHD interaction are presented in the context of these initial results. (orig.)

Clinical evaluation of arthroscopic treatment of shoulder adhesive capsulitis

Directory of Open Access Journals (Sweden)

Alberto Naoki Miyazaki

Full Text Available ABSTRACT OBJECTIVE: To evaluate the results of arthroscopic releases performed in patients with adhesive capsulitis refractory to conservative treatment. METHODS: This was a retrospective study, conducted between 1996 and 2012, which included 56 shoulders (52 patients that underwent surgery; 38 were female, and 28 had the dominant side affected. The mean age was 51 (29-73 years. The mean follow-up was 65 (12-168 months and the mean preoperative time was 8.9 (2-24 months. According to Zukermann's classification, 23 cases were considered primary and 33 secondary. With the patient in the lateral decubitus position, circumferential release of the joint capsule was performed: joint debridement; rotator interval opening; coracohumeral ligament release; anterior, posterior, inferior, and finally antero-inferior capsulotomy. A subscapularis tenotomy was performed when necessary. All patients underwent intense physical therapy in the immediate postoperative period. In 33 shoulders, an interscalene catheter was implanted for anesthetic infusion. Functional results were evaluated by the UCLA criteria. RESULTS: Improved range of motion was observed: mean increase of 45° of elevation, 41° of external rotation and eight vertebral levels of medial rotation. According to the UCLA score excellent results were obtained in 25 (45% patients; good, in 24 (45%; fair, in two (3%; and poor, in two (7%. Patients who had undergone inferior capsulotomy achieved better results. Only 8.8% of patients who used the anesthetic infusion catheter underwent postoperative manipulation. Seven patients had complications. CONCLUSION: There was improvement in pain and range of motion. Inferior capsulotomy leads to better results. The use of the interscalene infusion catheter reduces the number of re-approaches.

Early migration characteristics of a 180° porous-coated cup with 1-mm press fit.

Science.gov (United States)

Stihsen, Christoph; Rath, Christopher; Radl, Roman; Saalabian, Ali A; Materna, Wilfried; Rehak, Peter; Windhager, Reinhard

2013-05-01

Evaluation of early cup movement is an important diagnostic tool to predict the likelihood of long-term implant loosening and clinical failure. The investigated cementless cup is clinically proven over 10 years, but there is a paucity of information that accurately describes the migration characteristics of this component. We retrospectively analysed the clinical outcome and migration behaviour of 60 Pinnacle 100 shells after an average 3.8-year follow-up (range 2.1-5.4 years). For migration measurement, EBRA (Einzel-Bild-Röntgen-Analyse) digital software was applied. Clinical assessment was performed using the HHS, the UCLA score and the SF-36 health survey. The clinical outcome showed excellent results with a mean HHS of 95.4 (SD 7.1) and mean UCLA of 6.9 (SD 1.3). All implants were radiologically stable within the observation period and none of the cups was at risk for aseptical loosening. EBRA analysis revealed a mean total migration of 1.4 mm (SD 0.9) (95 % CI 1.1-1.6) at 3 years. Eight cups migrated more than 1 mm within the first three postoperative months, thereafter the migration curves flattened down. Surgeons may expect to find a variable amount of early migration when using the Pinnacle cup. To our knowledge, these are the first results, which show an early "impaction" of a cementless cup, followed by subsequent osseointegration. We believe that an appropriate long-term outcome of the investigated cup is ensured. The data of the present investigation will provide clinicians with useful baseline information with which to compare new cup designs.

Student Perceived Value of Anatomy Pedagogy, Part I: Prosection or Dissection?

