Structure of human ubiquitin-conjugating enzyme E2 G2 (UBE2G2/UBC7)

International Nuclear Information System (INIS)

Arai, Ryoichi; Yoshikawa, Seiko; Murayama, Kazutaka; Imai, Yuzuru; Takahashi, Ryosuke; Shirouzu, Mikako; Yokoyama, Shigeyuki

2006-01-01

The crystal structure of human UBE2G2/UBC7 was solved at 2.56 Å resolution. The superimposition of UBE2G2 on UbcH7 in a c-Cbl–UbcH7–ZAP70 ternary complex suggested that the two loop regions of UBE2G2 interact with the RING domain in a similar way as UbcH7. The human ubiquitin-conjugating enzyme E2 G2 (UBE2G2/UBC7) is involved in protein degradation, including a process known as endoplasmic reticulum-associated degradation (ERAD). The crystal structure of human UBE2G2/UBC7 was solved at 2.56 Å resolution. The UBE2G2 structure comprises a single domain consisting of an antiparallel β-sheet with four strands, five α-helices and two 3 10 -helices. Structural comparison of human UBE2G2 with yeast Ubc7 indicated that the overall structures are similar except for the long loop region and the C-terminal helix. Superimposition of UBE2G2 on UbcH7 in a c-Cbl–UbcH7–ZAP70 ternary complex suggested that the two loop regions of UBE2G2 interact with the RING domain in a similar way to UbcH7. In addition, the extra loop region of UBE2G2 may interact with the RING domain or its neighbouring region and may be involved in the binding specificity and stability

Distinct Functional Domains of Ubc9 Dictate Cell Survival and Resistance to Genotoxic Stress

Science.gov (United States)

van Waardenburg, Robert C. A. M.; Duda, David M.; Lancaster, Cynthia S.; Schulman, Brenda A.; Bjornsti, Mary-Ann

2006-01-01

Covalent modification with SUMO alters protein function, intracellular localization, or protein-protein interactions. Target recognition is determined, in part, by the SUMO E2 enzyme, Ubc9, while Siz/Pias E3 ligases may facilitate select interactions by acting as substrate adaptors. A yeast conditional Ubc9P123L mutant was viable at 36°C yet exhibited enhanced sensitivity to DNA damage. To define functional domains in Ubc9 that dictate cellular responses to genotoxic stress versus those necessary for cell viability, a 1.75-Å structure of yeast Ubc9 that demonstrated considerable conservation of backbone architecture with human Ubc9 was solved. Nevertheless, differences in side chain geometry/charge guided the design of human/yeast chimeras, where swapping domains implicated in (i) binding residues within substrates that flank canonical SUMOylation sites, (ii) interactions with the RanBP2 E3 ligase, and (iii) binding of the heterodimeric E1 and SUMO had distinct effects on cell growth and resistance to DNA-damaging agents. Our findings establish a functional interaction between N-terminal and substrate-binding domains of Ubc9 and distinguish the activities of E3 ligases Siz1 and Siz2 in regulating cellular responses to genotoxic stress. PMID:16782883

75 FR 56471 - Revisions to the Requirements for Authority To Manufacture and Distribute Postage Evidencing Systems

Science.gov (United States)

2010-09-16

... evidencing systems (``Company or Companies'') engage a qualified, independent audit firm to perform an... Distribute Postage Evidencing Systems AGENCY: Postal Service TM . ACTION: Final rule. SUMMARY: The Postal..., at 202-268-7613. SUPPLEMENTARY INFORMATION: Postage Evidencing Systems are devices or systems of...

Disruption of polyubiquitin gene Ubc leads to defective proliferation of hepatocytes and bipotent fetal liver epithelial progenitor cells

Energy Technology Data Exchange (ETDEWEB)

Park, Hyejin; Yoon, Min-Sik; Ryu, Kwon-Yul, E-mail: kyryu@uos.ac.kr

2013-06-07

Highlights: •Proliferation capacity of Ubc{sup −/−} FLCs was reduced during culture in vitro. •Ubc is required for proliferation of both hepatocytes and bipotent FLEPCs. •Bipotent FLEPCs exhibit highest Ubc transcription and proliferation capacity. •Cell types responsible for Ubc{sup −/−} fetal liver developmental defect were identified. -- Abstract: We have previously demonstrated that disruption of polyubiquitin gene Ubc leads to mid-gestation embryonic lethality most likely due to a defect in fetal liver development, which can be partially rescued by ectopic expression of Ub. In a previous study, we assessed the cause of embryonic lethality with respect to the fetal liver hematopoietic system. We confirmed that Ubc{sup −/−} embryonic lethality could not be attributed to impaired function of hematopoietic stem cells, which raises the question of whether or not FLECs such as hepatocytes and bile duct cells, the most abundant cell types in the liver, are affected by disruption of Ubc and contribute to embryonic lethality. To answer this, we isolated FLCs from E13.5 embryos and cultured them in vitro. We found that proliferation capacity of Ubc{sup −/−} cells was significantly reduced compared to that of control cells, especially during the early culture period, however we did not observe the increased number of apoptotic cells. Furthermore, levels of Ub conjugate, but not free Ub, decreased upon disruption of Ubc expression in FLCs, and this could not be compensated for by upregulation of other poly- or mono-ubiquitin genes. Intriguingly, the highest Ubc expression levels throughout the entire culture period were observed in bipotent FLEPCs. Hepatocytes and bipotent FLEPCs were most affected by disruption of Ubc, resulting in defective proliferation as well as reduced cell numbers in vitro. These results suggest that defective proliferation of these cell types may contribute to severe reduction of fetal liver size and potentially mid

Characterization of papillomavirus E1 helicase mutants defective for interaction with the SUMO-conjugating enzyme Ubc9

International Nuclear Information System (INIS)

Fradet-Turcotte, Amelie; Brault, Karine; Titolo, Steve; Howley, Peter M.; Archambault, Jacques

2009-01-01

The E1 helicase from BPV and HPV16 interacts with Ubc9 to facilitate viral genome replication. We report that HPV11 E1 also interacts with Ubc9 in vitro and in the yeast two-hybrid system. Residues in E1 involved in oligomerization (353-435) were sufficient for binding to Ubc9 in vitro, but the origin-binding and ATPase domains were additionally required in yeast. Nuclear accumulation of BPV E1 was shown previously to depend on its interaction with Ubc9 and sumoylation on lysine 514. In contrast, HPV11 and HPV16 E1 mutants defective for Ubc9 binding remained nuclear even when the SUMO pathway was inhibited. Furthermore, we found that K514 in BPV E1 and the analogous K559 in HPV11 E1 are not essential for nuclear accumulation of E1. These results suggest that the interaction of E1 with Ubc9 is not essential for its nuclear accumulation but, rather, depends on its oligomerization and binding to DNA and ATP.

Knockdown of UbcH10 Enhances the Chemosensitivity of Dual Drug Resistant Breast Cancer Cells to Epirubicin and Docetaxel

Directory of Open Access Journals (Sweden)

Cheng Wang

2015-03-01

Full Text Available Breast cancer is one of the most common and lethal cancers in women. As a hub gene involved in a diversity of tumors, the ubiquitin-conjugating enzyme H10 (UbcH10, may also play some roles in the genesis and development of breast cancer. In the current study, we found that the expression of UbcH10 was up-regulated in some breast cancer tissues and five cell lines. We established a dual drug resistant cell line MCF-7/EPB (epirubicin/TXT (docetaxel and a lentiviral system expressing UbcH10 shRNA to investigate the effects of UbcH10 knockdown on the chemosensitivity of MCF-7/EPB/TXT cells to epirubicin and docetaxel. The knockdown of UbcH10 inhibited the proliferation of both MCF-7 and MCF-7/EPB/TXT cells, due to the G1 phase arrest in cell cycle. Furthermore, UbcH10 knockdown increased the sensitivity of MCF-7/EPB/TXT cells to epirubicin and docetaxel and promoted the apoptosis induced by these two drugs. Protein detection showed that, in addition to inhibiting the expression of Ki67 and cyclin D1, UbcH10 RNAi also impaired the increased BCL-2 and MDR-1 expression levels in MCF-7/EPB/TXT cells, which may contribute to abating the drug resistance in the breast cancer cells. Our research in the current study demonstrated that up-regulation of UbcH10 was involved in breast cancer and its knockdown can inhibit the growth of cancer cells and increase the chemosensitivity of the dual drug resistant breast cancer cells to epirubicin and docetaxel, suggesting that UbcH10 may be a promising target for the therapy of breast cancer.

76 FR 74753 - Authority To Manufacture and Distribute Postage Evidencing Systems

Science.gov (United States)

2011-12-01

...) provided to customers by manufacturers or distributors. The proposed changes are intended to clarify the... (202) 268-7613. SUPPLEMENTARY INFORMATION: The office formerly known as Postage Technology Management... the business relationship, distribution, control, storage, maintenance, repair, replacement, and...

39 CFR 310.5 - Payment of postage on violation.

Science.gov (United States)

2010-07-01

... destination. (b) The amount equal to postage will be due and payable not later than 15 days after receipt of... persons who engage in, cause, or assist such activity to pay an amount or amounts not exceeding the total... 959 of this chapter. (c) Refusal to pay an unappealed demand or a demand that becomes final after...

Preliminary Results of a Multicentre Study of the UBC Rapid Test for Detection of Urinary Bladder Cancer.

Science.gov (United States)

Ecke, Thorsten H; Arndt, Christian; Stephan, Carsten; Hallmann, Steffen; Lux, Oliver; Otto, Thomas; Ruttloff, Jürgen; Gerullis, Holger

2015-05-01

UBC Rapid is a test detecting fragments of cytokeratins 8 and 18 in urine. These are cytokeratins frequently overexpressed in tumor cells. We present the first results of a multi-centre study using UBC Rapid in patients with bladder cancer and healthy controls. Clinical urine samples from 92 patients with tumors of the urinary bladder (45 low-grade and 47 high-grade tumors) and from 33 healthy controls were used. Urine samples were analyzed by the UBC Rapid point-of-care (POC) system and evaluated both visually and quantitatively using a concile Omega 100 POC reader. For visual evaluation, different thresholds of band intensity for considering a test as positive were applied. Sensitivities and specificities were calculated by contingency analyses. We found that pathological concentrations by UBC Rapid are detectable in urine of patients with bladder cancer. The calculated diagnostic sensitivity of UBC Rapid in urine was 68.1% for high-grade, but only 46.2% for low-grade tumors. The specificity was 90.9%. The area under the curve (AUC) after receiver-operated curve (ROC) analysis was 0.733. Pathological levels of UBC Rapid in urine are higher in patients with bladder cancer in comparison to the control group (pbladder cancer and controls. Further studies with a greater number of patients will show how valuable these results are. Copyright© 2015 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.

Cellular Ubc2/Rad6 E2 ubiquitin-conjugating enzyme facilitates tombusvirus replication in yeast and plants

International Nuclear Information System (INIS)

Imura, Yoshiyuki; Molho, Melissa; Chuang, Chingkai; Nagy, Peter D.

2015-01-01

Mono- and multi-ubiquitination alters the functions and subcellular localization of many cellular and viral proteins. Viruses can co-opt or actively manipulate the ubiquitin network to support viral processes or suppress innate immunity. Using yeast (Saccharomyces cerevisiae) model host, we show that the yeast Rad6p (radiation sensitive 6) E2 ubiquitin-conjugating enzyme and its plant ortholog, AtUbc2, interact with two tombusviral replication proteins and these E2 ubiquitin-conjugating enzymes could be co-purified with the tombusvirus replicase. We demonstrate that TBSV RNA replication and the mono- and bi-ubiquitination level of p33 is decreased in rad6Δ yeast. However, plasmid-based expression of AtUbc2p could complement both defects in rad6Δ yeast. Knockdown of UBC2 expression in plants also decreases tombusvirus accumulation and reduces symptom severity, suggesting that Ubc2p is critical for virus replication in plants. We provide evidence that Rad6p is involved in promoting the subversion of Vps23p and Vps4p ESCRT proteins for viral replicase complex assembly. - Highlights: • Tombusvirus p33 replication protein interacts with cellular RAD6/Ubc2 E2 enzymes. • Deletion of RAD6 reduces tombusvirus replication in yeast. • Silencing of UBC2 in plants inhibits tombusvirus replication. • Mono- and bi-ubiquitination of p33 replication protein in yeast and in vitro. • Rad6p promotes the recruitment of cellular ESCRT proteins into the tombusvirus replicase

Cellular Ubc2/Rad6 E2 ubiquitin-conjugating enzyme facilitates tombusvirus replication in yeast and plants

Energy Technology Data Exchange (ETDEWEB)

Imura, Yoshiyuki, E-mail: imura@brs.nihon-u.ac.jp; Molho, Melissa; Chuang, Chingkai; Nagy, Peter D., E-mail: pdnagy2@uky.edu

2015-10-15

Mono- and multi-ubiquitination alters the functions and subcellular localization of many cellular and viral proteins. Viruses can co-opt or actively manipulate the ubiquitin network to support viral processes or suppress innate immunity. Using yeast (Saccharomyces cerevisiae) model host, we show that the yeast Rad6p (radiation sensitive 6) E2 ubiquitin-conjugating enzyme and its plant ortholog, AtUbc2, interact with two tombusviral replication proteins and these E2 ubiquitin-conjugating enzymes could be co-purified with the tombusvirus replicase. We demonstrate that TBSV RNA replication and the mono- and bi-ubiquitination level of p33 is decreased in rad6Δ yeast. However, plasmid-based expression of AtUbc2p could complement both defects in rad6Δ yeast. Knockdown of UBC2 expression in plants also decreases tombusvirus accumulation and reduces symptom severity, suggesting that Ubc2p is critical for virus replication in plants. We provide evidence that Rad6p is involved in promoting the subversion of Vps23p and Vps4p ESCRT proteins for viral replicase complex assembly. - Highlights: • Tombusvirus p33 replication protein interacts with cellular RAD6/Ubc2 E2 enzymes. • Deletion of RAD6 reduces tombusvirus replication in yeast. • Silencing of UBC2 in plants inhibits tombusvirus replication. • Mono- and bi-ubiquitination of p33 replication protein in yeast and in vitro. • Rad6p promotes the recruitment of cellular ESCRT proteins into the tombusvirus replicase.

Postage stamps: A convergence of metallurgy, art, and history

Science.gov (United States)

Habashi, Fathi

2002-04-01

Postage stamps have been used around the world to commemorate, in miniature, significant events and people, including those of importance in the history of metals and mineral production. From the presence of gold artifacts in an ancient Egyptian tomb to the role of uranium in nuclear power, stamps have captured the evolution of metallurgical processes. This article highlights some of those stamps.

77 FR 23618 - Authority To Manufacture and Distribute Postage Evidencing Systems

Science.gov (United States)

2012-04-20

... inventory control processes of PES provided to customers by manufacturers or distributors. The office formerly known as Postage Technology Management (PTM) is now known as Payment Technology, making it... maintain sufficient facilities for and records of the business relationship, distribution, control, storage...

76 FR 77149 - Authority To Manufacture and Distribute Postage Evidencing Systems

Science.gov (United States)

2011-12-12

... POSTAL SERVICE 39 CFR Part 501 Authority To Manufacture and Distribute Postage Evidencing Systems AGENCY: Postal Service\\TM\\. ACTION: Final rule. SUMMARY: This rule clarifies the responsibility of the... reasons stated, 39 CFR part 501 is amended as follows: PART 501--AUTHORIZATION TO MANUFACTURE AND...

Usefulness of Bladder Tumour Antigen (BTA) and Urinary Bladder Cancer test (UBC) in Transitional Cell Bladder Cancer (TCC) diagnosis and follow-up

International Nuclear Information System (INIS)

Nuvoli, S.; Spanu, A.; Masia, A.; Mulas, A.; Falchi, A.; Solinas, M.E.; Marrosu, A.; Madeddu, G.; Mocci, A.

2002-01-01

Aim: We evaluated BTA and UBC clinical utility in TCC diagnosis and follow-up. Materials and Methods: We enrolled consecutively 96 untreated TCC, 73 other genitourinary carcinomas (OC), 106 benign genitourinary diseases (BD) and 75 normal controls (C). After trans-urethral resection (TUR), TCC were classified by clinical staging (9 Ta, 27 T1, 32 T2, 20 T3 and 8 T4) and pathological grading (14 G1, 28 G2, 41 G3 and 13 G4). Urine BTA and UBC were assayed by monoclonal antibody methods, IEMA and IRMA, respectively (cut-off:14 U/ml and 8 μg/l, respectively). Results: Sensitivity, specificity, PPV, NPV and accuracy were 83.6%, 75.1%, 64.6%, 89.% and 72.4%, respectively for BTA and 53.1%, 89.4%, 72.8%, 78% and 75.6%, respectively for UBC. BTA and UBC specificities were determined combining OC and BD data, although UBC reached the highest value in OC (93.15%). Sensitivity and specificity differences between the two markers were significant (p<0.00001). BTA and UBC sensitivity and mean values significantly increased with progressive staging and grading. Moreover, marker levels were significantly higher in TCC compared to OC, BD and C. Seventy-one high stage and/or grade TCC underwent radical cystectomy, while 25 were monitored after TUR (14 cases: group A) or segmental cystectomy (11 cases: group B) for 8-32 months by periodical clinical examination, cystoscopy and urinary BTA and UBC assays. During follow-up, 9 group A cases developed recurrences and 5 were NED. BTA was elevated in 8/9 cases (88.8%) with recurrence, while borderline in the remaining one. UBC was above cut-off in 6/9 cases (66.6%) all with high BTA, while low in the remaining 3, confirming first observation data. Both marker increases preceded by several months the cystoscopic evidence of recurrence. In NED patients, BTA was low in all cases (100%), while UBC was under cut-off in 4/5 cases (80%) and slightly high in the remaining asymptomatic patient. Ten group B patients developed local recurrences

Overexpression of the E2 ubiquitin-conjugating enzyme UbcH10 causes chromosome missegregation and tumor formation.

NARCIS (Netherlands)

Ree, J.H.; Jeganathan, K.B.; Malureanu, L.; Deursen, J.M.A. van

2010-01-01

The anaphase-promoting complex/cyclosome (APC/C) E3 ubiquitin ligase functions with the E2 ubiquitin-conjugating enzyme UbcH10 in the orderly progression through mitosis by marking key mitotic regulators for destruction by the 26-S proteasome. UbcH10 is overexpressed in many human cancer types and

Ectopic expression of ubiquitin-conjugating enzyme gene from wild rice, OgUBC1, confers resistance against UV-B radiation and Botrytis infection in Arabidopsis thaliana

International Nuclear Information System (INIS)

Jeon, En Hee; Pak, Jung Hun; Kim, Mi Jin; Kim, Hye Jeong; Shin, Sang Hyun; Lee, Jai Heon; Kim, Doh Hoon; Oh, Ju Sung; Oh, Boung-Jun; Jung, Ho Won; Chung, Young Soo

2012-01-01

Highlights: ► We isolated a novel E2 ubiquitin-conjugating enzyme from leaves of wild rice plants. ► The OgUBC1 was highly expressed in leaves treated with SA and UV-B radiation. ► The recombinant OgUBC1 has an enzymatic activity of E2 in vitro. ► The OgUBC1 could protect disruption of plant cells by UV-B radiation. ► OgUBC1 confers disease resistance and UV-B tolerance in transgenic Arabidopsis plants. -- Abstract: A previously unidentified gene encoding ubiquitin-conjugating enzyme was isolated from leaves of wild rice plant treated with wounding and microbe-associated molecular patterns. The OgUBC1 gene was composed of 148 amino acids and contained a typical active site and 21 ubiquitin thioester intermediate interaction residues and 4 E3 interaction residues. Both exogenous application of salicylic acid and UV-B irradiation triggered expression of OgUBC1 in leaves of wild rice. Recombinant OgUBC1 proteins bound to ubiquitins in vitro, proposing that the protein might act as E2 enzyme in planta. Heterologous expression of the OgUBC1 in Arabidopsis thaliana protected plants from cellular damage caused by an excess of UV-B radiation. A stable expression of chalcone synthase gene was detected in leaves of OgUBC1-expressing Arabidopsis, resulting in producing higher amounts of anthocyanin than those in wild-type Col-0 plants. Additionally, both pathogenesis-related gene1 and 5 were transcribed in the transgenic Arabidopsis in the absence of pathogen infection. The OgUBC1-expressing plants were resistant to the infection of Botrytis cinerea. Taken together, we suggested that the OgUBC1 is involved in ubiquitination process important for cellular response against biotic and abiotic stresses in plants.

Ectopic expression of ubiquitin-conjugating enzyme gene from wild rice, OgUBC1, confers resistance against UV-B radiation and Botrytis infection in Arabidopsis thaliana

Energy Technology Data Exchange (ETDEWEB)

Jeon, En Hee; Pak, Jung Hun; Kim, Mi Jin; Kim, Hye Jeong [Department of Genetic Engineering, Dong-A University, Busan 604-714 (Korea, Republic of); Shin, Sang Hyun [National Crop Experiment Station, Rural Development Administration, Suwon 441-100 (Korea, Republic of); Lee, Jai Heon; Kim, Doh Hoon; Oh, Ju Sung [Department of Genetic Engineering, Dong-A University, Busan 604-714 (Korea, Republic of); Oh, Boung-Jun [BioControl Center, Jeonnam 516-942 (Korea, Republic of); Jung, Ho Won, E-mail: hwjung@dau.ac.kr [Department of Genetic Engineering, Dong-A University, Busan 604-714 (Korea, Republic of); Chung, Young Soo, E-mail: chungys@dau.ac.kr [Department of Genetic Engineering, Dong-A University, Busan 604-714 (Korea, Republic of)

2012-10-19

Highlights: Black-Right-Pointing-Pointer We isolated a novel E2 ubiquitin-conjugating enzyme from leaves of wild rice plants. Black-Right-Pointing-Pointer The OgUBC1 was highly expressed in leaves treated with SA and UV-B radiation. Black-Right-Pointing-Pointer The recombinant OgUBC1 has an enzymatic activity of E2 in vitro. Black-Right-Pointing-Pointer The OgUBC1 could protect disruption of plant cells by UV-B radiation. Black-Right-Pointing-Pointer OgUBC1 confers disease resistance and UV-B tolerance in transgenic Arabidopsis plants. -- Abstract: A previously unidentified gene encoding ubiquitin-conjugating enzyme was isolated from leaves of wild rice plant treated with wounding and microbe-associated molecular patterns. The OgUBC1 gene was composed of 148 amino acids and contained a typical active site and 21 ubiquitin thioester intermediate interaction residues and 4 E3 interaction residues. Both exogenous application of salicylic acid and UV-B irradiation triggered expression of OgUBC1 in leaves of wild rice. Recombinant OgUBC1 proteins bound to ubiquitins in vitro, proposing that the protein might act as E2 enzyme in planta. Heterologous expression of the OgUBC1 in Arabidopsis thaliana protected plants from cellular damage caused by an excess of UV-B radiation. A stable expression of chalcone synthase gene was detected in leaves of OgUBC1-expressing Arabidopsis, resulting in producing higher amounts of anthocyanin than those in wild-type Col-0 plants. Additionally, both pathogenesis-related gene1 and 5 were transcribed in the transgenic Arabidopsis in the absence of pathogen infection. The OgUBC1-expressing plants were resistant to the infection of Botrytis cinerea. Taken together, we suggested that the OgUBC1 is involved in ubiquitination process important for cellular response against biotic and abiotic stresses in plants.

Estrogen receptor alpha and nuclear factor Y coordinately regulate the transcription of the SUMO-conjugating UBC9 gene in MCF-7 breast cancer cells.

Science.gov (United States)

Ying, Shibo; Dünnebier, Thomas; Si, Jing; Hamann, Ute

2013-01-01

UBC9 encodes a protein that conjugates small ubiquitin-related modifier (SUMO) to target proteins thereby changing their functions. Recently, it was noted that UBC9 expression and activity play a role in breast tumorigenesis and response to anticancer drugs. However, the underlying mechanism is poorly understood. To investigate the transcriptional regulation of the UBC9 gene, we identified and characterized its promoter and cis-elements. Promoter activity was tested using luciferase reporter assays. The binding of transcription factors to the promoter was detected by chromatin immunoprecipitation (ChIP), and their functional role was confirmed by siRNA knockdown. UBC9 mRNA and protein levels were measured by quantitative reverse transcription PCR and Western blot analysis, respectively. An increased expression of UBC9 mRNA and protein was found in MCF-7 breast cancer cells treated with 17β-estradiol (E2). Analysis of various deletion mutants revealed a 137 bp fragment upstream of the transcription initiation site to be sufficient for reporter gene transcription. Mutations of putative estrogen receptor α (ER-α) (one imperfect estrogen response element, ERE) and/or nuclear factor Y (NF-Y) binding sites (two CCAAT boxes) markedly reduced promoter activity. Similar results were obtained in ER-negative MDA-MB-231 cells except that the ERE mutation did not affect promoter activity. Additionally, promoter activity was stimulated upon E2 treatment and overexpression of ER-α or NF-YA in MCF-7 cells. ChIP confirmed direct binding of both transcription factors to the UBC9 promoter in vivo. Furthermore, UBC9 expression was diminished by ER-α and NF-Y siRNAs on the mRNA and protein levels. In conclusion, we identified the proximal UBC9 promoter and provided evidence that ER-α and NF-Y regulate UBC9 expression on the transcriptional level in response to E2 in MCF-7 cells. These findings may contribute to a better understanding of the regulation of UBC9 in ER

2013 Alan Blizzard Award Feature Article--Enriching Educational Experiences through UBC's First Year Seminar in Science (SCIE113)

Science.gov (United States)

Fox, Joanne; Birol, Gülnur; Han, Andrea; Cassidy, Alice; Nakonechny, Joanne; Berger, Jim; Peacock, Simon; Samuels, Lacey

2014-01-01

The First Year Seminar in Science (SCIE113) was developed during 2009/2010 academic year through an exemplary collaboration between faculty, administrators and educational support staff in the Faculty of Science at the University of British Columbia (UBC). SCIE113 reflects the vision and values of the Faculty of Science and UBC by offering an…

Estrogen receptor alpha and nuclear factor Y coordinately regulate the transcription of the SUMO-conjugating UBC9 gene in MCF-7 breast cancer cells.

Directory of Open Access Journals (Sweden)

Shibo Ying

Full Text Available UBC9 encodes a protein that conjugates small ubiquitin-related modifier (SUMO to target proteins thereby changing their functions. Recently, it was noted that UBC9 expression and activity play a role in breast tumorigenesis and response to anticancer drugs. However, the underlying mechanism is poorly understood. To investigate the transcriptional regulation of the UBC9 gene, we identified and characterized its promoter and cis-elements. Promoter activity was tested using luciferase reporter assays. The binding of transcription factors to the promoter was detected by chromatin immunoprecipitation (ChIP, and their functional role was confirmed by siRNA knockdown. UBC9 mRNA and protein levels were measured by quantitative reverse transcription PCR and Western blot analysis, respectively. An increased expression of UBC9 mRNA and protein was found in MCF-7 breast cancer cells treated with 17β-estradiol (E2. Analysis of various deletion mutants revealed a 137 bp fragment upstream of the transcription initiation site to be sufficient for reporter gene transcription. Mutations of putative estrogen receptor α (ER-α (one imperfect estrogen response element, ERE and/or nuclear factor Y (NF-Y binding sites (two CCAAT boxes markedly reduced promoter activity. Similar results were obtained in ER-negative MDA-MB-231 cells except that the ERE mutation did not affect promoter activity. Additionally, promoter activity was stimulated upon E2 treatment and overexpression of ER-α or NF-YA in MCF-7 cells. ChIP confirmed direct binding of both transcription factors to the UBC9 promoter in vivo. Furthermore, UBC9 expression was diminished by ER-α and NF-Y siRNAs on the mRNA and protein levels. In conclusion, we identified the proximal UBC9 promoter and provided evidence that ER-α and NF-Y regulate UBC9 expression on the transcriptional level in response to E2 in MCF-7 cells. These findings may contribute to a better understanding of the regulation of UBC9 in ER

MEL-18 interacts with HSF2 and the SUMO E2 UBC9 to inhibit HSF2 sumoylation.

Science.gov (United States)

Zhang, Jie; Goodson, Michael L; Hong, Yiling; Sarge, Kevin D

2008-03-21

In a previous study we found that sumoylation of the DNA-binding protein heat shock factor 2 (HSF2) is up-regulated during mitosis, but the mechanism that mediates this regulation was unknown. Here we show that HSF2 interacts with the polycomb protein MEL-18, that this interaction decreases during mitosis, and that overexpression and RNA interference-mediated reduction of MEL-18 result in decreased and increased HSF2 sumoylation, respectively. Other results suggest that MEL-18 may also function to inhibit the sumoylation of other cellular proteins. The results also show that MEL-18 is able to interact with the small ubiquitin-like modifier (SUMO) ubiquitin carrier protein (E2) enzyme UBC9 and that MEL-18 inhibits the ability of UBC9 to transfer the SUMO protein to target proteins. Together, the results in this work suggest a mechanism in which MEL-18 bound to HSF2 inhibits its sumoylation by binding to and inhibiting the activity of UBC9 enzymes in the vicinity of HSF2. These results provide an explanation for how mitotic HSF2 sumoylation is regulated and suggest that MEL-18, in contrast to the sumoylation-stimulating activities of the polycomb protein PC2, actually functions like an anti-SUMO ubiquitin-protein isopeptide ligase (E3), interacting both with HSF2 and the SUMO E2 UBC9 but acting to inhibit UBC9 activity to decrease sumoylation of a target protein, in this case that of HSF2.

76 FR 62000 - Express Mail Domestic Postage Refund Policy and Waiver of Signature

Science.gov (United States)

2011-10-06

... POSTAL SERVICE 39 CFR Part 111 Express Mail Domestic Postage Refund Policy and Waiver of Signature... days to 30 days after the date of mailing, and to change the Express Mail ``waiver of signature'' standard for domestic items by obtaining an addressee's signature only when the mailer selects the...

76 FR 75461 - Express Mail Domestic Postage Refund Policy and Waiver of Signature

Science.gov (United States)

2011-12-02

... POSTAL SERVICE 39 CFR Part 111 Express Mail Domestic Postage Refund Policy and Waiver of Signature... to 30 days after the date of mailing, and to change the Express Mail ``waiver of signature'' standard for domestic items by obtaining an addressee's signature only when the mailer selects the ``signature...

Mutually exclusive STAT1 modifications identified by Ubc9/substrate dimerization-dependent SUMOylation.

Science.gov (United States)

Zimnik, Susan; Gaestel, Matthias; Niedenthal, Rainer

2009-03-01

Post-translational modifications control the physiological activity of the signal transducer and activator of transcription STAT1. While phosphorylation at tyrosine Y701 is a prerequisite for STAT1 dimerization, its SUMOylation represses the transcriptional activity. Recently, we have demonstrated that SUMOylation at lysine K703 inhibits the phosphorylation of nearby localized Y701 of STAT1. Here, we analysed the influence of phosphorylation of Y701 on SUMOylation of K703 in vivo. For that reason, an Ubc9/substrate dimerization-dependent SUMOylation (USDDS) system was developed, which consists of fusions of the SUMOylation substrate and of the SUMO-conjugating enzyme Ubc9 to the chemically activatable heterodimerization domains FKBP and FRB, respectively. When FKBP fusion proteins of STAT1, p53, CRSP9, FOS, CSNK2B, HES1, TCF21 and MYF6 are coexpressed with Ubc9-FRB, treatment of HEK293 cells with the rapamycin-related dimerizer compound AP21967 induces SUMOylation of these proteins in vivo. For STAT1-FKBP and p53-FKBP we show that this SUMOylation takes place at their specific SUMOylation sites in vivo. Using USDDS, we then demonstrate that STAT1 phosphorylation at Y701 induced by interferon-beta treatment inhibits SUMOylation of K703 in vivo. Thus, pY701 and SUMO-K703 of STAT1 represent mutually exclusive modifications, which prevent signal integration at this molecule and probably ensure the existence of differentially modified subpopulations of STAT1 necessary for its regulated nuclear cytoplasmic activation/inactivation cycle.

The fission yeast ubiquitin-conjugating enzymes UbcP3, Ubc15, and Rhp6 affect transcriptional silencing of the mating-type region

DEFF Research Database (Denmark)

Nielsen, Inga Sig; Nielsen, Olaf; Murray, Johanne M

2002-01-01

Genes transcribed by RNA polymerase II are silenced when introduced near the mat2 or mat3 mating-type loci of the fission yeast Schizosaccharomyces pombe. Silencing is mediated by a number of gene products and cis-acting elements. We report here the finding of novel trans-acting factors identified...... was not suppressed by a mutation in the 26S proteasome, suggesting that loss of silencing is not due to an increased degradation of silencing factors but rather to the posttranslational modification of proteins by ubiquitination. We discuss the implications of these results for the possible modes of action of UbcP3...

Human Ubc9 is involved in intracellular HIV-1 Env stability after trafficking out of the trans-Golgi network in a Gag dependent manner.

Directory of Open Access Journals (Sweden)

Christopher R Bohl

Full Text Available The cellular E2 Sumo conjugase, Ubc9 interacts with HIV-1 Gag, and is important for the assembly of infectious HIV-1 virions. In the previous study we demonstrated that in the absence of Ubc9, a defect in virion assembly was associated with decreased levels of mature intracellular Envelope (Env that affected Env incorporation into virions and virion infectivity. We have further characterized the effect of Ubc9 knockdown on HIV Env processing and assembly. We found that gp160 stability in the endoplasmic reticulum (ER and its trafficking to the trans-Golgi network (TGN were unaffected, indicating that the decreased intracellular mature Env levels in Ubc9-depleted cells were due to a selective degradation of mature Env gp120 after cleavage from gp160 and trafficked out of the TGN. Decreased levels of Gag and mature Env were found to be associated with the plasma membrane and lipid rafts, which suggest that these viral proteins were not trafficked correctly to the assembly site. Intracellular gp120 were partially rescued when treated with a combination of lysosome inhibitors. Taken together our results suggest that in the absence of Ubc9, gp120 is preferentially degraded in the lysosomes likely before trafficking to assembly sites leading to the production of defective virions. This study provides further insight in the processing and packaging of the HIV-1 gp120 into mature HIV-1 virions.

Are We Doing Any Good? A Value-Added Analysis of UBC's Science One Program

Directory of Open Access Journals (Sweden)

Chris Waltham

2012-12-01

Full Text Available Science One is a full academic year interdisciplinary alternative to the traditional first-year experience in the Faculty of Science at the University of British Columbia (UBC. Anecdotal reports suggest that alumni/ae of the program do very well in upper-level classes and many become successful graduate and medical students. The high faculty/student ratio makes the program an expensive one, however, and thus we have sought rigorous evidence of the benefits to our students. Our approach has been a value-added one; we have compared high-school and upper-level undergraduate grades for students in all UBC's first-year science programs. We have found a clear signal that there is a large benefit to participating in Science One, and conclude that this arises from a combination of the recruitment of enthusiastic students who are up for a challenge, the Science One admissions process, and taking the program itself.Science One consiste en une année scolaire interdisciplinaire complète qui représente une variante de l’expérience traditionnelle vécue en première année à la Faculté des sciences de l’Université de la Colombie-Britannique (UBC. Des rapports isolés suggèrent que les anciens étudiants du programme obtiennent de très bons résultats dans les cours de niveau supérieur et plusieurs obtiennent leur diplôme avec succès et étudient en médecine. Cependant, le ratio élevé enseignant/étudiant fait en sorte que le programme coûte cher, c’est pourquoi les auteurs ont cherché à obtenir des données probantes sur les avantages qu’il présente pour leurs étudiants. Ils ont employé la méthode de la valeur ajoutée; ont comparé les notes obtenues au secondaire et celles des étudiants de premier cycle inscrits à des cours de niveau supérieur dans tous les programmes scientifiques offerts à l’UBC. Ils ont découvert que la participation à Science One est très bénéfique et ont conclu que cela résulte d�

Structure of a SUMO-binding-motif mimic bound to Smt3p–Ubc9p: conservation of a noncovalent Ubiquitin-like protein–E2 complex as a platform for selective interactions within a SUMO pathway

Science.gov (United States)

Duda, David M.; van Waardenburg, Robert C. A. M.; Borg, Laura A.; McGarity, Sierra; Nourse, Amanda; Waddell, M. Brett; Bjornsti, Mary-Ann; Schulman, Brenda A.

2007-01-01

Summary The SUMO ubiquitin-like proteins play regulatory roles in cell division, transcription, DNA repair, and protein subcellular localization. Paralleling other ubiquitin-like proteins, SUMO proteins are proteolytically processed to maturity, conjugated to targets by E1-E2-E3 cascades, and subsequently recognized by specific downstream effectors containing a SUMO-binding motif (SBM). SUMO and its E2 from the budding yeast S. cerevisiae, Smt3p and Ubc9p, are encoded by essential genes. Here we describe the 1.9 Å resolution crystal structure of a noncovalent Smt3p–Ubc9p complex. Unexpectedly, a heterologous portion of the crystallized complex derived from the expression construct mimics an SBM, and binds Smt3p in a manner resembling SBM binding to human SUMO family members. In the complex, Smt3p binds a surface distal from Ubc9's catalytic cysteine. The structure implies that a single molecule of Smt3p cannot bind concurrently to both the noncovalent binding site and the catalytic cysteine of a single Ubc9p molecule. However, formation of higher-order complexes can occur, where a single Smt3p covalently linked to one Ubc9p's catalytic cysteine also binds noncovalently to another molecule of Ubc9p. Comparison with other structures from the SUMO pathway suggests that formation of the noncovalent Smt3p–Ubc9p complex occurs mutually exclusively with many other Smt3p and Ubc9p interactions in the conjugation cascade. By contrast, high-resolution insights into how Smt3p–Ubc9p can also interact with downstream recognition machineries come from contacts with the SBM mimic. Interestingly, the overall architecture of the Smt3p–Ubc9p complex is strikingly similar to recent structures from the ubiquitin pathway. The results imply that noncovalent ubiquitin-like protein–E2 complexes are conserved platforms, which function as parts of larger assemblies involved many protein post-translational regulatory pathways. PMID:17475278

Efficacy of DNA double-strand breaks repair in breast cancer is decreased in carriers of the variant allele of the UBC9 gene c.73G>A polymorphism

International Nuclear Information System (INIS)

Synowiec, Ewelina; Krupa, Renata; Morawiec, Zbigniew; Wasylecka, Maja; Dziki, Lukasz; Morawiec, Jan; Blasiak, Janusz; Wozniak, Katarzyna

2010-01-01

UBC9 (E2) SUMO conjugating enzyme plays an important role in the maintenance of genome stability and integrity. In the present work we examined the association between the c.73G>A (Val25Met) polymorphism of the UBC9 gene (rs11553473) and efficacy of DNA double-strand breaks (DSBs) repair (DRE) in breast cancer patients. We determined the level of endogenous (basal) and exogenous (induced by γ-irradiation) DSBs and efficacy of their repair in peripheral blood lymphocytes of 57 breast cancer patients and 70 healthy individuals. DNA damage and repair were studied by neutral comet assay. Genotypes were determined in DNA from peripheral blood lymphocytes by allele-specific PCR (ASO-PCR). We also correlated genotypes with the clinical characteristics of breast cancer patients. We observed a strong association between breast cancer occurrence and the variant allele carried genotypes in patients with elevated level of basal as well as induced DNA damage (OR 6.74, 95% CI 2.27-20.0 and OR 5.33, 95% CI 1.81-15.7, respectively). We also found statistically significant (p A polymorphism of the UBC9 gene in breast cancer patients. Carriers of variant allele have decreased DNA DRE as compared to wild type genotype carriers. We did not find any association with the UBC9 gene polymorphism and estrogen and progesterone receptor status. The variant allele of the UBC9 gene polymorphism was strongly inversely related to HER negative breast cancer patients (OR 0.03, 95% CI 0.00-0.23). Our results suggest that the c.73G>A polymorphism of the UBC9 gene may affect DNA DSBs repair efficacy in breast cancer patients.

Caspase recruitment domain of procaspase-2 could be a target for SUMO-1 modification through Ubc9

International Nuclear Information System (INIS)

Shirakura, Hiromi; Hayashi, Naoko; Ogino, Shin-ichi; Tsuruma, Kazuhiro; Uehara, Takashi; Nomura, Yasuyuki

2005-01-01

To identify the binding proteins that regulate the function of procaspase-2, we screened for proteins using the yeast two-hybrid method and isolated human Ubc9 and SUMO-1 as the candidates. Ubc9 and SUMO-1 interacted with the caspase recruitment domain of procaspase-2 in its N-terminal. We elucidated the covalent modification of procaspase-2 by SUMO-1 in mammalian cells by immunoprecipitation followed by Western blot analysis. Procaspase-2 and SUMO-1 were co-localized by dot-like structures in the nucleus that are related to promyelocytic leukemia bodies. Interestingly, a conjugation-deficient mutant (K60R) procaspase-2 resulted in a delay of its enzyme maturation (appearance of p12 subunit) compared to that of wild-type. Thus, the modification with SUMO-1 may play a critical role in the nuclear localization and the activation (maturation) of procaspase-2

Efficacy of DNA double-strand breaks repair in breast cancer is decreased in carriers of the variant allele of the UBC9 gene c.73G>A polymorphism

Energy Technology Data Exchange (ETDEWEB)

Synowiec, Ewelina [Department of Molecular Genetics, University of Lodz, Lodz (Poland); Krupa, Renata [Laboratory of DNA Repair, Department of Molecular Genetics, University of Lodz, Banacha 12/16, Lodz (Poland); Morawiec, Zbigniew; Wasylecka, Maja [Department of Surgical Oncology, N. Copernicus Hospital, Lodz (Poland); Dziki, Lukasz; Morawiec, Jan [Department of General and Colorectal Surgery, Medical University of Lodz, Lodz (Poland); Blasiak, Janusz [Department of Molecular Genetics, University of Lodz, Lodz (Poland); Wozniak, Katarzyna, E-mail: wozniak@biol.uni.lodz.pl [Laboratory of DNA Repair, Department of Molecular Genetics, University of Lodz, Banacha 12/16, Lodz (Poland)

2010-12-10

UBC9 (E2) SUMO conjugating enzyme plays an important role in the maintenance of genome stability and integrity. In the present work we examined the association between the c.73G>A (Val25Met) polymorphism of the UBC9 gene (rs11553473) and efficacy of DNA double-strand breaks (DSBs) repair (DRE) in breast cancer patients. We determined the level of endogenous (basal) and exogenous (induced by {gamma}-irradiation) DSBs and efficacy of their repair in peripheral blood lymphocytes of 57 breast cancer patients and 70 healthy individuals. DNA damage and repair were studied by neutral comet assay. Genotypes were determined in DNA from peripheral blood lymphocytes by allele-specific PCR (ASO-PCR). We also correlated genotypes with the clinical characteristics of breast cancer patients. We observed a strong association between breast cancer occurrence and the variant allele carried genotypes in patients with elevated level of basal as well as induced DNA damage (OR 6.74, 95% CI 2.27-20.0 and OR 5.33, 95% CI 1.81-15.7, respectively). We also found statistically significant (p < 0.05) difference in DRE related to the c.73G>A polymorphism of the UBC9 gene in breast cancer patients. Carriers of variant allele have decreased DNA DRE as compared to wild type genotype carriers. We did not find any association with the UBC9 gene polymorphism and estrogen and progesterone receptor status. The variant allele of the UBC9 gene polymorphism was strongly inversely related to HER negative breast cancer patients (OR 0.03, 95% CI 0.00-0.23). Our results suggest that the c.73G>A polymorphism of the UBC9 gene may affect DNA DSBs repair efficacy in breast cancer patients.