Directory of Open Access Journals (Sweden)

Jonathan J. Wisco

2015-01-01

Full Text Available A series of three annual surveys of David Geffen School of Medicine (DGSOM at UCLA students and UCR/UCLA Thomas Haider Program in Biomedical Sciences students were administered from 2010 to 2012 to ascertain student perceptions of which anatomy pedagogy—prosection or dissection—was most valuable to them during the first year of preclinical medical education and for the entire medical school experience in general. Students were asked, “What value does gross anatomy education have in preclinical medical education?” We further asked the students who participated in both prosection and dissection pedagogies, “Would you have preferred an anatomy curriculum like the Summer Anatomy Dissection during your first year in medical school instead of prosection?” All students who responded to the survey viewed anatomy as a highly valued part of the medical curriculum, specifically referring to four major themes: Anatomy is (1 the basis for medical understanding, (2 part of the overall medical school experience, (3 a bridge to understanding pathology and physiology, and (4 the foundation for clinical skills. Students who participated in both prosection and dissection pedagogies surprisingly and overwhelmingly advocated for a prosection curriculum for the first year of medical school, not a dissection curriculum. Time efficiency was the dominant theme in survey responses from students who learned anatomy through prosection and then dissection. Students, regardless of whether interested in surgery/radiology or not, appreciated both pedagogies but commented that prosection was sufficient for learning basic anatomy, while dissection was a necessary experience in preparation for the anatomical medical specialties. This suggests that anatomy instruction should be integrated into the clinical years of medical education.

Entrevista a Sherry Ortner

Directory of Open Access Journals (Sweden)

Sergio Daniel López

2006-01-01

Full Text Available Una histórica fotografía de Franz Boas interpretando una danza ceremonial kwakiutl y La Declaración Universal de los Derechos Humanos, dan la bienvenida al despacho de Sherry Beth Ortner, en el Departamento de Antropología de la Universidad de California, Los Angeles (UCLA. Doctora en antropología por la Universidad de Chicago, Sherry Ortner trabajó durante gran parte de su carrera con los sherpas, en Nepal. La publicación de su artículo “¿Es la mujer con respecto al hombre lo que la naturaleza con respecto a la cultura?” en 1972, marcó un antes y un después en la antropología académica feminista y en los estudios de género. Ortner ha sido profesora en el Sarah Lawrence College, en la Universidad de California, Berkeley, en la Universidad de Columbia y dirigió el Departamento de Antropología de la Universidad de Michigan. Actualmente es Profesora Honoraria de UCLA, donde imparte cursos sobre imaginación etnográfica y teoría social crítica. En esta entrevista le hemos preguntado sobre sus distintas etapas investigadoras, desde sus primeros trabajos de campo hasta su actual investigación sobre la industria cinematográfica en Hollywood, pasando por su relación con la antropología feminista y sus trabajos sobre capitalismo y cambio social. Sherry Ortner es una antropóloga alegre, muy cordial, inquieta y capaz de captar en todo momento el pulso de la sociedad occidental a través de sus obras.

A short version of the revised 'experience of close relationships questionnaire': investigating non-clinical and clinical samples.

Science.gov (United States)

Wongpakaran, Tinakon; Wongpakaran, Nahathai

2012-01-01

This study seeks to investigate the psychometric properties of the short version of the revised 'Experience of Close Relationships' questionnaire, comparing non-clinical and clinical samples. In total 702 subjects participated in this study, of whom 531 were non-clinical participants and 171 were psychiatric patients. They completed the short version of the revised 'Experience of Close Relationships' questionnaire (ECR-R-18), the Perceived Stress Scale-10(PSS-10), the Rosenberg Self-Esteem Scale (RSES) and the UCLA Loneliness scale. A retest of the ECR-R-18 was then performed at four-week intervals. Then, confirmatory factor analyses were performed to test the validity of the new scale. The ECR-R-18 showed a fair to good internal consistency (α 0.77 to 0.87) for both samples, and the test-retest reliability was found to be satisfactory (ICC = 0.75). The anxiety sub-scale demonstrated concurrent validity with PSS-10 and RSES, while the avoidance sub-scale showed concurrent validity with the UCLA Loneliness Scale. Confirmatory factor analysis using method factors yielded two factors with an acceptable model fit for both groups. An invariance test revealed that the ECR-R-18 when used on the clinical group differed from when used with the non-clinical group. The ECR-R-18 questionnaire revealed an overall better level of fit than the original 36 item questionnaire, indicating its suitability for use with a broader group of samples, including clinical samples. The reliability of the ECR-R- 18 might be increased if a modified scoring system is used and if our suggestions with regard to future studies are followed up.

Hypofractionated Intensity-Modulated Radiotherapy for Carcinoma of the Prostate: Analysis of Toxicity

International Nuclear Information System (INIS)

Coote, Joanna H.; Wylie, James P.; Cowan, Richard A.; Logue, John P.; Swindell, Ric; Livsey, Jacqueline E.

2009-01-01

Purpose: Dose escalation for prostate cancer improves biological control but with a significant increase in late toxicity. Recent estimates of low α/β ratio for prostate cancer suggest that hypofractionation may result in biological advantage. Intensity-modulated radiotherapy (IMRT) should enable dose escalation to the prostate while reducing toxicity to local organs. We report late toxicity data of a hypofractionated IMRT regime. Methods and Materials: Eligible men had T2-3N0M0 adenocarcinoma prostate, and either Gleason score ≥ 7 or prostate-specific antigen 20-50 ng/L. Patients received 57-60 Gy to prostate in 19-20 fractions using five-field IMRT. All received hormonal therapy for 3 months before radiotherapy to a maximum of 6 months. Toxicity was assessed 2 years postradiotherapy using the RTOG criteria, LENT/SOMA, and UCLA prostate index assessment tools. Results: Acute toxicity was favorable with no RTOG Grade 3 or 4 toxicity. At 2 years, there was 4% Grade 2 bowel and 4.25% Grade 2 bladder toxicity. There was no Grade 3 or 4 bowel toxicity; one patient developed Grade 3 bladder toxicity. UCLA data showed a slight improvement in urinary function at 2 years compared with pretreatment. LENT/SOMA assessments demonstrated general worsening of bowel function at 2 years. Patients receiving 60 Gy were more likely to develop problems with bowel function than those receiving 57 Gy. Conclusions: These data demonstrate that hypofractionated radiotherapy using IMRT for prostate cancer is well tolerated with minimal late toxicity at 2 years posttreatment. Ongoing studies are looking at the efficacy of hypofractionated regimes with respect to biological control.

Outcomes following arthroscopic transosseous equivalent suture bridge double row rotator cuff repair: a prospective study and short-term results

Directory of Open Access Journals (Sweden)

Imam Mohamed Abdelnabi

2016-01-01

Full Text Available Background: The transosseous-equivalent cross bridge double row (TESBDR rotator cuff (RC repair technique has been developed to optimize healing biology at a repaired RC tendon insertion. It has been shown in the laboratory to improve pressurized contact area and mean foot print pressure when compared with a double row anchor technique. Pressure has been shown to influence healing between tendon and bone, and the tendon compression vector provided by the transosseous-equivalent suture bridges may enhance healing. The purpose was to prospectively evaluate the outcomes of arthroscopic TESBDR RC repair. Methods: Single center prospective case series study. Sixty-nine patients were selected to undergo arthroscopic TESBDR RC repair and were included in the current study. Primary outcome measures included the Oxford Shoulder Score (OSS, the University of California, Los Angeles (UCLA score, the Constant-Murley (CM Score and Range of motion (ROM. Secondary outcome measures included a Visual Analogue Scale (VAS for pain, another VAS for patient satisfaction from the operative procedure, EuroQoL 5-Dimensions Questionnaire (EQ-5D for quality of life assessment. Results: At 24 months post-operative, average OSS score was 44, average UCLA score was 31, average CM score was 88, average forward flexion was 145°, average internal rotation was 35°, average external rotation was 79°, average abduction was 150°, average EQ-5D score was 0.73, average VAS for pain was 2.3, and average VAS for patient satisfaction was 9.2. Conclusion: Arthroscopic TESBDR RC repair is a procedure with good post-operative functional outcome and low re-tear rate based on a short term follow-up.