Structural model of the hUbA1-UbcH10 quaternary complex: in silico and experimental analysis of the protein-protein interactions between E1, E2 and ubiquitin.

Directory of Open Access Journals (Sweden)

Stefania Correale

Full Text Available UbcH10 is a component of the Ubiquitin Conjugation Enzymes (Ubc; E2 involved in the ubiquitination cascade controlling the cell cycle progression, whereby ubiquitin, activated by E1, is transferred through E2 to the target protein with the involvement of E3 enzymes. In this work we propose the first three dimensional model of the tetrameric complex formed by the human UbA1 (E1, two ubiquitin molecules and UbcH10 (E2, leading to the transthiolation reaction. The 3D model was built up by using an experimentally guided incremental docking strategy that combined homology modeling, protein-protein docking and refinement by means of molecular dynamics simulations. The structural features of the in silico model allowed us to identify the regions that mediate the recognition between the interacting proteins, revealing the active role of the ubiquitin crosslinked to E1 in the complex formation. Finally, the role of these regions involved in the E1-E2 binding was validated by designing short peptides that specifically interfere with the binding of UbcH10, thus supporting the reliability of the proposed model and representing valuable scaffolds for the design of peptidomimetic compounds that can bind selectively to Ubcs and inhibit the ubiquitylation process in pathological disorders.

Ben Franklin, America’s Postage Stamp Star — on the Wane?

Directory of Open Access Journals (Sweden)

François Brunet

2010-01-01

Full Text Available This paper is an assessment of Ben Franklin’s evolving figure in U.S. postage stamps, focusing especially on the contrast between the 2006 tercentennial Franklin 4-stamp panel, a rather high-brow representation of Franklin as an intellectual, and his traditional image as a homely, common face. The singular history of U.S. postage stamps, with their innovative choice of historical figures as subject matter and their broader emphasis on commemoration, is briefly summarized. The evolution of the Franklin figure — the most common postal image, along with George Washington — is then detailed, showing how the traditional image prevailed until the 1950s, before being progressively displaced by a more cultural and, lately, intellectual image of the nation’s “electrizer”.Cet article vise à interpréter l’évolution de la figure de Benjamin Franklin dans les timbres-poste des Etats-Unis, en se fondant notamment sur le contraste entre le bloc de quatre timbres émis lors du tricentenaire en 2006, qui représente Franklin dans les différents métiers d’un intellectuel des Lumières, et son image traditionnelle d’Américain simple et moyen. On retrace tout d’abord l’histoire singulière des timbres américains, caractérisée par le choix innovant de figures historiques comme sujets et plus généralement par la prééminence de la fonction commémorative. Puis on étudie en détail l’évolution de la figure de Franklin — sujet le plus fréquent des timbres américains avec George Washington — en montrant que l’image traditionnelle s’est perpétuée jusqu’aux années 1950, avant de céder progressivement à une image plus culturelle et, récemment, plus intellectuelle.

Spectral analysis of postage stamps and banknotes from the region of Rijeka in Croatia

Science.gov (United States)

Jelovica Badovinac, I.; Orlić, N.; Lofrumento, C.; Dobrinić, J.; Orlić, M.

2010-07-01

Micro-Raman spectroscopy and X-ray emission spectroscopy induced using radioactive source have been applied to analyze two types of samples important for the history of Rijeka, Croatian port on the Adriatic Sea. In this paper we will present study of thirty-three original Hungarian postage stamps issued for Rijeka and overprinted with the word FIUME in 1918, after the World War I and the one-Lira banknotes (one original brown banknote and four trial prints: brown, blue, green and dark green) from Economy bank for Rijeka, Istria and Slovenian Littoral (1945-1947), the so-called Jugolire. This investigation was carried out to determine the differences between the original machine, original hand-made and fake overprints FIUME and to compare the pigments used on original banknote from circulation with the pigments on the trial prints.

Spectral analysis of postage stamps and banknotes from the region of Rijeka in Croatia

Energy Technology Data Exchange (ETDEWEB)

Jelovica Badovinac, I., E-mail: ijelov@phy.uniri.h [Department of Physics, University of Rijeka, Omladinska 14, 51000 Rijeka (Croatia); Orlic, N. [Department of Physics, University of Rijeka, Omladinska 14, 51000 Rijeka (Croatia); Lofrumento, C. [Dipartimento di Chimica, Universita di Firenze, Via della Lastruccia 3, 50019 Sesto Fiorentino (Italy); Dobrinic, J. [Faculty of Engineering, University of Rijeka, Vukovarska 58, 51000 Rijeka (Croatia); Orlic, M. [Department of Civil Engineering, Polytechnic of Zagreb, Av. V. Holjevca 15, 10000 Zagreb (Croatia)

2010-07-21

Micro-Raman spectroscopy and X-ray emission spectroscopy induced using radioactive source have been applied to analyze two types of samples important for the history of Rijeka, Croatian port on the Adriatic Sea. In this paper we will present study of thirty-three original Hungarian postage stamps issued for Rijeka and overprinted with the word FIUME in 1918, after the World War I and the one-Lira banknotes (one original brown banknote and four trial prints: brown, blue, green and dark green) from Economy bank for Rijeka, Istria and Slovenian Littoral (1945-1947), the so-called Jugolire. This investigation was carried out to determine the differences between the original machine, original hand-made and fake overprints FIUME and to compare the pigments used on original banknote from circulation with the pigments on the trial prints.

Spectral analysis of postage stamps and banknotes from the region of Rijeka in Croatia

International Nuclear Information System (INIS)

Jelovica Badovinac, I.; Orlic, N.; Lofrumento, C.; Dobrinic, J.; Orlic, M.

2010-01-01

Micro-Raman spectroscopy and X-ray emission spectroscopy induced using radioactive source have been applied to analyze two types of samples important for the history of Rijeka, Croatian port on the Adriatic Sea. In this paper we will present study of thirty-three original Hungarian postage stamps issued for Rijeka and overprinted with the word FIUME in 1918, after the World War I and the one-Lira banknotes (one original brown banknote and four trial prints: brown, blue, green and dark green) from Economy bank for Rijeka, Istria and Slovenian Littoral (1945-1947), the so-called Jugolire. This investigation was carried out to determine the differences between the original machine, original hand-made and fake overprints FIUME and to compare the pigments used on original banknote from circulation with the pigments on the trial prints.

SUMO modification through rapamycin-mediated heterodimerization reveals a dual role for Ubc9 in targeting RanGAP1 to nuclear pore complexes

International Nuclear Information System (INIS)

Zhu Shanshan; Zhang Hong; Matunis, Michael J.

2006-01-01

SUMOs (small ubiquitin-related modifiers) are eukaryotic proteins that are covalently conjugated to other proteins and thereby regulate a wide range of important cellular processes. The molecular mechanisms by which SUMO modification influences the functions of most target proteins and cellular processes, however, remain poorly defined. A major obstacle to investigating the effects of SUMO modification is the availability of a system for selectively inducing the modification or demodification of an individual protein. To address this problem, we have developed a procedure using the rapamycin heterodimerizer system. This procedure involves co-expression of rapamycin-binding domain fusion proteins of SUMO and candidate SUMO substrates in living cells. Treating cells with rapamycin induces a tight association between SUMO and a single SUMO substrate, thereby allowing specific downstream effects to be analyzed. Using RanGAP1 as a model SUMO substrate, the heterodimerizer system was used to investigate the molecular mechanism by which SUMO modification targets RanGAP1 from the cytoplasm to nuclear pore complexes (NPCs). Our results revealed a dual role for Ubc9 in targeting RanGAP1 to NPCs: In addition to conjugating SUMO-1 to RanGAP1, Ubc9 is also required to form a stable ternary complex with SUMO-1 modified RanGAP1 and Nup358. As illustrated by our studies, the rapamycin heterodimerizer system represents a novel tool for studying the molecular effects of SUMO modification

Over-accumulation of nuclear IGF-1 receptor in tumor cells requires elevated expression of the receptor and the SUMO-conjugating enzyme Ubc9

Energy Technology Data Exchange (ETDEWEB)

Deng, Hua; Lin, Yingbo; Badin, Margherita; Vasilcanu, Daiana; Stroemberg, Thomas [Department of Oncology and Pathology, The Karolinska Institute, Cancer Center Karolinska, SE-17176 Stockholm (Sweden); Jernberg-Wiklund, Helena [Department of Genetics and Pathology, Rudbeck Laboratory, Uppsala University, Uppsala (Sweden); Sehat, Bita [Department of Oncology and Pathology, The Karolinska Institute, Cancer Center Karolinska, SE-17176 Stockholm (Sweden); Larsson, Olle, E-mail: olle.larsson@ki.se [Department of Oncology and Pathology, The Karolinska Institute, Cancer Center Karolinska, SE-17176 Stockholm (Sweden)

2011-01-14

Research highlights: {yields} SUMOylation mediates nuclear translocation of IGF-1R which activates transcription. {yields} Here we show that nuclear IGF-1R over-accumulates in tumor cells. {yields} This requires overexpression of the receptor that is a common feature in tumor cells. {yields} An increased expression of the SUMO ligase Ubc9 seems to be an involved mechanism too. -- Abstract: The insulin-like growth factor 1 receptor (IGF-1R) plays crucial roles in tumor cell growth and is overexpressed in many cancers. IGF-1R's trans-membrane kinase signaling pathways have been well characterized. Very recently, we showed that SUMOylation mediates nuclear translocation of the IGF-1R, and that nuclear IGF-1R (nIGF-1R) binds to enhancer regions and activates transcription. We identified three lysine residues in the {beta}-subunit of the receptor and that mutation of these blocks nuclear translocation and gene activation. Furthermore, accumulation of nIGF-1R was proven strongly dependent on the specific SUMO-conjugating enzyme Ubc9. Here we show that nIGF-1R originates solely from the cell membrane and that phosphorylation of the core tyrosine residues of the receptor kinase is crucial for nuclear accumulation. We also compared the levels of nIGF-1R, measured as nuclear/membrane ratios, in tumor and normal cells. We found that the breast cancer cell line MCF-7 has 13-fold higher amounts of nIGF-1R than breast epithelial cells (IME) which showed only a small amount of nIGF-1R. In comparison, the total expression of IGF-1R was only 3.7- higher in MCF-7. Comparison of several other tumor and normal cell lines showed similar tumor cell over-accumulation of nIGF-1R, exceeding the total receptor expression substantially. Ectopic overexpression (>10-fold) of the receptor increased nIGF-1R in IME cells but not to that high level as in wild type MCF-7. The levels of Ubc9 were higher in all tumor cell lines, compared to the normal cells, and this probably contributes to over

Over-accumulation of nuclear IGF-1 receptor in tumor cells requires elevated expression of the receptor and the SUMO-conjugating enzyme Ubc9

International Nuclear Information System (INIS)

Deng, Hua; Lin, Yingbo; Badin, Margherita; Vasilcanu, Daiana; Stroemberg, Thomas; Jernberg-Wiklund, Helena; Sehat, Bita; Larsson, Olle

2011-01-01

Research highlights: → SUMOylation mediates nuclear translocation of IGF-1R which activates transcription. → Here we show that nuclear IGF-1R over-accumulates in tumor cells. → This requires overexpression of the receptor that is a common feature in tumor cells. → An increased expression of the SUMO ligase Ubc9 seems to be an involved mechanism too. -- Abstract: The insulin-like growth factor 1 receptor (IGF-1R) plays crucial roles in tumor cell growth and is overexpressed in many cancers. IGF-1R's trans-membrane kinase signaling pathways have been well characterized. Very recently, we showed that SUMOylation mediates nuclear translocation of the IGF-1R, and that nuclear IGF-1R (nIGF-1R) binds to enhancer regions and activates transcription. We identified three lysine residues in the β-subunit of the receptor and that mutation of these blocks nuclear translocation and gene activation. Furthermore, accumulation of nIGF-1R was proven strongly dependent on the specific SUMO-conjugating enzyme Ubc9. Here we show that nIGF-1R originates solely from the cell membrane and that phosphorylation of the core tyrosine residues of the receptor kinase is crucial for nuclear accumulation. We also compared the levels of nIGF-1R, measured as nuclear/membrane ratios, in tumor and normal cells. We found that the breast cancer cell line MCF-7 has 13-fold higher amounts of nIGF-1R than breast epithelial cells (IME) which showed only a small amount of nIGF-1R. In comparison, the total expression of IGF-1R was only 3.7- higher in MCF-7. Comparison of several other tumor and normal cell lines showed similar tumor cell over-accumulation of nIGF-1R, exceeding the total receptor expression substantially. Ectopic overexpression (>10-fold) of the receptor increased nIGF-1R in IME cells but not to that high level as in wild type MCF-7. The levels of Ubc9 were higher in all tumor cell lines, compared to the normal cells, and this probably contributes to over-accumulation of nIGF-1R

Helium-hydrogen microplasma device (MPD) on postage-stamp-size plastic-quartz chips.

Science.gov (United States)

Weagant, Scott; Karanassios, Vassili

2009-10-01

A new design of a miniaturized, atmospheric-pressure, low-power (e.g., battery-operated), self-igniting, planar-geometry microplasma device (MPD) for use with liquid microsamples is described. The inexpensive MPD was a hybrid, three-substrate quartz-plastic-plastic structure and it was formed on chips with area the size of a small postage stamp. The substrates were chosen for rapid prototyping and for speedy device-geometry testing and evaluation. The approximately 700-microm (diameter) and 7-mm (long) He-H(2) (3% H(2)) microplasma was formed by applying high-voltage ac between two needle electrodes. Operating conditions were found to be critical in sustaining stable microplasma on plastic substrates. Spectral interference from the electrode materials was not observed. A small-size, electrothermal vaporization system was used for introduction of microliter volumes of liquids into the MPD. The microplasma was operated from an inexpensive power supply. And, operation from a 14.4-V battery has been demonstrated. Microplasma background emission in the spectral range between 200 and 850 nm obtained using a portable, fiber-optic spectrometer is reported. Analyte emission from microliter volumes of dilute single-element standard solutions of Cd, Cu, K, Li, Mg, Mn, Na, Pb, and Zn is documented. Element-dependent precision was between 10-25% (the average was 15%) and detection limits ranged between 1.5 and 350 ng. The system was used for the determination of Na in diluted bottled-water samples.

‘Postage-stamp PIV’: small velocity fields at 400 kHz for turbulence spectra measurements

Science.gov (United States)

Beresh, Steven J.; Henfling, John F.; Spillers, Russell W.; Spitzer, Seth M.

2018-03-01

Time-resolved particle image velocimetry recently has been demonstrated in high-speed flows using a pulse-burst laser at repetition rates reaching 50 kHz. Turbulent behavior can be measured at still higher frequencies if the field of view is greatly reduced and lower laser pulse energy is accepted. Current technology allows image acquisition at 400 kHz for sequences exceeding 4000 frames but for an array of only 128  ×  120 pixels, giving the moniker of ‘postage-stamp PIV’. The technique has been tested far downstream of a supersonic jet exhausting into a transonic crossflow. Two-component measurements appear valid until 120 kHz, at which point a noise floor emerges whose magnitude is dependent on the reduction of peak locking. Stereoscopic measurement offers three-component data for turbulent kinetic energy spectra, but exhibits a reduced signal bandwidth and higher noise in the out-of-plane component due to the oblique camera images. The resulting spectra reveal two regions exhibiting power-law dependence describing the turbulent decay. The frequency response of the present measurement configuration exceeds nearly all previous velocimetry measurements in high speed flow.

Inhibition of Ubc13-mediated Ubiquitination by GPS2 Regulates Multiple Stages of B Cell Development.

Science.gov (United States)

Lentucci, Claudia; Belkina, Anna C; Cederquist, Carly T; Chan, Michelle; Johnson, Holly E; Prasad, Sherry; Lopacinski, Amanda; Nikolajczyk, Barbara S; Monti, Stefano; Snyder-Cappione, Jennifer; Tanasa, Bogdan; Cardamone, M Dafne; Perissi, Valentina

2017-02-17

Non-proteolytic ubiquitin signaling mediated by Lys 63 ubiquitin chains plays a critical role in multiple pathways that are key to the development and activation of immune cells. Our previous work indicates that GPS2 (G-protein Pathway Suppressor 2) is a multifunctional protein regulating TNFα signaling and lipid metabolism in the adipose tissue through modulation of Lys 63 ubiquitination events. However, the full extent of GPS2-mediated regulation of ubiquitination and the underlying molecular mechanisms are unknown. Here, we report that GPS2 is required for restricting the activation of TLR and BCR signaling pathways and the AKT/FOXO1 pathway in immune cells based on direct inhibition of Ubc13 enzymatic activity. Relevance of this regulatory strategy is confirmed in vivo by B cell-targeted deletion of GPS2, resulting in developmental defects at multiple stages of B cell differentiation. Together, these findings reveal that GPS2 genomic and non-genomic functions are critical for the development and cellular homeostasis of B cells. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

Influence of additives on the increase of the heating value of Bayah’s coal with upgrading brown coal (UBC) method

International Nuclear Information System (INIS)

Heriyanto, Heri; Widya Ernayati, K.; Umam, Chairul; Margareta, Nita

2015-01-01

UBC (upgrading brown coal) is a method of improving the quality of coal by using oil as an additive. Through processing in the oil media, not just the calories that increase, but there is also water repellent properties and a decrease in the tendency of spontaneous combustion of coal products produced. The results showed a decrease in the water levels of natural coal bayah reached 69%, increase in calorific value reached 21.2%. Increased caloric value and reduced water content caused by the water molecules on replacing seal the pores of coal by oil and atoms C on the oil that is bound to increase the percentage of coal carbon. As a result of this experiment is, the produced coal has better calorific value, the increasing of this new calorific value up to 23.8% with the additive waste lubricant, and the moisture content reduced up to 69.45%

Influence of additives on the increase of the heating value of Bayah’s coal with upgrading brown coal (UBC) method

Energy Technology Data Exchange (ETDEWEB)

Heriyanto, Heri [Chemical Engineering of University Sultan AgengTirtayasa, Indonesia Email: herfais@yahoo.com (Indonesia); Widya Ernayati, K.; Umam, Chairul; Margareta, Nita

2015-12-29

UBC (upgrading brown coal) is a method of improving the quality of coal by using oil as an additive. Through processing in the oil media, not just the calories that increase, but there is also water repellent properties and a decrease in the tendency of spontaneous combustion of coal products produced. The results showed a decrease in the water levels of natural coal bayah reached 69%, increase in calorific value reached 21.2%. Increased caloric value and reduced water content caused by the water molecules on replacing seal the pores of coal by oil and atoms C on the oil that is bound to increase the percentage of coal carbon. As a result of this experiment is, the produced coal has better calorific value, the increasing of this new calorific value up to 23.8% with the additive waste lubricant, and the moisture content reduced up to 69.45%.

78 FR 16213 - Refunds and Exchanges

Science.gov (United States)

2013-03-14

... service failure on a guaranteed product or for an extra service, refund requests for postage purchased... (cards and envelopes), that are damaged or otherwise unusable for postage (because of humidity, moisture... envelopes (mutilated no more than is necessary to remove contents): Postage value plus value of postage...

Památky starověké Núbie na známkách světa // Monuments of Ancient Nubia on postage stamps of the modern world

Directory of Open Access Journals (Sweden)

Břetislav Vachala

2015-06-01

Full Text Available The successful International UNESCO Campaign to Save the Monuments of (Egyptian and Sudanese Nubia became an important motif on the postage stamps of 47 countries of the world in the years 1960–1980. The stamps host famous rescued temples (listed here according to frequency of the used motifs, including general views, details of architecture and relief decoration of Abu Simbel, Philae, Wadi es-Sebua, and Dakka, the Kiosk of Qertassi and the South - ern temple of Buhen. Moreover, some of the unique painted murals found in the episcopal cathedral at Faras were reproduced on Polish stamps. The philatelic contribution to the campaign was far from symbolic. The total philatelic revenue (including income from the Philae Medals reached 112,665.64 US dollars. The philatelic activity of 47 countries substantially contributed to the publicity of the UNESCO Nubia Campaign around the world.

39 CFR 265.6 - Availability of records.

Science.gov (United States)

2010-07-01

... by the human eye, such as a computer print-out. On request, records will be provided in a different... investigation, or by an agency conducting a lawful national security intelligence investigation, information... authorized user of a postage meter or PC Postage product (postage evidencing systems) printing a specified...

78 FR 23137 - Implementation of Full-Service Intelligent Mail Requirements for Automation Prices

Science.gov (United States)

2013-04-18

... re- work or pay the additional postage. The existing thresholds used to verify and qualify automation...-work or pay the additional postage to mail at a non- automation price. Full-Service Electronic... re-work or pay the additional postage to mail at a non-automation price. In addition to the full...

76 FR 10757 - Combined Mailings of Standard Mail and Periodicals Flats

Science.gov (United States)

2011-02-28

... to Standard Mail. These mailings must also be identified as Standard Mail when scheduling dropship... advertising percentage. b. A consolidated postage statement register and postage statement for each...

The present and future burden of urinary bladder cancer in the world.

NARCIS (Netherlands)

Ploeg, M.; Aben, K.K.H.; Kiemeney, L.A.L.M.

2009-01-01

Urinary bladder cancer (UBC) is a common disease worldwide. At any point in time 2.7 million people have a history of UBC. The incidence of UBC varies over the world with highest rates in developed communities. But the burden of UBC will increase in less developed areas of the world. These changes

SENSITIVITY AND SPECIFICITY OF URINARY BLADDER CANCER ANTIGEN FOR DIAGNOSIS OF BLADDER TUMOR;A COMPARATIVE STUDY WITH URINARY CYTOLOGY

Directory of Open Access Journals (Sweden)

K. Radkhah

2005-06-01

Full Text Available Cystoscopy and urinary cytology are currently the basis for diagnosis and ‎follow-up of bladder tumors. Research to find a sensitive and specific tumor ‎marker for diagnosis of bladder tumor is actively underway, however, due to low sensitivity ‎and high cost of cytology. This cross-sectional study was performed in 65 patients to evaluate whether urinary bladder ‎cancer (UBC antigen level can predict the presence of active bladder tumor. In patients with ‎inactive tumor, UBC antigen level was determined in addition to standard cystoscopy ‎and cytology for follow-up. Patients with active tumor were ‎subjected to standard treatment and UBC antigen level determination. UBC antigen ‎ levels were measured by ELISA, using monoclonal antibodies ‎specific for UBC antigen. As a control group, UBC antigen level ‎was also determined in 65 persons who had been referred for urinalysis for other reasons. ‎UBC antigen level more than 1 μg/L which was regarded as ‎positive was found in 49.4% of the patients. In control group, 96.9% had UBC antigen < 1μg/L‎. Mean UBC antigen level in patients was ‎3.77 μg/L while it was 0.508 μg/L in controls (P < 0.0001. Sensitivity of ‎UBC antigen was 53.3% and its specificity was 40%. Sensitivity and specificity of urinary cytology was 17.3% and 88.2%, respectively. This difference was statistically ‎significant (P < 0.001. UBC antigen is more sensitive than urinary cytology, although cytology still ‎retains its priority in specificity. It is not yet recommended to replace UBC antigen for ‎cytology due to its low specificity and not favorable sensitivity.

The Ubiquitin-Conjugating Enzyme Gene Family in Longan (Dimocarpus longan Lour.: Genome-Wide Identification and Gene Expression during Flower Induction and Abiotic Stress Responses

Directory of Open Access Journals (Sweden)

Dengwei Jue

2018-03-01

Full Text Available Ubiquitin-conjugating enzymes (E2s or UBC enzymes play vital roles in plant development and combat various biotic and abiotic stresses. Longan (Dimocarpus longan Lour. is an important fruit tree in the subtropical region of Southeast Asia and Australia; however the characteristics of the UBC gene family in longan remain unknown. In this study, 40 D. longan UBC genes (DlUBCs, which were classified into 15 groups, were identified in the longan genome. An RNA-seq based analysis showed that DlUBCs showed distinct expression in nine longan tissues. Genome-wide RNA-seq and qRT-PCR based gene expression analysis revealed that 11 DlUBCs were up- or down-regualted in the cultivar “Sijimi” (SJ, suggesting that these genes may be important for flower induction. Finally, qRT-PCR analysis showed that the mRNA levels of 13 DlUBCs under SA (salicylic acid treatment, seven under methyl jasmonate (MeJA treatment, 27 under heat treatment, and 16 under cold treatment were up- or down-regulated, respectively. These results indicated that the DlUBCs may play important roles in responses to abiotic stresses. Taken together, our results provide a comprehensive insight into the organization, phylogeny, and expression patterns of the longan UBC genes, and therefore contribute to the greater understanding of their biological roles in longan.

The UBCTM test may be useful for diagnosis of recurred urinary bladder cancer

International Nuclear Information System (INIS)

Kang, Do Young; Jung, Se Il; Hwang, Joon Seong; Gil, Myung Cheol; Yoon, Jin Han; Kim, Duk Kyu

2001-01-01

Previously we reported the usefulness of UBC TM test compared to urinary cytology for diagnosis of transitional cell carcinoma (TCC) of the bladder in patients with hematuria. Now we evaluated the usefulness of the UBC TM test for diagnosis of recurred urinary bladder cancer. 146 patients with hematuria were included in our study. UNC TM test (IDL Biotech, Sweden) were assayed in mid-stream urine according to the ordinary assay protocol. 33 patients were confirmed as TCC by cystoscopic examination and underwent transurethral resection (Group A). Other patients had various benign urinary tract conditions (Group B). Samples were considered positive as the UBC concentration was greater than 12 μ g/L. We compared UBC TM level with previous value 6 months later in patients whom diagnosed with TCC. UBC levels were significantly different between group A (95.9±166.4 μ g/L) and group B (19.2±85.6 μ g/L) (p TM test and 100% (97/97) in cytology. UBC TM test was significantly more sensitive in stage Ta. T 1 tumors (80 vs 20 %, p TM test showed tendency to be more sensitive as the stage and grade was higher (80% in Ta, 83.3% in T1 and 100% in T2, 80% in Grade I, 85.7% in Grade II and 100% in Grade III). We follow-up UBC TM test in 5 patients after 6 months. UBC TM levels and recurrence were correlated in 4 patient (80%). Follow-up levels of UBC TM were increased in two recurred patients and normalized in non-recurred patients. One patient showed increased level of UBC TM test but clinically no evidence of recurrence. Although Also our patients were small, UBC TM test may be useful method for detecting the recurrence of TCC and further follow-up is necessary

Selection of Reference Genes for qRT-PCR Analysis of Gene Expression in Stipa grandis during Environmental Stresses.

Directory of Open Access Journals (Sweden)

Dongli Wan

Full Text Available Stipa grandis P. Smirn. is a dominant plant species in the typical steppe of the Xilingole Plateau of Inner Mongolia. Selection of suitable reference genes for the quantitative real-time reverse transcription polymerase chain reaction (qRT-PCR is important for gene expression analysis and research into the molecular mechanisms underlying the stress responses of S. grandis. In the present study, 15 candidate reference genes (EF1 beta, ACT, GAPDH, SamDC, CUL4, CAP, SNF2, SKIP1, SKIP5, SKIP11, UBC2, UBC15, UBC17, UCH, and HERC2 were evaluated for their stability as potential reference genes for qRT-PCR under different stresses. Four algorithms were used: GeNorm, NormFinder, BestKeeper, and RefFinder. The results showed that the most stable reference genes were different under different stress conditions: EF1beta and UBC15 during drought and salt stresses; ACT and GAPDH under heat stress; SKIP5 and UBC17 under cold stress; UBC15 and HERC2 under high pH stress; UBC2 and UBC15 under wounding stress; EF1beta and UBC17 under jasmonic acid treatment; UBC15 and CUL4 under abscisic acid treatment; and HERC2 and UBC17 under salicylic acid treatment. EF1beta and HERC2 were the most suitable genes for the global analysis of all samples. Furthermore, six target genes, SgPOD, SgPAL, SgLEA, SgLOX, SgHSP90 and SgPR1, were selected to validate the most and least stable reference genes under different treatments. Our results provide guidelines for reference gene selection for more accurate qRT-PCR quantification and will promote studies of gene expression in S. grandis subjected to environmental stress.

Nuclear energy through Philately; La energia nuclear a traves de la filatelia

Energy Technology Data Exchange (ETDEWEB)

Torres de la Pena, M. T.

2016-08-01

Postage stamps, apart from being signs of postage, are a valuable means of communication that reproduces, in mary ways, milestones of history. Postatge stamps have different formats and values, can be printed with different systems (offset, gravure or intaglio) and can also have several uses. Countries have used them to record important cultural, social, historical and scientific events that are often unknown, and generally to promote the image of a country. For this reason, postage stamps disclose international development in different disciplines; in this case, science and nuclear technology. (Author)

Molecular Genetic Analysis of Somaclonal Lines Genotypes of Silver Birch and Hybrid Birch

Directory of Open Access Journals (Sweden)

A. V. Konstantinov

2014-08-01

Full Text Available Enrichment of genetic diversity by means of somaclonal variation can allow selection of individuals with increased adaptability to various unfavorable conditions. Twenty shoot cultures differing in organogenesis and morphological features were selected for two studied clones. Multilocus genetic passports of somaclonal lines were developed according to RAPD analysis. Among the samples derived from clone № 52-84/8 shoot cultures the changes in RAPD-spectra were detected over primers UBC-106 and UBC-254. In the case of clone № 6-161/3 the same changes were detected over primers UBC-268 and UBC-154. UBC-203 primer didn’t show any variation.

Usefulness of the UBCTM (urinary bladder cancer) test compared to urinary cytology for transitional cell carcinoma of the bladder in patients with hematuria

International Nuclear Information System (INIS)

Gil, Myung Cheol; Kang, Do Young; Seong, Youl Koon

2001-01-01

Urinary cytology and cystoscopic exam are effective methods for diagnosis of transitional cell carcinoma (TCC). But the former shows drawbacks such as the need for a well-trained examiner, and wide imprecision related to the variability of microscopic exam; the latter is a invasive method. UBC TM test detects the epitope on specific cytokeratin fragments released from epithelium of bladder cancer by immunoradiometric assay. We compared UBC TM test with urinary cytology for diagnosis of TCC to evaluate the utility of UBC TM test. Eighty-four patients with hematuria were included in our study, UBC TM tests (IDL Biotech, Sweden) were assayed in mid-stream urine according to the ordinary assay protocol. Nineteen patients were confirmed as TCC by cystoscopic examination and underwent transurethral resection (Group A). Other patients had various benign urinary tract conditions (Group B). Samples were considered positive as the UBC TM concentration was greater than 12 μg/L. UBC TM levels were significantly different between group A (95.9 ±166.4 μg/L) and group B (19.2 ± 85.6 μg/L)(p TM test and 100% (65/65) in cytology. UBC TM test was significantly more sensitive in stage Ta, T 1 tumors (84.6 vs 38.5%, p TM test showed a tendency to be more sensitive as the grade was higher (83.3% in Grade 1, 90% in Grade II and 100% in Grade III). UBC TM test could be a useful method in distinguishing TCC from other benign genitourinary diseases. Moreover, UBC TM test could be an especially valuable marker for diagnosis of TCC in patients with early TCC of low grade TCC compared to urinary cytology. Therefore, mbined use of UBC TM test in association with cytology is helpful to overcome the limited sensitivity of cytology

α-Synuclein expression in the mouse cerebellum is restricted to VGluT1 excitatory terminals and is enriched in unipolar brush cells.

Science.gov (United States)

Lee, Sun Kyong; Sillitoe, Roy V; Silva, Coralie; Martina, Marco; Sekerkova, Gabriella

2015-10-01

α-Synuclein has a crucial role in synaptic vesicle release and synaptic membrane recycling. Although its general expression pattern has been described in the cerebellum, the precise cerebellar structures where α-synuclein is localized are poorly understood. To address this question, we used α-synuclein immunohistochemistry in adult mice cerebellar sections. We found that α-synuclein labels glutamatergic but not glycinergic and GABAergic synaptic terminals in the molecular and granule cell layers. α-Synuclein was preferentially expressed in parallel and mossy fiber synaptic terminals that also express vesicular glutamate transporter 1 (VGluT1), while it was not detected in VGluT2-positive climbing fibers. α-Synuclein was particularly enriched in lobules IX and X, a region known to contain a high density of unipolar brush cells (UBCs). To elucidate whether the α-synuclein-positive mossy fibers belong to UBCs, we double-labeled cerebellar sections with antibodies to α-synuclein and UBC-type-specific markers (calretinin for type I and metabotropic glutamate receptor 1α (mGluR1α) for type II UBCs) and took advantage of organotypic cerebellar cultures (in which all mossy fibers are UBC axons) and moonwalker mice (in which almost all UBCs are ablated) and found that both type I and type II UBCs express α-synuclein. In moonwalker mutant cerebella, the α-synuclein/VGluT1 immunolabeling showed a dramatic decrease in the vestibulocerebellum that correlated with the absence of UBC. α-Synuclein appears to be an excellent marker for intrinsic mossy fibers of the VGluT1 subset in conjunction with UBCs of both subtypes.

39 CFR 501.15 - Computerized Meter Resetting System.

Science.gov (United States)

2010-07-01

... 39 Postal Service 1 2010-07-01 2010-07-01 false Computerized Meter Resetting System. 501.15... AND DISTRIBUTE POSTAGE EVIDENCING SYSTEMS § 501.15 Computerized Meter Resetting System. (a) Description. The Computerized Meter Resetting System (CMRS) permits customers to reset their postage meters at...

77 FR 26185 - POSTNET Barcode Discontinuation

Science.gov (United States)

2012-05-03

... discontinue POSTNET barcodes for automation letter and flat price eligibility. There were six comments... on each piece, to facilitate processing by presort companies. We added language to specifically allow..., with or without prepayment of postage, for return to the address on the reply piece. If postage is...

Asthma status is associated with decreased risk of aggressive urothelial bladder cancer.

Science.gov (United States)

Rava, Marta; Czachorowski, Maciej J; Silverman, Debra; Márquez, Mirari; Kishore, Sirish; Tardón, Adonina; Serra, Consol; García-Closas, Montse; Garcia-Closas, Reina; Carrato, Alfredo; Rothman, Nathaniel; Real, Francisco X; Kogevinas, Manolis; Malats, Núria

2018-02-01

Previous studies suggested an association between atopic conditions and specific cancers. The results on the association with urothelial bladder cancer (UBC) are scarce and inconsistent. To evaluate the association between asthma and risk of UBC, we considered 936 cases and 1,022 controls from the Spanish Bladder Cancer/EPICURO Study (86% males, mean age 65.4 years), a multicenter and hospital-based case-control study conducted during 1998-2001. Participants were asked whether they had asthma and detailed information about occupational exposures, smoking habits, dietary factors, medical conditions and history of medication was collected through face-to-face questionnaires performed by trained interviewers. Since asthma and UBC might share risk factors, association between patients' characteristics and asthma was studied in UBC controls. Association between UBC and asthma was assessed using logistic regression unadjusted and adjusted for potential confounders. The complex interrelationships, direct and mediating effect of asthma on UBC, were appraised using counterfactual mediation models. Asthma was associated with a reduced risk of UBC (odds ratio (OR) = 0.54, 95% confidence interval (CI) 0.37, 0.79) after adjusting for a wide range of confounders. No mediating effect was identified. The reduced risk associated with asthma was restricted to patients with high-risk non-muscle invasive (OR = 0.25, 95%CI 0.10, 0.62) and muscle invasive UBC (OR = 0.32, 95%CI 0.15, 0.69). Our results support that asthma is associated with a decreased risk of UBC, especially among aggressive tumors. Further work on the relationship between asthma and other atopic conditions and cancer risk should shed light on the relationship between immune response mechanisms and bladder carcinogenesis. © 2017 UICC.

15 CFR 719.8 - Filing and service of papers other than the NOVA.

Science.gov (United States)

2010-01-01

... (first class postage prepaid), by express or equivalent parcel delivery service, via facsimile, or by... made by United States mail (first class postage prepaid), by express or equivalent parcel delivery... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Filing and service of papers other...

Degradation signals for ubiquitin system proteolysis in Saccharomyces cerevisiae.

Science.gov (United States)

Gilon, T; Chomsky, O; Kulka, R G

1998-01-01

Combinations of different ubiquitin-conjugating (Ubc) enzymes and other factors constitute subsidiary pathways of the ubiquitin system, each of which ubiquitinates a specific subset of proteins. There is evidence that certain sequence elements or structural motifs of target proteins are degradation signals which mark them for ubiquitination by a particular branch of the ubiquitin system and for subsequent degradation. Our aim was to devise a way of searching systematically for degradation signals and to determine to which ubiquitin system subpathways they direct the proteins. We have constructed two reporter gene libraries based on the lacZ or URA3 genes which, in Saccharomyces cerevisiae, express fusion proteins with a wide variety of C-terminal extensions. From these, we have isolated clones producing unstable fusion proteins which are stabilized in various ubc mutants. Among these are 10 clones whose products are stabilized in ubc6, ubc7 or ubc6ubc7 double mutants. The C-terminal extensions of these clones, which vary in length from 16 to 50 amino acid residues, are presumed to contain degradation signals channeling proteins for degradation via the UBC6 and/or UBC7 subpathways of the ubiquitin system. Some of these C-terminal tails share similar sequence motifs, and a feature common to almost all of these sequences is a highly hydrophobic region such as is usually located inside globular proteins or inserted into membranes. PMID:9582269

The mechanism of OTUB1-mediated inhibition of ubiquitination

Energy Technology Data Exchange (ETDEWEB)

Wiener, Reuven; Zhang, Xiangbin; Wang, Tao; Wolberger, Cynthia (JHU)

2013-04-08

Histones are ubiquitinated in response to DNA double-strand breaks (DSB), promoting recruitment of repair proteins to chromatin. UBC13 (also known as UBE2N) is a ubiquitin-conjugating enzyme (E2) that heterodimerizes with UEV1A (also known as UBE2V1) and synthesizes K63-linked polyubiquitin (K63Ub) chains at DSB sites in concert with the ubiquitin ligase (E3), RNF168 (ref. 3). K63Ub synthesis is regulated in a non-canonical manner by the deubiquitinating enzyme, OTUB1 (OTU domain-containing ubiquitin aldehyde-binding protein 1), which binds preferentially to the UBC13-Ub thiolester. Residues amino-terminal to the OTU domain, which had been implicated in ubiquitin binding, are required for binding to UBC13-Ub and inhibition of K63Ub synthesis. Here we describe structural and biochemical studies elucidating how OTUB1 inhibits UBC13 and other E2 enzymes. We unexpectedly find that OTUB1 binding to UBC13-Ub is allosterically regulated by free ubiquitin, which binds to a second site in OTUB1 and increases its affinity for UBC13-Ub, while at the same time disrupting interactions with UEV1A in a manner that depends on the OTUB1 N terminus. Crystal structures of an OTUB1-UBC13 complex and of OTUB1 bound to ubiquitin aldehyde and a chemical UBC13-Ub conjugate show that binding of free ubiquitin to OTUB1 triggers conformational changes in the OTU domain and formation of a ubiquitin-binding helix in the N terminus, thus promoting binding of the conjugated donor ubiquitin in UBC13-Ub to OTUB1. The donor ubiquitin thus cannot interact with the E2 enzyme, which has been shown to be important for ubiquitin transfer. The N-terminal helix of OTUB1 is positioned to interfere with UEV1A binding to UBC13, as well as with attack on the thiolester by an acceptor ubiquitin, thereby inhibiting K63Ub synthesis. OTUB1 binding also occludes the RING E3 binding site on UBC13, thus providing a further component of inhibition. The general features of the inhibition mechanism explain how OTUB1

Risk of bladder cancer in patients with diabetes

DEFF Research Database (Denmark)

Goossens, Maria E; Zeegers, Maurice P; Bazelier, Marloes T

2015-01-01

Statistics (ONS). Patients diagnosed with diabetes mellitus type 1 or 2, or using antidiabetic drugs (ADDs), were compared to matched non-diabetic controls. Cox proportional hazards models were used to estimate the risk and mortality of UBC. We adjusted for age, sex, smoking status and body mass index....... RESULTS: The cohort included 329,168 patients using ADD, and 307,315 controls with 1295 and 1071 patients, respectively, diagnosed as having UBC during follow-up. The adjusted HRs of UBC were 0.77 (95% CI 0.57 to 1.05) and 1.04 (95% CI 0.96 to 1.14) for type 1 and 2 diabetes, respectively. These results...... haemoglobin. Mortality of UBC was not increased for patients with either type 1 (HR=0.95 (95% CI 0.39 to 2.34)) or type 2 diabetes (HR=1.16 (95% CI 0.91 to 1.46)). CONCLUSIONS: Neither the risk of UBC nor the mortality from UBC was increased in patients with type 1 and patients with type 2 diabetes...

Exaggerated inflammatory response after use of recombinant bone morphogenetic protein in recurrent unicameral bone cysts.

Science.gov (United States)

MacDonald, Kevin M; Swanstrom, Morgan M; McCarthy, James J; Nemeth, Blaise A; Guliani, Teresa A; Noonan, Kenneth J

2010-03-01

Recurrent unicameral bone cysts (UBCs) can result in significant morbidity during a child's physical and emotional development. Multiple treatment options are available and a review of the literature fails to clearly define the optimal treatment for UBCs. Recombinant bone morphogenetic protein (BMP) has been used with success in other disorders of poor bone formation. This manuscript is the first to report on the use of recombinant BMP in the treatment of UBCs. Three patients with recurrent UBCs underwent revision surgery with recombinant BMP. Radiographic and medical review was performed and is reported here. In these patients, the use of BMP failed to fully resolve their UBC; 2 patients had complete recurrence that required further surgery. In addition to poor radiographic results, all patients developed exaggerated inflammatory responses in the acute postoperative period. Each child developed clinically significant limb swelling and pain that mimicked infection. On the basis of our poor radiographic results and a paradoxical clinical result, we no longer recommend the use of recombinant BMP in the manner reported here for the treatment of recurrent UBCs. Level IV, case series.

Subscriptions

African Journals Online (AJOL)

Subscriptions Contact. Rachel Rege Kenya Agricultural Research Institute, P O Box 57811, Nairobi, KENYA Email: rrege@kari.org. East Africa Kssh 4000; Sterling 40; USA $62; including postage by surface mail. Postage by air mail can be arranged at cost on request. Payments to be made to the Editor, East African ...

78 FR 14079 - Legal Processes

Science.gov (United States)

2013-03-04

...-hour) costs in the form of filing fees and postage costs. This collection has filing fees associated... that approximately 5 petitions will be filed per year with a fee of $130, for a total fee cost of $650. There are no other fees associated with this information collection. Customers may incur postage costs...

77 FR 10482 - Trademark Petitions

Science.gov (United States)

2012-02-22

...: $15,550. This collection has annual (non-hour) costs in the form of postage costs and filing fees. The... filing fee cost for this collection is $15,000. Total non-hour Item Responses Filing fee ($) cost burden...) respondent cost burden in postage costs and filing fees for this information collection is $15,550. IV...

78 FR 68419 - Trademark Trial and Appeal Board (TTAB) Actions

Science.gov (United States)

2013-11-14

... collection does have annual (non-hour) costs in the form of postage as well as filing fees. The petitions to... associated with this information collection. Total non-hour Item Responses Filing fee ($) cost burden (a) (b... collection, in the form of postage costs and filing fees, is 2,453,224 per year. IV. Request for Comments...