Evaluation of the results from arthroscopic surgical treatment of rotator cuff injuries in patients aged 65 years and over

Directory of Open Access Journals (Sweden)

Alberto Naoki Miyazaki

2015-06-01

Full Text Available OBJECTIVES: To evaluate the results from arthroscopic surgical treatment of rotator cuff injuries in patients aged 65 years and over.METHODS: Between 1998 and 2009, 168 patients underwent operations. Five cases were excluded. The remaining 163 patients were stratified according to their age group: 65-69 years (49.1%, 70-74 (26.4% and 75 years and over (24.5%. Their mean age was 71 years (range: 65-83. There were 63 male patients (38.7%. The mean length of time with pain, from the onset of symptoms to the surgery, was 23 months (range: 2 days to 240 months. Sixty-two patients (38% reported histories of trauma and 26 (16% reported that their pain worsened through exertion.RESULTS: From the UCLA criteria, 80.4% of the results were excellent, 16% good, 1.8% fair and 1.8% poor. Complications occurred in 11%. The final clinical result did not show any correlation with age progression, injury size or tendons affected. However, there was a significant association (p < 0.001 between the presence of trauma and larger injuries. The length of time between the onset of symptoms and the surgical procedure had a significant relationship (p < 0.027 with the postoperative results: the longer this time was, the worse the results were.CONCLUSION: Arthroscopic treatment of rotator cuff injuries in patients aged 65 years and over presented excellent and good results in 96.4% of the cases, according to the UCLA assessment, with a low complication rate. Advanced age did not show any influence on the postoperative clinical evolution, but the earlier the surgical treatment was instituted, the better the results were.

Effect of Preoperative Fatty Degeneration of the Rotator Cuff Muscles on the Clinical Outcome of Patients With Intact Tendons After Arthroscopic Rotator Cuff Repair of Large/Massive Cuff Tears.

Science.gov (United States)

Ohzono, Hiroki; Gotoh, Masafumi; Nakamura, Hidehiro; Honda, Hirokazu; Mitsui, Yasuhiro; Kakuma, Tatsuyuki; Okawa, Takahiro; Shiba, Naoto

2017-11-01

Fatty degeneration of the rotator cuff muscles is associated not only with postoperative retear but also with postoperative muscle weakness; therefore, fatty changes in the muscles may affect the clinical outcome even in patients with these tears who have intact tendons after arthroscopic rotator cuff repair (ARCR). To evaluate the effect of fatty infiltration on the clinical outcome in patients with intact tendons after arthroscopic repair of large/massive cuff tears. Case-control study; Level of evidence, 3. One hundred fifty-five consecutive patients with large/massive rotator cuff tears underwent ARCR. Of these, 55 patients (mean ± SD age, 64.4 ± 9.1 years) in whom intact tendons after surgery were confirmed with magnetic resonance imaging at final follow-up (mean ± SD, 2.5 ± 1.4 years) were included in this study. Depending on their University of California Los Angeles (UCLA) score at the final follow-up, they were assigned to either the unsatisfactory group (score ≤27; n = 12) or the satisfactory group (score >27; n = 43). Various clinical parameters affecting the clinical outcome were examined through univariate and multivariate analyses. The UCLA score of all patients significantly improved from 18.1 ± 4.4 points preoperatively to 29.8 ± 4.5 points postoperatively ( P muscles, with area under the curve values of 0.79 (sensitivity 91% and specificity 51%) and 0.84 (sensitivity 100% and specificity 54%) in the infraspinatus and subscapularis, respectively. Preoperative fatty degeneration of the infraspinatus and/or subscapularis with Goutallier stage 2 or higher was significantly associated with worse outcome in patients with large/massive tears who had intact tendons after ARCR.

ARTHROSCOPIC REPAIR OF LARGE AND MASSIVE ROTATOR CUFF TEARS: CLINICAL OUTCOMES AND POSTOPERATIVE MRI FINDINGS

Directory of Open Access Journals (Sweden)