Risk of urinary bladder cancer: a case-control analysis of industry and occupation

Directory of Open Access Journals (Sweden)

Wu Xifeng

2009-12-01

Full Text Available Abstract Background Uncertainty remains about urinary bladder cancer (UBC risk for many occupations. Here, we investigate the association between occupation, industry and UBC. Methods Lifetime occupational history was collected by in-person interview for 604 newly diagnosed UBC patients and 604 cancer-free controls. Each job title was assigned a two-digit industry code and a three-digit occupation code. Odds ratios (ORs for UBC associated with ever being employed in an industry or occupation were calculated by unconditional logistic regression adjusting for age, gender and smoking status. We also examined UBC risk by duration of employment (>0 to Results Significantly increased risk of UBC was observed among waiters and bartenders (OR 2.87; 95% CI 1.05 to 7.72 and occupations related to medicine and health (OR 2.17; 95% CI 1.21 to 3.92, agricultural production, livestock and animal specialties (OR 1.90; 95% CI 1.03 to 3.49, electrical assembly, installation and repair (OR 1.69; 95% CI 1.07 to 2.65, communications (OR 1.74; 95% CI 1.00 to 3.01, and health services (OR 1.58; 95% CI 1.02 to 2.44. For these occupations we also observed a significant excess risk of UBC for long-term work (i.e. ≥10 years, with the exception of waiters and bartenders. Employment for 10 years or more was associated with increased risk of UBC in general farmers (OR 9.58; 95% CI 2.18 to 42.05, agricultural production of crops (OR 3.36; 95% CI 1.10 to 10.27, occupations related to bench working (OR 4.76; 95% CI 1.74 to 13.01, agricultural, fishery, forestry & related (OR 4.58; 95% CI 1.97 to 10.65, transportation equipment (OR 2.68; 95% CI 1.03 to 6.97, and structural work (OR 1.85; 95% CI 1.16 to 2.95. Conclusions This study provides evidence of increased risk of UBC for occupations that were previously reported as at-risk. Workers in several occupation and industry groups have a significantly higher risk of UBC, particularly when duration of employment is 10 years or

Comparison of three surgical treatment options for unicameral bone cysts in humerus.

Science.gov (United States)

Mavčič, Blaž; Saraph, Vinay; Gilg, Magdalena M; Bergovec, Marko; Brecelj, Janez; Leithner, Andreas

2018-04-23

Treatment of unicameral bone cysts (UBC) in the humerus with drainage screws is scarcely reported in the literature. The aim of this retrospective study was to compare drainage screws and alternative treatment methods with respect to the number of required surgical procedures to achieve sufficient UBC healing, postoperative fractures/recurrences/complications, and radiological outcome. Medical archives of two tertiary orthopedic referral centers were screened for all patients who were treated surgically for humeral UBC in the period 1991-2015 with a histologically/cytologically confirmed diagnosis. Sex, age, all surgical procedures, fractures, complications, recurrences, and the final radiological outcome were compared between patients treated with drainage screws, elastic intramedullary nails, or curettage with optional grafting. The study included 106 operated patients with a mean age of 10.3 years, with a mean follow-up of 5.7 years. The average number of UBC-related surgical procedures in sex-matched and age-matched treatment groups was 2.7 with drainage screws, 2.8 with intramedullary nails, and 3.5 with curettage/grafting (P=0.54). Intramedullary nails (odds ratio 0.20) and older age (odds ratio for each year 0.83) predicted a lower risk of postoperative UBC recurrence. Patients with drainage screws had the highest UBC recurrence rates and the lowest rates of changed initial treatment method. There was no difference between the treatment groups in the postoperative fracture rate, complications, or the final radiological outcome. UBC treatment in the humerus therefore requires approximately three surgical procedures, irrespective of the treatment modality chosen. Adding an elastic intramedullary nail to a humeral UBC cyst may reduce recurrence risk and prevent further fractures. Level III - therapeutic retrospective comparative study.

UBC-Nepal expedition

DEFF Research Database (Denmark)

Hansen, Alexander B; Hoiland, Ryan L; Lewis, Nia C S

2018-01-01

the course of acclimatization to the hypoxia of terrestrial high altitude has not been examined. Thus, the purpose of the present study was to examine the influence of orally ingested antioxidants at clinically relevant doses (vitamins C and E and α-lipoic acid) on cerebrovascular regulation at sea level...... (344 m; n = 12; female n = 2 participants) and at high altitude (5050 m; n = 9; female n = 2) in a randomized, placebo-controlled and double-blinded crossover design. Hypercapnic and hypoxic cerebrovascular reactivity tests of the internal carotid artery (ICA) were conducted at sea level, and global...... that an oral antioxidant cocktail known to attenuate systemic oxidative stress failed to alter cerebrovascular function at sea level and CBF during acclimatization to high altitude....

Unicameral Bone Cysts in the Humerus: Treatment Outcomes.

Science.gov (United States)

Kadhim, Muayad; Sethi, Samir; Thacker, Mihir M

2016-06-01

Several treatment modalities have been described for the treatment of unicameral bone cysts (UBC). The aim of this study was to examine the outcome of various treatment modalities of UBC in a specific anatomic location, the humerus. This study is a retrospective case-only study of patients with humeral UBC with minimum follow-up of 1 year. Medical records and radiographs were assessed and UBC healing status was determined based on most recent follow-up radiographs and divided into 3 groups (healed, partially healed, and not healed). Descriptive statistics were utilized to summarize study outcome. Sixty-eight patients (54 boys and 14 girls) with humeral UBC comprised the study population. Sixty-four cases (94.1%) presented with a pathologic fracture. Fifty-one cases were in the proximal metaphysis and 17 were in the diaphysis. Mean age at diagnosis was 9.2±3.7 years, and mean follow-up was 4.0±2.6 years. Twenty-five patients were treated with observation, 38 by injection (27 with steroids and 11 with bone marrow), and 5 by open surgery. Patients who underwent open surgery had relatively larger cyst length, width, and cyst index, and all healed or partially healed at last follow-up. UBC persistence was observed in 29% of diaphyseal and 27.5% of metaphyseal cysts. Of the 19 patients with persistence, 8 were treated with observation, 9 with steroid injection, and 2 with bone marrow injection. Inner wall disruption before injection was performed in 17 patients (24% did not heal), whereas 21 patients did not have inner wall disruption (33% did not heal). Twenty patients received >1 injection. Eleven patients complained of pain at the last visit (8 had a persistent cyst, 2 were partially healed, and 1 had a healed UBC). Complete healing of humeral UBC is challenging to achieve irrespective of treatment modality. UBCs treated with open surgery tended to heal better. Unhealed cysts were more likely to be associated with pain. Level III-a retrospective comparative study.

MR imaging of simple bone cysts in children: not so simple

Energy Technology Data Exchange (ETDEWEB)

Margau, R. [Faculty of Medicine, University of Toronto, Toronto, ON (Canada); Babyn, P. [Department of Diagnostic Imaging, The Hospital for Sick Children, Toronto, ON (Canada); Cole, W.; Lee, F. [Division of Orthopaedic Surgery, Department of Surgery, The Hospital for Sick Children and University of Toronto, Toronto, ON (Canada); Smith, C. [Department of Pathology, The Hospital for Sick Children and University of Toronto, Toronto, ON (Canada)

2000-08-01

Objective. The unicameral bone cyst (UBC) is a common cystic bone lesion seen in children. We review and summarize its MR findings, focusing on their appearance following contrast enhancement, and correlating them to known histologic features of UBC. Subjects and methods. A retrospective review of 20 cases (13 boys, 7 girls; age range, 1-17 years; mean age, 8.9) diagnosed as UBC was conducted. Clinical histories, radiographic and MR features, follow-up data, and available pathologic findings were noted. Results. At initial presentation 18 (90 %) of the patients with UBC had a history of acute or remote pathologic fracture. Cysts with history of fracture displayed heterogeneous fluid signals on T1- (n = 9, 50 %), and T2-weighted (n = 15, 83 %) MR images. Gadolinium-enhanced images were obtained in 15 of the 18 UBC cases with history of previous fracture. All showed enhancement with focal, thick peripheral, heterogeneous, or subcortical patterns. Focal nodules of homogeneous enhancement (diameter > 1 cm) within the UBC (n = 5) correlated with areas of ground-glass opacification on plain film. Other interesting MR features were fluid-fluid levels (n = 11), ''fallen-leaf'' sign (n = 1), soft-tissue changes (n = 2), and detection of septations not seen on plain film (n = 2). Conclusion. UBCs frequently appear complicated on MR imaging, with heterogeneous fluid signals and regions of nodular and thick peripheral enhancement related to previous pathologic fracture and early healing. (orig.)

MR imaging of simple bone cysts in children: not so simple

International Nuclear Information System (INIS)

Margau, R.; Babyn, P.; Cole, W.; Lee, F.; Smith, C.

2000-01-01

Objective. The unicameral bone cyst (UBC) is a common cystic bone lesion seen in children. We review and summarize its MR findings, focusing on their appearance following contrast enhancement, and correlating them to known histologic features of UBC. Subjects and methods. A retrospective review of 20 cases (13 boys, 7 girls; age range, 1-17 years; mean age, 8.9) diagnosed as UBC was conducted. Clinical histories, radiographic and MR features, follow-up data, and available pathologic findings were noted. Results. At initial presentation 18 (90 %) of the patients with UBC had a history of acute or remote pathologic fracture. Cysts with history of fracture displayed heterogeneous fluid signals on T1- (n = 9, 50 %), and T2-weighted (n = 15, 83 %) MR images. Gadolinium-enhanced images were obtained in 15 of the 18 UBC cases with history of previous fracture. All showed enhancement with focal, thick peripheral, heterogeneous, or subcortical patterns. Focal nodules of homogeneous enhancement (diameter > 1 cm) within the UBC (n = 5) correlated with areas of ground-glass opacification on plain film. Other interesting MR features were fluid-fluid levels (n = 11), ''fallen-leaf'' sign (n = 1), soft-tissue changes (n = 2), and detection of septations not seen on plain film (n = 2). Conclusion. UBCs frequently appear complicated on MR imaging, with heterogeneous fluid signals and regions of nodular and thick peripheral enhancement related to previous pathologic fracture and early healing. (orig.)

Women Putting Our Stamp on America: Biographies and Activities for National Women's History Month, March 1999.

Science.gov (United States)

National Women's History Project, Windsor, CA.

This booklet, intended for use by educators and by workplace and community organizers, introduces women who have been featured on U.S. postage stamps as well as a few of the women who clearly merit such honor in the future. Postage stamps featuring women have been relatively few and far between and have only skimmed the surface of U.S. women in…

The prognostic value of family history among patients with urinary bladder cancer.

Science.gov (United States)

Egbers, Lieke; Grotenhuis, Anne J; Aben, Katja K; Alfred Witjes, J; Kiemeney, Lambertus A; Vermeulen, Sita H

2015-03-01

A history of urinary bladder cancer (UBC) in first-degree relatives increases UBC risk by twofold. The influence of positive family history on UBC prognosis is unknown. Here, we investigated association of first-degree UBC family history with clinicopathological characteristics and prognosis of UBC patients. Detailed clinical data of 1,465 non-muscle-invasive bladder cancer (NMIBC) and 250 muscle-invasive or metastatic bladder cancer (MIBC) patients, diagnosed from 1995 to 2010, were collected through medical file review. Competing risk analyses were used to compare recurrence-free survival (RFS) and progression-free survival (PFS) of NMIBC patients according to self-reported UBC family history. Overall survival in MIBC patients was estimated using Kaplan-Meier analysis. The added value of family history in prediction of NMIBC prognosis was quantified with Harrell's concordance-index. Hundred (6.8%) NMIBC and 14 (5.6%) MIBC patients reported UBC in first-degree relatives. Positive family history was statistically significantly associated with smaller tumor size and non-significantly with more favorable distribution of other tumor characteristics. In univariable analyses, positive family history correlated with longer RFS (p = 0.11) and PFS (p = 0.04). Hazard ratios for positive vs. negative family history after adjustment for clinicopathological characteristics were 0.75 (95% CI = 0.53-1.07) and 0.45 (95% CI = 0.18-1.12) for RFS and PFS, respectively. Five familial and 48 sporadic MIBC patients (Kaplan-Meier 10-year risk: 41% and 25%) died within 10 years. Family history did not improve the c-index of prediction models. This study shows that a first-degree family history of UBC is not clearly associated with NMIBC prognosis. Family history does not aid in prediction of NMIBC recurrence or progression. © 2014 The Authors. Published by Wiley Periodicals, Inc. on behalf of UICC.

Case report: unicameral bone cysts in a young patient with acquired generalized lipodystrophy.

Science.gov (United States)

Gregory, James M; Arkader, Alexandre; Bokhari, Aqiba; Bothari, Aqiba; Dormans, John P

2010-05-01

We report the case of a 13-year-old boy with bilateral distal femoral unicameral bone cysts (UBCs) associated with acquired generalized lipodystrophy. As opposed to congenital generalized lipodystrophy, cystic bone lesions in acquired generalized lipodystrophy are rare. After radiographic and histologic confirmation of the UBCs, we performed percutaneous intramedullary decompression, curettage, and grafting. UBCs can be an important manifestation of acquired generalized lipodystrophy. Cystic bone lesions appear to be less common in acquired generalized lipodystrophy than in congenital generalized lipodystrophy, and intramedullary adipose tissue loss may be a predisposing factor for the development of bone lesions in patients with acquired generalized lipodystrophy. When evaluating a patient with lipodystrophy, doctors should recognize the clinical course may include the development of UBCs.

Unicameral Bone Cyst in the Calcaneus of Mirror Image Twins.

Science.gov (United States)

Lenze, Ulrich; Stolberg-Stolberg, Josef; Pohlig, Florian; Lenze, Florian; von Eisenhart-Rothe, Rüdiger; Rechl, Hans; Toepfer, Andreas

2015-01-01

Unicameral bone cysts (UBCs) are benign tumor-like lesions that commonly occur in the diaphyseal or metaphyseal region of the long bones within the first 2 decades of life. Until today, the pathogenesis of UBC has been unclear, but mechanisms such as vascular occlusion or a response to trauma have been supposed. During the past decade, in particular, the genetic aspects of the development of this rare lesion have been discussed. We present the first case of mirror image monozygotic twins with a mirror image UBC of the calcaneus. Our findings reinforce the importance of additional studies to understand the significance of cytogenetic factors in the etiology of UBC. Copyright © 2015 American College of Foot and Ankle Surgeons. Published by Elsevier Inc. All rights reserved.

A Highly Expressed High-Molecular-Weight S-Layer Complex of Pelosinus sp. Strain UFO1 Binds Uranium

Energy Technology Data Exchange (ETDEWEB)

Thorgersen, Michael P. [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology; Lancaster, W. Andrew [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology; Rajeev, Lara [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Systems and Engineering Division; Ge, Xiaoxuan [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology; Vaccaro, Brian J. [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology; Poole, Farris L. [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology; Arkin, Adam P. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Systems and Engineering Division; Mukhopadhyay, Aindrila [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Systems and Engineering Division; Adams, Michael W. W. [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology

2016-12-02

Cell suspensions of Pelosinus sp. strain UFO1 were previously shown, using spectroscopic analysis, to sequester uranium as U(IV) complexed with carboxyl and phosphoryl group ligands on proteins. The goal of our present study was to characterize the proteins involved in uranium binding. Virtually all of the uranium in UFO1 cells was associated with a heterodimeric protein, which was termed the uranium-binding complex (UBC). The UBC was composed of two S-layer domain proteins encoded by UFO1_4202 and UFO1_4203. Samples of UBC purified from the membrane fraction contained 3.3 U atoms/heterodimer, but significant amounts of phosphate were not detected. The UBC had an estimated molecular mass by gel filtration chromatography of 15 MDa, and it was proposed to contain 150 heterodimers (UFO1_4203 and UFO1_4202) and about 500 uranium atoms. The UBC was also the dominant extracellular protein, but when purified from the growth medium, it contained only 0.3 U atoms/heterodimer. The two genes encoding the UBC were among the most highly expressed genes within the UFO1 genome, and their expressions were unchanged by the presence or absence of uranium. Therefore, the UBC appears to be constitutively expressed and is the first line of defense against uranium, including by secretion into the extracellular medium. Although S-layer proteins were previously shown to bind U(VI), here we showed that U(IV) binds to S-layer proteins, we identified the proteins involved, and we quantitated the amount of uranium bound. Widespread uranium contamination from industrial sources poses hazards to human health and to the environment. Here in this paper, we identified a highly abundant uranium-binding complex (UBC) from Pelosinus sp. strain UFO1. The complex makes up the primary protein component of the S-layer of strain UFO1 and binds 3.3 atoms of U(IV) per heterodimer. Finally, while other bacteria have been shown to bind U(VI) on their S-layer, we demonstrate here an example of U(IV) bound by

Treatment of unicameral bone cyst: systematic review and meta analysis.

Science.gov (United States)

Kadhim, Muayad; Thacker, Mihir; Kadhim, Amjed; Holmes, Laurens

2014-03-01

Different treatment modalities have been utilized to treat unicameral bone cyst (UBC), but evidence has not been fully described to support one treatment over another and the optimal treatment is controversial. The aim of this quantitative systematic review was to assess the effectiveness of different UBC treatment modalities. We utilized Pubmed to isolate retrospective studies on patients with UBC who received any kind of treatment. The included studies needed to have a minimum sample size of 15 patients, and have provided data on radiographic healing outcome. Sixty-two articles were selected for the meta-analysis from a total of 463 articles. The cumulative sample size was 3,211 patients with 3,217 UBC, and male to female ratio was 2.2:1. The summary or pool estimate of methylprednisolone acetate (MPA) injection resulted in a healing rate of (77.4 %) that was comparable to bone marrow injection (77.9 %). A higher healing rate was observed with MPA injection when inner wall disruption was performed. The pool estimate of bone marrow with demineralized bone matrix injection was high (98.7 %). UBC healing rate after surgical curettage was comparable whether autograft or allograft was utilized (90 %). UBC treatment with flexible intramedullary nails without curettage provided almost 100% healing rate, while continuous decompression with cannulated screws provided 89 % healing rate. Conservative treatment indicated a healing rate of 64.2, 95 % CI (26.7-101.8). Active treatment for UBC provided variable healing rates and the outcomes were favorable relative to conservative treatment. Due to the heterogeneity of the studies and reporting bias, the interpretation of these findings should be handled with caution.

CDM Project Opportunities in Thailand

DEFF Research Database (Denmark)

2009-01-01

Interview on Channel 2 UBC Thailand Fysisk medie: .dat mpeg video file Tidspunkt for udsendelse: 2003/06/28......Interview on Channel 2 UBC Thailand Fysisk medie: .dat mpeg video file Tidspunkt for udsendelse: 2003/06/28...

Genome-Wide Identification, Phylogenetic and Expression Analyses of the Ubiquitin-Conjugating Enzyme Gene Family in Maize

Science.gov (United States)

Jue, Dengwei; Sang, Xuelian; Lu, Shengqiao; Dong, Chen; Zhao, Qiufang; Chen, Hongliang; Jia, Liqiang

2015-01-01

Background Ubiquitination is a post-translation modification where ubiquitin is attached to a substrate. Ubiquitin-conjugating enzymes (E2s) play a major role in the ubiquitin transfer pathway, as well as a variety of functions in plant biological processes. To date, no genome-wide characterization of this gene family has been conducted in maize (Zea mays). Methodology/Principal Findings In the present study, a total of 75 putative ZmUBC genes have been identified and located in the maize genome. Phylogenetic analysis revealed that ZmUBC proteins could be divided into 15 subfamilies, which include 13 ubiquitin-conjugating enzymes (ZmE2s) and two independent ubiquitin-conjugating enzyme variant (UEV) groups. The predicted ZmUBC genes were distributed across 10 chromosomes at different densities. In addition, analysis of exon-intron junctions and sequence motifs in each candidate gene has revealed high levels of conservation within and between phylogenetic groups. Tissue expression analysis indicated that most ZmUBC genes were expressed in at least one of the tissues, indicating that these are involved in various physiological and developmental processes in maize. Moreover, expression profile analyses of ZmUBC genes under different stress treatments (4°C, 20% PEG6000, and 200 mM NaCl) and various expression patterns indicated that these may play crucial roles in the response of plants to stress. Conclusions Genome-wide identification, chromosome organization, gene structure, evolutionary and expression analyses of ZmUBC genes have facilitated in the characterization of this gene family, as well as determined its potential involvement in growth, development, and stress responses. This study provides valuable information for better understanding the classification and putative functions of the UBC-encoding genes of maize. PMID:26606743

Unicameral (simple) and aneurysmal bone cysts: the effect of insufficient curettage on recurrence.

Science.gov (United States)

Çelik, Suat; Uludağ, Abuzer; Tosun, Hacı Bayram; Serbest, Sancar; Gürger, Murat; Kılıç, Sabahattin

2016-01-01

Curettage of the cyst and bone grafting are the most common methods used in the treatment of unicameral bone cysts (UBC) and aneurysmal bone cysts (ABC). Recurrence of these cysts is often associated with insufficient curettage of the cyst during surgery. In this study, we aimed to evaluate the effect of insufficient curettage on recurrence in patients with UBC and ABC. The retrospective study included 18 patients with UBC and 14 patients with ABC that were surgically treated by curettage and bone grafting in our clinic between 2006-2013. Mean age was 19.80 (range, 4-50) years in the patients with UBC and 21.76 (range, 4-56) in the patients with ABC. The diagnosis of the cysts was established both clinically and radiologically. Mean follow-up period was 36 (range, 6-60) months both in the patients with UBC and ABC. The patients with recurrence underwent a second curettage and grafting procedure. Healing and recurrence were evaluated according to modified Neer's scale. Recurrence occurred in 8 patients. Of these, 5 patients underwent a second curettage and grafting procedure and 3 patients were lost to follow-up. Complete healing occurred in all the patients that underwent a second curettage and grafting procedure. The achievement of complete healing in the patients that underwent a second curettage and grafting procedure indicates that the recurrence of UBC and ABC is associated with insufficient curettage.

Clinical factors affecting pathological fracture and healing of unicameral bone cysts.

Science.gov (United States)

Urakawa, Hiroshi; Tsukushi, Satoshi; Hosono, Kozo; Sugiura, Hideshi; Yamada, Kenji; Yamada, Yoshihisa; Kozawa, Eiji; Arai, Eisuke; Futamura, Naohisa; Ishiguro, Naoki; Nishida, Yoshihiro

2014-05-17

Unicameral bone cyst (UBC) is the most common benign lytic bone lesion seen in children. The aim of this study is to investigate clinical factors affecting pathological fracture and healing of UBC. We retrospectively reviewed 155 UBC patients who consulted Nagoya musculoskeletal oncology group hospitals in Japan. Sixty of the 155 patients had pathological fracture at presentation. Of 141 patients with follow-up periods exceeding 6 months, 77 were followed conservatively and 64 treated by surgery. The fracture risk was significantly higher in the humerus than other bones. In multivariate analysis, ballooning of bone, cyst in long bone, male sex, thin cortical thickness and multilocular cyst were significant adverse prognostic factors for pathological fractures at presentation. The healing rates were 30% and 83% with observation and surgery, respectively. Multivariate analysis revealed that fracture at presentation and history of biopsy were good prognostic factors for healing of UBC in patients under observation. The present results suggest that mechanical disruption of UBC such as fracture and biopsy promotes healing, and thus watchful waiting is indicated in these patients, whereas patients with poor prognostic factors for fractures should be considered for surgery.

Controversial roles played by toll like receptor 4 in urinary bladder cancer; A systematic review.

Science.gov (United States)

Afsharimoghaddam, Amin; Soleimani, Mohammad; Lashay, Alireza; Dehghani, Mahdi; Sepehri, Zahra

2016-08-01

Urinary bladder cancer (UBC) is a prevalent human cancer. The main mechanisms which lead to eradication or progression the disease has yet to be clarified. Toll like receptor (TLR) 4 is a membrane receptor which is expressed either on immune cells or tumor cells. This review article was aimed to clear the main mechanisms played by TLR4 and its related intracellular pathways on outcome of UBC. PubMed, Scopus and Google scholar databases have been used for searching related research articles which have evaluated the roles played by TLR4 and its related intracellular pathways on outcome of UBC. Collected information from the related articles revealed that TLR4 either participates in induction of immune responses against UBC or development of the malignancy. There are limited investigations regarding the genetic variations of TLR4 in UBC. According to the results it seems that TLR4/ligands interaction outcome is dependent on several factors including TLR4 ligand doses, interaction of TLR4 with its ligands on immune cells or tumor cells, and other TLRs/ligand interaction simultaneously. Copyright © 2016 Elsevier Inc. All rights reserved.

Telomerase reverse transcriptase promoter mutations in bladder cancer

DEFF Research Database (Denmark)

Allory, Yves; Beukers, Willemien; Sagrera, Ana

2014-01-01

for detection of recurrences in urine in patients with urothelial bladder cancer (UBC). DESIGN, SETTING, AND PARTICIPANTS: A set of 111 UBCs of different stages was used to assess TERT promoter mutations by Sanger sequencing and TERT messenger RNA (mRNA) expression by reverse transcription...... surveillance after diagnosis of non-muscle-invasive UBC (n=194), was tested using a SNaPshot assay. OUTCOME MEASUREMENTS AND STATISTICAL ANALYSIS: Association of mutation status with age, sex, tobacco, stage, grade, fibroblast growth factor receptor 3 (FGFR3) mutation, progression-free survival, disease...... frequent among FGFR3 mutant tumors (p=0.0002). There was no association between TERT mutations and mRNA expression (p=0.3). Mutations were not associated with clinical outcome. In urine, TERT mutations had 90% specificity in subjects with hematuria but no bladder tumor, and 73% in recurrence-free UBC...

Elastic stable intramedullary nailing is the best treatment of unicameral bone cysts of the long bones in children?: Prospective long-term follow-up study.

Science.gov (United States)

de Sanctis, Nando; Andreacchio, Antonio

2006-01-01

Since Virchow first described the unicameral bone cyst (UBC) in 1876, several methods for management were proposed. Currently performed surgical procedures include curettage combined with bone grafting, allografting with freeze-dried crushed cortical bone, use of homologous cancellous bone chips, the application of high-porosity hydroxyapatite, and cryosurgery. Decompression with multiple drill holes and intralesional injections of either steroids or bone marrow have also been used to treat UBC, with variable success rates. Elastic stable intramedullary nailing for the treatment of UBC in long bones has been rapidly gaining popularity. Elastic stable intramedullary nailing for the treatment of a UBC was performed in 56 patients between 1994 and 2003. The follow-up is between 2.1 and 11 years. Nine children were excluded because of short period of follow-up or were lost. The study population consisted of 47 children. The cyst was located in the humerus in 36 patients, in the femur in 11. The mean age of the patients at the time of surgery was 8.9 years. Results were evaluated on plain radiographs according to the classification system of Capanna et al. In our study population of 47 UBCs, 31 (65.9 %) were classified as completely healed, and 16 (34.1%) were healed with residual radiolucency. No recurrence or no response was observed. Each lesion responded to treatment after the nailing. This method can solve in time the pathology, and we feel that, with skilled hands, this method is the best one for UBC treatment in the long bones of the children.

Considering University-Business Cooperation Modes from the Perspective of Enterprises

Science.gov (United States)

Pavlin, Samo

2016-01-01

This article analyses enterprises' engagement in university-business cooperation (UBC) activities: research and development, mobility of academics and students, curriculum development and lifelong learning. It first provides an introductory overview of university-business cooperation policy. It then presents a selection of UBC models, elements and…

A new avenue for classification and prediction of olive cultivars using supervised and unsupervised algorithms.

Directory of Open Access Journals (Sweden)

Amir H Beiki

Full Text Available Various methods have been used to identify cultivares of olive trees; herein we used different bioinformatics algorithms to propose new tools to classify 10 cultivares of olive based on RAPD and ISSR genetic markers datasets generated from PCR reactions. Five RAPD markers (OPA0a21, OPD16a, OP01a1, OPD16a1 and OPA0a8 and five ISSR markers (UBC841a4, UBC868a7, UBC841a14, U12BC807a and UBC810a13 selected as the most important markers by all attribute weighting models. K-Medoids unsupervised clustering run on SVM dataset was fully able to cluster each olive cultivar to the right classes. All trees (176 induced by decision tree models generated meaningful trees and UBC841a4 attribute clearly distinguished between foreign and domestic olive cultivars with 100% accuracy. Predictive machine learning algorithms (SVM and Naïve Bayes were also able to predict the right class of olive cultivares with 100% accuracy. For the first time, our results showed data mining techniques can be effectively used to distinguish between plant cultivares and proposed machine learning based systems in this study can predict new olive cultivars with the best possible accuracy.

Unusual localizations of unicameral bone cysts and aneurysmal bone cysts: A retrospective review of 451 cases.

Science.gov (United States)

Aycan, Osman Emre; Çamurcu, İsmet Yalkın; Özer, Devrim; Arıkan, Yavuz; Kabukçuoğlu, Yavuz Selim

2015-06-01

Unicameral bone cysts (UBC) and aneurysmal bone cysts (ABC) are benign cystic lesions of bone which are easily diagnosed. However, unusual locations may lead to a false diagnosis. Therefore the aim of this retrospective study was to determine the frequency of unusual localizations. The authors studied 451 cases with histopathologically confirmed diagnosis of UBC or ABC, seen between 1981 and 2012. In the UBC group (352 cases) humerus, femur and calcaneus were found to be the most common sites, while acetabulum, scapula, scaphoid, lunatum, metacarpals, metatarsals, toe phalanges and ulna each accounted for less than 1%. In the ABC group (99 cases) the most common sites of involvement were femur, humerus and tibia, while finger phalanges, ilium, acetabulum, pubis, calcaneus, cuboid, and toe phalanges each accounted for only 1%. The differential diagnosis of cystic bone lesions should include both UBC and ABC. Pain complaints plead for the latter, except in case of fracture.

Establishment of dna fingerprinting in clonal tea improved cultivars from yunnan of china using issr markers

International Nuclear Information System (INIS)

Liu, B.Y.; Zhao, C.M.; Sun, X.M.; Jiang, H.B.

2015-01-01

In this study, DNA fingerprints were constructed by using ISSR markers for 20 clonal improved varieties developed by two breeding institutes in Yunnan province. Seven core ISSR primers were selected from 15 primers. A total of 110 bands were generated by PAGE with seven core primers, 93 of which were polymorphic bands, the percentage of polymorphic band (PPB) was 84.54%, and the mean value of polymorphism information content (PIC) reached 0.417; the genetic similarity coefficient of the cultivars was 0.574-0.854. The two primers, UBC835 and ISSR2, had high PIC values, and could be used to distinguish all cultivars, presenting the most efficient single primers. Among the all of primer combinations from the seven core primers, the three combinations, UBC835/UBC811, UBC835/ISSR2, and UBC835/ISSR3 showed lower similar coefficients, and more efficient in identifying the 20 improved varieties than the other primer combinations. Then these three primer combinations were further scored in 15 traditional cultivars. The results showed that UBC835/ISSR2 was the optimal primer combination, which could be used to distinguish each material among the 20 clonal improved varieties and 15 traditional cultivals. Finally, the DNA fingerprints of the 20 clonal improved varieties were constructed based on country and region code, breeding institute, core primer name and ISSR marker data. The established fingerprints could provide reliable scientific base for the protection of intellectual property right for these clonal improved varieties, and the important molecular information contained in these fingerprints would be useful for the authenticity identification and genetic relationship analysis of tea varieties. (author)

Treatment of Unicameral Bone Cysts of the Calcaneus: A Systematic Review.

Science.gov (United States)

Levy, David M; Gross, Christopher E; Garras, David N

2015-01-01

The calcaneus is the most common tarsal affected by unicameral bone cysts (UBCs); however, the treatment of calcaneal UBCs remains controversial. The purpose of the present systematic review was to evaluate the treatment modalities for calcaneal UBCs. A systematic review was performed using clinical studies of calcaneal UBCs with a minimum of 1 year of follow-up and level I to IV evidence. Ten studies with 171 patients (181 cysts) were selected. Heel pain and radiographic cyst consolidation were the primary outcomes. A series of Z tests were used to compare the outcomes in the nonoperative and operative groups, cannulated screw and bone augmentation groups, and autografting and allografting groups. All patients treated with open curettage and bone augmentation had significant improvements in heel pain (p < .001). Only 1.1% ± 1.0% of the cysts treated conservatively had healed on radiographs compared with 93.0% ± 13.0% of the cysts after surgery (p < .001). A greater percentage of patients treated with bone augmentation had preoperative heel pain and resolution of that pain than did patients treated with cannulated screws (p < .001). Autografting had a significantly greater percentage of radiographic cyst consolidation than did allografting (97.4% ± 11.1% versus 85.1% ± 15.8%, p < .001, Z = 3.5). Objective outcomes data on calcaneal UBCs are relatively sparse. The results of the present review suggest that open curettage with autograft bone augmentation is the most effective procedure. We would encourage future comparative clinical studies to elucidate differences in UBC treatment modalities. Copyright © 2015 American College of Foot and Ankle Surgeons. Published by Elsevier Inc. All rights reserved.

Barriers and Pathways to Creating Sustainability Education Programs: Policy, Rhetoric and Reality

Science.gov (United States)

Moore, Janet

2005-01-01

This article outlines an action-oriented research project regarding the University of British Columbia's engagement with sustainability. In 1997, the University of British Columbia (UBC) created a sustainability policy that suggests all UBC students should be educated about sustainability. Using data from a series of in-depth interviews the author…

Computational modeling predicts the ionic mechanism of late-onset responses in Unipolar Brush Cells

Directory of Open Access Journals (Sweden)

Sathyaa eSubramaniyam

2014-08-01

Full Text Available Unipolar Brush Cells (UBCs have been suggested to have a strong impact on cerebellar granular layer functioning, yet the corresponding cellular mechanisms remain poorly understood. UBCs have recently been reported to generate, in addition to early-onset glutamatergic synaptic responses, a late-onset response (LOR composed of a slow depolarizing ramp followed by a spike burst (Locatelli et al., 2013. The LOR activates as a consequence of synaptic activity and involves an intracellular cascade modulating H- and TRP-current gating. In order to assess the LOR mechanisms, we have developed a UBC multi-compartmental model (including soma, dendrite, initial segment and axon incorporating biologically realistic representations of ionic currents and a generic coupling mechanism regulating TRP and H channel gating. The model finely reproduced UBC responses to current injection, including a low-threshold spike sustained by CaLVA currents, a persistent discharge sustained by CaHVA currents, and a rebound burst following hyperpolarization sustained by H- and CaLVA-currents. Moreover, the model predicted that H- and TRP-current regulation was necessary and sufficient to generate the LOR and its dependence on the intensity and duration of mossy fiber activity. Therefore, the model showed that, using a basic set of ionic channels, UBCs generate a rich repertoire of delayed bursts, which could take part to the formation of tunable delay-lines in the local microcircuit.

Computational modeling predicts the ionic mechanism of late-onset responses in unipolar brush cells.

Science.gov (United States)

Subramaniyam, Sathyaa; Solinas, Sergio; Perin, Paola; Locatelli, Francesca; Masetto, Sergio; D'Angelo, Egidio

2014-01-01

Unipolar Brush Cells (UBCs) have been suggested to play a critical role in cerebellar functioning, yet the corresponding cellular mechanisms remain poorly understood. UBCs have recently been reported to generate, in addition to early-onset glutamate receptor-dependent synaptic responses, a late-onset response (LOR) composed of a slow depolarizing ramp followed by a spike burst (Locatelli et al., 2013). The LOR activates as a consequence of synaptic activity and involves an intracellular cascade modulating H- and TRP-current gating. In order to assess the LOR mechanisms, we have developed a UBC multi-compartmental model (including soma, dendrite, initial segment, and axon) incorporating biologically realistic representations of ionic currents and a cytoplasmic coupling mechanism regulating TRP and H channel gating. The model finely reproduced UBC responses to current injection, including a burst triggered by a low-threshold spike (LTS) sustained by CaLVA currents, a persistent discharge sustained by CaHVA currents, and a rebound burst following hyperpolarization sustained by H- and CaLVA-currents. Moreover, the model predicted that H- and TRP-current regulation was necessary and sufficient to generate the LOR and its dependence on the intensity and duration of mossy fiber activity. Therefore, the model showed that, using a basic set of ionic channels, UBCs generate a rich repertoire of bursts, which could effectively implement tunable delay-lines in the local microcircuit.

Slagging behavior of upgraded brown coal and bituminous coal in 145 MW practical coal combustion boiler

Energy Technology Data Exchange (ETDEWEB)

Akiyama, Katsuya; Pak, Haeyang; Takubo, Yoji [Kobe Steel, Ltd, Kobe (Japan). Mechanical Engineering Research Lab.; Tada, Toshiya [Kobe Steel, Ltd, Takasago (Japan). Coal and Energy Technology Dept.; Ueki, Yasuaki [Nagoya Univ. (Japan). Energy Science Div.; Yoshiie, Ryo; Naruse, Ichiro [Nagoya Univ. (Japan). Dept. of Mechanical Science and Engineering

2013-07-01

The purpose of this study is to quantitatively evaluate behaviors of ash deposition during combustion of Upgraded Brown Coal (UBC) and bituminous coal in a 145 MW practical coal combustion boiler. A blended coal consisting 20 wt% of the UBC and 80 wt% of the bituminous coal was burned for the combustion tests. Before the actual ash deposition tests, the molten slag fractions of ash calculated by chemical equilibrium calculations under the combustion condition was adopted as one of the indices to estimate the tendency of ash deposition. The calculation results showed that the molten slag fraction for UBC ash reached approximately 90% at 1,523 K. However, that for the blended coal ash became about 50%. These calculation results mean that blending the UBC with a bituminous coal played a role in decreasing the molten slag fraction. Next, the ash deposition tests were conducted, using a practical pulverized coal combustion boiler. A water-cooled stainless-steel tube was inserted in locations at 1,523 K in the boiler to measure the amount of ash deposits. The results showed that the mass of deposited ash for the blended coal increased and shape of the deposited ash particles on the tube became large and spherical. This is because the molten slag fraction in ash for the blended coal at 1,523 K increased and the surface of deposited ash became sticky. However, the mass of the deposited ash for the blended coal did not greatly increase and no slagging problems occurred for 8 days of boiler operation under the present blending conditions. Therefore, appropriate blending of the UBC with a bituminous coal enables the UBC to be used with a low ash melting point without any ash deposition problems in a practical boiler.

From Exam to Education: The Math Exam/Education Resources

Science.gov (United States)

Bruni, Carmen; Koch, Christina; Konrad, Bernhard; Lindstrom, Michael; Moyles, Iain; Thompson, Will

2016-01-01

The Math Exam/Education Resources (MER) is an open online learning resource hosted at The University of British Columbia (UBC), aimed at providing mathematics education resources for students and instructors at UBC. In this paper, there will be a discussion of the motivation for creating this resource on the MediaWiki platform, key features of the…

76 FR 25711 - Proposed Exemptions from Certain Prohibited Transaction Restrictions

Science.gov (United States)

2011-05-05

... the supervision of various governmental and self-regulatory bodies. Northern has a network of 79... Council is aligned with the UBC, as mentioned above, it is a separate and autonomous entity from UBC. As a.... Situated on the 19.25 acre tract are a car rental facility, which has a passenger terminal, a car wash, a...

Low awareness of risk factors among bladder cancer survivors: New evidence and a literature overview.

Science.gov (United States)

Westhoff, Ellen; Maria de Oliveira-Neumayer, Julia; Aben, Katja K; Vrieling, Alina; Kiemeney, Lambertus A

2016-06-01

Data on urinary bladder cancer (UBC) patients' perceptions about causes of bladder cancer is limited, while this may be important knowledge for health prevention and education. We evaluated self-reported perceptions and beliefs about the causes of bladder cancer among UBC survivors in the Netherlands. UBC survivors identified through the Netherlands Cancer Registry from 2007 to 2012 were invited to participate. Patients who consented were asked to fill out a questionnaire, including questions on lifestyle characteristics, occupational and medical history, and family history of cancer. The final question was 'You have been diagnosed with bladder cancer. Do you have any idea what may have been the cause of your cancer?'. Of the 1793 UBC survivors included, 366 (20%) reported a possible cause for their bladder cancer. The most frequently reported suspected causes were smoking (10%), occupational exposure (5%), and heredity (2%). Smoking, occupational exposure and heredity were mentioned only slightly more frequently by participants with these risk factors (11%, 8%, and 5%, respectively) compared to the total population. Most UBC survivors did not suspect any cause that might have contributed to the development of their cancer. Even among participants with established risk factors for bladder cancer, these risk factors were not commonly perceived. This finding probably reflects the superficial knowledge of risk factors for bladder cancer in the population and highlights the importance of effective education on cancer prevention. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

Treated unicameral bone cysts

International Nuclear Information System (INIS)

Weinman, J.; Servaes, S.; Anupindi, S.A.

2013-01-01

Unicameral bone cysts (UBCs) are a common benign entity involving the metaphysis of growing bone, occurring within the first two decades of life. Assessment of these lesions, both before and after surgery, is performed routinely utilizing radiographs. We present a review of UBCs at various stages of treatment, including both successful and incomplete healing, and describe the imaging findings throughout their postoperative course

Biofluorescence as a survey tool for cryptic marine species.

Science.gov (United States)

De Brauwer, Maarten; Hobbs, Jean-Paul A; Ambo-Rappe, Rohani; Jompa, Jamaluddin; Harvey, Euan S; McIlwain, Jennifer L

2017-10-06

As ecosystems come under increasing anthropogenic pressure, rare species face the highest risk of extinction. Paradoxically, data necessary to evaluate the conservation status of rare species are often lacking because of the challenges of detecting species with low abundance. One group of fishes subject to this undersampling bias are those with cryptic body patterns. Twenty-one percent of cryptic fish species assessed for their extinction risk (International Union for Conservation of Nature [IUCN]) are data deficient. We developed a nondestructive method for surveying cryptically patterned marine fishes based on the presence of biofluorescence (underwater biofluorescence census, UBC). Blue LED torches were used to investigate how widespread biofluorescence was in cryptic reef fishes in the Coral Triangle region. The effectiveness of UBC to generate abundance data was tested on a data-deficient pygmy seahorse species (Hippocampus bargibanti) and compared with data obtained from standard underwater visual census (UVC) surveys. We recorded 95 reef fish species displaying biofluorescence, 73 of which had not been previously described as biofluorescent. Of those fish with cryptic patterns, 87% were biofluorescent compared with 9% for noncryptic fishes. The probability of species displaying biofluorescence was 70.9 times greater for cryptic species than for noncryptic species. Almost twice the number of H. bargibanti was counted using the UBC compared with UVC. For 2 triplefin species (Ucla xenogrammus, Enneapterygius tutuilae), the abundance detected with UBC was triple that detected with UVC. The UBC method was effective at finding cryptic species that would otherwise be difficult to detect and thus will reduce interobserver variability inherent to UVC surveys. Biofluorescence is ubiquitous in cryptic fishes, making this method applicable across a wide range of species. Data collected using UBC could be used with multiple IUCN criteria to assess the extinction risk of

Mid- and long-term clinical results of surgical therapy in unicameral bone cysts

Directory of Open Access Journals (Sweden)

Hagmann Sébastien

2011-12-01

Full Text Available Abstract Background Unicameral (or simple bone cysts (UBC are benign tumours most often located in long bones of children and adolescents. Pathological fractures are common, and due to high recurrence rates, these lesions remain a challenge to treat. Numerous surgical procedures have been proposed, but there is no general consensus of the ideal treatment. The aim of this investigation therefore was to study the long-term outcome after surgical treatment in UBC. Methods A retrospective analysis of 46 patients surgically treated for UBC was performed for short and mid-term outcome. Clinical and radiological outcome parameters were studied according to a modified Neer classification system. Long-term clinical information was retrieved via a questionnaire at a minimum follow-up of 10 years after surgery. Results Forty-six patients (17 female, 29 male with a mean age of 10.0 ± 4.8 years and with histopathologically confirmed diagnosis of UBC were included. Pathological fractures were observed in 21 cases (46%. All patients underwent surgery for UBC (35 patients underwent curettage and bone grafting as a primary therapy, 4 curettage alone, 3 received corticoid instillation and 4 decompression by cannulated screws. Overall recurrence rate after the first surgical treatment was 39% (18/46, second (17.4% of all patients and third recurrence (4.3% were frequently observed and were addressed by revision surgery. Recurrence was significantly higher in young and in male patients as well as in active cysts. After a mean of 52 months, 40 out of 46 cysts were considered healed. Prognosis was significantly better when recurrence was observed later than 30 months after therapy. After a mean follow-up of 15.5 ± 6.2 years, 40 patients acknowledged clinically excellent results, while five reported mild and casual pain. Only one patient reported a mild limitation of range of motion. Conclusions Our results suggest satisfactory overall long-term outcome for the

Mid- and long-term clinical results of surgical therapy in unicameral bone cysts.

Science.gov (United States)

Hagmann, Sébastien; Eichhorn, Florian; Moradi, Babak; Gotterbarm, Tobias; Dreher, Thomas; Lehner, Burkhard; Zeifang, Felix

2011-12-13

Unicameral (or simple) bone cysts (UBC) are benign tumours most often located in long bones of children and adolescents. Pathological fractures are common, and due to high recurrence rates, these lesions remain a challenge to treat. Numerous surgical procedures have been proposed, but there is no general consensus of the ideal treatment. The aim of this investigation therefore was to study the long-term outcome after surgical treatment in UBC. A retrospective analysis of 46 patients surgically treated for UBC was performed for short and mid-term outcome. Clinical and radiological outcome parameters were studied according to a modified Neer classification system. Long-term clinical information was retrieved via a questionnaire at a minimum follow-up of 10 years after surgery. Forty-six patients (17 female, 29 male) with a mean age of 10.0 ± 4.8 years and with histopathologically confirmed diagnosis of UBC were included. Pathological fractures were observed in 21 cases (46%). All patients underwent surgery for UBC (35 patients underwent curettage and bone grafting as a primary therapy, 4 curettage alone, 3 received corticoid instillation and 4 decompression by cannulated screws). Overall recurrence rate after the first surgical treatment was 39% (18/46), second (17.4% of all patients) and third recurrence (4.3%) were frequently observed and were addressed by revision surgery. Recurrence was significantly higher in young and in male patients as well as in active cysts. After a mean of 52 months, 40 out of 46 cysts were considered healed. Prognosis was significantly better when recurrence was observed later than 30 months after therapy. After a mean follow-up of 15.5 ± 6.2 years, 40 patients acknowledged clinically excellent results, while five reported mild and casual pain. Only one patient reported a mild limitation of range of motion. Our results suggest satisfactory overall long-term outcome for the surgical treatment of UBC, although short-and mid

SPIRE - combining SGI-110 with cisplatin and gemcitabine chemotherapy for solid malignancies including bladder cancer: study protocol for a phase Ib/randomised IIa open label clinical trial

OpenAIRE

Crabb, Simon; Caddy, Joshua; Dunkley, Denise; Rajaram, Jessica; Ellis, Deborah; Hill, Stephanie; Whitehead, Amy; Huddart, Robert; Griffiths, Gareth; Kalevras, Michail

2018-01-01

Background: urothelial bladder cancer (UBC) accounts for 10,000 new diagnoses and 5000 deaths annually in the UK (Cancer Research UK, http://www.cancerresearchuk.org/health-professional/cancer-statistics/statistics-by-cancer-type/bladder-cancer , Cancer Research UK, Accessed 26 Mar 2018). Cisplatin-based chemotherapy is standard of care therapy for UBC for both palliative first-line treatment of advanced/metastatic disease and radical neoadjuvant treatment of localised muscle invasive bladder...

Clinical Experiences of Korean Medicine Treatment against Urinary Bladder Cancer in General Practice

Directory of Open Access Journals (Sweden)

Taeyeol Park

2016-01-01

Full Text Available Urinary bladder cancer (UBC is one of the most common cancers, with 1 out of every 26 men and 1 out of every 80 women worldwide developing the disease during their lifetime. Moreover, it is a disease that predominantly affects the elderly and is becoming a major health problem as the elderly population continues to rapidly increase. In spite of the rapid development of medical science, the 5-year survival rate has remained around 75% since the 1990s, and the FDA has approved no new drugs for UBC over the last 10 years. In addition, most patients experience frequent recurrence and poor quality of life after diagnosis. Therefore, in order to solve unmet needs by alternative methods, we present our clinical cases of UBC where we observed outstanding results including regression and recurrence prevention exclusively through Traditional Korean Medicine such as (1 herbal therapy, (2 acupuncture, (3 pharmacopuncture and needle-embedding therapy, (4 moxibustion, and (5 cupping therapy. From our experience, it appears that multimodal strategies for synergistic efficiency are more effective than single Korean Medicine treatment. We hope this will encourage investigation of the efficacy of Korean Medicine treatment in clinical trials for UBC patients.

76 FR 16588 - Combined Mailings of Standard Mail and Periodicals Flats

Science.gov (United States)

2011-03-24

... Standard Mail. These mailings must also be identified as Standard Mail when scheduling dropship... pending permit number), issue date, and advertising percentage. b. A consolidated postage statement...

Evaluation of reference genes for real-time quantitative PCR studies in Candida glabrata following azole treatment

Directory of Open Access Journals (Sweden)

Li Qingdi

2012-06-01

Full Text Available Abstract Background The selection of stable and suitable reference genes for real-time quantitative PCR (RT-qPCR is a crucial prerequisite for reliable gene expression analysis under different experimental conditions. The present study aimed to identify reference genes as internal controls for gene expression studies by RT-qPCR in azole-stimulated Candida glabrata. Results The expression stability of 16 reference genes under fluconazole stress was evaluated using fold change and standard deviation computations with the hkgFinder tool. Our data revealed that the mRNA expression levels of three ribosomal RNAs (RDN5.8, RDN18, and RDN25 remained stable in response to fluconazole, while PGK1, UBC7, and UBC13 mRNAs showed only approximately 2.9-, 3.0-, and 2.5-fold induction by azole, respectively. By contrast, mRNA levels of the other 10 reference genes (ACT1, EF1α, GAPDH, PPIA, RPL2A, RPL10, RPL13A, SDHA, TUB1, and UBC4 were dramatically increased in C. glabrata following antifungal treatment, exhibiting changes ranging from 4.5- to 32.7-fold. We also assessed the expression stability of these reference genes using the 2-ΔΔCT method and three other software packages. The stability rankings of the reference genes by geNorm and the 2-ΔΔCT method were identical to those by hkgFinder, whereas the stability rankings by BestKeeper and NormFinder were notably different. We then validated the suitability of six candidate reference genes (ACT1, PGK1, RDN5.8, RDN18, UBC7, and UBC13 as internal controls for ten target genes in this system using the comparative CT method. Our validation experiments passed for all six reference genes analyzed except RDN18, where the amplification efficiency of RDN18 was different from that of the ten target genes. Finally, we demonstrated that the relative quantification of target gene expression varied according to the endogenous control used, highlighting the importance of the choice of internal controls in such

Chronic tinnitus and unipolar brush cell alterations in the cerebellum and dorsal cochlear nucleus.

Science.gov (United States)

Brozoski, Thomas; Brozoski, Daniel; Wisner, Kurt; Bauer, Carol

2017-07-01

Animal model research has shown that the central features of tinnitus, the perception of sound without an acoustic correlate, include elevated spontaneous and stimulus-driven activity, enhanced burst-mode firing, decreased variance of inter-spike intervals, and distortion of tonotopic frequency representation. Less well documented are cell-specific correlates of tinnitus. Unipolar brush cell (UBC) alterations in animals with psychophysical evidence of tinnitus has recently been reported. UBCs are glutamatergic interneurons that appear to function as local-circuit signal amplifiers. UBCs are abundant in the dorsal cochlear nucleus (DCN) and very abundant in the flocculus (FL) and paraflocculus (PFL) of the cerebellum. In the present research, two indicators of UBC structure and function were examined: Doublecortin (DCX) and epidermal growth factor receptor substrate 8 (Eps8). DCX is a protein that binds to microtubules where it can modify their assembly and growth. Eps8 is a cell-surface tyrosine kinase receptor mediating the response to epidermal growth factor; it appears to have a role in actin polymerization as well as cytoskeletal protein interactions. Both functions could contribute to synaptic remodeling. In the present research UBC Eps8 and DCX immunoreactivity (IR) were determined in 4 groups of rats distinguished by their exposure to high-level sound and psychophysical performance: Unexposed, exposed to high-level sound with behavioral evidence of tinnitus, and two exposed groups without behavioral evidence of tinnitus. Compared to unexposed controls, exposed animals with tinnitus had Eps8 IR elevated in their PFL; other structures were not affected, nor was DCX IR affected. This was interpreted as UBC upregulation in animals with tinnitus. Exposure that failed to produce tinnitus did not increase either Eps8 or DCX IR. Rather Eps8 IR was decreased in the FL and DCN of one subgroup (Least-Tinnitus), while DCX IR decreased in the FL of the other subgroup (No

Treated unicameral bone cysts.

Science.gov (United States)

Weinman, J; Servaes, S; Anupindi, S A

2013-06-01

Unicameral bone cysts (UBCs) are a common benign entity involving the metaphysis of growing bone, occurring within the first two decades of life. Assessment of these lesions, both before and after surgery, is performed routinely utilizing radiographs. We present a review of UBCs at various stages of treatment, including both successful and incomplete healing, and describe the imaging findings throughout their postoperative course. Copyright © 2012 The Royal College of Radiologists. Published by Elsevier Ltd. All rights reserved.

Influence of metformin intake on the risk of bladder cancer in type 2 diabetes patients

DEFF Research Database (Denmark)

Goossens, Maria E; Buntinx, Frank; Zeegers, Maurice P

2015-01-01

, SUs, insulin or more than one combination), all metformin users (1 + 2) was compared with SU only users using Cox proportional hazards models. The estimates were adjusted for age, gender, smoking status, BMI and diabetes duration. RESULTS: The inception cohort included 165,398 participants of whom 132...... users, even after adjustment for diabetes duration (HR = 1.13, 95% CI 0.90, 1.40). We found a pattern of decreasing risk of UBC with increasing duration of metformin intake, which was statistically not significant. CONCLUSION: Metformin has no influence on the risk of UBC compared with SU in type 2...... Practice Research Datalink (CPRD) including all patients with at least one prescription of oral anti-diabetic drugs (ADD) and/or insulin. The risk of UBC in different groups of ADD users (metformin alone (one), metformin in combination (two) with other ADD medication (glinides, glitazones, DPP-4-inhibitors...

Expression of the Long Non-Coding RNA HOTAIR Correlates with Disease Progression in Bladder Cancer and Is Contained in Bladder Cancer Patient Urinary Exosomes.

Directory of Open Access Journals (Sweden)

Claudia Berrondo

Full Text Available Exosomes are 30-150nM membrane-bound secreted vesicles that are readily isolated from biological fluids such as urine (UEs. Exosomes contain proteins, micro RNA (miRNA, messenger RNA (mRNA, and long non-coding RNA (lncRNA from their cells of origin. Although miRNA, protein and lncRNA have been isolated from serum as potential biomarkers for benign and malignant disease, it is unknown if lncRNAs in UEs from urothelial bladder cancer (UBC patients can serve as biomarkers. lncRNAs are > 200 nucleotide long transcripts that do not encode protein and play critical roles in tumor biology. As the number of recognized tumor-associated lncRNAs continues to increase, there is a parallel need to include lncRNAs into biomarker discovery and therapeutic target algorithms. The lncRNA HOX transcript antisense RNA (HOTAIR has been shown to facilitate tumor initiation and progression and is associated with poor prognosis in several cancers. The importance of HOTAIR in cancer biology has sparked interest in using HOTAIR as a biomarker and potential therapeutic target. Here we show HOTAIR and several tumor-associated lncRNAs are enriched in UEs from UBC patients with high-grade muscle-invasive disease (HGMI pT2-pT4. Knockdown of HOTAIR in UBC cell lines reduces in vitro migration and invasion. Importantly, loss of HOTAIR expression in UBC cell lines alters expression of epithelial-to-mesenchyme transition (EMT genes including SNAI1, TWIST1, ZEB1, ZO1, MMP1 LAMB3, and LAMC2. Finally, we used RNA-sequencing to identify four additional lncRNAs enriched in UBC patient UEs. These data, suggest that UE-derived lncRNA may potentially serve as biomarkers and therapeutic targets.

77 FR 72960 - International Mail: Product Rate and Fee Changes

Science.gov (United States)

2012-12-07

..., English, Arabic, Chinese, Spanish, and/ or Russian. 381.2 Previously Sold Coupons and Exchange Value The... postage validation imprinter (PVI) label, and dispatch it to the appropriate International Service Center...

76 FR 70971 - Proposed Information Collection; Comment Request; Societal Response to Tornado Warnings

Science.gov (United States)

2011-11-16

... to another to determine if differing verification statistics indicate any change in response and.... Method of Collection A questionnaire and a self-addressed postage-paid envelope will be mailed to...

32 CFR 806.4 - Definitions.

Science.gov (United States)

2010-07-01

..., supplies, stationery, postage, telephones, or official mail channels to make FOIA requests. (1) Simple..., Fiscal, Ethics, and Civilian Personnel (SAF/GCA) as the FOIA appellate authority. (h) Reading room. Any...

Battery-operated, argon-hydrogen microplasma on hybrid, postage stamp-sized plastic-quartz chips for elemental analysis of liquid microsamples using a portable optical emission spectrometer.

Science.gov (United States)

Weagant, Scott; Chen, Vivian; Karanassios, Vassili

2011-11-01

A battery-operated, atmospheric pressure, self-igniting, planar geometry Ar-H(2) microplasma for elemental analysis of liquid microsamples is described. The inexpensive microplasma device (MPD) fabricated for this work was a hybrid plastic-quartz structure that was formed on chips with an area (roughly) equal to that of a small-sized postage stamp (MPD footprint, 12.5-mm width by 38-mm length). Plastic substrates were chosen due to their low cost, for rapid prototyping purposes, and for a speedy microplasma device evaluation. To enhance portability, the microplasma was operated from an 18-V rechargeable battery. To facilitate portability even further, it was demonstrated that the battery can be recharged by a portable solar panel. The battery-supplied dc voltage was converted to a high-voltage ac. The ~750-μm (diameter) and 12-mm (long) Ar-H(2) (3% H(2)) microplasma was formed by applying the high-voltage ac between two needle electrodes. Spectral interference from the electrode materials or from the plastic substrate was not observed. Operating conditions were found to be key to igniting and sustaining a microplasma that was simply "warm" to the touch (thus alleviating the need for cooling or other thermal management) and that had a stable background emission. A small-sized (900 μL internal volume) electrothermal vaporization system (40-W max power) was used for microsample introduction. Microplasma background emission in the spectral region between 200 and 850 nm obtained using a portable fiber-optic spectrometer is reported and the effect of the operating conditions is described. Analyte emission from microliter volumes of dilute single-element standard solutions of Cd, Cu, K, Li, Mg, Mn, Na, Pb, and Zn is documented. The majority of spectral lines observed for the elements tested were from neutral atoms. The relative lack of emission from ion lines simplified the spectra, thus facilitating the use of a portable spectrometer. Despite the relative spectral

39 CFR 501.18 - Customer information and authorization.

Science.gov (United States)

2010-07-01

... for any illegal scheme or enterprise. (2) The customer's Postage Evidencing System is not used for... changes implemented or proposed for implementation by the Postal Service. (6) To advertise Postal Service...

Biochemical function of typical and variant Arabidopsis thaliana U-box E3 ubiquitin-protein ligases

DEFF Research Database (Denmark)

Wiborg, Jakob; O'Shea, Charlotte; Skriver, Karen

2008-01-01

of the distant U-box protein, AtPUB49, representing a large family of eukaryotic proteins containing a U-box linked to a cyclophilin-like peptidyl-prolyl cis-trans isomerase domain, was characterized biochemically. AtPUB49 functioned both as a prolyl isomerase and a chaperone by catalysing cis......The variance of the U-box domain in 64 Arabidopsis thaliana (thale cress) E3s (ubiquitin-protein ligases) was used to examine the interactions between E3s and E2s (ubiquitin-conjugating enzymes). E2s and E3s are components of the ubiquitin protein degradation pathway. Seven U-box proteins were...... analysed for their ability to ubiquitinate proteins in vitro in co-operation with different E2s. All U-box domains exhibited ubiquitination activity and interacted productively with UBC4/5-type E2s. Three and four of the U-box domains mediated ubiquitin addition in the presence of UBC13 and UBC7 E2s...

[Simultaneous existence of unicameral bone cysts involving the femur and ischium].

Science.gov (United States)

Makris, Vassilios; Papavasiliou, Kyriakos A; Bobos, Mattheos; Hytiroglou, Prodromos; Kirkos, John M; Kapetanos, George A

2009-01-01

We report a 30-year-old male patient with two unicameral bone cysts (UBC) simultaneously located in the proximal third of the right femur and ipsilateral ischium ramus, respectively. Fine needle biopsies were attempted for both lesions. Biopsy of the femoral lesion under local anesthesia was unsuccessful, so an open biopsy was performed which confirmed the diagnosis of UBC. Biopsy of the ischial lesion was not sufficient for diagnosis. Cytological examination of both specimens showed no other benign or malignant pathology. The femoral lesion was treated with intralesional (due to its large size) excision-curettage, bone grafting, and the introduction of a long gamma locking intramedullary nail to prevent the occurrence of a pathological fracture. The ischial lesion was left untreated and followed conservatively. The patient was free of any symptoms and complications three years postoperatively. This is the first report of an adult patient with UBCs simultaneously located both in a long tubular bone (femur) and a flat bone (ischium ramus).

Steroid injections in the treatment of humeral unicameral bone cysts: long-term follow-up and review of the literature.

Science.gov (United States)

Pavone, V; Caff, G; Di Silvestri, C; Avondo, S; Sessa, G

2014-05-01

Retrospective evaluation of long-term effectiveness of the steroid injections treatment in patients with unicameral bone cysts (UBC). From January 1993 to April 2005, 23 children affected by proximal humeral UBC were evaluated according to the Neer-Cole classification system and treated with serial methylprednisolone acetate's injections. The patients were followed up at 1, 3, 6 and 12 months and then every year until the adolescence. After treatment, in 15 out of 23 patients (65.2%), the humeral cysts were referred, respectively, as Grade 1 and in four as Grade 2. In 4 patients, a refracture occurred. Statistical analysis showed an overall good response in 82.6% of patients at the end of the follow-up. Minor complication including skin discoloration accounted for 13.04%. The steroid injections showed to be an alternative excellent treatment for UBC, with complete healing of the lesions in the majority of cases. This procedure is not expensive, mini-invasive, with low surgical risk and short hospitalization.

Atomic structure of the APC/C and its mechanism of protein ubiquitination

Science.gov (United States)

Yang, Jing; McLaughlin, Stephen H.; Barford, David

2015-01-01

The anaphase-promoting complex (APC/C) is a multimeric RING E3 ubiquitin ligase that controls chromosome segregation and mitotic exit. Its regulation by coactivator subunits, phosphorylation, the mitotic checkpoint complex, and interphase inhibitor Emi1 ensures the correct order and timing of distinct cell cycle transitions. Here, we used cryo-electron microscopy to determine atomic structures of APC/C-coactivator complexes with either Emi1 or a UbcH10-ubiquitin conjugate. These structures define the architecture of all APC/C subunits, the position of the catalytic module, and explain how Emi1 mediates inhibition of the two E2s UbcH10 and Ube2S. Definition of Cdh1 interactions with the APC/C indicates how they are antagonized by Cdh1 phosphorylation. The structure of the APC/C with UbcH10-ubiquitin reveals insights into the initiating ubiquitination reaction. Our results provide a quantitative framework for the design of experiments to further investigate APC/C functions in vivo. PMID:26083744

77 FR 64768 - International Mailing Services: Proposed Product and Price Changes

Science.gov (United States)

2012-10-23

... the text relating to its use in German, English, Arabic, Chinese, Spanish, and/ or Russian. [[Page... is paid with a permit imprint or USPS-produced postage validation imprinter (PVI) label, and dispatch...

The tomato Fni3 lysine-63-specific ubiquitin-conjugating enzyme and suv ubiquitin E2 variant positively regulate plant immunity.

Science.gov (United States)

Mural, Ravi V; Liu, Yao; Rosebrock, Tracy R; Brady, Jennifer J; Hamera, Sadia; Connor, Richard A; Martin, Gregory B; Zeng, Lirong

2013-09-01

The activation of an immune response in tomato (Solanum lycopersicum) against Pseudomonas syringae relies on the recognition of E3 ligase-deficient forms of AvrPtoB by the host protein kinase, Fen. To investigate the mechanisms by which Fen-mediated immunity is regulated, we characterize in this study a Fen-interacting protein, Fni3, and its cofactor, S. lycoperiscum Uev (Suv). Fni3 encodes a homolog of the Ubc13-type ubiquitin-conjugating enzyme that catalyzes exclusively Lys-63-linked ubiquitination, whereas Suv is a ubiquitin-conjugating enzyme variant. The C-terminal region of Fen was necessary for interaction with Fni3, and this interaction was required for cell death triggered by overexpression of Fen in Nicotiana benthamiana leaves. Fni3 was shown to be an active E2 enzyme, but Suv displayed no ubiquitin-conjugating activity; Fni3 and Suv together directed Lys-63-linked ubiquitination. Decreased expression of Fni3, another tomato Ubc13 homolog, Sl-Ubc13-2, or Suv in N. benthamiana leaves diminished cell death associated with Fen-mediated immunity and cell death elicited by several other resistance (R) proteins and their cognate effectors. We also discovered that coexpression of Fen and other R proteins/effectors with a Fni3 mutant that is compromised for ubiquitin-conjugating activity diminished the cell death. These results suggest that Fni3/Sl-Ubc13-2 and Suv regulate the immune response mediated by Fen and other R proteins through Lys-63-linked ubiquitination.

Locking plate and fibular strut-graft augmentation in the reconstruction of unicameral bone cyst of proximal femur in the paediatric population.

Science.gov (United States)

Jamshidi, Khodamorad; Mirkazemi, Masoud; Izanloo, Azra; Mirzaei, Alireza

2018-01-01

Several therapeutic strategies have been used for managing unicameral bone cyst (UBC) of the proximal femur. However, there is insufficient evidence to support one treatment over another, and the optimal treatment is controversial. This study aims at describing our experience with surgical reconstruction of paediatric UBCs of the proximal femur using a proximal locking plate and fibular strut allograft. In total, 14 consecutive paediatric patients with Dormans types IB (four cases) and IIB (10 cases) UBC were assessed. Mean patient age was 8.6 ± 2.3 years, and mean follow-up period was 41.7 ± 29.8 months. Six patients (42.8%) were referred with a pathologic fracture. Clinical/radiological outcome and complication rates were evaluated at the final follow-up session. No cysts were Capanna's class III (recurrence) or IV (no response). Complete healing (Capanna's class I) was seen in ten cysts, while four other cysts healed with residual radiolucent areas (Capanna's class II). Mean healing period was 14.1 ± 5.1 (9-24 months). One patient had superficial infection, one heterotopic ossification, and one mild coxa vara, and mean Musculoskeletal Tumor Society (MSTS) score was 99.5%. According to our results, locking plate and fibular strut graft in Dormans classification types IB and IIB results in a favorable outcome in managing UBC of the proximal femur in the paediatric population.

DEVELOPMENT OF A VALIDATED MODEL FOR USE IN MINIMIZING NOx EMISSIONS AND MAXIMIZING CARBON UTILIZATION WHEN CO-FIRING BIOMASS WITH COAL

Energy Technology Data Exchange (ETDEWEB)

Larry G. Felix; P. Vann Bush; Stephen Niksa

2003-04-30

In full-scale boilers, the effect of biomass cofiring on NO{sub x} and unburned carbon (UBC) emissions has been found to be site-specific. Few sets of field data are comparable and no consistent database of information exists upon which cofiring fuel choice or injection system design can be based to assure that NOX emissions will be minimized and UBC be reduced. This report presents the results of a comprehensive project that generated an extensive set of pilot-scale test data that were used to validate a new predictive model for the cofiring of biomass and coal. All testing was performed at the 3.6 MMBtu/hr (1.75 MW{sub t}) Southern Company Services/Southern Research Institute Combustion Research Facility where a variety of burner configurations, coals, biomasses, and biomass injection schemes were utilized to generate a database of consistent, scalable, experimental results (422 separate test conditions). This database was then used to validate a new model for predicting NO{sub x} and UBC emissions from the cofiring of biomass and coal. This model is based on an Advanced Post-Processing (APP) technique that generates an equivalent network of idealized reactor elements from a conventional CFD simulation. The APP reactor network is a computational environment that allows for the incorporation of all relevant chemical reaction mechanisms and provides a new tool to quantify NOx and UBC emissions for any cofired combination of coal and biomass.

Steroid receptor coactivator-3 regulates glucose metabolism in bladder cancer cells through coactivation of hypoxia inducible factor 1α.

Science.gov (United States)

Zhao, Wei; Chang, Cunjie; Cui, Yangyan; Zhao, Xiaozhi; Yang, Jun; Shen, Lan; Zhou, Ji; Hou, Zhibo; Zhang, Zhen; Ye, Changxiao; Hasenmayer, Donald; Perkins, Robert; Huang, Xiaojing; Yao, Xin; Yu, Like; Huang, Ruimin; Zhang, Dianzheng; Guo, Hongqian; Yan, Jun

2014-04-18

Cancer cell proliferation is a metabolically demanding process, requiring high glycolysis, which is known as "Warburg effect," to support anabolic growth. Steroid receptor coactivator-3 (SRC-3), a steroid receptor coactivator, is overexpressed and/or amplified in multiple cancer types, including non-steroid targeted cancers, such as urinary bladder cancer (UBC). However, whether SRC-3 regulates the metabolic reprogramming for cancer cell growth is unknown. Here, we reported that overexpression of SRC-3 accelerated UBC cell growth, accompanied by the increased expression of genes involved in glycolysis. Knockdown of SRC-3 reduced the UBC cell glycolytic rate under hypoxia, decreased tumor growth in nude mice, with reduction of proliferating cell nuclear antigen and lactate dehydrogenase expression levels. We further revealed that SRC-3 could interact with hypoxia inducible factor 1α (HIF1α), which is a key transcription factor required for glycolysis, and coactivate its transcriptional activity. SRC-3 was recruited to the promoters of HIF1α-target genes, such as glut1 and pgk1. The positive correlation of expression levels between SRC-3 and Glut1 proteins was demonstrated in human UBC patient samples. Inhibition of glycolysis through targeting HK2 or LDHA decelerated SRC-3 overexpression-induced cell growth. In summary, overexpression of SRC-3 promoted glycolysis in bladder cancer cells through HIF1α to facilitate tumorigenesis, which may be an intriguing drug target for bladder cancer therapy.

Special Edition: Fighting Feminism – Organised Opposition to Women’s Rights; Guest Editors’ Introduction

Directory of Open Access Journals (Sweden)

Molly Dragiewicz

2016-06-01

Full Text Available This special issue presents a series of papers by scholars who participated in a workshop entitled ‘Men's Groups: Challenging Feminism’, which was held at the University of British Columbia (UBC, Canada, 26-27 May 2014. The workshop was organised by Susan B Boyd, Professor of Law and Chair in Feminist Legal Studies at the UBC Faculty of Law, and was sponsored by the Peter Wall Institute for Advanced Studies at UBC, the Peter A Allard School of Law, the Centre for Feminist Legal Studies at UBC, and the Canadian Journal of Women and the Law. The aim of the workshop was to bring together feminist scholars from multiple disciplines and multiple national contexts to explore a source of resistance to feminism that has been largely overlooked in scholarly research: the growing number of nationally situated and globally linked organisations acting in the name of men's rights and interests which contend that men are discriminated against in law, education and government funding, and that feminism is to blame for this. This special edition presents eight papers inspired by the workshop, authored by scholars from Canada, New Zealand, Poland, Sweden and the United States. A second special issue comprised of eight other papers inspired by the workshop was published in the Canadian Journal of Women and the Law as volume 28(1 in 2016.To find out more about this special edition, download the PDF file from this page.

19 CFR 145.3 - Opening of letter class mail; reading of correspondence prohibited.

Science.gov (United States)

2010-04-01

... correspondence. The provisions of paragraph (c) shall also apply to correspondence between school children and correspondence of the blind which are authorized to be mailed at other than the letter rate of postage in...

Successful treatment of unicameral bone cyst by single percutaneous injection of alpha-BSM.

Science.gov (United States)

Thawrani, Dinesh; Thai, Chia Che; Welch, Robert D; Copley, Lawson; Johnston, Charles E

2009-01-01

Unicameral bone cyst (UBC) is a benign bone lesion, recognized for its high rate of recurrence and need for repeat procedures to achieve healing. We hypothesized that the osteoconductive material apatitic calcium phosphate (alpha-BSM) could be effective in filling and stimulating resolution of UBC. The purpose of this study was to evaluate clinical and radiographic outcomes of UBC treated by a single injection of alpha-BSM. Thirteen patients (6 male, 7 female) with a mean age of 10.5 years, underwent single percutaneous injection of alpha-BSM for presumed UBC. The aspiration of the cysts was followed by vigorous saline lavage using 2 wide bore needles to disrupt the cyst walls. alpha-BSM "paste" was then injected under fluoroscopic guidance. Radiographs were digitized to measure cystic area (millimeter squares) on 2 orthogonal views. Healing was rated according to a modified Neer outcome grading system. Nine of the 13 patients had had pathologic fractures in the past. Eleven of the 13 patients had had past unsuccessful treatment: multiple steroid injections in 6, curettage and bone grafting in 3, and bone marrow and demineralized bone matrix (Grafton) injection in 2. Five cysts were grade 1 (healed 100%), 6 grade 2 (healed >50%), 2 grade 3 (healed <50% with increased cortical thickness), and none grade 4 (recurrence/enlargement). The average resolution of cystic area in 11/13 cysts was 85.7% at final follow-up of 35.8 months (P=0.0001) with 2.8 mm of average gain in cortical thickness (P=0.0018). None of the 13 lesions required an additional procedure or repeat injection. All patients were clinically asymptomatic at latest follow-up. This is the first study quantifying cyst resolution objectively according to actual decrease in area (millimeter squares). A single injection of alpha-BSM is a safe, minimally invasive and efficacious method to treat UBC in the pediatric population.

Role for sumoylation in systemic inflammation and immune homeostasis in Drosophila larvae.

Directory of Open Access Journals (Sweden)

Indira Paddibhatla

2010-12-01

Full Text Available To counter systemic risk of infection by parasitic wasps, Drosophila larvae activate humoral immunity in the fat body and mount a robust cellular response resulting in encapsulation of the wasp egg. Innate immune reactions are tightly regulated and are resolved within hours. To understand the mechanisms underlying activation and resolution of the egg encapsulation response and examine if failure of the latter develops into systemic inflammatory disease, we correlated parasitic wasp-induced changes in the Drosophila larva with systemic chronic conditions in sumoylation-deficient mutants. We have previously reported that loss of either Cactus, the Drosophila (IκB protein or Ubc9, the SUMO-conjugating enzyme, leads to constitutive activation of the humoral and cellular pathways, hematopoietic overproliferation and tumorogenesis. Here we report that parasite infection simultaneously activates NF-κB-dependent transcription of Spätzle processing enzyme (SPE and cactus. Endogenous Spätzle protein (the Toll ligand is expressed in immune cells and excessive SPE or Spätzle is pro-inflammatory. Consistent with this function, loss of Spz suppresses Ubc9⁻ defects. In contrast to the pro-inflammatory roles of SPE and Spätzle, Cactus and Ubc9 exert an anti-inflammatory effect. We show that Ubc9 maintains steady state levels of Cactus protein. In a series of immuno-genetic experiments, we demonstrate the existence of a robust bidirectional interaction between blood cells and the fat body and propose that wasp infection activates Toll signaling in both compartments via extracellular activation of Spätzle. Within each organ, the IκB/Ubc9-dependent inhibitory feedback resolves immune signaling and restores homeostasis. The loss of this feedback leads to chronic inflammation. Our studies not only provide an integrated framework for understanding the molecular basis of the evolutionary arms race between insect hosts and their parasites, but also offer

76 FR 11485 - Agency Information Collection Activities; Submission for Office of Management and Budget Review...

Science.gov (United States)

2011-03-02

.... While FDA understands that there appears to be a large discrepancy in burden between this commenter's... manufacturer will use $1 of paper products and pay postage approximating a rounded figure of $0.50 for a total...

Fingerprinting for discriminating tea germplasm using inter-simple sequence repeat (ISSR) markers

International Nuclear Information System (INIS)

Liu, B.Y.; Li, Y.Y.; Wang, P.S.; Wang, L.Y.; Wang, P.S.

2012-01-01

For the discrimination of tea germplasm at the inter-specific level, 134 tea varieties preserved in the China National Germplasm Tea Repositories (CNGTR) were analyzed using inter simple sequence repeat (ISSR) markers. Eighteen primers were chosen from 60 screened for ISSR amplification, generating 99.4% polymorphic bands. The mean Nei's gene diversity (H) and the overall mean Shannon's Information index (I) were 0.396 and 0.578, respectively, indicating a wide gene pool. Using the presence, sometimes absence of unique ISSR markers, it was possible to discriminate 32 of the genotypes tested. No single primer could discriminate all the 134 genotypes. However, UBC811 provided rich band patterns and it can discriminate 35 genotypes. The combination of two and three primers could discriminate 99 and 121 genotypes, respectively. Furthermore, the combination of band patterns or the DNA fingerprinting based on specific ISSR markers generated by UBC811, UBC835, ISSR2 and ISSR3 could discriminate all 134 genotypes tested. ISSR markers also provide a powerful tool to discriminate tea germplasm at the inter-specific level. (author)

78 FR 53027 - Balloting Materials Postage

Science.gov (United States)

2013-08-28

... Postal Service recognizes the potential for inconsistency when voters self-print ballots and use... supplementary notification specifically directed to voters who self-print and return ballots, such as: ``Please... verification to ensure compliance with the marking requirements. As part of the verification procedure, mailers...

78 FR 25677 - Balloting Materials Postage

Science.gov (United States)

2013-05-02

... for the return of ballots, unless mailed under the special exemption for military or overseas voting... ballot by mail. To rectify this problem, the Postal Service is proposing that the balloting materials for... exemption for military and overseas voting or returned under Business Reply Mail service must indicate in a...

The Tomato Fni3 Lysine-63–Specific Ubiquitin-Conjugating Enzyme and Suv Ubiquitin E2 Variant Positively Regulate Plant Immunity[C][W

Science.gov (United States)

Mural, Ravi V.; Liu, Yao; Rosebrock, Tracy R.; Brady, Jennifer J.; Hamera, Sadia; Connor, Richard A.; Martin, Gregory B.; Zeng, Lirong

2013-01-01

The activation of an immune response in tomato (Solanum lycopersicum) against Pseudomonas syringae relies on the recognition of E3 ligase–deficient forms of AvrPtoB by the host protein kinase, Fen. To investigate the mechanisms by which Fen-mediated immunity is regulated, we characterize in this study a Fen-interacting protein, Fni3, and its cofactor, S. lycoperiscum Uev (Suv). Fni3 encodes a homolog of the Ubc13-type ubiquitin-conjugating enzyme that catalyzes exclusively Lys-63–linked ubiquitination, whereas Suv is a ubiquitin-conjugating enzyme variant. The C-terminal region of Fen was necessary for interaction with Fni3, and this interaction was required for cell death triggered by overexpression of Fen in Nicotiana benthamiana leaves. Fni3 was shown to be an active E2 enzyme, but Suv displayed no ubiquitin-conjugating activity; Fni3 and Suv together directed Lys-63–linked ubiquitination. Decreased expression of Fni3, another tomato Ubc13 homolog, Sl-Ubc13-2, or Suv in N. benthamiana leaves diminished cell death associated with Fen-mediated immunity and cell death elicited by several other resistance (R) proteins and their cognate effectors. We also discovered that coexpression of Fen and other R proteins/effectors with a Fni3 mutant that is compromised for ubiquitin-conjugating activity diminished the cell death. These results suggest that Fni3/Sl-Ubc13-2 and Suv regulate the immune response mediated by Fen and other R proteins through Lys-63–linked ubiquitination. PMID:24076975

Comprehensive gene expression profiling reveals synergistic functional networks in cerebral vessels after hypertension or hypercholesterolemia.

Directory of Open Access Journals (Sweden)

Wei-Yi Ong

Full Text Available Atherosclerotic stenosis of cerebral arteries or intracranial large artery disease (ICLAD is a major cause of stroke especially in Asians, Hispanics and Africans, but relatively little is known about gene expression changes in vessels at risk. This study compares comprehensive gene expression profiles in the middle cerebral artery (MCA of New Zealand White rabbits exposed to two stroke risk factors i.e. hypertension and/or hypercholesterolemia, by the 2-Kidney-1-Clip method, or dietary supplementation with cholesterol. Microarray and Ingenuity Pathway Analyses of the MCA of the hypertensive rabbits showed up-regulated genes in networks containing the node molecules: UBC (ubiquitin, P38 MAPK, ERK, NFkB, SERPINB2, MMP1 and APP (amyloid precursor protein; and down-regulated genes related to MAPK, ERK 1/2, Akt, 26 s proteasome, histone H3 and UBC. The MCA of hypercholesterolemic rabbits showed differentially expressed genes that are surprisingly, linked to almost the same node molecules as the hypertensive rabbits, despite a relatively low percentage of 'common genes' (21 and 7% between the two conditions. Up-regulated common genes were related to: UBC, SERPINB2, TNF, HNF4A (hepatocyte nuclear factor 4A and APP, and down-regulated genes, related to UBC. Increased HNF4A message and protein were verified in the aorta. Together, these findings reveal similar nodal molecules and gene pathways in cerebral vessels affected by hypertension or hypercholesterolemia, which could be a basis for synergistic action of risk factors in the pathogenesis of ICLAD.

Bone cysts: unicameral and aneurysmal bone cyst.

Science.gov (United States)

Mascard, E; Gomez-Brouchet, A; Lambot, K

2015-02-01

Simple and aneurysmal bone cysts are benign lytic bone lesions, usually encountered in children and adolescents. Simple bone cyst is a cystic, fluid-filled lesion, which may be unicameral (UBC) or partially separated. UBC can involve all bones, but usually the long bone metaphysis and otherwise primarily the proximal humerus and proximal femur. The classic aneurysmal bone cyst (ABC) is an expansive and hemorrhagic tumor, usually showing characteristic translocation. About 30% of ABCs are secondary, without translocation; they occur in reaction to another, usually benign, bone lesion. ABCs are metaphyseal, excentric, bulging, fluid-filled and multicameral, and may develop in all bones of the skeleton. On MRI, the fluid level is evocative. It is mandatory to distinguish ABC from UBC, as prognosis and treatment are different. UBCs resolve spontaneously between adolescence and adulthood; the main concern is the risk of pathologic fracture. Treatment in non-threatening forms consists in intracystic injection of methylprednisolone. When there is a risk of fracture, especially of the femoral neck, surgery with curettage, filling with bone substitute or graft and osteosynthesis may be required. ABCs are potentially more aggressive, with a risk of bone destruction. Diagnosis must systematically be confirmed by biopsy, identifying soft-tissue parts, as telangiectatic sarcoma can mimic ABC. Intra-lesional sclerotherapy with alcohol is an effective treatment. In spinal ABC and in aggressive lesions with a risk of fracture, surgical treatment should be preferred, possibly after preoperative embolization. The risk of malignant transformation is very low, except in case of radiation therapy. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

Comprehensive Gene Expression Profiling Reveals Synergistic Functional Networks in Cerebral Vessels after Hypertension or Hypercholesterolemia

Science.gov (United States)

Ong, Wei-Yi; Ng, Mary Pei-Ern; Loke, Sau-Yeen; Jin, Shalai; Wu, Ya-Jun; Tanaka, Kazuhiro; Wong, Peter Tsun-Hon

2013-01-01

Atherosclerotic stenosis of cerebral arteries or intracranial large artery disease (ICLAD) is a major cause of stroke especially in Asians, Hispanics and Africans, but relatively little is known about gene expression changes in vessels at risk. This study compares comprehensive gene expression profiles in the middle cerebral artery (MCA) of New Zealand White rabbits exposed to two stroke risk factors i.e. hypertension and/or hypercholesterolemia, by the 2-Kidney-1-Clip method, or dietary supplementation with cholesterol. Microarray and Ingenuity Pathway Analyses of the MCA of the hypertensive rabbits showed up-regulated genes in networks containing the node molecules: UBC (ubiquitin), P38 MAPK, ERK, NFkB, SERPINB2, MMP1 and APP (amyloid precursor protein); and down-regulated genes related to MAPK, ERK 1/2, Akt, 26 s proteasome, histone H3 and UBC. The MCA of hypercholesterolemic rabbits showed differentially expressed genes that are surprisingly, linked to almost the same node molecules as the hypertensive rabbits, despite a relatively low percentage of ‘common genes’ (21 and 7%) between the two conditions. Up-regulated common genes were related to: UBC, SERPINB2, TNF, HNF4A (hepatocyte nuclear factor 4A) and APP, and down-regulated genes, related to UBC. Increased HNF4A message and protein were verified in the aorta. Together, these findings reveal similar nodal molecules and gene pathways in cerebral vessels affected by hypertension or hypercholesterolemia, which could be a basis for synergistic action of risk factors in the pathogenesis of ICLAD. PMID:23874591

Assessment of range of uric and serum biomarkers in determination of bladder cancer severity

Directory of Open Access Journals (Sweden)

Popkov V.M.

2013-12-01

Full Text Available Purpose: to establish efficiency of a range of uric and serum biomarkers of bladder cancer for diagnostics and the prognosis of risk of development of disease recurrence. Material and methods: TPA and TPS, VEGF level research in blood serum, UBC in urine in 176 people, among which 135 patients with bladder cancer (RMP have been conducted. Group of comparison has included16 patients (patients with cystitis. The control group has been made of 25 almost healthy men. 75 patients had non-muscle invasive RMP (Ta-1N0M0. Results. It has been statistically determined that reliable growth of of TPA, TPS in blood serum and UBC in urine in patients with non-muscle invasive RMP in comparison with patients in groups of control and comparison has been established. The increase of UBC in urine of patients of this group with recurrence of tumoral growth within a year has been noted. In comparison with cytological research of urine sedimentation, molecular markers of RMP (the uric UBC and serum TPA, TPS possess diagnostic sensitivity, allow to confirm the presence of disease, to carry out diagnostics of stages of organ and extra invasion. RMP is possible to consider as an additional prognostic serum marker increase in the VEGF level in blood serum. Conclusion. Inclusion in diagnostic process in the clinical research of biomarkers showed that identification of NMIRMP increased from 18,1% in 2006 to 55,6% in 2011. The chosen volume of complex treatment allowed to reduce recurrence and lethality in the first two years from 32 to 15,5%.