S. Yu. Dokolin

2017-01-01

Full Text Available Purpose of the study – to identify incidence rate of recurrent rotator cuff (RC tears, to evaluate outcomes of arthroscopic bone-tendon anchor suture, to determine the factors influencing arthroscopic treatment outcomes.Materials and methods. Medical history data, pre-operative x-rays and MRI of shoulder joints of 305 patients (main group who underwent arthroscopic bone-tendon anchor suture repair of large or massive RC tears during 2010-2016 were included in the study. Follow up period ranged from 1 to 6 years postoperatively with mean value of 25,6±4,5 months. Telephone survey of patients was conducted after the surgery as well as a single examination of patients with evaluation by functional scales – UCLA, ASES, CS, VAS, DN4. Preoperative standard x-rays in AP and axial views were done in all patients. Arthropathy severity was evaluated by K.Hamada classification. Comparison of patient specific data, features of RC lesions and surgical treatment was made by Kruskal-Wallis test.Results. Good outcomes by ASES, CS and UCLA functional scales were obtained in 15 (5% of patients, satisfactory – in 213 (69.8%, poor – in 77 (25.2%. Postoperative MRI data provided the following sub-distribution of patients: 49 (41.1% patients with complete repair of RC tendons lesions, 38 (31.9% patients with partial repair and 33 (27.0% patients with recurrent tear of reconstructed tendon. Correlation analysis allowed to establish the limits for achieving good outcomes of arthroscopic bone-tendon anchor suturing for significant association with infraspinatus muscle atrophy (not exceeding 40% and fatty infiltration of supraspinatus muscle (not exceeding 23.5%. 

Incidence of retear with double-row versus single-row rotator cuff repair.

Science.gov (United States)

Shen, Chong; Tang, Zhi-Hong; Hu, Jun-Zu; Zou, Guo-Yao; Xiao, Rong-Chi

2014-11-01

Rotator cuff tears have a high recurrence rate, even after arthroscopic rotator cuff repair. Although some biomechanical evidence suggests the superiority of the double-row vs the single-row technique, clinical findings regarding these methods have been controversial. The purpose of this study was to determine whether the double-row repair method results in a lower incidence of recurrent tearing compared with the single-row method. Electronic databases were systematically searched to identify reports of randomized, controlled trials (RCTs) comparing single-row with double-row rotator cuff repair. The primary outcome assessed was retear of the repaired cuff. Secondary outcome measures were the American Shoulder and Elbow Surgeons (ASES) shoulder score, the Constant shoulder score, and the University of California, Los Angeles (UCLA) score. Heterogeneity between the included studies was assessed. Six studies involving 428 patients were included in the review. Compared with single-row repair, double-row repair demonstrated a lower retear incidence (risk ratio [RR]=1.71 [95% confidence interval (CI), 1.18-2.49]; P=.005; I(2)=0%) and a reduced incidence of partial-thickness retears (RR=2.16 [95% CI, 1.26-3.71]; P=.005; I(2)=26%). Functional ASES, Constant, and UCLA scores showed no difference between single- and double-row cuff repairs. Use of the double-row technique decreased the incidence of retears, especially partial-thickness retears, compared with the single-row technique. The functional outcome was not significantly different between the 2 techniques. To improve the structural outcome of the repaired rotator cuff, surgeons should use the double-row technique. However, further long-term RCTs on this topic are needed. Copyright 2014, SLACK Incorporated.

Long-term functional evaluation of videoarthroscopic treatment of partial injuries of the rotator cuff

Directory of Open Access Journals (Sweden)

Glaydson Gomes Godinho

2015-04-01

Full Text Available OBJECTIVE: To compare the functional results from high and low-grade isolated partial lesions of the supraspinatus tendon of bursal and articular types, after arthroscopic treatment.METHODS: Sixty-four patients with isolated partial lesions of the supraspinatus tendon were evaluated. The mean length of follow-up was 76 months (range: 29-193. The mean age was 59 years (range: 36-82. The dominant side was affected in 44 patients (68.8%. There were 35 bursal lesions (54.7% and 29 articular lesions (45.3%. We used the Ellman classification and characterized the lesions as low or high-grade according to whether they affected less than or more than 50% of the tendon thickness, respectively. Debridement was performed in 15 patients (23.5%, repair without completing the lesion in 11 (17% and repair after completing the lesion in 38 (59.5%. The functional assessments on the patients were done using the Constant & Murley and UCLA scores.RESULTS: The mean Constant & Murley score among the patients with bursal lesions was 82.64 ± 6.98 (range: 59.3-99 and among those with articular lesions, 83.57 ± 7.58 (range: 66-95, while the mean UCLA score in the bursal lesions was 33.37 ± 2.85 (range: 21-35 and in the articular lesions, 32.83 ± 2.95 (range: 22-35.CONCLUSION: Videoarthroscopic treatment of partial lesions of the rotator cuff presents good or excellent results when the low-grade lesions are debrided and the high-grade lesions are completed and repaired. These results are maintained over the long term, with a high satisfaction rate and few complications.