CD147 and MCT1-potential partners in bladder cancer aggressiveness and cisplatin resistance.

Science.gov (United States)

Afonso, Julieta; Santos, Lúcio L; Miranda-Gonçalves, Vera; Morais, António; Amaro, Teresina; Longatto-Filho, Adhemar; Baltazar, Fátima

2015-11-01

The relapsing and progressive nature of bladder tumors, and the heterogeneity in the response to cisplatin-containing regimens, are the major concerns in the care of urothelial bladder carcinoma (UBC) patients. The metabolic adaptations that alter the tumor microenvironment and thus contribute to chemoresistance have been poorly explored in UBC setting. We found significant associations between the immunoexpressions of the microenvironment-related molecules CD147, monocarboxylate transporters (MCTs) 1 and 4, CD44 and CAIX in tumor tissue sections from 114 UBC patients. The presence of MCT1 and/or MCT4 expressions was significantly associated with unfavorable clinicopathological parameters. The incidence of CD147 positive staining significantly increased with advancing stage, grade and type of lesion, and occurrence of lymphovascular invasion. Similar associations were observed when considering the concurrent expression of CD147 and MCT1. This expression profile lowered significantly the 5-year disease-free and overall survival rates. Moreover, when selecting patients who received platinum-based chemotherapy, the prognosis was significantly worse for those with MCT1 and CD147 positive tumors. CD147 specific silencing by small interfering RNAs (siRNAs) in UBC cells was accompanied by a decrease in MCT1 and MCT4 expressions and, importantly, an increase in chemosensitivity to cisplatin. Our results provide novel insights for the involvement of CD147 and MCTs in bladder cancer progression and resistance to cisplatin-based chemotherapy. We consider that the possible cooperative role of CD147 and MCT1 in determining cisplatin resistance should be further explored as a potential theranostics biomarker. © 2014 Wiley Periodicals, Inc.

A complex regulatory network coordinating cell cycles during C. elegans development is revealed by a genome-wide RNAi screen.

Science.gov (United States)

Roy, Sarah H; Tobin, David V; Memar, Nadin; Beltz, Eleanor; Holmen, Jenna; Clayton, Joseph E; Chiu, Daniel J; Young, Laura D; Green, Travis H; Lubin, Isabella; Liu, Yuying; Conradt, Barbara; Saito, R Mako

2014-02-28

The development and homeostasis of multicellular animals requires precise coordination of cell division and differentiation. We performed a genome-wide RNA interference screen in Caenorhabditis elegans to reveal the components of a regulatory network that promotes developmentally programmed cell-cycle quiescence. The 107 identified genes are predicted to constitute regulatory networks that are conserved among higher animals because almost half of the genes are represented by clear human orthologs. Using a series of mutant backgrounds to assess their genetic activities, the RNA interference clones displaying similar properties were clustered to establish potential regulatory relationships within the network. This approach uncovered four distinct genetic pathways controlling cell-cycle entry during intestinal organogenesis. The enhanced phenotypes observed for animals carrying compound mutations attest to the collaboration between distinct mechanisms to ensure strict developmental regulation of cell cycles. Moreover, we characterized ubc-25, a gene encoding an E2 ubiquitin-conjugating enzyme whose human ortholog, UBE2Q2, is deregulated in several cancers. Our genetic analyses suggested that ubc-25 acts in a linear pathway with cul-1/Cul1, in parallel to pathways employing cki-1/p27 and lin-35/pRb to promote cell-cycle quiescence. Further investigation of the potential regulatory mechanism demonstrated that ubc-25 activity negatively regulates CYE-1/cyclin E protein abundance in vivo. Together, our results show that the ubc-25-mediated pathway acts within a complex network that integrates the actions of multiple molecular mechanisms to control cell cycles during development. Copyright © 2014 Roy et al.

78 FR 7820 - Notice of Intelligent Mail Indicia Performance Criteria

Science.gov (United States)

2013-02-04

... FURTHER INFORMATION CONTACT: Marlo Kay Ivey, Business Programs Specialist, Payment Technology, U.S. Postal... Performance Criteria and Security Architecture for Open Information Based Indicia (IBI) Postage Evidencing Systems and the Performance Criteria and Security Architecture for Closed Information Based Indicia (IBI...

Book Review: The Drug Effect | Kriegler | South African Crime ...

African Journals Online (AJOL)

Title: The Drug Effect: Health, Crime and Society Editors: Suzanne Fraser and David Moore Publisher: Cambridge University Press Price: R500.00 (incl. VAT and postage) Pages: 260. Availability: Published. Available through all academic bookstores. ISBN: 978-0-521-15605-9 ...

75 FR 66677 - New Postal Products

Science.gov (United States)

2010-10-29

... Authentication Confirm Customized Postage International Reply Coupon Service International Business Reply Mail... International Reply Coupon Service International Business Reply Mail Service Money Orders Post Office Box...) International Business Reply Service Competitive Contract 1 (MC2009-14 and CP2009-20) International Business...

75 FR 53216 - New Postal Products

Science.gov (United States)

2010-08-31

... Authentication Confirm Customized Postage International Reply Coupon Service International Business Reply Mail... International Reply Coupon Service International Business Reply Mail Service Money Orders Post Office Box...) International Business Reply Service Competitive Contract 1 (MC2009-14 and CP2009-20) International Business...

77 FR 51751 - Assessment of Fees for Dairy Import Licenses for the 2013 Tariff-Rate Import Quota Year

Science.gov (United States)

2012-08-27

... Agriculture's costs of administering the licensing system under this regulation. The regulation at 7 CFR 6.33... system, and $125,280.00 represents other miscellaneous costs, including travel, postage, publications... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Assessment of Fees for Dairy Import...

76 FR 60801 - Assessment of Fees for Dairy Import Licenses for the 2012 Tariff-Rate Import Quota Year

Science.gov (United States)

2011-09-30

... for the 2012 calendar year. Notice: The total cost to USDA of administering the licensing system for... administering the licensing system, and $125,280 represents other miscellaneous costs, including travel, postage... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Assessment of Fees for Dairy Import...

The role of osteoblast cells in the pathogenesis of unicameral bone cysts.

Science.gov (United States)

Aarvold, Alexander; Smith, James O; Tayton, Edward R; Edwards, Caroline J; Fowler, Darren J; Gent, Edward D; Oreffo, Richard O C

2012-08-01

The pathogenesis of unicameral bone cysts (UBCs) remains largely unknown. Osteoclasts have been implicated, but the role of osteoblastic cells has, to date, not been explored. This study investigated the pathophysiology of UBCs by examining the interactions between the cyst fluid and human bone marrow stromal cells (hBMSCs) and the effect of the fluid on osteogenesis. Fluid was aspirated from two UBCs and analysed for protein, electrolyte and cytokine levels. Graded concentrations of the fluid were used as culture media for hBMSCs to determine the effects of the fluid on hBMSC proliferation and osteogenic differentiation. The fibrocellular lining was analysed histologically and by electron microscopy. Alkaline phosphatase (ALP) staining of hBMSCs that were cultured in cyst fluid demonstrated increased cell proliferation and osteogenic differentiation compared to basal media controls. Biochemical analysis of these hBMSCs compared to basal controls confirmed a marked increase in DNA content (as a marker of proliferation) and ALP activity (as a marker of osteogenic differentiation) which was highly significant (p < 0.001). Osteoclasts were demonstrated in abundance in the cyst lining. The cyst fluid cytokine profile revealed levels of the pro-osteoclast cytokines IL-6, MIP-1α and MCP-1 that were 19×, 31× and 35× greater than those in reference serum. Cyst fluid promoted osteoblastic growth and differentiation. Despite appearing paradoxical that the cyst fluid promoted osteogenesis, osteoblastic cells are required for osteoclastogenesis through RANKL signalling. Three key cytokines in this pathway (IL-6, MIP-1α, MCP-1) were highly elevated in cyst fluid. These findings may hold the key to the pathogenesis of UBCs, with implications for treatment methods.

Immobilization of Cu2 + and Cd2 + by earthworm manure derived biochar in acidic circumstance

Institute of Scientific and Technical Information of China (English)

Zhanghong Wang; Fei Shen; Dekui Shen; Yahui Jiang; Rui Xiao

2017-01-01

Earthworm manure,the by-product obtained from the disposing of biowastes by earthworm breeding,is largely produced and employed as a feedstock for biochar preparation through pyrolysis.For repairing acidic soil or acidic electroplating effluent,biochar physicochemical properties would suffer from some changes like an acidic washing process,which hence affected its application functions.Pristine biochar (UBC)from pyrolysis of earthworm manure at 700℃ and biochar treated by HCl (WBC) were comparatively investigated regarding their physicochemical properties,adsorption capability and adsorption mechanism of Cu2+ and Cd2+ from aqueous solution to explore the immobilization characteristics ofbiochar in acidic environment.After HCl treatment,the soluble ash content and phenolic-OH in the WBC sample was notably decreased against the increase of the carboxyl C==O,aromatic C=C and Si-O-Si,compared to that of UBC.All adsorption processes can be well described by Langmuir isotherm model.The calculated maximum adsorption capacity of Cu2+ and Cd2+ adsorption on UBC were 36.56and 29.31 mg/g,respectively,which were higher than that of WBC (8.64 and 12.81 mg/g,respectively),indicating that HCl treatment significantly decreased biochar adsorption ability.Mechanism analysis revealed that alkali and alkaline earth metallic,salts (carbonates,phosphates and silicates),and surface functional groups were responsible for UBC adsorption,corresponding to ion exchange,precipitation and complexation,respectively.However,ion exchange made little contributions to WBC adsorption due to the great loss of soluble ash content.WBC adsorption was mainly attributed to the abundant exposure of silicates and surface functional groups (carboxyl C==O and aromatic C=C).

Reference gene selection for molecular studies of dormancy in wild oat (Avena fatua L. caryopses by RT-qPCR method.

Directory of Open Access Journals (Sweden)

Izabela Ruduś

Full Text Available Molecular studies of primary and secondary dormancy in Avena fatua L., a serious weed of cereal and other crops, are intended to reveal the species-specific details of underlying molecular mechanisms which in turn may be useable in weed management. Among others, quantitative real-time PCR (RT-qPCR data of comparative gene expression analysis may give some insight into the involvement of particular wild oat genes in dormancy release, maintenance or induction by unfavorable conditions. To assure obtaining biologically significant results using this method, the expression stability of selected candidate reference genes in different data subsets was evaluated using four statistical algorithms i.e. geNorm, NormFinder, Best Keeper and ΔCt method. Although some discrepancies in their ranking outputs were noticed, evidently two ubiquitin-conjugating enzyme homologs, AfUBC1 and AfUBC2, as well as one homolog of glyceraldehyde 3-phosphate dehydrogenase AfGAPDH1 and TATA-binding protein AfTBP2 appeared as more stably expressed than AfEF1a (translation elongation factor 1α, AfGAPDH2 or the least stable α-tubulin homolog AfTUA1 in caryopses and seedlings of A. fatua. Gene expression analysis of a dormancy-related wild oat transcription factor VIVIPAROUS1 (AfVP1 allowed for a validation of candidate reference genes performance. Based on the obtained results it can be recommended that the normalization factor calculated as a geometric mean of Cq values of AfUBC1, AfUBC2 and AfGAPDH1 would be optimal for RT-qPCR results normalization in the experiments comprising A. fatua caryopses of different dormancy status.

Reference gene selection for molecular studies of dormancy in wild oat (Avena fatua L.) caryopses by RT-qPCR method.

Science.gov (United States)

Ruduś, Izabela; Kępczyński, Jan

2018-01-01

Molecular studies of primary and secondary dormancy in Avena fatua L., a serious weed of cereal and other crops, are intended to reveal the species-specific details of underlying molecular mechanisms which in turn may be useable in weed management. Among others, quantitative real-time PCR (RT-qPCR) data of comparative gene expression analysis may give some insight into the involvement of particular wild oat genes in dormancy release, maintenance or induction by unfavorable conditions. To assure obtaining biologically significant results using this method, the expression stability of selected candidate reference genes in different data subsets was evaluated using four statistical algorithms i.e. geNorm, NormFinder, Best Keeper and ΔCt method. Although some discrepancies in their ranking outputs were noticed, evidently two ubiquitin-conjugating enzyme homologs, AfUBC1 and AfUBC2, as well as one homolog of glyceraldehyde 3-phosphate dehydrogenase AfGAPDH1 and TATA-binding protein AfTBP2 appeared as more stably expressed than AfEF1a (translation elongation factor 1α), AfGAPDH2 or the least stable α-tubulin homolog AfTUA1 in caryopses and seedlings of A. fatua. Gene expression analysis of a dormancy-related wild oat transcription factor VIVIPAROUS1 (AfVP1) allowed for a validation of candidate reference genes performance. Based on the obtained results it can be recommended that the normalization factor calculated as a geometric mean of Cq values of AfUBC1, AfUBC2 and AfGAPDH1 would be optimal for RT-qPCR results normalization in the experiments comprising A. fatua caryopses of different dormancy status.

The effect of Ontario's transmission system policies on cogeneration projects

International Nuclear Information System (INIS)

Carr, J.

1999-01-01

The impact that the establishment of transmission tariffs would have on the viability of cogeneration projects in Ontario was discussed. The proposal to establish such tariffs on the basis of a 'postage stamp' rate would ensure that all electricity users have access to electricity at the same price. However, this would unfairly penalize short-haul transmission transactions and would possibly result in the inappropriate location of new generation facilities. Electricity users would ultimately be burdened with these inefficiencies. This presentation also discussed another public policy which proposes to determine what parts of the electricity system should have their costs recovered at postage stamp rates. The costs would include not only transmission charges but also distribution and generation costs. The restructuring of Ontario Hydro into the Ontario Power Generation Company (OPGC) and the Ontario Hydro Services Company (OHSC) and its impact on the cogeneration projects was also discussed

Synthesis of non-ionic and ionic resins for BEP intaglio inks curing by electron-beam radiation. Annual report

International Nuclear Information System (INIS)

Bauer, B.J.; Dickens, B.

1992-01-01

The inks currently used to print US postage stamps on web presses are dried by heat evaporation of solvents. Emission of solvents into the atmosphere is governed by Local and Federal Government Regulations. Reduction of these emissions to acceptable levels can be accomplished by either of two methods available to the BEP. The work was part of a continuing effort to produce resins for use in formulation of intaglio inks for the printing of postage stamps and security documents. The inks are to be cured by exposure to an electron beam. The uncured inks are cleaned from the roller and wiping blade by washing the wiping blade with neutral water or with caustic water. Laboratory scale work on the urethane/polyethylene oxide/methacrylate resins has now been concluded and information on the synthesis has been provided to BEP for patenting and scaleup. Some effort on nonionic resins continued into FY88

Study on de-coating used beverage cans with thick sulfuric acid for recycle

International Nuclear Information System (INIS)

Wang, Minghua; Woo, Kee-Do; Kim, Dong-Keon; Ma, Lirong

2007-01-01

More than 1800 hundreds of millions of beverage cans are manufactured yearly over the world, which will pollute the globe environment without recycle. The recycle and regeneration estates of used beverage cans are highly profitable enterprises. Vacuum technologies are mature on a large scale today, and therefore, the re-melting process of used beverage cans (UBCs) does not have to use flux. Furthermore, the coating on UBCs becomes the key factor causing poor product quality. The present paper concerns removing the coating of UBCs and compares two different kinds of methods to remove the coating: a thermal method and a chemical reagent method. A new kind of reagent, thick sulfuric acid, was employed in the chemical reagent de-coating process. The de-coating ratio in the thermal method reached 93% at most, but the de-coating ratio reached 100% within 30 min in the chemical reagent method by using thick sulfuric acid. Recycling the used thick sulfuric acid was also supplied. A titanium yellow product can be simultaneously obtained. The experiments show that the chemical reagent method is more available than the thermal method, which will enhance the purity of the regeneration product enormously

Unicameral bone cysts: comparison of percutaneous curettage, steroid, and autologous bone marrow injections.

Science.gov (United States)

Canavese, Federico; Wright, James G; Cole, William G; Hopyan, Sevan

2011-01-01

The purpose of this study was to compare the outcome of percutaneous curettage with intralesional injection of methylprednisolone and bone marrow for unicameral bone cysts (UBCs). This was a retrospective review of 46 children and adolescents with UBC treated with autologous bone marrow injection, methylprednisolone acetate injection or percutaneous curettage alone. Inclusion criteria were a radiological diagnosis of UBC and at least 24 months follow-up from the last procedure. Healing was determined using Neer/Cole 4-grades rating scale. The 3 treatment groups were comparable with regard to age, sex, location of the cyst, and the number of procedures undertaken. At 2 years follow-up, the proportion of patients with satisfactory healing (Neer/Cole grades I and II) was greatest among those who underwent percutaneous curettage (70%) compared with bone marrow injection (21%) and methylprednisolone acetate injection (41%) (P = 0.03). We found no association between healing and age (P = 0.80) nor between healing and sex (P = 0.61). These results suggest that mechanical disruption of the cyst membrane may be helpful in healing of cysts and that this technique may be preferred to simple intralesional injections. Level III.

Main: 2AAK [RPSD[Archive

Lifescience Database Archive (English)

Full Text Available Molecule: Ubiquitin Conjugating Enzyme; Chain: Null; Synonym: Ubc1; Engineered: Yes Ubiquitin Conjugation 6....TPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD arabi_2AAK.jpg ...

NRC/UBC fuelling station with intelligent compression

International Nuclear Information System (INIS)

Dada, A.; Boyd, B.; Law, L.; Semczyszyn, D.

2004-01-01

BOC Canada Ltd. will design, integrate and construct the second fueling station on the Hydrogen Highway. This station will be located at the National Research Council's Institute for Fuel Cell Innovation on the campus of the University of British Columbia. BOC's design will bring together an existing alkaline electrolyser, new compression, storage and dispensing. The station will be designed to serve fuel cell passenger vehicles using 350-bar storage. However, the flexible design concept will allow for many other user needs including the potential for servicing larger vehicles, as well as filling portable storage systems for use at satellite stations. The novel station design also offers the potential to fuel from multiple hydrogen sources. Together with NRC, this fueling station will be used to increase public, consumer and investor awareness of hydrogen technologies. Design and construction of this facility will assist in the development of industry codes and standards and familiarize authorities having jurisdiction with hydrogen fueling. The system concept offers the utmost attention to safety, novelty and flexibility. (author)

Purification of SUMO conjugating enzymes and kinetic analysis of substrate conjugation

Science.gov (United States)

Yunus, Ali A.; Lima, Christopher D.

2009-01-01

SUMO conjugation to protein substrates requires the concerted action of a dedicated E2 ubiquitin conjugation enzyme (Ubc9) and associated E3 ligases. Although Ubc9 can directly recognize and modify substrate lysine residues that occur within a consensus site for SUMO modification, E3 ligases can redirect specificity and enhance conjugation rates during SUMO conjugation in vitro and in vivo. In this chapter, we will describe methods utilized to purify SUMO conjugating enzymes and model substrates which can be used for analysis of SUMO conjugation in vitro. We will also describe methods to extract kinetic parameters during E3-dependent or E3-independent substrate conjugation. PMID:19107417

Cost-allocation principles for pipeline capacity and usage

International Nuclear Information System (INIS)

Salant, D.J.; Watkins, G.C.

1996-01-01

The issue of cost sharing among multiple users of transmission facilities, such as pipelines, was discussed. The various ways in which a fair and reasonable pipeline cost-allocation scheme can be implemented were examined. It was suggested that no method exists for allocating costs that will achieve all major policy goals. The advantages and disadvantages of a system of uniform rates, such as postage stamp tolls, was discussed in the context of a natural gas pipeline system. A postage stamp system is one in which all users pay the same amount per unit of capacity, regardless of transport distances. This rate structure, while sometimes appropriate, is inefficient if total costs are distance-sensitive or if there is a significant variation in the sources of demand. Two commonly accepted minimal principles that a cost allocation should satisfy include: (1) the stand-alone cost test, and (2) the incremental cost test. This means that no one should pay costs in excess of their stand-alone costs and no one should pay less than their incremental costs. Postage stamp tolls were found to fail the minimal set of commonly applied principles. More optimal ways in which to allocate pipeline network costs among users were presented. The nucleolus is a unique cost allocation that is consistent, symmetric and homogeneous. The nucleolus is calculated by splitting the costs equally among users of a common facility. Another effective cost allocation system is the Shapley value which can be derived from a set of axioms which differ slightly from those that identify the nucleolus. 2 refs., 1 tab

Cost-allocation principles for pipeline capacity and usage

Energy Technology Data Exchange (ETDEWEB)

Salant, D.J.; Watkins, G.C. [Law and Economics Consulting Group, Emeryville, CA (United States)

1996-12-31

The issue of cost sharing among multiple users of transmission facilities, such as pipelines, was discussed. The various ways in which a fair and reasonable pipeline cost-allocation scheme can be implemented were examined. It was suggested that no method exists for allocating costs that will achieve all major policy goals. The advantages and disadvantages of a system of uniform rates, such as postage stamp tolls, was discussed in the context of a natural gas pipeline system. A postage stamp system is one in which all users pay the same amount per unit of capacity, regardless of transport distances. This rate structure, while sometimes appropriate, is inefficient if total costs are distance-sensitive or if there is a significant variation in the sources of demand. Two commonly accepted minimal principles that a cost allocation should satisfy include: (1) the stand-alone cost test, and (2) the incremental cost test. This means that no one should pay costs in excess of their stand-alone costs and no one should pay less than their incremental costs. Postage stamp tolls were found to fail the minimal set of commonly applied principles. More optimal ways in which to allocate pipeline network costs among users were presented. The nucleolus is a unique cost allocation that is consistent, symmetric and homogeneous. The nucleolus is calculated by splitting the costs equally among users of a common facility. Another effective cost allocation system is the Shapley value which can be derived from a set of axioms which differ slightly from those that identify the nucleolus. 2 refs., 1 tab.

7 CFR 1822.265 - Loan purposes.

Science.gov (United States)

2010-01-01

... the payment of necessary engineering fees, legal fees, and closing costs. (c) For the payment of actual cash cost of incidental administrative expenses such as postage, telephone, advertising, and temporary secretarial help, if funds to pay these expenses are not otherwise available. The estimated cost...

7 CFR 351.7 - Regulations governing importation by mail of plant material for immediate export.

Science.gov (United States)

2010-01-01

... (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE IMPORTATION OF PLANTS OR... enter the commerce of the United States. (3) After inspection by the customs and quarantine officers... parcel under customs supervision; affix to the parcel the necessary postage, and comply with other...

77 FR 39985 - Information Collection; Forest Industries and Residential Fuelwood and Post Data Collection Systems

Science.gov (United States)

2012-07-06

... personnel use three questionnaires, which are collected by personal mill visits or phone calls, or which respondents return in self-addressed, postage pre-paid envelopes, or by email. Pulpwood Received Questionnaire: Forest Service personnel use this questionnaire to collect and evaluate information from pulp and...

Custom magazines: where digital page-turn editions fail

NARCIS (Netherlands)

Schijns, J.M.C.; Smit, E.G.

2010-01-01

Threatened by the rise in paper, printing and postage costs, online custom magazines rejoice an increased interest. They are seen as a more efficient, but equivalent alternative to offline custom magazines. Most digital custom magazines, however, contain an electronic replica of the print version.

75 FR 39477 - New Standards for Domestic Mailing Services

Science.gov (United States)

2010-07-09

... markets, test new mailpieces, and increase the frequency of their mailings at reduced net postage prices... growth of automation letter-size mail, particularly pieces that are part of full-service Intelligent Mail[supreg] automation mailings entered at PostalOne![supreg] acceptance facilities. Accordingly, we propose...

76 FR 9648 - Product List Update

Science.gov (United States)

2011-02-22

... Authentication Confirm Customized Postage International Reply Coupon Service International Business Reply Mail... International Reply Coupon Service International Business Reply Mail Service Money Orders Post Office Box... Administrations 1 (MC2008-6 and CP2009-62) International Business Reply Service Competitive Contract 1 (MC2009-14...

76 FR 22618 - Product List Update

Science.gov (United States)

2011-04-22

... Postage International Reply Coupon Service International Business Reply Mail Service Money Orders Post... International Reply Coupon Service International Business Reply Mail Service Money Orders Post Office Box... and CP2009-62) International Business Reply Service Competitive Contract 1 (MC2009-14 and CP2009-20...

78 FR 51073 - Product List Update

Science.gov (United States)

2013-08-20

... Authentication Confirm Customized Postage International Reply Coupon Service International Business Reply Mail... International Reply Coupon Service International Business Reply Mail Service Money Orders Post Office Box... Administrations 1 (MC2008-6 and CP2009-62) International Business Reply Service Competitive Contract 1 (MC2009-14...

19 CFR 134.33 - J-List exceptions.

Science.gov (United States)

2010-04-01

... planed, tongued and grooved T.D.s 49750; 50366(6). Flowers, artificial, except bunches. Flowers, cut... dimensions, shape or form. Monuments. Nails, spikes, and staples. Natural products, such as vegetables...) T.D. 49750. Skins, fur, dressed or dyed. Skins, raw fur. Sponges. Springs, watch. Stamps, postage...

Philatelic Mycology: Families of Fungi

NARCIS (Netherlands)

Marasas, W.F.O.; Marasas, H.M.; Wingfield, M.J.; Crous, P.W.

2014-01-01

Philately, the study of postage stamps, and mycology, the study of fungi, are seldom connected by those that practice these very different activities. When associated, philatelic mycology would be considered as the study of fungi on stamps. The Fungi touch every aspect of our daily lives, most

Letting Students Take the Lead: A User-Centred Approach to Evaluating Subject Guides

Directory of Open Access Journals (Sweden)

Kimberley Hintz

2010-12-01

Full Text Available Objective – What do students need and want from library subject guides? Options such as Web 2.0 enhancement are now available to librarians creating subject-specific web pages. Librarians may be eager to implement these new tools, but are such add-ons a priority forstudents? This paper aims to start a dialogue on this issue by presenting the findings of the University of British Columbia (UBC Library’s Subject Guides Working Group (SGWG, which was tasked with assessing current library subject guides in order to make recommendations for the update and future development of UBC Library subject guides.Methods – The working group solicited feedback through a questionnaire that was distributed to undergraduate and graduate students from a variety of disciplines at UBC. The questionnaire included an evaluation of UBC subject guides, as well as guides from other academic libraries that used various platforms such as LibGuides and SubjectsPlus.Results – Respondents to the student questionnaire indicated that a simple and clean layout was of primary importance. Students also desired succinct annotations to resources and limited page scrolling. Meanwhile, few students identified Web 2.0 features such as rating systems and discussion forums as being important for their needs. The working group used the questionnaire data to create a “Top Ten” list of student recommendations.Conclusions – The “Top Ten” list of student recommendations was combined with stakeholder feedback from faculty, liaison librarians and Library Systems and Information Technology representatives to create the SGWG’s final recommendation for subject guide revision and enhancement. For the SGWG these findings called into question the necessity of Web 2.0 technologies within subject guide pages and highlighted the need for further research on the topic of subject guide usability and effectiveness.

Treatment of unicameral bone cysts in pediatric patients with an injectable regenerative graft: a preliminary report.

Science.gov (United States)

Gentile, John V; Weinert, Carl R; Schlechter, John A

2013-01-01

Multiple treatment modalities exist for unicameral bone cysts (UBC), including steroid injection, autologous bone marrow injection, mechanical decompression, intramedullary fixation, curettage, and bone grafting. All have their own potential limitations such as high recurrence rates, cyst persistence, need for multiple procedures, and prolonged immobilization. A minimally invasive regimen consisting of curettage, decompression, and injection of a calcium sulfate-calcium phosphate (CaSO4-CaPO4) composite has been utilized at our institution in an attempt to obtain optimal results for the treatment of UBCs in the pediatric population. We retrospectively evaluated 16 patients with pathologically confirmed UBC who were treated with curettage, decompression, and injection of a calcium sulfate-calcium phosphate composite between April 2006 and August 2010 at a single institution. The average age of the patients at time of surgical intervention was 9.4 years of age (range, 3 to 16 y). Average follow-up was 16 months (range, 6 to 36 mo). Radiographic healing, clinical outcomes, and complications were evaluated. Final follow-up radiographs demonstrated healing in 93.7% (15 of 16) of patients after a single procedure. Complete healing was observed in 14 of 16 patients and partially healed with a defect in 1 of 16 patients. One patient had a persistent cyst but did not wish to receive further treatment. All patients returned to full activities including sports on average at 3.1 months (range, 1 to 6 mo) and were asymptomatic on most recent follow-up. No postoperative complications, including refracture, were observed. Curettage, decompression, and injection of a calcium sulfate-calcium phosphate composite for UBC in the pediatric population demonstrates encouraging results with low recurrence rates and complications compared with conventional methods. Case series, Level of Evidence IV.

Investigating a potential biological treatment to prevent pathological fractures caused by unicameral bone cysts in children under 8 years.

Science.gov (United States)

Ramos-Pascua, Luis R; Sánchez-Herraéz, Sergio; Casas-Ramos, Paula; Molnar Fuentes, Sebastián; Santos Sánchez, José Ángel

2014-10-01

There is no consensus on when and how to treat unicameral bone cysts (UBCs), partly because of a lack of knowledge of the aetiology. To review the different treatment techniques for UBCs and to describe our results with a single injection of autogenous bone marrow (BM) mixed with demineralised bone matrix (DBM) in very young children. We reviewed five patients under the age of 8 years with UBCs treated by percutaneous aspiration and a single injection of BM associated with DBM. The cyst was located in the proximal humerus in four patients and in the proximal femur in one patient. Assessment of the need for surgery was based on the clinical and radiographic suspicion of new pathological fractures. The administration of a second injection, when necessary, was based on the surgeon's judgement regarding the risk of fracture. The mean follow-up after first injection was 41 months. There were no complications related to the procedure, except a non-displaced fracture, which healed without problems. All patients were pain free and progressively resumed their activities without restriction until a new fracture occurred in two cases. According to Capanna's classification, only one case healed completely (grade 1), one lesion was classified as grade 2, and there were three recurrences at 11, 12 and 27 months after initial treatment (grade 3). The final outcome was treatment failure for three out of the five patients. Two patients were treated with a second injection and one patient is waiting for surgery. A single injection of aspirated autogenous BM mixed with DBM in very young children with active UBCs at risk of fracture is very simple, comfortable and safe. Nevertheless, the results seem to be unpredictable and are probably more dependent on the natural evolution of the cyst than on the treatment. Further comparative studies with larger sample numbers are needed.

Percutaneous intramedullary decompression, curettage, and grafting with medical-grade calcium sulfate pellets for unicameral bone cysts in children: a new minimally invasive technique.

Science.gov (United States)

Dormans, John P; Sankar, Wudbhav N; Moroz, Leslie; Erol, Bülent

2005-01-01

Several treatment options exist for unicameral bone cysts (UBCs), including observation, steroid injection, bone marrow injection, and curettage and bone grafting. These are all associated with high recurrence rates, persistence, and occasional complications. Newer techniques have been described, most with variable success and only short follow-up reported. Because of these factors, a new minimally invasive percutaneous technique was developed for the treatment of UBCs in children. Twenty-eight children with UBCs who underwent percutaneous intramedullary decompression, curettage, and grafting with medical-grade calcium sulfate (MGCS) pellets by the senior author (J.P.D.) between April 2000 and April 2003 were analyzed as part of a pediatric musculoskeletal tumor registry at a large tertiary children's hospital. Four patients were lost to follow-up, and the remaining 24 patients had an average follow-up of 21.9 months (range 4-48 months). Twelve patients were followed for at least 24 months. Six of the 24 children had received previous treatment of their UBC, most often at an outside institution. Follow-up was performed through clinical evaluation and radiographic review. Postoperative radiographs at most recent follow-up showed complete healing, defined as more than 95% opacification, in 22 of 24 patients (91.7%). One patient (4.2%) demonstrated partial healing, defined as 80% to 95% opacification. One patient had less than 80% radiographic healing (4.2%). All 24 patients returned to full activities and were asymptomatic at most recent follow-up. The only complication noted was a superficial suture abscess that occurred in one patient; this resolved with local treatment measures. The new minimally invasive technique of percutaneous intramedullary decompression, curettage, and grafting with MGCS pellets demonstrates favorable results with low complication and recurrence rates compared with conventional techniques. The role of intramedullary decompression as a part

Efficacy of breast conservation therapy in early stage bilateral breast cancer

International Nuclear Information System (INIS)

Lee, Misa M.; Chen, Luci M.; Heimann, Ruth; Powers, Claire; Weichselbaum, Ralph R.

1996-01-01

-up was 50 months for synchronous patients, 45 months for metachronous patients, and 52 months for unilateral patients. Local control and survival were analyzed in patients with (1) synchronous bilateral breast cancer (SBBC), (2) metachronous breast cancer (MBBC), (3) unilateral breast cancer (UBC). The interval to development of local recurrence and survival were calculated from the time of development of the second breast lesion in patients with metachronous breast cancer. RESULTS: There were no differences in survival and failure free survival in patients with SBBC, MBBC, or UBC. Five year overall survival by lifetable analysis was 76% for SBBC, 78% for MBBC, and 87% for UBC patients; the p-value was 0.32 by logrank analysis. The five year failure-free survival was 79% for SBBC, 73% for MBBC, and 85% for UBC patients; the p-value was 0.28 by logrank analysis. There were no significant differences in median age, tumor size, pathologic node status, tamoxifen use, chemotherapy use, or median total dose of radiation therapy for SBBC, MBBC, or UBC patients. A significant difference was found in the incidence of family history of breast cancer in patients with unilateral (28%) versus bilateral breast cancer (40%) (p=0.0028 by chi-square analysis). However, there was no difference seen in outcome of patients by family history of breast cancer. The local control was identical in both bilateral and UBC patients with a crude failure rate of 3%. CONCLUSION: In our patients, no differences were observed in both local control and overall survival. Therefore, breast conservation therapy in local-regional, early stage breast cancer is a rational treatment modality for patients with SBBC and MBBC as well as UBC

No Comment: Eloquent Dissent

Science.gov (United States)

Carney, Loretta J.

1976-01-01

Discusses sex stereotypes and presents innovative ideas for dealing with them in a social studies course. Techniques suggested include collecting sexist cartoons and articles for display on the class bulletin board, photographing sexist signs on community business, and discussing sexist artifacts such as U.S. commemorative postage stamps and…

76 FR 22739 - Postal Service Market Test

Science.gov (United States)

2011-04-22

... test offers the potential for it to tap a greater share of advertising media expenditures, while offering participating mailers the possibility of postage refunds if qualifying advertising campaigns... annually on advertising, but do not include mail as a large part of their advertising mix.\\2\\ Id. at 1. The...

Personal Subscription 2018 revised.cdr

Indian Academy of Sciences (India)

user

Resonance - Journal of Science Education. 0250-6335. 0250-5991. 0253-4142. 0022-1333. 0250-4707. 0253-4126. 0256-2499. 0253- ... Rates are inclusive of postage (ordinary post) and handling charges but with additional charges, journals can also be mailed by Registered post. 4. All correspondence regarding journal ...

76 FR 16460 - Mail Classification Change for Priority Mail Flat Mail

Science.gov (United States)

2011-03-23

... online model and the retail model. The online model will allow customers to purchase packs from a Web... offer those packs in their stores directly to their customers. The Postal Service includes five... noticing a recently-filed Postal Service request to provide Forever postage on Priority Mail Flat Rate...

Fifty years of CERN history in the spotlight

CERN Document Server

2004-01-01

The programme of events for CERN's Golden Jubilee year was officially unveiled at a press conference on 8 March. The first of these events took place the following day, when the Swiss commemorative postage stamp issued in the Laboratory's honour went on sale in post offices throughout Switzerland.

39 CFR 501.4 - Changes in ownership or control, bankruptcy, or insolvency.

Science.gov (United States)

2010-07-01

... insolvency. 501.4 Section 501.4 Postal Service UNITED STATES POSTAL SERVICE POSTAGE PROGRAMS AUTHORIZATION TO... insolvency. (a) Any person or entity authorized under § 501.2 must promptly notify the Postal Service when it... condition either through bankruptcy, insolvency, assignment for the benefit of creditors, or other similar...

1 CFR 11.7 - Federal Register Index.

Science.gov (United States)

2010-01-01

... 1 General Provisions 1 2010-01-01 2010-01-01 false Federal Register Index. 11.7 Section 11.7... REGISTER PUBLICATIONS SUBSCRIPTIONS § 11.7 Federal Register Index. The annual subscription price for the monthly Federal Register Index, purchased separately, in paper form, is $29. The price excludes postage...

Injection of Unicameral Bone Cysts with Bone Marrow Aspirate and Demineralized Bone Matrix Avoids Open Curettage and Bone Grafting in a Retrospective Cohort.

Science.gov (United States)

Gundle, Kenneth R; Bhatt, Etasha M; Punt, Stephanie E; Bompadre, Viviana; Conrad, Ernest U

2017-01-01

Many treatment options exist for unicameral bone cysts (UBC), without clear evidence of superiority. Meta-analyses have been limited by small numbers of patients in specific anatomic and treatment subgroups. The purpose of this study was to report the outcomes of injecting bone marrow aspirate and demineralized bone matrix (BMA/DBM) for the treatment of proximal humerus UBC. Fifty-one patients with proximal humerus lesions treated by BMA/DBM injection were retrospectively reviewed from a single academic medical center. The mean number of injections performed per patient was 2.14 (range 1-5). Eleven patients underwent only one injection (22%), an additional 19 patients completed treatment after two injections (37%), four patients healed after three injections (8%), and one patient healed after four injections (2%). The cumulative success rate of serial BMA/DBM injections was 22% (11/51), 58% (30/51), 67% (34/51), and 69% (35/51). Eleven patients (22%) ultimately underwent open curettage and bone grafting, and five patients (10%) were treated with injection of calcium phosphate bone substitute. A BMA/DBM injection strategy avoided an open procedure in 78% of patients with a proximal humerus UBC. The majority of patients underwent at least 2 injection treatments. Level IV retrospective cohort study.

Background Checks for all Gun Buyers and Gun Violence Restraining Orders: State Efforts to Keep Guns from High-Risk Persons.

Science.gov (United States)

Vernick, Jon S; Alcorn, Ted; Horwitz, Joshua

2017-03-01

There were more than 36,000 firearm-related deaths in the U.S. in 2015. Under federal law, a background check is required only for gun purchases from licensed dealers. Research suggests that some persons prohibited from owning a gun turn to private sellers, including those identified online, to attempt to obtain a firearm. State-level approaches to make it more difficult for high-risk persons to purchase or possess firearms include universal background check (UBC) and gun violence restraining order (GVRO) laws. UBC laws, on the books in 18 states as of the end of 2016, can reduce both homicide and suicide rates. After Colorado adopted a UBC law in 2013, the number of background checks conducted by private sellers for sales occurring at places other than gun shows steadily increased. GVRO laws give law enforcement and families the authority to petition a court to temporarily remove firearms from an individual who presents a danger to himself or others during times of crisis, regardless of whether that person has been diagnosed with a mental illness. California enacted a GVRO law in 2014. Data are emerging to suggest the effectiveness of GVRO-type laws at averting suicides and providing an entryway to services.

Assessment of DNA damage and telomerase activity in exfoliated urinary cells as sensitive and noninvasive biomarkers for early diagnosis of bladder cancer in ex-workers of a rubber tyres industry.

Science.gov (United States)

Cavallo, Delia; Casadio, Valentina; Bravaccini, Sara; Iavicoli, Sergio; Pira, Enrico; Romano, Canzio; Fresegna, Anna Maria; Maiello, Raffaele; Ciervo, Aureliano; Buresti, Giuliana; Zoli, Wainer; Calistri, Daniele

2014-01-01

The aim of the present study was to identify sensitive and noninvasive biomarkers of early carcinogenic effect at target organ to use in biomonitoring studies of workers at risk for previous occupational exposure to potential carcinogens. Standard urine cytology (Papanicolaou staining test), comet assay, and quantitative telomerase repeat amplification protocol (TRAP) assay were performed in 159 ex-rubber workers employed in tyres production and 97 unexposed subjects. In TRAP positive cases, a second level analysis using FISH (Urovysion) was done. Cystoscopy results were available for 11 individuals whose 6 FISH/TRAP/comet positive showed in 3 cases a dysplastic condition confirmed by biopsy, 1 comet positive resulted in infiltrating UBC to the biopsy and with hyperplasia and slight dysplasia to the urinary cytology, 1 comet positive resulted in papillary superficial UBC to the biopsy, 1 FISH/TRAP positive showed a normal condition, and 2 TRAP positive showed in one case a phlogosis condition. The results evidenced good concordance of TRAP, comet, and FISH assays as early biomarkers of procarcinogenic effect confirmed by the dysplastic condition and UBC found by cystoscopy-biopsy analysis. The analysis of these markers in urine cells could be potentially more accurate than conventional cytology in monitoring workers exposed to mixture of bladder potential carcinogens.

Assessment of DNA Damage and Telomerase Activity in Exfoliated Urinary Cells as Sensitive and Noninvasive Biomarkers for Early Diagnosis of Bladder Cancer in Ex-Workers of a Rubber Tyres Industry

Directory of Open Access Journals (Sweden)

Delia Cavallo

2014-01-01

Full Text Available The aim of the present study was to identify sensitive and noninvasive biomarkers of early carcinogenic effect at target organ to use in biomonitoring studies of workers at risk for previous occupational exposure to potential carcinogens. Standard urine cytology (Papanicolaou staining test, comet assay, and quantitative telomerase repeat amplification protocol (TRAP assay were performed in 159 ex-rubber workers employed in tyres production and 97 unexposed subjects. In TRAP positive cases, a second level analysis using FISH (Urovysion was done. Cystoscopy results were available for 11 individuals whose 6 FISH/TRAP/comet positive showed in 3 cases a dysplastic condition confirmed by biopsy, 1 comet positive resulted in infiltrating UBC to the biopsy and with hyperplasia and slight dysplasia to the urinary cytology, 1 comet positive resulted in papillary superficial UBC to the biopsy, 1 FISH/TRAP positive showed a normal condition, and 2 TRAP positive showed in one case a phlogosis condition. The results evidenced good concordance of TRAP, comet, and FISH assays as early biomarkers of procarcinogenic effect confirmed by the dysplastic condition and UBC found by cystoscopy-biopsy analysis. The analysis of these markers in urine cells could be potentially more accurate than conventional cytology in monitoring workers exposed to mixture of bladder potential carcinogens.

Molecular basis of APC/C regulation by the spindle assembly checkpoint

Science.gov (United States)

Zhang, Ziguo; Yang, Jing; Maslen, Sarah; Skehel, Mark; Barford, David

2016-01-01

In the dividing eukaryotic cell the spindle assembly checkpoint (SAC) ensures each daughter cell inherits an identical set of chromosomes. The SAC coordinates the correct attachment of sister chromatid kinetochores to the mitotic spindle with activation of the anaphase-promoting complex/cyclosome (APC/C), the E3 ubiquitin ligase that initiates chromosome separation. In response to unattached kinetochores, the SAC generates the mitotic checkpoint complex (MCC), a multimeric assembly that inhibits the APC/C, delaying chromosome segregation. Here, using cryo-electron microscopy we determined the near-atomic resolution structure of an APC/C-MCC complex (APC/CMCC). We reveal how degron-like sequences of the MCC subunit BubR1 block degron recognition sites on Cdc20, the APC/C coactivator subunit (Cdc20APC/C) responsible for substrate interactions. BubR1 also obstructs binding of UbcH10 (APC/C’s initiating E2) to repress APC/C ubiquitination activity. Conformational variability of the complex allows for UbcH10 association, and we show from a structure of APC/CMCC in complex with UbcH10 how the Cdc20 subunit intrinsic to the MCC (Cdc20MCC) is ubiquitinated, a process that results in APC/C reactivation when the SAC is silenced. PMID:27509861

Project To Design a Marketing Plan for Promoting Educators' Awareness of and Access to ERIC Products. Proposed Marketing Plan.

Science.gov (United States)

Contemporary Associates, Inc., Washington, DC.

The proposed strategy, which is designed to maximize the effectiveness and minimize the costs of marketing the Information Analysis Products (IAPs) produced by the 16 ERIC Clearinghouses, is based on a study of the concept of centralized versus decentralized ordering of selected ERIC products. The experiment measured four variables--postage,…

Book Review: An Uneasy Story. | Cameron | South African Medical ...

African Journals Online (AJOL)

An Uneasy Story. The Nationalising of South African Mission Hospitals 1960 - 1976. A Personal Account. By Dr Ronald Ingle. Foreword by Professor Dons Kritzinger. Pp. xiii+189. Published by the author. 2010. ISBN 978-0-620-47820-5. Illustrated. R230 (including postage). For overseas order options, contact the author.

The Lives and Hard Times of Magazine Editors in the Big Apple: A Report on the Society of Magazine Editors' Educators Seminar.

Science.gov (United States)

English, John W.

This report chronicles the first Society of Magazine Editors' educators seminar, which was held in New York from May 13-17, 1974, and was attended by ten journalism faculty. The industry's concerns, as expressed through editors, are paper, printing, postage, people, and profit. The Magazine Publishers Association (MPA) seems mostly concerned with…

Reviews

NARCIS (Netherlands)

NN,

1969-01-01

Ashton, P.S.: A Manual of the Dipterocarp Trees of Brunei State and of Sarawak. Supplement. Borneo Literature Bureau, Rock Road, Kuching, Sarawak (Printed by Cathay Press, Hong Kong). 1968. viii + 129 pp., 15 fig., 20 pl. (photogr.), large 8°, clothbound. M$ 18.00 + postage M$ 1.30; bank charges of

77 FR 64725 - International Product and Price Changes

Science.gov (United States)

2012-10-23

... Postage or a permit imprint, (i.e., Click-N-Ship for Business, Webtools) must pay the retail price... Commercial Base TM price and Commercial Plus TM price for customers that prepare and pay for GXG shipments... at least $100,000 in revenue per year for not only GXG, Express Mail International, Priority Mail...

Ex-Post : The Investment Performance of Collectible Stamps

NARCIS (Netherlands)

Dimson, E.; Spaenjers, C.

2009-01-01

This paper investigates the returns on British collectible postage stamps over the very long run, based on stamp catalogue prices. Between 1900 and 2008, we find an annualized return on stamps of 6.7% in nominal terms, which is equivalent to an average real return of 2.7% per annum. Prices have

Untitled

Indian Academy of Sciences (India)

Resonance - J. of Science Education. (12 issues per year, ISSN: 0971-8044). O. J. of Biosciences. (4 issues per year, ISSN: 0250-5991). J. of Genetics ... Rates are inclusive of postage (ordinary post) and handling charges but with additional charges, journals can also be mailed by Registered post. 6. Free specimen copies ...

(Wormwood capillary) by random amplified polymorphic DNA (RAPD)

African Journals Online (AJOL)

STORAGESEVER

2009-05-04

May 4, 2009 ... Faculty of Agrotechnology and Food Science, Universiti Malaysia Terengganu, .... Operon and UBC (University of British Columbia, Canada) 10mers .... a visual representation of the relationship of difference population of.

School and the Limits of Philosophy

Science.gov (United States)

Fitzsimons, Peter

2014-01-01

Philosophy and schools, children and dynamite, elephants and postage stamps: each has a place, but not necessarily in any natural combination with the other. Whether schools and philosophy belong together depends largely on what we mean by both. To the extent that schools are instruments of government regulation and a mechanism for production of…

39 CFR 551.6 - Pricing.

Science.gov (United States)

2010-07-01

... 39 Postal Service 1 2010-07-01 2010-07-01 false Pricing. 551.6 Section 551.6 Postal Service UNITED STATES POSTAL SERVICE POSTAGE PROGRAMS SEMIPOSTAL STAMP PROGRAM § 551.6 Pricing. (a) The Semipostal Authorization Act, as amended by Public Law 107-67, section 652, 115 Stat. 514 (2001), prescribes that the price...

76 FR 4820 - New Mailing Standards for Domestic Mailing Services

Science.gov (United States)

2011-01-27

.... The parcels do not bear a GS1-128 or Intelligent Mail package barcode. b. The parcels weigh less than... pieces in a mailing must be paid with the same method unless otherwise authorized by Business Mailer... pieces only if authorized by Business Mailer Support. 2.2 Affixed Postage for Presorted First-Class Mail...

76 FR 35411 - Applications for Trademark Registration

Science.gov (United States)

2011-06-17

...-hour) cost burden in the form of postage costs, as well as filing and processing fees. Applicants incur....00 There is also annual (non-hour) cost burden in the way of filing fees associated with this... application. Total non-hour cost Item Responses (a) Filing fee * ($) burden (yr) (a) x (b) (b) (c) Use-Based...

75 FR 37380 - Trademark Trial and Appeal Board (TTAB) Actions

Science.gov (United States)

2010-06-29

... information collection. There are, however, postage and recordkeeping costs, as well as filing fees... will be $6,800 per year. There is also annual nonhour cost burden in the way of filing fees associated... Responses Filing fee cost burden (a x (a) ($) (b) b) (c) Petition to Cancel 125 $300.00 $37,500.00...

Aspects of Hydrological Modelling In The Punjab Himalayan and Karakoram Ranges, Pakistan

Science.gov (United States)

Loukas, A.; Khan, M. I.; Quick, M. C.

Various aspects of hydrologic modelling of high mountainous basins in the Punjab Hi- malayan and Karakoram ranges of Northern Pakistan were studied. The runoff from three basins in this region was simulated using the U.B.C. watershed model, which re- quires limited meteorological data of minimum and maximum daily temperature and precipitation. The structure of the model is based on the concept that the hydrolog- ical behavior is a function of elevation and thus, a watershed is conceptualized as a number of elevational zones. A simplified energy budget approach, which is based on daily maximum and minimum temperature and can account for forested and open areas, and aspect and latitude, is used in the U.B.C. model for the estimation of the snowmelt and glacier melt. The studied basins have different hydrological responses and limited data. The runoff from the first basin, the Astore basin, is mainly gener- ated by snowmelt. In the second basin, the Kunhar basin, the runoff is generated by snowmelt but significant redistribution of snow, caused by snow avalanches, affect the runoff generation. The third basin, the Hunza basin, is a highly glacierized basin and its runoff is mainly generated by glacier melt. The application of the U.B.C. watershed model to these three basins showed that the model could estimate reasonably well the runoff generated by the different components.

Towards a more adaptive co - management of natural resources ...

African Journals Online (AJOL)

2014-06-01

Jun 1, 2014 ... being channelled into Madagascar's environmental sector since the mid-1980s, the ...... firmly embedded in Malagasy environmental legislation, there is little potential to ..... UBC Press, British Colombia. Norris, S. 2006.

Biochemical function of typical and variant Arabidopsis thaliana U-box E3 ubiquitin-protein ligases.

Science.gov (United States)

Wiborg, Jakob; O'Shea, Charlotte; Skriver, Karen

2008-08-01

The variance of the U-box domain in 64 Arabidopsis thaliana (thale cress) E3s (ubiquitin-protein ligases) was used to examine the interactions between E3s and E2s (ubiquitin-conjugating enzymes). E2s and E3s are components of the ubiquitin protein degradation pathway. Seven U-box proteins were analysed for their ability to ubiquitinate proteins in vitro in co-operation with different E2s. All U-box domains exhibited ubiquitination activity and interacted productively with UBC4/5-type E2s. Three and four of the U-box domains mediated ubiquitin addition in the presence of UBC13 and UBC7 E2s respectively, but no productive interaction was observed with the UBC15 E2 tested. The activity of AtPUB54 [Arabidopsis thaliana (thale cress) plant U-box 54 protein] was dependent on Trp(266) in the E2-binding cleft, and the E2 selectivity was changed by substitution of this position. The function of the distant U-box protein, AtPUB49, representing a large family of eukaryotic proteins containing a U-box linked to a cyclophilin-like peptidyl-prolyl cis-trans isomerase domain, was characterized biochemically. AtPUB49 functioned both as a prolyl isomerase and a chaperone by catalysing cis-trans isomerization of peptidyl-prolyl bonds and dissolving protein aggregates. In conclusion, both typical and atypical Arabidopsis U-box proteins were active E3s. The overlap in the E3/E2 selectivity suggests that in vivo specificity is not determined only by the E3-E2 interactions, but also by other parameters, e.g. co-existence or interactions with additional domains. The biochemical functions of AtPUB49 suggest that the protein can be involved in folding or degradation of protein substrates. Similar functions can also be retained within a protein complex with separate chaperone and U-box proteins.

The importance of visitors' knowledge of the cultural and natural history of the Adirondacks in influencing sense of place in the high peaks region

Science.gov (United States)

Laura Fredrickson

2002-01-01

This study examined various dimensions of the sense of place experience felt by visitors to the High Peaks of the Adirondack Park. More specifically, a 6-page questionnaire (mail-back postage-paid) was distributed to 803 people over a three-month period (June, July & August, 1999). The two primary objectives of this study were to: 1) explore the various...

76 FR 42684 - Statutory Invention Registration

Science.gov (United States)

2011-07-19

... 3.00 Totals 8 10.00 There is annual (non-hour) cost burden in the way of filing fees associated with...) Filing fee $ cost burden (a) (b) (a x b) (c) Statutory Invention Registration (Requested prior to 2 $920...) respondent cost burden for this collection in the form of postage costs and filing fees will be $8,170. IV...

77 FR 4637 - Defense Federal Acquisition Regulation Supplement: Shipping Instructions (DFARS Case 2011-D052)

Science.gov (United States)

2012-01-30

.... origin contracts, Export Traffic Release regardless of f.o.b. terms, or foreign military sales shipments... use the DD Form 1659 when using the clauses at FAR 52.242-10, F.o.b. Origin--Government Bills of Lading or Prepaid Postage, or 52.242-11, F.o.b. Origin-- Government Bills of Lading or Indicia Mail...

Safety, Dosimetry, and Tumor Detection Ability of ⁶⁸Ga-NOTA-AE105

DEFF Research Database (Denmark)

Skovgaard Lund, Dorthe; Persson, Morten; Brandt-Larsen, Malene

2017-01-01

The overexpression of urokinase-type plasminogen activator receptors (uPARs) represents an established biomarker for aggressiveness in most common malignant diseases, including breast cancer (BC), prostate cancer (PC), and urinary bladder cancer (UBC), and is therefore an important target for new...... cancer therapeutic and diagnostic strategies. In this study, uPAR PET imaging using a68Ga-labeled version of the uPAR-targeting peptide (AE105) was investigated in a group of patients with BC, PC, and UBC. The aim of this first-in-human, phase I clinical trial was to investigate the safety.......Conclusion:This first-in-human, phase I clinical trial demonstrates the safe use and clinical potential of68Ga-NOTA-AE105 as a new radioligand for uPAR PET imaging in cancer patients....

NONINVASIVE DIAGNOSIS OF URINARY BLADDER CANCER BY CROSS-POLARIZATION OPTICAL COHERENCE TOMOGRAPHY: CLINICAL RESULTS

Directory of Open Access Journals (Sweden)

O. S. Streltsova

2014-07-01

Full Text Available The investigation examined the feasibility of cross-polarization optical cohe-rence tomography (CP OCT to detect early urinary bladder cancer (UBC. Studies were performed in 376 patients; 5290 images were obtained using an OCT 133-U optical coherence tomograph. To acquire and compare intrared-light scattering images in baseline and orthogonal polarizations is the basis of CP OCT; their analysis makes it possible to judge from the state of the epithelium/connective tissue system and to obtain information on changes in tissue depolarizing components, collagen in particular. The authors elaborated criteria as determinants of the nature of CP OCT changes in direct and orthogonal polarizations in health, inflammatory changes, and UBC at its early stage - urothelial dysplasia and carcinoma in situ in flat suspected areas.

Conversion of the random amplified polymorphic DNA (RAPD ...

African Journals Online (AJOL)

Conversion of the random amplified polymorphic DNA (RAPD) marker UBC#116 linked to Fusarium crown and root rot resistance gene (Frl) into a co-dominant sequence characterized amplified region (SCAR) marker for marker-assisted selection of tomato.

39 CFR 501.7 - Postage Evidencing System requirements.

Science.gov (United States)

2010-07-01

... FOR SALE PROPERTY OF [NAME OF PROVIDER] (800) ###-#### Use of this meter is permissible only under U.S. Postal Service authorization. Call [Name of Provider] at (800) ###-#### to relocate/return this meter.... PROPERTY OF [NAME OF PROVIDER] as well as the provider's toll-free number must be emphasized by capitalized...

Selection of Suitable Internal Control Genes for Accurate Normalization of Real-Time Quantitative PCR Data of Buffalo (Bubalus bubalis) Blastocysts Produced by SCNT and IVF.

Science.gov (United States)

Sood, Tanushri Jerath; Lagah, Swati Viviyan; Sharma, Ankita; Singla, Suresh Kumar; Mukesh, Manishi; Chauhan, Manmohan Singh; Manik, Radheysham; Palta, Prabhat

2017-10-01

We evaluated the suitability of 10 candidate internal control genes (ICGs), belonging to different functional classes, namely ACTB, EEF1A1, GAPDH, HPRT1, HMBS, RPS15, RPS18, RPS23, SDHA, and UBC for normalizing the real-time quantitative polymerase chain reaction (qPCR) data of blastocyst-stage buffalo embryos produced by hand-made cloning and in vitro fertilization (IVF). Total RNA was isolated from three pools, each of cloned and IVF blastocysts (n = 50/pool) for cDNA synthesis. Two different statistical algorithms geNorm and NormFinder were used for evaluating the stability of these genes. Based on gene stability measure (M value) and pairwise variation (V value), calculated by geNorm analysis, the most stable ICGs were RPS15, HPRT1, and ACTB for cloned blastocysts, HMBS, UBC, and HPRT1 for IVF blastocysts and RPS15, GAPDH, and HPRT1 for both the embryo types analyzed together. RPS18 was the least stable gene for both cloned and IVF blastocysts. Following NormFinder analysis, the order of stability was RPS15 = HPRT1>GAPDH for cloned blastocysts, HMBS = UBC>RPS23 for IVF blastocysts, and HPRT1>GAPDH>RPS15 for cloned and IVF blastocysts together. These results suggest that despite overlapping of the three most stable ICGs between cloned and IVF blastocysts, the panel of ICGs selected for normalization of qPCR data of cloned and IVF blastocyst-stage embryos should be different.

Bioceramic bone graft substitute for treatment of unicameral bone cysts.

Science.gov (United States)

Fillingham, Y A; Cvetanovich, G L; Haughom, B D; Erickson, B J; Gitelis, S

2016-08-01

To review the outcome of 12 patients who underwent debridement and injection of bioceramic for unicameral bone cyst (UBC). The resorption rate of the bioceramic was estimated by both traditional and novel methods. Records of 10 males and 2 females aged 6 to 34 years who underwent debridement and injection of bioceramic for UBC and were followed up for a mean of 41 (range, 26-57) months were reviewed. Functional outcome was assessed using the selfcompleted Musculoskeletal Tumor Society (MSTS) questionnaire. Radiological outcome was assessed using both original and modified Neer Outcome Rating System. The resorption rate of the bioceramic was estimated using both traditional and novel (ImageJ) methods. The mean MSTS score was 29.7 (range, 28-30) indicating excellent functional outcome. Of the 12 patients, 9 achieved complete healing and 3 had a residual cyst of 1%, 11%, and 52%. The last was considered a local recurrence, and the patient underwent repeat percutaneous injection of the bioceramic 1.5 years later and remained disease-free 4 years later. The mean resorption rate was 29% faster when estimated using the traditional rather than the ImageJ method (0.47 vs. 0.33 cm3/day, p=0.02). In the patient with recurrence, the resorption rate was faster than the average (0.68 vs. 0.33 cm3/day). A single percutaneous injection of the bioceramic for UBC achieved good functional and radiological outcome while avoiding donor-site morbidity.

Tropical Freshwater Biology: Submissions

African Journals Online (AJOL)

The Publishers now levy a charge of N800.00 or U. S. $8.00 per final printed page after acceptance, to partially defray the cost of publication. ... The price of a single issue including air postage is U.S. $100.00 (One hundred U.S. Dollars) or its equivalent in U.K., Sterling, French Francs, Swiss Francs or Dutsche Marks.

Unicameral bone cyst of the proximal tibia in a five year old girl.

Science.gov (United States)

Tahririan, Mohammadali; Motiffard, Mehdi

2012-01-01

Unicameral bone cysts (UBCs) are benign, osteolytic lesions which are often asymptomatic and are commonly seen in the proximal of humerus and femur. The average age at diagnosis is 9-11 years and there is a male preponderance with a male-to-female ratio of approximately 2-2.5 to 1. We describe a case of 5-year-old girl who presented to orthopedic clinic with a 4-month history of painful limping. Plain radiography of the right knee demonstrated a well-defined lytic lesion in the proximal of the tibia. Open biopsy and then curettage and bone grafting with bone- substitute was performed. The diagnosis of this condition requires a high index of suspicion. This report demonstrates that all UBCs do not have the same clinical patterns and with adequate attention good results can be achieved.

Unicameral bone cyst of the proximal tibia in a five year old girl

Directory of Open Access Journals (Sweden)

Mohammadali Tahririan

2012-01-01

Full Text Available Unicameral bone cysts (UBCs are benign, osteolytic lesions which are often asymptomatic and are commonly seen in the proximal of humerus and femur. The average age at diagnosis is 9-11 years and there is a male preponderance with a male-to-female ratio of approximately 2-2.5 to 1. We describe a case of 5-year-old girl who presented to orthopedic clinic with a 4-month history of painful limping. Plain radiography of the right knee demonstrated a well-defined lytic lesion in the proximal of the tibia. Open biopsy and then curettage and bone grafting with bone- substitute was per-formed. The diagnosis of this condition requires a high index of suspicion. This report demonstrates that all UBCs do not have the same clinical patterns and with adequate attention good results can be achieved.

Long non-coding RNA HOTAIR regulates proliferation and invasion ...

Indian Academy of Sciences (India)

2016-09-22

Sep 22, 2016 ... Retinoblastoma (Rb) is an eye cancer that originates from the retina, and the most ..... receptor, and Jagged1, the most common ligand in Notch signalling .... urothelial bladder cancer (UBC) patients can serve as bio- markers ...

Mechanisms and functional roles of glutamatergic synapse diversity in a cerebellar circuit

NARCIS (Netherlands)

Zampini, Valeria; Liu, Jian K; Diana, Marco A; Maldonado, Paloma P; Brunel, Nicolas; Dieudonné, Stéphane

2016-01-01

Synaptic currents display a large degree of heterogeneity of their temporal characteristics, but the functional role of such heterogeneities remains unknown. We investigated in rat cerebellar slices synaptic currents in Unipolar Brush Cells (UBCs), which generate intrinsic mossy fibers relaying

The Treatment of Vaginismus

Science.gov (United States)

Szasz, George; Stuart, Freida; Maurice, William L.; Garry, Matthew

1977-01-01

The treatment of vaginismus was the subject of grand rounds in the Department of Obstetrics and Gynecology at Vancouver General Hospital. Staff members of the UBC Sex Therapy Unit participated in the presentation of a case of unconsummated marriage. PMID:21304871

Body Mass Index, Diet-Related Factors, and Bladder Cancer Prognosis: A Systematic Review and Meta-Analysis

NARCIS (Netherlands)

Westhoff, E.; Witjes, J.A.; Fleshner, N.E.; Lerner, S.P.; Shariat, S.F.; Steineck, G.; Kampman, E.; Kiemeney, L.A.L.M.; Vrieling, A.

2018-01-01

Background: Urologists are frequently confronted with questions of urinary bladder cancer (UBC) patients about what they can do to improve their prognosis. Unfortunately, it is largely unknown which lifestyle factors can influence prognosis. Objective: To systematically review the available evidence

[Pathologic proximal femoral fractures in children in an unicameral bone cyst].

Science.gov (United States)

Havránek, P; Pesl, T; Bartonícek, J

2005-01-01

Proximal femoral fractures in children are rare, pathologic fractures being extremely rare. Despite many meanings these fractures are still "unsolved" there are some definite rules for treatment of true accidental injuries. Pathologic fractures are outstanding with their extremely rare incidence. The aim of the study is to overview a large clinical material, find out the incidence of this pathologic fracture, the extent and shape of the unicameral bone cyst (UBC), specific therapeutic approach, technical problems of eventual osteosynthesis, number of reoperations and sequels. Altogether 49 children with 50 accidental and pathologic fractures of proximal part of the femur treated in the Regional Pediatric Trauma Centre of the Department of Pediatric and Trauma Surgery, 3rd Faculty of Medicine, Charles University, Prague. Retrospective and prospective study of children (0 to 15 years of age) treated with proximal femoral accidental and pathologic fractures during the 20 year period (from August 1984 to November 2004). Classification of fractures according to Delbet and Colonna. Diagnosis of bone cyst with plain X-rays, eventually CT scans. During the 20 years period (August 1984 to November 2004) 49 children with 50 proximal femoral fractures were treated in the Department. Four patients sustained a pathologic fracture through an unicameral bone cyst. Two of these latter children were treated by an open reduction and osteosynthesis with the use of the proximal femoral AO-ASIF angled-plate and two children nonoperatively using skeletal traction because of impossibility of insertion of the osteosynthetic material without a damage of the growth plate. Subsequent operations of the UBC were necessary in these two children. All four patients recovered well without sequels. Pathologic fractures in UBC are usually treated nonoperatively and the cyst itself is treated after fracture healing. Proximal femoral impairment is the exception from this rule because of weigh bearing

HTLV-1 Tax Stimulates Ubiquitin E3 Ligase, Ring Finger Protein 8, to Assemble Lysine 63-Linked Polyubiquitin Chains for TAK1 and IKK Activation.

Science.gov (United States)

Ho, Yik-Khuan; Zhi, Huijun; Bowlin, Tara; Dorjbal, Batsukh; Philip, Subha; Zahoor, Muhammad Atif; Shih, Hsiu-Ming; Semmes, Oliver John; Schaefer, Brian; Glover, J N Mark; Giam, Chou-Zen

2015-08-01

Human T lymphotropic virus type 1 (HTLV-1) trans-activator/oncoprotein, Tax, impacts a multitude of cellular processes, including I-κB kinase (IKK)/NF-κB signaling, DNA damage repair, and mitosis. These activities of Tax have been implicated in the development of adult T-cell leukemia (ATL) in HTLV-1-infected individuals, but the underlying mechanisms remain obscure. IKK and its upstream kinase, TGFβ-activated kinase 1 (TAK1), contain ubiquitin-binding subunits, NEMO and TAB2/3 respectively, which interact with K63-linked polyubiquitin (K63-pUb) chains. Recruitment to K63-pUb allows cross auto-phosphorylation and activation of TAK1 to occur, followed by TAK1-catalyzed IKK phosphorylation and activation. Using cytosolic extracts of HeLa and Jurkat T cells supplemented with purified proteins we have identified ubiquitin E3 ligase, ring finger protein 8 (RNF8), and E2 conjugating enzymes, Ubc13:Uev1A and Ubc13:Uev2, to be the cellular factors utilized by Tax for TAK1 and IKK activation. In vitro, the combination of Tax and RNF8 greatly stimulated TAK1, IKK, IκBα and JNK phosphorylation. In vivo, RNF8 over-expression augmented while RNF8 ablation drastically reduced canonical NF-κB activation by Tax. Activation of the non-canonical NF-κB pathway by Tax, however, is unaffected by the loss of RNF8. Using purified components, we further demonstrated biochemically that Tax greatly stimulated RNF8 and Ubc13:Uev1A/Uev2 to assemble long K63-pUb chains. Finally, co-transfection of Tax with increasing amounts of RNF8 greatly induced K63-pUb assembly in a dose-dependent manner. Thus, Tax targets RNF8 and Ubc13:Uev1A/Uev2 to promote the assembly of K63-pUb chains, which signal the activation of TAK1 and multiple downstream kinases including IKK and JNK. Because of the roles RNF8 and K63-pUb chains play in DNA damage repair and cytokinesis, this mechanism may also explain the genomic instability of HTLV-1-transformed T cells and ATL cells.

Expression Profiling of WSSV ORF 199 and Shrimp Ubiquitin Conjugating Enzyme in WSSV Infected

Directory of Open Access Journals (Sweden)

K. Jeena

2012-08-01

Full Text Available White spot syndrome virus (WSSV is one of the major viral pathogens affecting shrimp aquaculture. Four proteins, WSSV199, WSSV 222, WSSV 249 and WSSV 403, from WSSV are predicted to encode a RING-H2 domain, which in presence of ubiquitin conjugating enzyme (E2 in shrimp can function as viral E3 ligase and modulate the host ubiquitin proteasome pathway. Modulation of host ubiquitin proteasome pathway by viral proteins is implicated in viral pathogenesis. In the present study, a time course expression profile analysis of WSSV Open Reading Frame (ORF 199 and Penaeus monodon ubiquitin conjugating enzyme (PmUbc was carried out at 0, 3, 6, 12, 24, 48 and 72 h post WSSV challenge by semi-quantitative RT-PCR as well as Real Time PCR. EF1α was used as reference control to normalize the expression levels. A significant increase in PmUbc expression at 24 h post infection (h.p.i was observed followed by a decline till 72 h.p.i. Expression of WSSV199 was observed at 24 h.p.i in WSSV infected P. monodon. Since the up-regulation of PmUbc was observed at 24 h.p.i where WSSV199 expression was detected, it can be speculated that these proteins might interact with host ubiquitination pathway for viral pathogenesis. However, further studies need to be carried out to unfold the molecular mechanism of interaction between host and virus to devise efficient control strategies for this chaos in the shrimp culture industry.

41 CFR 128-1.8005 - Seismic safety standards.

Science.gov (United States)

2010-07-01

... the model building codes that the Interagency Committee on Seismic Safety in Construction (ICSSC...) Uniform Building Code (UBC); (2) The 1992 Supplement to the Building Officials and Code Administrators International (BOCA) National Building Code (NBC); and (3) The 1992 Amendments to the Southern Building Code...

Rising in Silence and Wonder

DEFF Research Database (Denmark)

Hansen, Finn Thorbjørn

2006-01-01

I denne interview-artikel redegør den canadiske vejledningsprofessor Norman Amundson og lektor Finn Thorbjørn Hansen om deres forskningssamarbejde på UBC i Vancouver og hvorledes de har tænkt forholdet mellem den ontologiske og eksistentielle dimension i karrierevejledning. Udgivelsesdato: August...

Atomicity in Electronic Commerce,

Science.gov (United States)

1996-01-01

even 1¢, the standard credit card rates would dominate the cost of the item. Thus, a number of parties have proposed support for microtransactions ...Millicent [14].) Both NetBill and cryptographic postage indicia are motivated by the idea of supporting microtransactions . Some of the design decisions made...for those systems can only be understood by the microtransaction requirement. However, a detailed discussion of microtransactions is beyond the scope

Recurrent urinary tract infection and risk of bladder cancer in the Nijmegen bladder cancer study

NARCIS (Netherlands)

Vermeulen, S.; Hanum, N.; Grotenhuis, A.J.; Castano-Vinyals, G.; Heijden, A.G. van der; Aben, K.K.H.; Mysorekar, I.U.; Kiemeney, L.A.L.M.

2015-01-01

BACKGROUND: Controversy exists on whether urinary tract infection (UTI) is a risk factor for urinary bladder cancer (UBC). Here, the association is investigated using data from one of the largest bladder cancer case-control studies worldwide. METHODS: Information on (i) history and age at onset of

Experimental Investigation into the Combustion Characteristics on the Co-firing of Biomass with Coal as a Function of Particle Size and Blending Ratio

Energy Technology Data Exchange (ETDEWEB)

Lkhagvadorj, Sh; Kim, Sang In; Lim, Ho; Kim, Seung Mo; Jeon, Chung Hwan [Pusan National Univ., Busan (Korea, Republic of); Lee, Byoung Hwa [Doosan Heavy Industries and Construction, Ltd., Changwon (Korea, Republic of)

2016-01-15

Co-firing of biomass with coal is a promising combustion technology in a coal-fired power plant. However, it still requires verifications to apply co-firing in an actual boiler. In this study, data from the Thermogravimetric analyzer(TGA) and Drop tube furnace(DTF) were used to obtain the combustion characteristics of biomass when co-firing with coal. The combustion characteristics were verified using experimental results including reactivity from the TGA and Unburned carbon(UBC) data from the DTF. The experiment also analyzed with the variation of the biomass blending ratio and biomass particle size. It was determined that increasing the biomass blending ratio resulted in incomplete chemical reactions due to insufficient oxygen levels because of the rapid initial combustion characteristics of the biomass. Thus, the optimum blending condition of the biomass based on the results of this study was found to be 5 while oxygen enrichment reduced the increase of UBC that occurred during combustion of blended biomass and coal.

Development of upgraded brown coal process

Energy Technology Data Exchange (ETDEWEB)

Komatsu, N.; Sugita, S.; Deguchi, T.; Shigehisa, T.; Makino, E. [Kobe Steel Ltd., Hyogo (Japan). Coal and Energy Project Department

2004-07-01

Half of the world's coal resources are so-called low rank coal (LRC) such as lignite, subbituminous coal. Utilization of such coal is limited due to low heat value and high propensity of spontaneous combustion. Since some of LRCs have advantages as clean coal, i.e. low ash and low sulfur content, LRC can be the excellent feedstock for power generation and metallurgy depending on the upgrading technology. The UBC (upgraded brown coal) process introduced here converts LRC to solid fuel with high heat value and less propensity of self-heating. Various world coals, such as Australian, Indonesian and USA LRC, were tested using the Autoclave and Bench Scale Unit, and the process application to LRC of wide range is proven. The R & D activities of the UBC process are introduced including a demonstration project with a 5 ton/day test plant in progress in Indonesia, expecting near future commercialisation in order to utilize abundant LRC of clean properties. 8 refs., 12 figs., 3 tabs.

Energy efficient technologies for the mining industry

Energy Technology Data Exchange (ETDEWEB)

Klein, B.; Bamber, A.; Weatherwax, T.; Dozdiak, J.; Nadolski, S.; Roufail, R.; Parry, J.; Roufail, R.; Tong, L.; Hall, R. [British Columbia Univ., Vancouver, BC (Canada). Centre for Environmental Research in Minerals, Metals and Materials, Norman B. Keevil Inst. of Mining Engineering

2010-07-01

Mining in British Columbia is the second largest industrial electricity consumer. This presentation highlighted methods to help the mining industry reduce their energy requirements by limiting waste and improving efficiency. The measures are aimed at optimizing energy-use and efficiency in mining and processing and identifying opportunities and methods of improving this efficiency. Energy conservation in comminution and beneficiation is a primary focus of research activities at the University of British Columbia (UBC). The objective is to reduce energy usage in metal mines by 20 per cent overall. Open pit copper, gold and molybdenum mines are being targeted. Projects underway at UBC were outlined, with particular reference to energy usage, recovery and alternative energy sources; preconcentration; reducing energy usage from comminution in sorting, high pressure grinding rolls and high speed stirred mills; Hydromet; other energy efficient technologies such as control and flotation; and carbon dioxide sequestration. Studies were conducted at various mining facilities, including mines in Sudbury, Ontario. tabs., figs.

POS-Tagging for informal language (study in Indonesian tweets)

Science.gov (United States)

Suryawati, Endang; Munandar, Devi; Riswantini, Dianadewi; Fatchuttamam Abka, Achmad; Arisal, Andria

2018-03-01

This paper evaluates Part-of-Speech Tagging for the formal Indonesian language can be used for the tagging process of Indonesian tweets. In this study, we add five additional tags which reflect to social media attributes to the existing original tagset. Automatic POS tagging process is done by stratified training process with 1000, 1600, and 1800 of annotated tweets. It shows that the process can achieve up to 66.36% accuracy. The experiment with original tagset gives slightly better accuracy (67.39%) than the experiment with five additional tags, but will lose important informations which given by the five additional tagset.POS-Tagging for Informal Language (Study in Indonesian Tweets).

78 FR 68868 - First-Class Mail Postage Payment Option

Science.gov (United States)

2013-11-15

... Option AGENCY: Postal Regulatory Commission. ACTION: Notice. SUMMARY: The Commission is noticing a recent... the option of increasing the value of the pre-approved envelopes by applying a customized Picture... encourages increased mail volume (factors 1 and 7) and, by providing a more convenient option for sending...

39 CFR 501.3 - Postage Evidencing System provider qualification.

Science.gov (United States)

2010-07-01

... official government business, when available, under such rules respecting class of travel as apply to those... necessary travel-related costs incurred by the Postal Service to conduct the inspections. Travel-related costs are determined in accordance with Postal Service Handbook F-15, Travel and Relocation. At its...

Influence of metformin intake on the risk of bladder cancer in type 2 diabetes patients

NARCIS (Netherlands)

Goossens, Maria E; Buntinx, Frank; Zeegers, Maurice P; Driessen, J H M; De Bruin, Marie L; de Vries, Frank

2015-01-01

OBJECTIVE: The aim of this study is to look at the influence of metformin intake and duration, on urinary bladder cancer (UBC) risk, with sulfonylurea (SU) only users as control using a new-user design (inception cohort). METHODS: We conducted a retrospective cohort study using data from the UK

Shot loading platform analysis

International Nuclear Information System (INIS)

Norman, B.F.

1994-01-01

This document provides the wind/seismic analysis and evaluation for the shot loading platform. Hand calculations were used for the analysis. AISC and UBC load factors were used in this evaluation. The results show that the actual loads are under the allowable loads and all requirements are met

Spool assembly support analysis

International Nuclear Information System (INIS)

Norman, B.F.

1994-01-01

This document provides the wind/seismic analysis and evaluation for the pump pit spool assemblies. Hand calculations were used for the analysis. UBC, AISC, and load factors were used in this evaluation. The results show that the actual loads are under the allowable loads and all requirements are met

Book Review: The Social Life of Stories: Narrative and Knowledge in ...

African Journals Online (AJOL)

Cruikshank, Julie. 1998. The Social Life of Stories: Narrative and Knowledge in the Yukon Territory. Columbia: UBC Press. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · Creative Commons License This work is licensed under a Creative Commons ...

SUMO regulates p21Cip1 intracellular distribution and with p21Cip1 facilitates multiprotein complex formation in the nucleolus upon DNA damage.

Science.gov (United States)

Brun, Sonia; Abella, Neus; Berciano, Maria T; Tapia, Olga; Jaumot, Montserrat; Freire, Raimundo; Lafarga, Miguel; Agell, Neus

2017-01-01

We previously showed that p21Cip1 transits through the nucleolus on its way from the nucleus to the cytoplasm and that DNA damage inhibits this transit and induces the formation of p21Cip1-containing intranucleolar bodies (INoBs). Here, we demonstrate that these INoBs also contain SUMO-1 and UBC9, the E2 SUMO-conjugating enzyme. Furthermore, whereas wild type SUMO-1 localized in INoBs, a SUMO-1 mutant, which is unable to conjugate with proteins, does not, suggesting the presence of SUMOylated proteins at INoBs. Moreover, depletion of the SUMO-conjugating enzyme UBC9 or the sumo hydrolase SENP2 changed p21Cip1 intracellular distribution. In addition to SUMO-1 and p21Cip1, cell cycle regulators and DNA damage checkpoint proteins, including Cdk2, Cyclin E, PCNA, p53 and Mdm2, and PML were also detected in INoBs. Importantly, depletion of UBC9 or p21Cip1 impacted INoB biogenesis and the nucleolar accumulation of the cell cycle regulators and DNA damage checkpoint proteins following DNA damage. The impact of p21Cip1 and SUMO-1 on the accumulation of proteins in INoBs extends also to CRM1, a nuclear exportin that is also important for protein translocation from the cytoplasm to the nucleolus. Thus, SUMO and p21Cip1 regulate the transit of proteins through the nucleolus, and that disruption of nucleolar export by DNA damage induces SUMO and p21Cip1 to act as hub proteins to form a multiprotein complex in the nucleolus.

Tariff structures for the transport of electricity

International Nuclear Information System (INIS)

Frenken, R.M.L.; Van de Water, C.J.

1995-01-01

Some possible tariff structures for electricity transport are discussed. First, the costs associated with the transport of electricity are explained. The fixed and variable costs of a transport are illustrated with some examples. Furthermore, the most common tariff structures (contract path, megawatt mile, postage stamp) and negotiated Third Party Access are discussed. Finally, the way the tariff structures reflect the costs of electricity transport are reviewed. 3 figs., 1 tab., 7 refs

Advertising postcards in the collections of the National Museum of the History of Moldova (late 19th c. - the 1st half of the 20th c.

OpenAIRE

Ana Griţco

2017-01-01

The subject of the paper is advertising postcards, discovered during the research of the museum collection of postcards. Performed in the style of their time, they reflect changes in both production and society. Unlike postage stamps and envelopes, the postcard is more convenient as a carrier of information, including advertising. The first classic promotional postcards appeared in Europe in the late 1870s, initially they presented advertising of hotels and restaurants. In Russia, inclu...

ONR Tokyo Scientific Bulletin. Volume 5, Number 1, January-March 1980,

Science.gov (United States)

1980-03-01

postage stamps and a children’s poster contest, for which SCOPE provided prize money. SCOPE is now organizing a seminar on ecotoxicological problems in...the southwest coast is near the most important site for aquaculture. 4. Studies of the pollution of the shellfish cultivation areas of the west coast. 5... Ecotoxicological Problems in the Taipei, Taiwan Dr. Jong-Chin Su, Institute of Zoology lndoPacific Region Academia Sinica, Taipei 115 April 13-17 International

Defense AT&L. Volume 42, Number 3, May-June 2013

Science.gov (United States)

2013-06-01

dau.mil or by phone to 703-805-2892 or DSN 655-2892. Subscribe/unsubscribe/change of address: Fill out, sign, and mail the postage-free self ...database , which became the authoritative source for tracking status and reporting to the three-star NTM-A/CSTC-A com- mander, and also provided...intrinsic values, such as meaningful work, experience greater happiness than those who esteem extrinsic values like wealth, even when the differences in

Genetic diversity among endangered rare Dalbergia ...

African Journals Online (AJOL)

Genetic diversity among endangered rare Dalbergia cochinchinensis (Fabaceae) genotypes in Vietnam revealed by random amplified polymorphic DNA (RAPD) ... The number of amplified fragments varied from 1 (OPR15, OPB05, RA142, OPR08, UBC348, OPE14 and OPO04) to 8 (OPP19) and their sizes ranged from 250 ...

Use of Research-Based Instructional Strategies: How to Avoid Faculty Quitting

Science.gov (United States)

Wieman, Carl; Deslauriers, Louis; Gilley, Brett

2013-01-01

We have examined the teaching practices of faculty members who adopted research-based instructional strategies (RBIS) as part of the Carl Wieman Science Education Initiative (CWSEI) at the University of British Columbia (UBC). Of the 70 that adopted such strategies with the support of the CWSEI program, only one subsequently stopped using these…

Vickrey Auctions in Practice: From Nineteenth-Century Philately to Twenty-First-Century E-Commerce

OpenAIRE

David Lucking-Reiley

2000-01-01

William Vickrey (1961) proposed an auction mechanism in which bidders submit sealed bids, and the highest bidder wins the good in return for payment of the second-highest bid amount. For decades, economists have credited Vickrey with inventing this auction format, and have believed that the Vickrey auction is rarely used in practice. This paper presents evidence that Vickrey auctions have long been the predominant auction format for mail sales of collectible postage stamps. Stamp auctioneers ...

Modified Glasgow Prognostic Score is Associated With Risk of Recurrence in Bladder Cancer Patients After Radical Cystectomy

Science.gov (United States)

Ferro, Matteo; De Cobelli, Ottavio; Buonerba, Carlo; Di Lorenzo, Giuseppe; Capece, Marco; Bruzzese, Dario; Autorino, Riccardo; Bottero, Danilo; Cioffi, Antonio; Matei, Deliu Victor; Caraglia, Michele; Borghesi, Marco; De Berardinis, Ettore; Busetto, Gian Maria; Giovannone, Riccardo; Lucarelli, Giuseppe; Ditonno, Pasquale; Perdonà, Sisto; Bove, Pierluigi; Castaldo, Luigi; Hurle, Rodolfo; Musi, Gennaro; Brescia, Antonio; Olivieri, Michele; Cimmino, Amelia; Altieri, Vincenzo; Damiano, Rocco; Cantiello, Francesco; Serretta, Vincenzo; De Placido, Sabino; Mirone, Vincenzo; Sonpavde, Guru; Terracciano, Daniela

2015-01-01

Abstract Recently, many studies explored the role of inflammation parameters in the prognosis of urinary cancers, but the results were not consistent. The modified Glasgow Prognostic Score (mGPS), a systemic inflammation marker, is a prognostic marker in various types of cancers. The aim of the present study was to investigate the usefulness of the preoperative mGPS as predictor of recurrence-free (RFS), overall (OS), and cancer-specific (CSS) survivals in a large cohort of urothelial bladder cancer (UBC) patients. A total of 1037 patients with UBC were included in this study with a median follow-up of 22 months (range 3–60 months). An mGPS = 0 was observed in 646 patients (62.3%), mGPS = 1 in 297 patients (28.6 %), and mGPS = 2 in 94 patients (9.1%). In our study cohort, subjects with an mGPS equal to 2 had a significantly shorter median RFS compared with subjects with mGPS equal to 1 (16 vs 19 months, hazard ratio [HR] 1.54, 95% CI 1.31–1.81, P < 0.001) or with subjects with mGPS equal to 0 (16 vs 29 months, HR 2.38, 95% CI 1.86–3.05, P < 0.001). The association between mGPS and RFS was confirmed by weighted multivariate Cox model. Although in univariate analysis higher mGPS was associated with lower OS and CSS, this association disappeared in multivariate analysis where only the presence of lymph node-positive bladder cancer and T4 stage were predictors of worse prognosis for OS and CSS. In conclusion, the mGPS is an easily measured and inexpensive prognostic marker that was significantly associated with RFS in UBC patients. PMID:26496339

Modified Glasgow Prognostic Score is Associated With Risk of Recurrence in Bladder Cancer Patients After Radical Cystectomy: A Multicenter Experience.