Arthroscopic repair of massive contracted rotator cuff tears: aggressive release with anterior and posterior interval slides do not improve cuff healing and integrity.

Science.gov (United States)

Kim, Sung-Jae; Kim, Sung-Hwan; Lee, Su-Keon; Seo, Jae-Wan; Chun, Yong-Min

2013-08-21

Few studies of large-to-massive contracted rotator cuff tears have examined the arthroscopic complete repair obtained by a posterior interval slide and whether the clinical outcomes or structural integrity achieved are better than those after partial repair without the posterior interval slide. The study included forty-one patients with large-to-massive contracted rotator cuff tears, not amenable to complete repair with margin convergence alone. The patients underwent either arthroscopic complete repair with a posterior interval slide and side-to-side repair of the interval slide edge (twenty-two patients; Group P) or partial repair with margin convergence (nineteen patients; Group M). The patient assignment was not randomized. The Simple Shoulder Test (SST), American Shoulder and Elbow Surgeons (ASES) score, University of California at Los Angeles (UCLA) shoulder score, and range of motion were used to compare the functional outcomes. Preoperative and six-month postoperative magnetic resonance arthrography (MRA) images were compared within or between groups. At the two-year follow-up evaluation, the SST, ASES score, UCLA score, and range of motion had significantly improved (p repair group with an aggressive release had no better clinical or structural outcomes compared with the partial repair group with margin convergence alone for large-to-massive contracted rotator cuff tears. In addition, the complete repair group had a 91% retear rate and a greater defect on follow-up MRA images. Even though this study had a relatively short-term follow-up, a complete repair of large-to-massive contracted rotator cuff tears, with an aggressive release such as posterior interval slide, may not have an increased benefit compared with partial repair without posterior interval slide.

[Relationship between four components of assertiveness and mental health among high school students].

Science.gov (United States)

Watanabe, Asami

2009-04-01

This study examines the relationship between four components of assertiveness ("open expression", "control of emotion", "consideration for others" and "self-direction") and mental health. In Study 1, the analysis of interviews with thirteen high school students suggested that some components did not have a positive relationship with mental health. In Study 2, 176 high school students completed a questionnaire which included the UCLA isolation scale, the General Health Questionnaire (GHQ) and a scale to measure the four components of assertiveness. The results showed that an excessively high score for "consideration for others" was associated with mental unhealthiness. This component probably has an optimum level to maintain mental health.

Formulation of an explicit-multiple-time-step time integration method for use in a global primitive equation grid model

Science.gov (United States)

Chao, W. C.

1982-01-01

With appropriate modifications, a recently proposed explicit-multiple-time-step scheme (EMTSS) is incorporated into the UCLA model. In this scheme, the linearized terms in the governing equations that generate the gravity waves are split into different vertical modes. Each mode is integrated with an optimal time step, and at periodic intervals these modes are recombined. The other terms are integrated with a time step dictated by the CFL condition for low-frequency waves. This large time step requires a special modification of the advective terms in the polar region to maintain stability. Test runs for 72 h show that EMTSS is a stable, efficient and accurate scheme.

Volume correction in the aging hand: role of dermal fillers

Directory of Open Access Journals (Sweden)

Rivkin AZ

2016-08-01

Full Text Available Alexander Z Rivkin David Geffen/UCLA School of Medicine Los Angeles, CA, USA Abstract: The hands, just like the face, are highly visible parts of the body. They age at a similar rate and demonstrate comparable changes with time, sun damage, and smoking. Loss of volume in the hands exposes underlying tendons, veins, and bony prominences. Rejuvenation of the hands with dermal fillers is a procedure with high patient satisfaction and relatively low risk for complications. This study will review relevant anatomy, injection technique, clinical safety, and efficacy of dermal filler volumization of the aging hand. Keywords: dermal fillers, hands, volumization, hyaluronic acid, calcium hydroxylapatite