Science.gov (United States)

Ferro, Matteo; De Cobelli, Ottavio; Buonerba, Carlo; Di Lorenzo, Giuseppe; Capece, Marco; Bruzzese, Dario; Autorino, Riccardo; Bottero, Danilo; Cioffi, Antonio; Matei, Deliu Victor; Caraglia, Michele; Borghesi, Marco; De Berardinis, Ettore; Busetto, Gian Maria; Giovannone, Riccardo; Lucarelli, Giuseppe; Ditonno, Pasquale; Perdonà, Sisto; Bove, Pierluigi; Castaldo, Luigi; Hurle, Rodolfo; Musi, Gennaro; Brescia, Antonio; Olivieri, Michele; Cimmino, Amelia; Altieri, Vincenzo; Damiano, Rocco; Cantiello, Francesco; Serretta, Vincenzo; De Placido, Sabino; Mirone, Vincenzo; Sonpavde, Guru; Terracciano, Daniela

2015-10-01

Recently, many studies explored the role of inflammation parameters in the prognosis of urinary cancers, but the results were not consistent. The modified Glasgow Prognostic Score (mGPS), a systemic inflammation marker, is a prognostic marker in various types of cancers. The aim of the present study was to investigate the usefulness of the preoperative mGPS as predictor of recurrence-free (RFS), overall (OS), and cancer-specific (CSS) survivals in a large cohort of urothelial bladder cancer (UBC) patients.A total of 1037 patients with UBC were included in this study with a median follow-up of 22 months (range 3-60 months). An mGPS = 0 was observed in 646 patients (62.3%), mGPS = 1 in 297 patients (28.6 %), and mGPS = 2 in 94 patients (9.1%).In our study cohort, subjects with an mGPS equal to 2 had a significantly shorter median RFS compared with subjects with mGPS equal to 1 (16 vs 19 months, hazard ratio [HR] 1.54, 95% CI 1.31-1.81, P < 0.001) or with subjects with mGPS equal to 0 (16 vs 29 months, HR 2.38, 95% CI 1.86-3.05, P < 0.001). The association between mGPS and RFS was confirmed by weighted multivariate Cox model. Although in univariate analysis higher mGPS was associated with lower OS and CSS, this association disappeared in multivariate analysis where only the presence of lymph node-positive bladder cancer and T4 stage were predictors of worse prognosis for OS and CSS.In conclusion, the mGPS is an easily measured and inexpensive prognostic marker that was significantly associated with RFS in UBC patients.

Identifying Stable Reference Genes for qRT-PCR Normalisation in Gene Expression Studies of Narrow-Leafed Lupin (Lupinus angustifolius L..

Directory of Open Access Journals (Sweden)

Candy M Taylor

Full Text Available Quantitative Reverse Transcription PCR (qRT-PCR is currently one of the most popular, high-throughput and sensitive technologies available for quantifying gene expression. Its accurate application depends heavily upon normalisation of gene-of-interest data with reference genes that are uniformly expressed under experimental conditions. The aim of this study was to provide the first validation of reference genes for Lupinus angustifolius (narrow-leafed lupin, a significant grain legume crop using a selection of seven genes previously trialed as reference genes for the model legume, Medicago truncatula. In a preliminary evaluation, the seven candidate reference genes were assessed on the basis of primer specificity for their respective targeted region, PCR amplification efficiency, and ability to discriminate between cDNA and gDNA. Following this assessment, expression of the three most promising candidates [Ubiquitin C (UBC, Helicase (HEL, and Polypyrimidine tract-binding protein (PTB] was evaluated using the NormFinder and RefFinder statistical algorithms in two narrow-leafed lupin lines, both with and without vernalisation treatment, and across seven organ types (cotyledons, stem, leaves, shoot apical meristem, flowers, pods and roots encompassing three developmental stages. UBC was consistently identified as the most stable candidate and has sufficiently uniform expression that it may be used as a sole reference gene under the experimental conditions tested here. However, as organ type and developmental stage were associated with greater variability in relative expression, it is recommended using UBC and HEL as a pair to achieve optimal normalisation. These results highlight the importance of rigorously assessing candidate reference genes for each species across a diverse range of organs and developmental stages. With emerging technologies, such as RNAseq, and the completion of valuable transcriptome data sets, it is possible that other

Identification of ISSR and RAPD markers linked to yield traits in bread wheat under normal and drought conditions

Directory of Open Access Journals (Sweden)

A.G.A. Khaled

2015-12-01

Full Text Available Genetic variability and identification of some molecular markers were studied in twenty promising lines of wheat using agronomic traits, ISSR (inter simple sequences repeats and RAPD (random amplified polymorphic DNA markers. Significant variation was evidenced in all agronomic traits. The lines proved to be superior to the check cultivar Sahel1 in yield and its component traits. Lines L2, L7 and L8 were the best in most yield component traits in both seasons. Moreover, Lines L2, L4, L5, L7 and L8 showed drought tolerance by which they displayed high performance in agronomic traits as well as a low drought susceptibility index. The percentage of polymorphism was 39.3% and 53.2% for ISSRs and RAPDs, respectively. UBC-881 belonged to penta-nucleotide repeat sequences (GGGTG that produced the highest level of polymorphism, while UBC-846 belonged to di-nucleotide repeat sequences (CA that produced the lowest level of polymorphism. Genetic similarities among wheat lines based on ISSR and RAPD markers ranged from 0.81 to 1.00 and from 0.86 to 0.98, respectively. There was a low average of PIC (polymorphism information content values which were 0.10 (ISSR and 0.15 (RAPD. The RAPD technique exhibited a higher marker index (MI = 0.69 compared to ISSR (MI = 0.43. There was insignificant correlation between ISSR and RAPD data (0.168, p > 0.05. There were two markers (UBC-881450bp and OPF-10540bp, on each of which two traits regressed significantly. The associated markers each explained a maximum regression of 18.92–34.95% of the total available variation for individual associated traits.

The Learning Exchange: A Shared Space for the University of British Columbia and Vancouver's Downtown Eastside Communities

Science.gov (United States)

Towle, Angela; Leahy, Kathleen

2016-01-01

The Learning Exchange was established by the University of British Columbia (UBC) in 1999 in Vancouver's Downtown Eastside (DTES). The challenge has been to create a shared space for learning exchanges between two very different communities: a research-intensive university and an inner city area most commonly depicted as a place of hopelessness.…

Aftershocks of Chile's Earthquake for an Ongoing, Large-Scale Experimental Evaluation

Science.gov (United States)

Moreno, Lorenzo; Trevino, Ernesto; Yoshikawa, Hirokazu; Mendive, Susana; Reyes, Joaquin; Godoy, Felipe; Del Rio, Francisca; Snow, Catherine; Leyva, Diana; Barata, Clara; Arbour, MaryCatherine; Rolla, Andrea

2011-01-01

Evaluation designs for social programs are developed assuming minimal or no disruption from external shocks, such as natural disasters. This is because extremely rare shocks may not make it worthwhile to account for them in the design. Among extreme shocks is the 2010 Chile earthquake. Un Buen Comienzo (UBC), an ongoing early childhood program in…

The predictive value of 53BP1 and BRCA1 mRNA expression in advanced non-small-cell lung cancer patients treated with first-line platinum-based chemotherapy

Science.gov (United States)

Bonanno, Laura; Costa, Carlota; Majem, Margarita; Sanchez, Jose Javier; Gimenez-Capitan, Ana; Rodriguez, Ignacio; Vergenegre, Alain; Massuti, Bartomeu; Favaretto, Adolfo; Rugge, Massimo; Pallares, Cinta; Taron, Miquel; Rosell, Rafael

2013-01-01

Platinum-based chemotherapy is the standard first-line treatment for non-oncogene-addicted non-small cell lung cancers (NSCLCs) and the analysis of multiple DNA repair genes could improve current models for predicting chemosensitivity. We investigated the potential predictive role of components of the 53BP1 pathway in conjunction with BRCA1. The mRNA expression of BRCA1, MDC1, CASPASE3, UBC13, RNF8, 53BP1, PIAS4, UBC9 and MMSET was analyzed by real-time PCR in 115 advanced NSCLC patients treated with first-line platinum-based chemotherapy. Patients expressing low levels of both BRCA1 and 53BP1 obtained a median progression-free survival of 10.3 months and overall survival of 19.3 months, while among those with low BRCA1 and high 53BP1 progression-free survival was 5.9 months (P <0.0001) and overall survival was 8.2 months (P=0.001). The expression of 53BP1 refines BRCA1-based predictive modeling to identify patients most likely to benefit from platinum-based chemotherapy. PMID:24197907

Incidence of human herpes virus-6 and human cytomegalovirus infections in donated bone marrow and umbilical cord blood hematopoietic stem cells

Directory of Open Access Journals (Sweden)

Behzad-Behbahani A

2008-01-01

Full Text Available This study examined the incidence of human herpes virus-6 (HHV-6 and human cytomegalovirus (HCMV infections that are potentially transmitted to haematopoietic stem cells (HSC transplant recipients via bone marrow (BM or umbilical cord blood (UCB. Bone marrow progenitor cells were collected from 30 allogenic BM donors. UCB HSC were collected from 34 subjects. The extracted DNA was then processed using nested polymerase chain reaction (nPCR technique. HCMV and HHV-6 serological status were determined by enzyme immunoassay (EIA. Nested PCR identified HCMV in 22 (73% of 30 samples of BM progenitor cells but in only eight (23.5% of 34 samples of UBC HSC ( P = 0.001. HHV-6 DNA was detected in 11 (36.6% of 30 BM progenitor cells and in only one (2.9% of 34 UBC cells ( P = 0.002. Both HHV-6 and HCMV infections were determined in nine (26.5% of 34 bone marrow samples. The results indicate that, the risk of HCMV and HHV-6 via BM progenitor cells is higher than transmission by UCB cells ( P= 0.04.

Stability of cell-free DNA from maternal plasma isolated following a single centrifugation step.

Science.gov (United States)

Barrett, Angela N; Thadani, Henna A; Laureano-Asibal, Cecille; Ponnusamy, Sukumar; Choolani, Mahesh

2014-12-01

Cell-free fetal DNA can be used for prenatal testing with no procedure-related risk to the fetus. However, yield of fetal DNA is low compared with maternal cell-free DNA fragments, resulting in technical challenges for some downstream applications. To maximize the fetal fraction, careful blood processing procedures are essential. We demonstrate that fetal fraction can be preserved using a single centrifugation step followed by postage of plasma to the laboratory for further processing. Digital PCR was used to quantify copies of total, maternal, and fetal DNA present in single-spun plasma at time points over a two-week period, compared with immediately processed double-spun plasma, with storage at room temperature, 4°C, and -80°C representing different postage scenarios. There was no significant change in total, maternal, or fetal DNA copy numbers when single-spun plasma samples were stored for up to 1 week at room temperature and 2 weeks at -80°C compared with plasma processed within 4 h. Following storage at 4°C no change in composition of cell-free DNA was observed. Single-spun plasma can be transported at room temperature if the journey is expected to take one week or less; shipping on dry ice is preferable for longer journeys. © 2014 John Wiley & Sons, Ltd.

Journal of EAEA, Vol. 18, 2001

African Journals Online (AJOL)

SERIES -. The UBC seismic regulations are generally based on the series of publication of the Structural. Engineers Ass6ciation of California (SEAOC) released regularly .... F; = 0.07 TV ~ 0.25V. (6). W and h are the weight at and the height from the base to a particuiar floor level. Story Shear and Story Overturning Moment.

Genetic and bibliographic information: UBE2N [GenLibi

Lifescience Database Archive (English)

Full Text Available UBE2N ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) human Skin Neoplasms ...(MeSH) Neoplasms (C04) > Neoplasms by Site (C04.588) > Skin Neoplasms (C04.588.805) Skin and Connective Tissue Diseases (C17) > Skin... Diseases (C17.800) > Skin Neoplasms (C17.800.882) 03A0584544 ...

CAGEd-oPOSSUM: motif enrichment analysis from CAGE-derived TSSs.

Science.gov (United States)

Arenillas, David J; Forrest, Alistair R R; Kawaji, Hideya; Lassmann, Timo; Wasserman, Wyeth W; Mathelier, Anthony

2016-09-15

With the emergence of large-scale Cap Analysis of Gene Expression (CAGE) datasets from individual labs and the FANTOM consortium, one can now analyze the cis-regulatory regions associated with gene transcription at an unprecedented level of refinement. By coupling transcription factor binding site (TFBS) enrichment analysis with CAGE-derived genomic regions, CAGEd-oPOSSUM can identify TFs that act as key regulators of genes involved in specific mammalian cell and tissue types. The webtool allows for the analysis of CAGE-derived transcription start sites (TSSs) either provided by the user or selected from ∼1300 mammalian samples from the FANTOM5 project with pre-computed TFBS predicted with JASPAR TF binding profiles. The tool helps power insights into the regulation of genes through the study of the specific usage of TSSs within specific cell types and/or under specific conditions. The CAGEd-oPOSUM web tool is implemented in Perl, MySQL and Apache and is available at http://cagedop.cmmt.ubc.ca/CAGEd_oPOSSUM CONTACTS: anthony.mathelier@ncmm.uio.no or wyeth@cmmt.ubc.ca Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press.

Active unicameral bone cysts in the upper limb are at greater risk of fracture.

Science.gov (United States)

Tey, Inn Kuang; Mahadev, Arjandas; Lim, Kevin Boon Leong; Lee, Eng Hin; Nathan, Saminathan Suresh

2009-08-01

To elucidate the natural history of unicameral bone cyst (UBC) and risk factors for pathological fracture. 14 males and 8 females (mean age, 9 years) diagnosed with UBC were reviewed. Cyst location, symptoms, and whether there was any fracture or surgery were recorded. Cyst parameters were measured on radiographs, and included (1) the cyst index, (2) the ratio of the widest cyst diameter to the growth plate diameter, and (3) the adjusted distance of the cyst border from the growth plate. There were 11 upper- and 11 lower-limb cysts. 13 patients had pathological fractures and 9 did not. 20 patients were treated conservatively with limb immobilisation; 2 underwent curettage and bone grafting (one resolved and one did not). Seven cysts resolved (5 had fractures and 2 did not). The risk of fracture was higher in the upper than lower limbs (100% vs 18%, pFractured cysts were larger than unfractured cysts (mean cyst index, 4.5 vs. 2.2, p=0.07). Active cysts were more likely to fracture. Conservative management had a 30% resolution rate. Surgery should be considered for large active cysts in the upper limbs in order to minimise the fracture risk.

Flow variation in Astore river under assumed glaciated extents due to climate change

International Nuclear Information System (INIS)

Naeem, U.A.

2012-01-01

Various researchers have concluded the existence of many glaciers in doubt by the end of this century due to global warming phenomenon. The great Himalayas are also under such stress. The recent acceleration in rainfall pattern resulted the ever worst destruction due to floods (2010) in Pakistan. Many Watershed models, capable of incorporating the climate change scenarios have been developed in this regard to predict the future flows. But it is not easy to select the most appropriate model for a particular watershed to get the best results. In this regard. the paper is an effort where the analysis has been made on Astore Watershed, Pakistan, by considering the model results obtained from the three watershed models i.e. UBC Watershed Model, HBV-Met and HBV-PRECIS. The results are obtained by considering different glaciated extents of 100%, 50% and 0% under future climate scenario (SRES A2), simulated by PRECIS Regional Climate Model for (2071-2100). For changed climate scenario, discharges for the simulations at 100% reduction in glaciated area were -72%, -15% and-46% for HBV-Met, HBV-PRECIS and UBC Watershed Model respectively. (author)

BRISK--research-oriented storage kit for biology-related data.

Science.gov (United States)

Tan, Alan; Tripp, Ben; Daley, Denise

2011-09-01

In genetic science, large-scale international research collaborations represent a growing trend. These collaborations have demanding and challenging database, storage, retrieval and communication needs. These studies typically involve demographic and clinical data, in addition to the results from numerous genomic studies (omics studies) such as gene expression, eQTL, genome-wide association and methylation studies, which present numerous challenges, thus the need for data integration platforms that can handle these complex data structures. Inefficient methods of data transfer and access control still plague research collaboration. As science becomes more and more collaborative in nature, the need for a system that adequately manages data sharing becomes paramount. Biology-Related Information Storage Kit (BRISK) is a package of several web-based data management tools that provide a cohesive data integration and management platform. It was specifically designed to provide the architecture necessary to promote collaboration and expedite data sharing between scientists. The software, documentation, Java source code and demo are available at http://genapha.icapture.ubc.ca/brisk/index.jsp. BRISK was developed in Java, and tested on an Apache Tomcat 6 server with a MySQL database. denise.daley@hli.ubc.ca.

The 1994 Forum on Appropriate Criteria and Methods for Seismic Design of Nuclear Piping

International Nuclear Information System (INIS)

Slagis, G.C.

1995-01-01

A record of the 1994 Forum on Appropriate Criteria and Methods for Seismic Design of Nuclear Piping is provided. The focus of the forum was the design-by-rule method for seismic design of piping. Issues such as acceptance criteria, ductility considerations, demonstration of margin, training, verification and costs were discussed. The use of earthquake experience data, including the recent Northridge earthquake, to justify a design-by-rule method was explored. The majority of the participants felt there are not significant advantages to developing a design-by-rule approach for new plant design. One major disadvantage was considered by many to be training. Extensive training will be required to properly implement a design-by-rule approach. Verification of designs was considered by the majority to be equally important for design-by-rule as for design-by-analysis. If a design-by-rule method is going to be effective, the method will have to be based on ductility considerations (UBC approach). A significant issue will be justification of seismic margins with liberal rules. The UBC approach is being questioned by some because of the recent structural cracking problems in the Northridge earthquake

Continuous decompression with intramedullary nailing for the treatment of unicameral bone cysts.

Science.gov (United States)

Masquijo, Julio Javier; Baroni, Eduardo; Miscione, Horacio

2008-08-01

To evaluate the efficacy of decompression of unicameral bone cysts (UBCs) of the long bones with intramedullary nailing and to compare responses to treatment according to location. We evaluated 48 consecutive patients treated between January 1988 and June 2000. Mean age was 10.3 years. Mean follow-up was 9.8 years. Evaluation was performed according to the radiographic criteria of Capanna. UBCs were located in the proximal humerus (n = 24), humeral shaft (n = 2), proximal femur (n = 19), distal tibia (n = 2) and fibula (n = 1). A total of 62.5% presented a pathological fracture. Successful results were observed in 89.5% (26 total healing, 17 healing with residual radiolucent areas), and there were four recurrences and, in one case, no response to treatment. There was more healing in the humerus than in the femur (92.3% versus 84.2%), and more tendency to restitution ad integrum, although the difference was not statistically significant (P = 0.1499). Intramedullary nailing is a minimally invasive method, which permits early stability and decompresses the cyst allowing healing. Significant differences were not observed among results from different locations.

CONSERVATIVE TREATMENT VERSUS STEROID INJECTIONS IN THE MANAGEMENT OF UNICAMERAL BONE CYST

Directory of Open Access Journals (Sweden)

Rajeev Kumar Roy

2017-05-01

Full Text Available BACKGROUND Unicameral Bone Cyst (UBC is described as a central metaphyseal cystic lesion of the bone with serum fluid content. Diagnosis is typically based on x-ray imaging features, age, localisation at proximal humerus and femur and the absence of symptoms until pathological fracture development. MATERIALS AND METHODS Eighteen patients with unicameral bone cysts were reviewed in Nalanda Medical College Hospital. Nine patients received serial steroid injections and the other nine patients were treated conservatively following fractures. In the steroid injection group, six cases were in the proximal femur and three in the proximal humerus. RESULTS The nine steroid injection patients showed radiological evidence of cyst healing within four months of treatment. Subsequently, all 9 patients showed a satisfactory radiological outcome after a year and complete resolution after 2 years. In the conservative group, all 9 cases were in the proximal humerus. Persistent cystic lesions were observed in all 9 patients and 2 was complicated by another fracture within 6 months. CONCLUSION Fractures through UBC in the upper extremity can be treated nonoperatively. However, steroid injection is an effective option to hasten healing and should be considered as a primary treatment of unicameral bone cyst.

Simple Bone Cyst of Metacarpal: Rare Lesion with Unique Treatment

Science.gov (United States)

Patwardhan, Sandeep; Shah, Kunal; Shyam, Ashok; Sancheti, Parag

2014-01-01

Introduction: Simple bone cyst or unicameral bone cyst (UBC) are benign cystic lesions commonly found in femur and humerus. However hand is a very rare site of occurrence. Treatment described for UBC of hand commonly involves curettage and bone grafting. Case Report: A 7 year old right hand dominant girl presented to us with chief complaints of pain and swelling in right 4th metacarpal since 2 month. On imaging, plain radiographs of right hand showed expansile lytic lesion on Metaphyseal-diaphyseal region of 4th metacarpal with pathological fracture. MRI showed cystic lesions with internal loculations and fluid-fluid levels (Fig 2). There was minimal soft tissue extension. We performed aspiration which showed serosanguinous fluid with haemorrhagic tinge. With the diagnosis of unicameral bone cyst in mind we performed and closed intramedullary nail with k wire. The cyst healed up completely within 2 months. There was no recurrence at 18 month follow up. Conclusion: In conclusion simple bone cyst is very rare in metacarpal bone. However it should be considered as important differential since it warrants simple treatment and extensive procedures should be avoided. PMID:27298987

Educational leadership during a decade of medical curricular innovation and renewal.

Science.gov (United States)

Pinder, Karen E; Shabbits, Jennifer A

2018-03-05

The past decade has witnessed successful expansion, distribution and curricular renewal at the University of British Columbia (UBC) medical school. The expansion and distribution of the medical program doubled enrollment and established the first North American medical school training students across multiple geographical locations. The more recent competency-based curriculum renewal demonstrates sustained innovation within UBC medicine. This paper describes that a significant contributor to these successes has been a team of teaching faculty whose exclusive roles have been providing curricular support. Over the past decade, this group has evolved into a vital component of the day-to-day operations and performance of the distributed medical curriculum; they now provide continuity in leadership and innovation across multiple educational facets of the program. This paper reports on the evolution and significance of these faculty members. The descriptions establish the success of an investment in teaching faculty and underscore the importance of engaging faculty whose primary commitments are to teaching, educational pedagogy, and student support. This efficacious model of supporting and advancing a complex distributed medical program over more than a decade of pivotal change will be of interest to faculties and programs that are contemplating or navigating similar pursuits.

Effect of long-term aging on microstructural stabilization and mechanical properties of 20Cr32Ni1Nb steel

Energy Technology Data Exchange (ETDEWEB)

Guo, Xiaofeng; Jia, Xiankai [School of Mechanical and Power Engineering, Nanjing Tech University, Nanjing, Jiangsu 211816 (China); Gong, Jianming, E-mail: gongjm@njtech.edu.cn [School of Mechanical and Power Engineering, Nanjing Tech University, Nanjing, Jiangsu 211816 (China); Key Lab of Design and Manufacture of Extreme Pressure Equipment, Jiangsu Province (China); Geng, Luyang; Tang, Jianqun; Jiang, Yong [School of Mechanical and Power Engineering, Nanjing Tech University, Nanjing, Jiangsu 211816 (China); Key Lab of Design and Manufacture of Extreme Pressure Equipment, Jiangsu Province (China); Ni, Yingying; Yang, Xinyu [School of Mechanical and Power Engineering, Nanjing Tech University, Nanjing, Jiangsu 211816 (China)

2017-04-06

The centrifugally cast 20Cr32Ni1Nb stainless steel aged at 950 ℃ from 200 h up to 5000 h was investigated on the mechanical properties and microstructural evolution using post-aged tensile tests, post-aged Charpy impact tests, Optical microscopy (OM) observations, and field emission-scanning electron microscopy (FE-SEM) examinations. Experimental results indicate that the as-cast microstructure of the steel typically consists of a supersaturated solid solution of austenite matrix with a network of interdendritic primary carbides (NbC and M{sub 23}C{sub 6}). During aging process, the growth and coarsening of NbC carbides and M{sub 23}C{sub 6} carbides as well as the transformation of NbC carbide into G phase take place. Meanwhile, the transformation of NbC into G phase releases C into the matrix during aging exposure. This released C tends to combine with Cr, and forms M{sub 23}C{sub 6} at the dendrite boundaries. Compared with a continuous reduction of the elongation in the whole aging period, the strength parameters (σ{sub ult} and σ{sub ys}) exhibit an initial increase followed by a continuous decrease with the aging time prolonged from 1000 h to 5000 h. Additionally, the variation of Charpy impact absorbed energy is relatively complex during aging process. The microstructural evolution during long-term aging process is consistent with the variation of mechanical properties.

Mitochondrial control region and GSTP1 polymorphism associated ...

African Journals Online (AJOL)

These two heteroplasmic mutations were found at positions 11qG3037G/A and 11qC3038C/A in patient, father, mother, brother and son, but not in the sister and wife samples in family 2. The GSTP1, 105Ile >Val is most susceptible to inherited UBC risk for these ethnic families. The samples from families 1 and 2, including ...

ELROI Extremely Low Resource Optical Identifier. A license plate for your satellite, and more.

Energy Technology Data Exchange (ETDEWEB)

Palmer, David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-09-18

ELROI (Extremely Low Resource Optical Identifier) is a license plate for your satellite; a small tag that flashes an optical identification code that can be read by a small telescope on the ground. The final version of the tag will be the size of a thick postage stamp and fully autonomous: you can attach it to everything that goes into space, including small cubesats and inert debris like rocket stages, and it will keep blinking even after the satellite is shut down, reliably identifying the object from launch until re-entry.

Ancillary reactive power service allocation cost in deregulated markets: a methodology

International Nuclear Information System (INIS)

Hernandez, J. Horacio Tovar; Jimenez-Guzman, Miguel; Gutierrez-Alcaraz, Guillermo

2005-01-01

This paper presents a methodology to allocate reactive power costs in deregulated markets. Reactive power supply service is decomposed into voltage regulation and reactive power spinning reserve. The proposed methodology is based on sensitivities and the postage-stamp method in order to allocate the total costs service among all participants. With the purpose of achieving this goal, the system operator identifies voltage support and/or reactive power requirements, and looks out for suitable providers. One case study is presented here to illustrate the methodology over a simplified southeastern Mexican grid. (Author)

Proteasome, but not autophagy, disruption results in severe eye and wing dysmorphia: a subunit- and regulator-dependent process in Drosophila.

Science.gov (United States)

Velentzas, Panagiotis D; Velentzas, Athanassios D; Pantazi, Asimina D; Mpakou, Vassiliki E; Zervas, Christos G; Papassideri, Issidora S; Stravopodis, Dimitrios J

2013-01-01

Proteasome-dependent and autophagy-mediated degradation of eukaryotic cellular proteins represent the two major proteostatic mechanisms that are critically implicated in a number of signaling pathways and cellular processes. Deregulation of functions engaged in protein elimination frequently leads to development of morbid states and diseases. In this context, and through the utilization of GAL4/UAS genetic tool, we herein examined the in vivo contribution of proteasome and autophagy systems in Drosophila eye and wing morphogenesis. By exploiting the ability of GAL4-ninaE. GMR and P{GawB}Bx(MS1096) genetic drivers to be strongly and preferentially expressed in the eye and wing discs, respectively, we proved that proteasomal integrity and ubiquitination proficiency essentially control fly's eye and wing development. Indeed, subunit- and regulator-specific patterns of severe organ dysmorphia were obtained after the RNAi-induced downregulation of critical proteasome components (Rpn1, Rpn2, α5, β5 and β6) or distinct protein-ubiquitin conjugators (UbcD6, but not UbcD1 and UbcD4). Proteasome deficient eyes presented with either rough phenotypes or strongly dysmorphic shapes, while transgenic mutant wings were severely folded and carried blistered structures together with loss of vein differentiation. Moreover, transgenic fly eyes overexpressing the UBP2-yeast deubiquitinase enzyme were characterized by an eyeless-like phenotype. Therefore, the proteasome/ubiquitin proteolytic activities are undoubtedly required for the normal course of eye and wing development. In contrast, the RNAi-mediated downregulation of critical Atg (1, 4, 7, 9 and 18) autophagic proteins revealed their non-essential, or redundant, functional roles in Drosophila eye and wing formation under physiological growth conditions, since their reduced expression levels could only marginally disturb wing's, but not eye's, morphogenetic organization and architecture. However, Atg9 proved indispensable for

VARIABILIDADE GENÉTICA EM GENÓTIPOS DE TECA (Tectona grandis Linn. F. BASEADA EM MARCADORES MOLECULARES ISSR E CARACTERES MORFOLÓGICOS

Directory of Open Access Journals (Sweden)

Luana Della Giustina

2017-01-01

Full Text Available The aim of this work was to evaluate 50 genotypes of teak based on molecular markers ISSR. Among the genotypes studied, 12 were candidate trees, 36 were surrounding the candidates and 02 trees were considered superior based on the phenotype, according to the assessment of the producers. These genotypes were propagated through seminal via and are 10 to 12 years old in the field. For this study, young and expanded leaves of each genotype were collected in the field. Total DNA was extracted and the amplifications were made by PCR with 12 primers ISSR, previously selected. The samples were applied in agarose gel 1.5% and subjected to electrophoresis running. For visualization of the amplified products, the gel was stained with ethidium bromide and photodocumented in UV transilluminator. Data were analyzed using the program POPGENE 1.31 and diversity parameters were estimated. Dissimilarity analyzes were estimated by Jaccard Index and the dendrogram construction was made based on the UPGMA method. At the same time, the phenotypic analysis of morphological data regarding the candidate trees was conducted by multicategorical analysis. All analyzes were performed with the assistance of Genes Program. The 12 primers amplified 56 fragments. For polymorphic information content the indicators UBC 841, UBC 857 and UBC 807 provided higher values, 0.329, 0.327 and 0.303, respectively. The genetic diversity of the candidate trees (H = 0.1601 and I = 0.2301 was similar to the neighbors (H = 0.1507, I = 0.2178. The dendrogram generated by the UPGMA method formed 14 groups, while the grouping based on Tocher, 15 groups were formed. For the phenotypic analysis, the variable that most contributes to the diversity was the formation of catana. These results reflect that there is variability among the genotypes. It is possible to note, therefore, the need to expand the variability of the material, by introducing genotypes of different origins and genetically unrelated.

Proteasome, but not autophagy, disruption results in severe eye and wing dysmorphia: a subunit- and regulator-dependent process in Drosophila.

Directory of Open Access Journals (Sweden)

Panagiotis D Velentzas

Full Text Available Proteasome-dependent and autophagy-mediated degradation of eukaryotic cellular proteins represent the two major proteostatic mechanisms that are critically implicated in a number of signaling pathways and cellular processes. Deregulation of functions engaged in protein elimination frequently leads to development of morbid states and diseases. In this context, and through the utilization of GAL4/UAS genetic tool, we herein examined the in vivo contribution of proteasome and autophagy systems in Drosophila eye and wing morphogenesis. By exploiting the ability of GAL4-ninaE. GMR and P{GawB}Bx(MS1096 genetic drivers to be strongly and preferentially expressed in the eye and wing discs, respectively, we proved that proteasomal integrity and ubiquitination proficiency essentially control fly's eye and wing development. Indeed, subunit- and regulator-specific patterns of severe organ dysmorphia were obtained after the RNAi-induced downregulation of critical proteasome components (Rpn1, Rpn2, α5, β5 and β6 or distinct protein-ubiquitin conjugators (UbcD6, but not UbcD1 and UbcD4. Proteasome deficient eyes presented with either rough phenotypes or strongly dysmorphic shapes, while transgenic mutant wings were severely folded and carried blistered structures together with loss of vein differentiation. Moreover, transgenic fly eyes overexpressing the UBP2-yeast deubiquitinase enzyme were characterized by an eyeless-like phenotype. Therefore, the proteasome/ubiquitin proteolytic activities are undoubtedly required for the normal course of eye and wing development. In contrast, the RNAi-mediated downregulation of critical Atg (1, 4, 7, 9 and 18 autophagic proteins revealed their non-essential, or redundant, functional roles in Drosophila eye and wing formation under physiological growth conditions, since their reduced expression levels could only marginally disturb wing's, but not eye's, morphogenetic organization and architecture. However, Atg9 proved

WD40 domain of Apc1 is critical for the coactivator-induced allosteric transition that stimulates APC/C catalytic activity.

Science.gov (United States)

Li, Qiuhong; Chang, Leifu; Aibara, Shintaro; Yang, Jing; Zhang, Ziguo; Barford, David

2016-09-20

The anaphase-promoting complex/cyclosome (APC/C) is a large multimeric cullin-RING E3 ubiquitin ligase that orchestrates cell-cycle progression by targeting cell-cycle regulatory proteins for destruction via the ubiquitin proteasome system. The APC/C assembly comprises two scaffolding subcomplexes: the platform and the TPR lobe that together coordinate the juxtaposition of the catalytic and substrate-recognition modules. The platform comprises APC/C subunits Apc1, Apc4, Apc5, and Apc15. Although the role of Apc1 as an APC/C scaffolding subunit has been characterized, its specific functions in contributing toward APC/C catalytic activity are not fully understood. Here, we report the crystal structure of the N-terminal domain of human Apc1 (Apc1N) determined at 2.2-Å resolution and provide an atomic-resolution description of the architecture of its WD40 (WD40 repeat) domain (Apc1(WD40)). To understand how Apc1(WD40) contributes to APC/C activity, a mutant form of the APC/C with Apc1(WD40) deleted was generated and evaluated biochemically and structurally. We found that the deletion of Apc1(WD40) abolished the UbcH10-dependent ubiquitination of APC/C substrates without impairing the Ube2S-dependent ubiquitin chain elongation activity. A cryo-EM structure of an APC/C-Cdh1 complex with Apc1(WD40) deleted showed that the mutant APC/C is locked into an inactive conformation in which the UbcH10-binding site of the catalytic module is inaccessible. Additionally, an EM density for Apc15 is not visible. Our data show that Apc1(WD40) is required to mediate the coactivator-induced conformational change of the APC/C that is responsible for stimulating APC/C catalytic activity by promoting UbcH10 binding. In contrast, Ube2S activity toward APC/C substrates is not dependent on the initiation-competent conformation of the APC/C.

Safety and Efficacy of Durvalumab (MEDI4736), an Anti–Programmed Cell Death Ligand-1 Immune Checkpoint Inhibitor, in Patients With Advanced Urothelial Bladder Cancer

Science.gov (United States)

Massard, Christophe; Gordon, Michael S.; Sharma, Sunil; Rafii, Saeed; Wainberg, Zev A.; Luke, Jason; Curiel, Tyler J.; Colon-Otero, Gerardo; Hamid, Omid; Sanborn, Rachel E.; O’Donnell, Peter H.; Drakaki, Alexandra; Tan, Winston; Kurland, John F.; Rebelatto, Marlon C.; Jin, Xiaoping; Blake-Haskins, John A.; Gupta, Ashok

2016-01-01

Purpose To investigate the safety and efficacy of durvalumab, a human monoclonal antibody that binds programmed cell death ligand-1 (PD-L1), and the role of PD-L1 expression on clinical response in patients with advanced urothelial bladder cancer (UBC). Methods A phase 1/2 multicenter, open-label study is being conducted in patients with inoperable or metastatic solid tumors. We report here the results from the UBC expansion cohort. Durvalumab (MEDI4736, 10 mg/kg every 2 weeks) was administered intravenously for up to 12 months. The primary end point was safety, and objective response rate (ORR, confirmed) was a key secondary end point. An exploratory analysis of pretreatment tumor biopsies led to defining PD-L1–positive as ≥ 25% of tumor cells or tumor-infiltrating immune cells expressing membrane PD-L1. Results A total of 61 patients (40 PD-L1–positive, 21 PD-L1–negative), 93.4% of whom received one or more prior therapies for advanced disease, were treated (median duration of follow-up, 4.3 months). The most common treatment-related adverse events (AEs) of any grade were fatigue (13.1%), diarrhea (9.8%), and decreased appetite (8.2%). Grade 3 treatment-related AEs occurred in three patients (4.9%); there were no treatment-related grade 4 or 5 AEs. One treatment-related AE (acute kidney injury) resulted in treatment discontinuation. The ORR was 31.0% (95% CI, 17.6 to 47.1) in 42 response-evaluable patients, 46.4% (95% CI, 27.5 to 66.1) in the PD-L1–positive subgroup, and 0% (95% CI, 0.0 to 23.2) in the PD-L1–negative subgroup. Responses are ongoing in 12 of 13 responding patients, with median duration of response not yet reached (range, 4.1+ to 49.3+ weeks). Conclusion Durvalumab demonstrated a manageable safety profile and evidence of meaningful clinical activity in PD-L1–positive patients with UBC, many of whom were heavily pretreated. PMID:27269937

Additional Analysis of the ESTCP Discrimination Study Data at Camp Sibert, Alabama. Project 200504: Practical Discrimination Strategies for Application to Live Sites

Science.gov (United States)

2008-10-20

Dr. Stephen Billings Dr. Leonard Pasion Sky Research, Inc) Laurens Beran UBC-GIF Approved for public release; distribution...Sites 5. FUNDING NUMBERS Contract # W912HQ-05-C-0018 6. AUTHOR(S) Dr. Stephen Billings, Dr. Leonard Pasion (Sky Research, Inc.) Laurens Beran...representative of the test datasets. ESTCP MM-0504: Additional Analysis of Camp Sibert Data Sky Research Inc October 2008 References [1] L.R. Pasion , N

75 FR 22725 - Express Mail Next Day Delivery Postage Refund Amendment

Science.gov (United States)

2010-04-30

... Headquarters, and the delay was caused by governmental action beyond the control of USPS or air carriers; war... factors outside the control of USPS; or acts of God. g. The shipment contained live animals and was... governmental action beyond the control of USPS or air carriers; war, insurrection, or civil disturbance; delay...

75 FR 36537 - Express Mail Next Day Delivery Postage Refund Amendment

Science.gov (United States)

2010-06-28

... delay was caused by governmental action beyond the control of USPS or air carriers; war, insurrection... the control of USPS; or acts of God. g. The shipment contained live animals and was delivered or... governmental action beyond the control of USPS or air carriers; war, insurrection, or civil disturbance; delay...

Between Postage Stamps and Digitalization: The Changing Roles of Educational Broadcasting.

Science.gov (United States)

Fleisher, Frederic

1995-01-01

Provides a broadcasting practitioner's perspective of educational broadcasting in Europe, and how, with data compression, the emergence of more television channels can affect the educationalist and public service broadcasting. Discusses technological development, equal access to education, cultural maintenance, advertising, future outlooks, and…

The Embodied Life Course: Post-ageism or the Renaturalization of Gender?

Directory of Open Access Journals (Sweden)

Barbara L. Marshall

2012-10-01

Full Text Available This paper argues that the sociology of the body must take more account of embodiment as an ongoing process that occurs over the life course, and it suggests that a critical perspective is required that emphasizes the material processes of embodiment by which physical changes in age and time are culturally mediated. We take the concept of the embodied life course as a starting point for probing the temporal aspects of bodily life, for exploring the ways in which biological, biographical and socio-historical time intersect, and for grasping the ways that temporality is materialized and mobilized through bodies. Taking the example of the biomedical reconfiguration of sexual function across the life course, we demonstrate how aging bodies have been opened to new forms of intervention that situate them within new understandings of nature and culture. Conclusions reflect on the contradictions of ‘post-ageist’ discourses and practices that promise to liberate bodies from chronological age, while simultaneously re-naturalizing gender in sexed bodies.

Postage for the messenger: Designating routes for Nuclear mRNA Export

Science.gov (United States)

Natalizio, Barbara J.; Wente, Susan R.

2013-01-01

Transcription of messenger(m) RNA occurs in the nucleus, making the translocation of mRNA across the nuclear envelope (NE) boundary a critical determinant of proper gene expression and cell survival. A major mRNA export route occurs via the NXF1-dependent pathway through the nuclear pore complexes (NPCs) embedded in the NE. However, recent findings have discovered new evidence supporting the existence of multiple mechanisms for crossing the NE, including both NPC-mediated and NE budding-mediated pathways. An analysis of the trans-acting factors and cis components that define these pathways reveals shared elements as well as mechanistic differences. We review here the current understanding of the mechanisms that characterize each pathway and highlight the determinants that influence mRNA transport fate. PMID:23583578

Importance of Electricity Transport Pricing in Liberalised Energy Markets

International Nuclear Information System (INIS)

Wohlgemuth, N.

2001-01-01

Electricity has traditionally been supplied by vertically integrated companies providing generation, transmission and distribution services. Consumers have purchased a bundled commodity - delivered electricity - and there has been no need to price the components individually. This is no longer the case in competitive and unbundled electricity markets. One of the outstanding issues in the restructuring of the electricity markets is the way in which transmission costs are translated into tariffs. The efforts to create a single European electricity market are difficult to reconcile due to different national network pricing approaches. The European Commission's draft regulation on conditions for access to the network for cross-border exchanges of electricity sets general principles for the pricing of international electricity exchanges. Nodal pricing provides incentives for an efficient use of generation and transmission assets. Experience shows that nodal pricing is workable, and its use may be expected to increase progressively. Postage stamp pricing does not generally provide adequate incentives for efficiency. However, inefficiencies may be small under certain conditions, and postage stamp pricing has the advantage of being relatively transparent and easy to implement. This paper presents an overview of objectives related to an effective design of transmission pricing approaches, of transmission pricing models and presents recent developments in Europe in this respect. Due to the great number of institutional designs of electricity market organisations, it will be difficult to design and implement a model of cross-border transmission pricing that results in a high degree of non-discriminatory international competition in electricity markets, a key objective of the Electricity Directive.(author)

Sumoylation of the net inhibitory domain (NID) is stimulated by PIAS1 and has a negative effect on the transcriptional activity of Net.

Science.gov (United States)

Wasylyk, Christine; Criqui-Filipe, Paola; Wasylyk, Bohdan

2005-01-27

Net (Elk-3, Sap-2, Erp) and the related ternary complex factors Elk-1 and Sap-1 are effectors of multiple signalling pathways at the transcriptional level and play a key role in the dynamic regulation of gene expression. Net is distinct from Elk-1 and Sap-1, in that it is a strong repressor of transcription that is converted to an activator by the Ras/Erk signalling pathway. Two autonomous repression domains of Net, the NID and the CID, mediate repression. We have previously shown that the co-repressor CtBP is implicated in repression by the CID. In this report we show that repression by the NID involves a different pathway, sumoylation by Ubc9 and PIAS1. PIAS1 interacts with the NID in the two-hybrid assay and in vitro. Ubc9 and PIAS1 stimulate sumoylation in vivo of lysine 162 in the NID. Sumoylation of lysine 162 increases repression by Net and decreases the positive activity of Net. These results increase our understanding of how one of the ternary complex factors regulates transcription, and contribute to the understanding of how different domains of a transcription factor participate in the complexity of regulation of gene expression.

Validation of Suitable Reference Genes for RT-qPCR Data in Achyranthes bidentata Blume under Different Experimental Conditions

Directory of Open Access Journals (Sweden)

Jinting Li

2017-05-01

Full Text Available Real-time quantitative polymerase chain reaction (RT-qPCR is a sensitive technique for gene expression studies. However, choosing the appropriate reference gene is essential to obtain reliable results for RT-qPCR assays. In the present work, the expression of eight candidate reference genes, EF1-α (elongation factor 1-α, GAPDH (glyceraldehyde 3-phosphate dehydrogenase, UBC (ubiquitin-conjugating enzyme, UBQ (polyubiquitin, ACT (actin, β-TUB (β-tubulin, APT1 (adenine phosphoribosyltransferase 1, and 18S rRNA (18S ribosomal RNA, was evaluated in Achyranthes bidentata samples using two algorithms, geNorm and NormFinder. The samples were classified into groups according to developmental stages, various tissues, stresses (cold, heat, drought, NaCl, and hormone treatments (MeJA, IBA, SA. Suitable combination of reference genes for RT-qPCR normalization should be applied according to different experimental conditions. In this study, EF1-α, UBC, and ACT genes were verified as the suitable reference genes across all tested samples. To validate the suitability of the reference genes, we evaluated the relative expression of CAS, which is a gene that may be involved in phytosterol synthesis. Our results provide the foundation for gene expression analysis in A. bidentata and other species of Amaranthaceae.

Unicameral Bone Cyst in the Proximal Humerus with Secondary Infection in an 18-Month-Old Foal

Directory of Open Access Journals (Sweden)

Maria C. Fugazzola

2014-01-01

Full Text Available An 18-month-old warmblood filly was 4/5 lame on the front right limb at referral and showed severe swelling of the right shoulder region and pain during manipulation of the shoulder region. Radiography revealed a roundish 5 × 7 cm radiolucent area with defined borders within the greater tubercle and the presence of a fracture of the lateral tubercle associated with the cyst. Cellular blood count was 27,500 WBC/μL and serum biochemical analyses revealed fibrinogen of 855 mg/dL. The fractured bone was removed surgically; the cyst debrided and filled with autologous cancellous bone graft. Three and five weeks after surgery the filly was reoperated on because of an osseous sequestrum and a periostal defect on the distal dorsolateral aspect of the pastern of the right hind limb and a septic synovitis of the DFTS of the left hind limb. Fifteen month after surgery the filly was not lame and was introduced to training. Unicameral bone cysts (UBC are well described lesions, often associated to pathologic fracture in the proximal humerus of children but, until present, no scientific report exists of UBC in the foal. The prompt surgical management had a favorable outcome.

HTLV-1 Tax Functions as a Ubiquitin E3 Ligase for Direct IKK Activation via Synthesis of Mixed-Linkage Polyubiquitin Chains.

Directory of Open Access Journals (Sweden)

Chong Wang

2016-04-01

Full Text Available The HTLV-1 oncoprotein Tax plays a key role in CD4+ T cell transformation by promoting cell proliferation and survival, mainly through permanent activation of the NK-κB pathway and induction of many NF-κB target genes. Elucidating the underlying molecular mechanism is therefore critical in understanding HTLV-1-mediated transformation. Current studies have suggested multiple but controversial mechanisms regarding Tax-induced IKK activation mainly due to blending of primary Tax-induced IKK activation events and secondary IKK activation events induced by cytokines secreted by the primary Tax-induced IKK-NF-κB activation events. We reconstituted Tax-stimulated IKK activation in a cell-free system to dissect the essential cellular components for primary IKK activation by Tax and studied the underlying biochemical mechanism. We found that Tax is a putative E3 ubiquitin ligase, which, together with UbcH2, UhcH5c, or UbcH7, catalyzes the assembly of free mixed-linkage polyubiquitin chains. These free mixed-linkage polyubiquitin chains are then responsible for direct IKK activation by binding to the NEMO subunit of IKK. Our studies revealed the biochemical function of Tax in the process of IKK activation, which utilizes the minimal cellular ubiquitination components for NF-κB activation.

HTLV-1 Tax Functions as a Ubiquitin E3 Ligase for Direct IKK Activation via Synthesis of Mixed-Linkage Polyubiquitin Chains.

Science.gov (United States)

Wang, Chong; Long, Wenying; Peng, Chao; Hu, Lin; Zhang, Qiong; Wu, Ailing; Zhang, Xiaoqing; Duan, Xiaotao; Wong, Catherine C L; Tanaka, Yuetsu; Xia, Zongping

2016-04-01

The HTLV-1 oncoprotein Tax plays a key role in CD4+ T cell transformation by promoting cell proliferation and survival, mainly through permanent activation of the NK-κB pathway and induction of many NF-κB target genes. Elucidating the underlying molecular mechanism is therefore critical in understanding HTLV-1-mediated transformation. Current studies have suggested multiple but controversial mechanisms regarding Tax-induced IKK activation mainly due to blending of primary Tax-induced IKK activation events and secondary IKK activation events induced by cytokines secreted by the primary Tax-induced IKK-NF-κB activation events. We reconstituted Tax-stimulated IKK activation in a cell-free system to dissect the essential cellular components for primary IKK activation by Tax and studied the underlying biochemical mechanism. We found that Tax is a putative E3 ubiquitin ligase, which, together with UbcH2, UhcH5c, or UbcH7, catalyzes the assembly of free mixed-linkage polyubiquitin chains. These free mixed-linkage polyubiquitin chains are then responsible for direct IKK activation by binding to the NEMO subunit of IKK. Our studies revealed the biochemical function of Tax in the process of IKK activation, which utilizes the minimal cellular ubiquitination components for NF-κB activation.

In vivo RNAi screen reveals neddylation genes as novel regulators of Hedgehog signaling.

Directory of Open Access Journals (Sweden)

Juan Du

Full Text Available Hedgehog (Hh signaling is highly conserved in all metazoan animals and plays critical roles in many developmental processes. Dysregulation of the Hh signaling cascade has been implicated in many diseases, including cancer. Although key components of the Hh pathway have been identified, significant gaps remain in our understanding of the regulation of individual Hh signaling molecules. Here, we report the identification of novel regulators of the Hh pathway, obtained from an in vivo RNA interference (RNAi screen in Drosophila. By selectively targeting critical genes functioning in post-translational modification systems utilizing ubiquitin (Ub and Ub-like proteins, we identify two novel genes (dUba3 and dUbc12 that negatively regulate Hh signaling activity. We provide in vivo and in vitro evidence illustrating that dUba3 and dUbc12 are essential components of the neddylation pathway; they function in an enzyme cascade to conjugate the ubiquitin-like NEDD8 modifier to Cullin proteins. Neddylation activates the Cullin-containing ubiquitin ligase complex, which in turn promotes the degradation of Cubitus interruptus (Ci, the downstream transcription factor of the Hh pathway. Our study reveals a conserved molecular mechanism of the neddylation pathway in Drosophila and sheds light on the complex post-translational regulations in Hh signaling.

iPhone Design Award-Winning Projects

CERN Document Server

Dannen, Chris

2010-01-01

This book profiles developers who have received the prestigious Apple Design Award for iPhone app excellence. You'll learn all about what makes these apps truly standout, including explanations of great user interface design and implementation, as well as the code under the hood that makes these the most responsive, intuitive, useful, and just plain fun apps running on the iPhone. * Insightful profiles of the developers behind Tweetie, Topple 2, AccuTerra, Postage, and Wooden Labyrinth 3D* Detailed explanations of the technical wizardry that makes these apps tick* Full-color screenshots and co

The Hamlet dilemma for aluminium cans in the circular economy: to be or not to be in a closed loop?

DEFF Research Database (Denmark)

Niero, Monia; Hoffmeyer, Simon B.; Langen, Håkon

2015-01-01

In the context of circular economy the focus is not only on recycling from a quantitative point of view, but also on improving the quality of materials. We considered the case of aluminium cans, and quantified the influence of alloying elements on the overall environmental performances of alumini...... the use of UBC scraps. This suggests that in a circular economy context for aluminium cans it is better to be in a closed loop....

Engineering developments on the UBC-TRIUMF modified PETT VI positron emission tomograph

International Nuclear Information System (INIS)

Evans, B.; Harrop, R.; Heywood, D.

1982-10-01

A tomograph with the PETT VI geometry has been built with improvements generally applicable to such devices. In addition to improved temperature control, the gantry features commercial CsF detectors with the newer Amperex photomultiplier tubes. Much of the coincidence support circuitry is of an original design, utilizing new 'fast' TTL family devices. A local DEC 11/23 microprocessor provides for routine diagnostic and reliability checking, gantry control, and acquisition of single detector counting rates. Image reconstruction and display is performed by a medium size VAX 11/780 computer, operating in a time-sharing environment. Some preliminary performance characteristics of the machine have been measured. The reconstructed resolution in-slice, as well as the reconstructed slice thickness, has been measured as a function of radius for both 'straight' and 'cross' slices

Multi-filter spectrophotometry simulations

Science.gov (United States)

Callaghan, Kim A. S.; Gibson, Brad K.; Hickson, Paul

1993-01-01

To complement both the multi-filter observations of quasar environments described in these proceedings, as well as the proposed UBC 2.7 m Liquid Mirror Telescope (LMT) redshift survey, we have initiated a program of simulated multi-filter spectrophotometry. The goal of this work, still very much in progress, is a better quantitative assessment of the multiband technique as a viable mechanism for obtaining useful redshift and morphological class information from large scale multi-filter surveys.

The Shock and Vibration Digest. Volume 15, Number 10

Science.gov (United States)

1983-10-01

kreisgefflhrter, spurkranzloger Rader) ti G. Strunk A mechanical model for a wheel disc with a flat web, based Fortschritt-Berichte VDI -Zt., Reihe 11...wheel are calculated with VDI -Z, 125 (3), p 89 (Feb 1983). Avail: Verlag the assumption that a fixed point on the rim is connected GmbH, Postfach 1139...Earthquake Engrg. Res. Ctr., Univ. of California, 83- 2048 Berkeley, CA, Rept. No. UBC/EERC-82/24, NSF/ Dynamics of Vibromotors with Annular Actuators . CEE

Prediction of BMI at age 11 in a longitudinal sample of the Ulm Birth Cohort Study.

Directory of Open Access Journals (Sweden)

Hanna Christiansen

Full Text Available Obesity is one of the greatest public health challenges in the world with childhood prevalence rates between 20-26% and numerous associated health risks. The aim of the current study was to analyze the 11-year follow-up data of the Ulm Birth Cohort Study (UBCS, to identify whether abnormal eating behavior patterns, especially restrained eating, predict body mass index (BMI at 11 years of age and to explore other factors known to be longitudinally associated with it. Of the original UBCS, n = 422 children (~ 40% of the original sample and their parents participated in the 11-year follow-up. BMI at age 8 and 11 as well as information on restrained eating, psychological problems, depressive symptoms, lifestyle, and IQ at age 8 were assessed. Partial Least Squares Structural Equation Modeling (PLS-SEM was used to predict children's BMI scores at age 11. PLS-SEM explained 68% of the variance of BMI at age 11, with BMI at age 8 being the most important predictor. Restrained eating, via BMI at age 8 as well as parental BMI, had further weak associations with BMI at age 11; no other predictor was statistically significant. Since established overweight at age 8 already predicts BMI scores at age 11 longitudinally, obesity interventions should be implemented in early childhood.

Sumoylation of the Tumor Suppressor Promyelocytic Leukemia Protein Regulates Arsenic Trioxide-Induced Collagen Synthesis in Osteoblasts.

Science.gov (United States)

Xu, Wen-Xiao; Liu, Sheng-Zhi; Wu, Di; Qiao, Guo-Fen; Yan, Jinglong

2015-01-01

Promyelocytic leukemia (PML) protein is a tumor suppressor that fuses with retinoic acid receptor-α (PML-RARα) to contribute to the initiation of acute promyelocytic leukemia (APL). Arsenic trioxide (ATO) upregulates expression of TGF-β1, promoting collagen synthesis in osteoblasts, and ATO binds directly to PML to induce oligomerization, sumoylation, and ubiquitination. However, how ATO upregulates TGF-β1 expression is uncertain. Thus, we suggested that PML sumoylation is responsible for regulation of TGF-β1 protein expression. Kunming mice were treated with ATO, and osteoblasts were counted under scanning electron microscopy. Masson's staining was used to quantify collagen content. hFOB1.19 cells were transfected with siRNA against UBC9 or RNF4, and then treated with ATO or FBS. TGF-β1, PML expression, and sumoylation were quantified with Western blot, and collagen quantified via immunocytochemistry. ATO enhanced osteoblast accumulation, collagen synthesis, and PML-NB formation in vivo. Knocking down UBC9 in hFOB1.19 cells inhibited ATO- and FBS-induced PML sumoylation, TGF-β1 expression, and collagen synthesis. Conversely, knocking down RNF4 enhanced ATO- and FBS-induced PML sumoylation, TGF-β1 expression, and collagen synthesis. These data suggest that PML sumoylation is required for ATO-induced collagen synthesis in osteoblasts. © 2015 S. Karger AG, Basel.

Myrciaria dubia, an Amazonian fruit: population structure and its implications for germplasm conservation and genetic improvement.

Science.gov (United States)

Nunes, C F; Setotaw, T A; Pasqual, M; Chagas, E A; Santos, E G; Santos, D N; Lima, C G B; Cançado, G M A

2017-03-22

Myrciaria dubia (camu-camu) is an Amazon tree that produces a tart fruit with high vitamin C content. It is probably the fruit with the highest vitamin C content among all Brazilian fruit crops and it can be used to supplement daily vitamin C dose. This property has attracted the attention of consumers and, consequently, encouraged fruit farmers to produce it. In order to identify and select potential accessions for commercial exploitation and breeding programs, M. dubia has received considerable research attention. The identification and characterization of genetic diversity, as well as identification of the population structure of accessions preserved in germplasm banks are fundamental for the success of any breeding program. The objective of this study was to evaluate the genetic variability of 10 M. dubia populations obtained from the shores of Reis Lake, located in the municipality of Caracaraí, Roraima, Brazil. Fourteen polymorphic inter simple sequence repeat (ISSR) markers were used to study the population genetic diversity, which resulted in 108 identified alleles. Among the 14 primers, GCV, UBC810, and UBC827 produced the highest number of alleles. The study illustrated the suitability and efficiency of ISSR markers to study the genetic diversity of M. dubia accessions. We also revealed the existence of high genetic variability among both accessions and populations that can be exploited in future breeding programs and conservation activities of this species.

Minerals on postage stamps: A mix of art, history, economics and geography

Science.gov (United States)

Glover, Paul

2010-05-01

Most people would agree that minerals represent some of the most beautiful natural objects known to mankind, especially in the form of precious and semi-precious gemstones. It is hardly surprising, therefore, that they are often illustrated on stamps. Examples are the fine crystalline forms represented as coloured etchings in the French 1986 issue, and the stylized simplicity of the mineral stamps that were part of the Swiss Pro Patria series, issued annually between 1958 and 1961. I aim in this presentation to introduce the beautiful world of mineral illustrations on stamps. The talk cannot be comprehensive because of the very large number of minerals and stamps concerned, but it will introduce the range of minerals depicted on stamps, then look in some greater detail at several sets from France, Southern Africa and East Germany. Minerals become the subject of sets of stamps for many reasons. In many cases, it is part of an attempt by the particular national post office to depict the whole of the natural history of their country in stamp form - a statement of nationality and politics. The 1986 French issue was an example which followed sets of stamps that had already portrayed insects, flowers, trees and birds native to France. We also find that certain countries have produced several sets of stamps to mark the importance to their economy of mining particular minerals. Many African states depend upon minerals for much of their wealth and economic power, explaining why, for instance, Sierra Leone issued over 35 stamps on the subject of diamonds between 1965 and 1978, and why over 77% of mineral stamps come from countries with major mining interests. Countries with traditional links with the history of the study of geology and mining also produce mineral stamps. These are usually European countries with a long record of the study of the Earth, such as Germany and Switzerland. Curiously enough, though, despite its fine tradition of geological observation and research, the United Kingdom has never produced a stamp depicting rocks or minerals. It is often said that the study of stamps is a study of history, language, culture, art, geography and politics. If this is true for stamps in general, it is particularly true for minerals on stamps.

Astronomia.pl: Ideas for the International Year of Astronomy 2009

Science.gov (United States)

Czart, K.; Pomierny, J.

2008-06-01

Astronomia.pl is an internet portal for Polish-speaking people. As a website, most of our activities in IYA2009 will focus on the internet and other electronic media. We will prepare a content-rich website, in cooperation with the Polish committee for IYA2009. We present some extended suggestions for ideas proposed by the IAU, like postage stamps or mobile phone wallpapers, ring tones and themes and some original propositions like naming a small Solar System body for each country, a computer game, a stadium as a solar clock, a media event with thousands of amateur astronomers in one place and a network of cities.

Bridging the gap between theory and practice of transmission pricing

International Nuclear Information System (INIS)

Hughes, W.R.; Felak, R.

1996-01-01

The authors describe some strategies for pricing transmission service. Traditionally, wheeling prices have been postage stamp rates based on the level of megawatt demand; a related approach would assign grid costs to customers based on their respective shares of overall megawatt-miles. Innovative regulators have recently approved transmission rates based on opportunity cost of foregone capacity and the incremental costs of additional capacity needed to enable delivery. Others determined prices designed to reflect short-run congestion costs on the grid. The authors assess these pricing approaches and their effects on the distribution of wealth and economic efficiency for both firm and interruptible services. 3 refs

Screening of resistance genes to fusarium root rot and fusarium wilt ...

African Journals Online (AJOL)

STORAGESEVER

2010-05-10

May 10, 2010 ... sequence for UBC 194 primer is: 5'-AGGACGTGCC-3'. The marker was amplified in 15 µL reaction volume containing 0.8 mM dNTPs,. 0.067 mM of primer, 2.6 mM MgSO4, 100 mM KCl, 100 mM. (NH4)2SO4, 200 mM Tris HCl (pH 8.75), 1% Triton X-100, 1 mg/ml. BSA and , 0.2 units of Taq polymerase with ...

The Unfolded Protein Response Is Induced by the Cell Wall Integrity Mitogen-activated Protein Kinase Signaling Cascade and Is Required for Cell Wall Integrity in Saccharomyces cerevisiae

OpenAIRE

Scrimale, Thomas; Didone, Louis; de Mesy Bentley, Karen L.; Krysan, Damian J.

2009-01-01

The yeast cell wall is an extracellular structure that is dependent on secretory and membrane proteins for its construction. We investigated the role of protein quality control mechanisms in cell wall integrity and found that the unfolded protein response (UPR) and, to a lesser extent, endoplasmic reticulum (ER)-associated degradation (ERAD) pathways are required for proper cell wall construction. Null mutation of IRE1, double mutation of ERAD components (hrd1Δ and ubc7Δ) and ire1Δ, or expres...

The Propagation of the Gravity Current of Viscoplastic Fluid

Science.gov (United States)

Liu, Ye

2014-11-01

We are studying the spreading of the viscoplastic fluid of Bingham type over a horizontal plane, using both mathematical derivation and numerical experiments. We are interested in its final shape and whether theory and numerics correspond well. There are two theories for comparison: lubrication theory from asymptotics, and slipline theory from plasticity. The numerical method we are using is based on the volume-of-fluid method, with both regularization and Augmented Lagrangian for the constitutive law of Bingham type fluid. UBC IRSN.

Small Ubiquitin-like Modifier (SUMO) Conjugation Impedes Transcriptional Silencing by the Polycomb Group Repressor Sex Comb on Midleg*

OpenAIRE

Smith, Matthew; Mallin, Daniel R.; Simon, Jeffrey A.; Courey, Albert J.

2011-01-01

The Drosophila protein Sex Comb on Midleg (Scm) is a member of the Polycomb group (PcG), a set of transcriptional repressors that maintain silencing of homeotic genes during development. Recent findings have identified PcG proteins both as targets for modification by the small ubiquitin-like modifier (SUMO) protein and as catalytic components of the SUMO conjugation pathway. We have found that the SUMO-conjugating enzyme Ubc9 binds to Scm and that this interaction, which requires the Scm C-te...

Forty-year follow up of bilateral breast cancer treated with mastectomy: the prognostic value of elapsed interval between the two breast primaries

International Nuclear Information System (INIS)

Abdalla, Ibrahim; Ferguson, Donald; Powers, Claire; Weichselbaum, Ralph R.; Hellman, Samuel; Heimann, Ruth

1996-01-01

PURPOSE: To analyze the clinical and prognostic characteristics of patients who developed bilateral breast cancer(synchronous or metachronous), to assess their long-term outcome and compare it to patients with unilateral breast cancer (UBC) PATIENTS AND METHODS: From our database of 2136 patients with stage I-III breast cancer treated by mastectomy between 1927 and 1987, we analyzed 115 patients who had bilateral breast cancer (BBC). Synchronous BBC was found in 10 patients while 105 had metachronous BBC at median interval between the two breast primaries of 54 months (range : 0-391 months). The age range at the time of first diagnosis was (29-77 year, median of 51). The majority of patients underwent radical mastectomy (used in 66% of the first cancer and 59% of the second cancer) followed by modified and extended radical mastectomy. Adjuvant therapy after the first mastectomy was as follows: 30% radiotherapy (RT), 23% endocrine therapy and 10% had chemotherapy (CT). Adjuvant therapy for the second primary was as follows: 9% RT, 12% endocrine and 6% had CT. The median follow-up was 160 months for all patients, range: 1-653 months (233 months, range:27-446 for surviving patients). The median follow-up for surviving patients after developing the second cancer was 119 months (range : 1-380). The disease-specific survival (DSS) was calculated from the diagnosis date of the first breast cancer to date of distant metastasis or death of breast cancer. Comparing BBC to UBC is confounded by the fact that BBC represents a selected subgroup that have already survived long enough without recurrence to develop contralateral breast cancer (CBC). The analysis below does not compensate for this, however further analysis will be presented. RESULTS: In comparison with the second breast cancer, the first cancer had a larger tumor size (median of 3 cm vs 2 cm, p=0.001) and higher percentage of positive axillary lymph nodes (55.8% vs 45.1%, p=0.001). When we compared the BBC patients

Selection of internal control genes for real-time quantitative PCR in ovary and uterus of sows across pregnancy.

Directory of Open Access Journals (Sweden)

María Martínez-Giner

Full Text Available BACKGROUND: Reproductive traits play a key role in pig production in order to reduce costs and increase economic returns. Among others, gene expression analyses represent a useful approach to study genetic mechanisms underlying reproductive traits in pigs. The application of reverse-transcription quantitative PCR requires the selection of appropriate reference genes, whose expression levels should not be affected by the experimental conditions, especially when comparing gene expression across different physiological stages. RESULTS: The gene expression stability of ten potential reference genes was studied by three different methods (geNorm, NormFinder and BestKeeper in ovary and uterus collected at five different physiological time points (heat, and 15, 30, 45 and 60 days of pregnancy. Although final ranking differed, the three algorithms gave very similar results. Thus, the most stable genes across time were TBP and UBC in uterus and TBP and HPRT1 in ovary, while HMBS and ACTB showed the less stable expression in uterus and ovary, respectively. When studied as a systematic effect, the reproductive stage did not significantly affect the expression of the candidate reference genes except at 30d and 60d of pregnancy, when a general drop in expression was observed in ovary. CONCLUSIONS: Based in our results, we propose the use of TBP, UBC and SDHA in uterus and TBP, GNB2L1 and HPRT1 in ovary for normalization of longitudinal expression studies using quantitative PCR in sows.

Suitable Reference Genes for Accurate Gene Expression Analysis in Parsley (Petroselinum crispum) for Abiotic Stresses and Hormone Stimuli.

Science.gov (United States)

Li, Meng-Yao; Song, Xiong; Wang, Feng; Xiong, Ai-Sheng

2016-01-01

Parsley, one of the most important vegetables in the Apiaceae family, is widely used in the food, medicinal, and cosmetic industries. Recent studies on parsley mainly focus on its chemical composition, and further research involving the analysis of the plant's gene functions and expressions is required. qPCR is a powerful method for detecting very low quantities of target transcript levels and is widely used to study gene expression. To ensure the accuracy of results, a suitable reference gene is necessary for expression normalization. In this study, four software, namely geNorm, NormFinder, BestKeeper, and RefFinder were used to evaluate the expression stabilities of eight candidate reference genes of parsley ( GAPDH, ACTIN, eIF-4 α, SAND, UBC, TIP41, EF-1 α, and TUB ) under various conditions, including abiotic stresses (heat, cold, salt, and drought) and hormone stimuli treatments (GA, SA, MeJA, and ABA). Results showed that EF-1 α and TUB were the most stable genes for abiotic stresses, whereas EF-1 α, GAPDH , and TUB were the top three choices for hormone stimuli treatments. Moreover, EF-1 α and TUB were the most stable reference genes among all tested samples, and UBC was the least stable one. Expression analysis of PcDREB1 and PcDREB2 further verified that the selected stable reference genes were suitable for gene expression normalization. This study can guide the selection of suitable reference genes in gene expression in parsley.

Suitable reference genes for accurate gene expression analysis in parsley (Petroselinum crispum for abiotic stresses and hormone stimuli

Directory of Open Access Journals (Sweden)

Meng-Yao Li

2016-09-01

Full Text Available Parsley is one of the most important vegetable in Apiaceae family and widely used in food industry, medicinal and cosmetic. The recent studies in parsley are mainly focus on chemical composition, further research involving the analysis of the gene functions and expressions will be required. qPCR is a powerful method for detecting very low quantities of target transcript levels and widely used for gene expression studies. To ensure the accuracy of results, a suitable reference gene is necessary for expression normalization. In this study, three software geNorm, NormFinder, and BestKeeper were used to evaluate the expression stabilities of eight candidate reference genes (GAPDH, ACTIN, eIF-4α, SAND, UBC, TIP41, EF-1α, and TUB under various conditions including abiotic stresses (heat, cold, salt, and drought and hormone stimuli treatments (GA, SA, MeJA, and ABA. The results showed that EF-1α and TUB were identified as the most stable genes for abiotic stresses, while EF-1α, GAPDH, and TUB were the top three choices for hormone stimuli treatments. Moreover, EF-1α and TUB were the most stable reference genes across all the tested samples, while UBC was the least stable one. The expression analysis of PcDREB1 and PcDREB2 further verified that the selected stable reference genes were suitable for gene expression normalization. This study provides a guideline for selection the suitable reference genes in gene expression in parsley.

Acute Vhl gene inactivation induces cardiac HIF-dependent erythropoietin gene expression.

Directory of Open Access Journals (Sweden)

Marta Miró-Murillo

Full Text Available Von Hippel Lindau (Vhl gene inactivation results in embryonic lethality. The consequences of its inactivation in adult mice, and of the ensuing activation of the hypoxia-inducible factors (HIFs, have been explored mainly in a tissue-specific manner. This mid-gestation lethality can be also circumvented by using a floxed Vhl allele in combination with an ubiquitous tamoxifen-inducible recombinase Cre-ER(T2. Here, we characterize a widespread reduction in Vhl gene expression in Vhl(floxed-UBC-Cre-ER(T2 adult mice after dietary tamoxifen administration, a convenient route of administration that has yet to be fully characterized for global gene inactivation. Vhl gene inactivation rapidly resulted in a marked splenomegaly and skin erythema, accompanied by renal and hepatic induction of the erythropoietin (Epo gene, indicative of the in vivo activation of the oxygen sensing HIF pathway. We show that acute Vhl gene inactivation also induced Epo gene expression in the heart, revealing cardiac tissue to be an extra-renal source of EPO. Indeed, primary cardiomyocytes and HL-1 cardiac cells both induce Epo gene expression when exposed to low O(2 tension in a HIF-dependent manner. Thus, as well as demonstrating the potential of dietary tamoxifen administration for gene inactivation studies in UBC-Cre-ER(T2 mouse lines, this data provides evidence of a cardiac oxygen-sensing VHL/HIF/EPO pathway in adult mice.

Transmission cost allocation for an efficient tariff action of electricity in a liberalised market

International Nuclear Information System (INIS)

Bassi, C.; Caldon, R.; Lorenzoni, A.

1999-01-01

The work is focused on the evaluation of the costs of an electricity transmission system operator and on their allocation among the users of the grid in liberalized market. After a recall of the goals of an efficient tariff for transmission, an original method for the cost allocation is proposed called ZI. Based on the marginal cost approach, this method could be the base for setting an efficient transmission tariff that at the same time covers costs and stimulates efficient behaviours. The performances of such an approach have been tested on a real 47 bus grid and ZI tariffs have been compared to the traditional postage stamp ones, highlighting the strong differences between them [it

A search for hot post-AGE stars in the IRAS Point Source Catalog

NARCIS (Netherlands)

Oudmaijer, RD

In this paper a first step is made to search for hot post-AGB stars in the IRAS Point Source Catalog. In order to find objects that evolved off the AGE a longer time ago than post-AGB objects discussed in the literature, objects that were not detected at 12 mu m by IRAS were selected. The selection

Tiny Devices Project Sharp, Colorful Images

Science.gov (United States)

2009-01-01

Displaytech Inc., based in Longmont, Colorado and recently acquired by Micron Technology Inc. of Boise, Idaho, first received a Small Business Innovation Research contract in 1993 from Johnson Space Center to develop tiny, electronic, color displays, called microdisplays. Displaytech has since sold over 20 million microdisplays and was ranked one of the fastest growing technology companies by Deloitte and Touche in 2005. Customers currently incorporate the microdisplays in tiny pico-projectors, which weigh only a few ounces and attach to media players, cell phones, and other devices. The projectors can convert a digital image from the typical postage stamp size into a bright, clear, four-foot projection. The company believes sales of this type of pico-projector may exceed $1.1 billion within 5 years.

The TESS Input Catalog and Selection of Targets for the TESS Transit Search

Science.gov (United States)

Pepper, Joshua; Stassun, Keivan G.; Paegert, Martin; Oelkers, Ryan; De Lee, Nathan Michael; Torres, Guillermo; TESS Target Selection Working Group

2018-01-01

The TESS mission will photometrically survey millions of the brightest stars over almost the entire the sky to detect transiting exoplanets. A key step to enable that search is the creation of the TESS Input Catalog (TIC), a compiled catalog of 700 million stars and galaxies with observed and calculated parameters. From the TIC we derive the Candidate Target List (CTL) to identify target stars for the 2-minute TESS postage stamps. The CTL is designed to identify the best stars for the detection of small planets, which includes all bright cool dwarf stars in the sky. I will describe the target selection strategy, the distribution of stars in the current CTL, and how both the TIC and CTL will expand and improve going forward.

Exploring valid reference genes for quantitative real - time rt - pce studies of hydrogenperoxide signaling in arabidopsis

International Nuclear Information System (INIS)

Zhou, H.; Han, B.; Xie, Y.; Zhang, J.; Shen, W.

2015-01-01

Hydrogen peroxide (H/sub 2/O/sub 2/ ) acts as a signaling molecule modulating the expression of various genes in plants. However, the reference gene(s) used for gene expression analysis of H/sub 2/O/sub 2/ signaling is still arbitrary. A reliable result obtained by quantitative real-time RT-PCR (RT-qPCR) highly depends on accurate transcript normalization using stably expressed reference genes, whereas the inaccurate normalization could easily lead to the false conclusions. In this report, by using geNorm and NormFinder algorithms, 12 candidate reference genes were evaluated and compared in root and shoot tissues of Arabidopsis upon different doses of H/sub 2/O/sub 2/. The results revealed that, in our experimental conditions, three novel reference genes (TIP41-like, UKN, and UBC21) were identified and validated as suitable reference genes for RT-qPCR normalization in both root and shoot tissues under oxidative stress. This conclusion was further confirmed by publicly available microarray data of methyl viologen and drought stress. In comparison with a single reference gene (EF-1a), the expression pattern of ZAT12 modulated by H/sub 2/O/sub 2/, when using TIP41-like, UKN, and UBC21 as multiple reference gene(s), was similar with the previous reports by using northern blotting. Thus, we proposed that these three reference genes might be good candidates for other researchers to include in their reference gene validation in gene expression studies under H/sub 2/O/sub 2/ related oxidative stress. (author)

CEBPA exerts a specific and biologically important proapoptotic role in pancreatic β cells through its downstream network targets

Science.gov (United States)

Barbagallo, Davide; Condorelli, Angelo Giuseppe; Piro, Salvatore; Parrinello, Nunziatina; Fløyel, Tina; Ragusa, Marco; Rabuazzo, Agata Maria; Størling, Joachim; Purrello, Francesco; Di Pietro, Cinzia; Purrello, Michele

2014-01-01

Transcription factor CEBPA has been widely studied for its involvement in hematopoietic cell differentiation and causal role in hematological malignancies. We demonstrate here that it also performs a causal role in cytokine-induced apoptosis of pancreas β cells. Treatment of two mouse pancreatic α and β cell lines (αTC1-6 and βTC1) with proinflammatory cytokines IL-1β, IFN-γ, and TNF-α at doses that specifically induce apoptosis of βTC1 significantly increased the amount of mRNA and protein encoded by Cebpa and its proapoptotic targets, Arl6ip5 and Tnfrsf10b, in βTC1 but not in αTC1-6. Cebpa knockdown in βTC1 significantly decreased cytokine-induced apoptosis, together with the amount of Arl6ip5 and Tnfrsf10b. Analysis of the network comprising CEBPA, its targets, their first interactants, and proteins encoded by genes known to regulate cytokine-induced apoptosis in pancreatic β cells (genes from the apoptotic machinery and from MAPK and NFkB pathways) revealed that CEBPA, ARL6IP5, TNFRSF10B, TRAF2, and UBC are the top five central nodes. In silico analysis further suggests TRAF2 as trait d'union node between CEBPA and the NFkB pathway. Our results strongly suggest that Cebpa is a key regulator within the apoptotic network activated in pancreatic β cells during insulitis, and Arl6ip5, Tnfrsf10b, Traf2, and Ubc are key executioners of this program. PMID:24943845

Molecular characterization of accessions of Cratylia argentea (Camaratuba) using ISSR markers.

Science.gov (United States)

Luz, G A; Gomes, S O; Araujo Neto, R B; Nascimento, M S C B; Lima, P S C

2015-11-27

Cratylia argentea (Desv.) Kuntze (Fabaceae) is a drought-tolerant, perennial legume found primarily in Brazil, Bolivia, and Peru. The shrub is well adapted to acid soils and exhibits high productivity and nutritional value, characteristics that would favor its use as a dry season animal forage supplement in semiarid regions. In plant improvement programs, the production of elite hybrids with superior traits is generally achieved by crossing parents that exhibit the highest level of genetic divergence. Therefore, the aim of the present study was to assess genetic diversity among 13 accessions of C. argentea from the same population maintained in the active germplasm bank of Embrapa Meio-Norte using inter-simple sequence repeat (ISSR) markers. Genetic similarities between C. argentea accessions were estimated from Jaccard coefficients, and a dendrogram was constructed using the unweighted pair group method with arithmetic average (UPGMA). The set of 15 primers selected for ISSR analysis generated a total of 313 loci of which 79.23% were polymorphic. The mean number of bands per primer was 20.87, and the amplicons ranged from 280 to 3000 bp in size. Primers UBC834 and UBC827 generated the largest number of polymorphic loci and exhibited 90.91 and 100% polymorphism, respectively. The coefficients of genetic similarity among accessions varied between 0.49 and 0.73. UPGMA cluster analysis allowed the identification of four genotypic groups and demonstrated the existence of considerable variability within the collection. Potential progenitors were selected that would offer good possibilities of obtaining unusual and favorable combinations of genes in a plant breeding program.

Human T-cell leukemia virus type 1 (HTLV-1 tax requires CADM1/TSLC1 for inactivation of the NF-κB inhibitor A20 and constitutive NF-κB signaling.

Directory of Open Access Journals (Sweden)

Rajeshree Pujari

2015-03-01

Full Text Available Persistent activation of NF-κB by the Human T-cell leukemia virus type 1 (HTLV-1 oncoprotein, Tax, is vital for the development and pathogenesis of adult T-cell leukemia (ATL and HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP. K63-linked polyubiquitinated Tax activates the IKK complex in the plasma membrane-associated lipid raft microdomain. Tax also interacts with TAX1BP1 to inactivate the NF-κB negative regulatory ubiquitin-editing A20 enzyme complex. However, the molecular mechanisms of Tax-mediated IKK activation and A20 protein complex inactivation are poorly understood. Here, we demonstrated that membrane associated CADM1 (Cell adhesion molecule1 recruits Ubc13 to Tax, causing K63-linked polyubiquitination of Tax, and IKK complex activation in the membrane lipid raft. The c-terminal cytoplasmic tail containing PDZ binding motif of CADM1 is critical for Tax to maintain persistent NF-κB activation. Finally, Tax failed to inactivate the NF-κB negative regulator ubiquitin-editing enzyme A20 complex, and activate the IKK complex in the lipid raft in absence of CADM1. Our results thus indicate that CADM1 functions as a critical scaffold molecule for Tax and Ubc13 to form a cellular complex with NEMO, TAX1BP1 and NRP, to activate the IKK complex in the plasma membrane-associated lipid rafts, to inactivate NF-κB negative regulators, and maintain persistent NF-κB activation in HTLV-1 infected cells.

Pathologic fracture of the distal radius in a 25-year-old patient with a large unicameral bone cyst.

Science.gov (United States)

Massen, Felix; Baumbach, Sebastian; Volkmer, Elias; Mutschler, Wolf; Grote, Stefan

2014-06-13

Distal radius fractures (DRF) are often referred to as osteoporosis indicator fractures as their incidence increases from age 45. In the group of young adults, distal radius fractures normally result from high-energy trauma. Wrist fractures in young patients without adequate trauma thus raise suspicion of a pathologic fracture. In this report we present the case of a fractured unicameral bone cyst (UBC) at the distal radius in a young adult.To the author's best knowledge, this is the first detailed report in an UBC at the distal radius causing a pathologic DRF in an adult patient. A 25-year-old otherwise healthy male presented to our Emergency Department after a simple fall on his right outstretched hand. Extended diagnostics revealed a pathologic, dorsally displaced, intra-articular distal radius fracture secondary to a unicameral bone cyst occupying almost the whole metaphysis of the distal radius. To stabilize the fracture, a combined dorsal and volar approach was used for open reduction and internal fixation. A tissue specimen for histopathological examination was gathered and the lesion was filled with an autologous bone graft harvested from the ipsilateral femur using a reamer-irrigator-aspirator (RIA) system. Following one revision surgery due to an intra-articular step-off, the patient recovered without further complications. Pathologic fractures in young patients caused by unicameral bone cysts require extended diagnostics and adequate treatment. A single step surgical treatment is reasonable if fracture and bone cyst are treated appropriately. Arthroscopically assisted fracture repair may be considered in intra-articular fractures or whenever co-pathologies of the carpus are suspected.

Discovery of Ubiquitin Deamidases in the Pathogenic Arsenal of Legionella pneumophila

Directory of Open Access Journals (Sweden)

Dylan Valleau

2018-04-01

Full Text Available Summary: Legionella pneumophila translocates the largest known arsenal of over 330 pathogenic factors, called “effectors,” into host cells during infection, enabling L. pneumophila to establish a replicative niche inside diverse amebas and human macrophages. Here, we reveal that the L. pneumophila effectors MavC (Lpg2147 and MvcA (Lpg2148 are structural homologs of cycle inhibiting factor (Cif effectors and that the adjacent gene, lpg2149, produces a protein that directly inhibits their activity. In contrast to canonical Cifs, both MavC and MvcA contain an insertion domain and deamidate the residue Gln40 of ubiquitin but not Gln40 of NEDD8. MavC and MvcA are functionally diverse, with only MavC interacting with the human E2-conjugating enzyme UBE2N (Ubc13. MavC deamidates the UBE2N∼Ub conjugate, disrupting Lys63 ubiquitination and dampening NF-κB signaling. Combined, our data reveal a molecular mechanism of host manipulation by pathogenic bacteria and highlight the complex regulatory mechanisms integral to L. pneumophila’s pathogenic strategy. : Legionella pneumophila, possessing the largest known arsenal of effectors, continues to reveal unique approaches to host cell control. Valleau et al. decrypt the functions of a trio of effectors, discovering a pair of ubiquitin-specific deamidases, their regulation by a neighboring dual-specificity protein inhibitor, and a mechanism of NF-κB suppression. Keywords: pathogen-host interaction, ubiquitination, Legionella, UBE2N/Ubc13, NF-κB signaling, Type IV secretion system, effectors, metaeffector, cycle inhibiting factor

Solid Waste Operations Complex W-113, Detail Design Report (Title II). Volume 5: Design validation assessments and lists

International Nuclear Information System (INIS)

1995-09-01

The Solid Waste Retrieval Facility--Phase 1 (Project W113) will provide the infrastructure and the facility required to retrieve from Trench 04, Burial ground 4C, contact handled (CH) drums and boxes at a rate that supports all retrieved TRU waste batching, treatment, storage, and disposal plans. This includes (1) operations related equipment and facilities, viz., a weather enclosure for the trench, retrieval equipment, weighing, venting, obtaining gas samples, overpacking, NDE, NDA, shipment of waste and (2) operations support related facilities, viz., a general office building, a retrieval staff change facility, and infrastructure upgrades such as supply and routing of water, sewer, electrical power, fire protection, roads, and telecommunication. Title I design for the operations related equipment and facilities was performed by Raytheon/BNFL, and that for the operations support related facilities including infrastructure upgrade was performed by KEH. These two scopes were combined into an integrated W113 Title II scope that was performed by Raytheon/BNFL. The following Code Evaluation analyzes the applicable sections of the National Fire Protection Association (NFPA) 101, Life Safety Code, 1994 Edition and the 1994 Edition of the Uniform Building Code (UBC) to the W113 Trench Enclosure. A Building Code Analysis generally establishes four primary design criteria: occupancy classification; separation requirements; egress requirements; and construction type. The UBC establishes requirements for all criteria. This analysis is limited to the Trench Enclosure Building. The General Office Building and the Retrieval Staff Change Building is not within the scope of this analysis

Using Efference Copy and a Forward Internal Model for Adaptive Biped Walking

DEFF Research Database (Denmark)

Schröder-Schetelig, Johannes; Manoonpong, Poramate; Wörgötter, Florentin

2010-01-01

an application of this for our dynamic walking robot RunBot. We use efference copies of the motor commands with a simple forward internal model to predict the expected self-generated acceleration during walking. The difference to the actually measured acceleration is then used to stabilize the walking...... on terrains with changing slopes through its upper body component controller. As a consequence, the controller drives the upper body component (UBC) to lean forwards/backwards as soon as an error occurs resulting in dynamical stable walking. We have evaluated the performance of the system on four different...

Pipelines update : new tolls and new opportunities in gas gathering

International Nuclear Information System (INIS)

Shelton, E.

1999-01-01

An overview of the new TransCanada energy transmission system was given. TransCanada has ownership interests in seven other North American natural gas pipelines and the integration of former NOVA Gas Transmission, TransCanada Energy Transmission and ANG Pipeline organizations into a single organization is nearing completion. Integration efforts have been driven by TransCanada's commitment to provide customers with lower costs and improved service levels. The service enhancements will include one-stop shopping, customer advisory councils, harmonized design criteria, optimized operations/maintenance, and consistent billing processes. The new toll design which will replace the current postage-stamp pricing regime offered by NGTL was also reviewed, emphasizing key features such as pricing, term linked tolls, interruptible/short term tolls, renewal incentive, risk/reward collar, transition period and new services

Using Electronic Surveys: Advice from Survey Professionals.

Directory of Open Access Journals (Sweden)

David M. Shannon

2002-01-01

Full Text Available The study reports the perceptions and recommendations of sixty-two experienced survey..researchers from the American Educational Research Association regarding the use of..electronic surveys. The most positive aspects cited for the use of electronic surveys were..reduction of costs (i.e., postage, phone charges, the use of electronic mail for pre-notification or..follow-up purposes, and the compatibility of data with existing software programs. These..professionals expressed limitations in using electronic surveys pertaining to the limited..sampling frame as well as issues of confidentiality, privacy, and the credibility of the sample...They advised that electronic surveys designed with the varied technological background and..capabilities of the respondent in mind, follow sound principles of survey construction, and be..administered to pre-notified, targeted populations with published email addresses.

Introduction to number theory with cryptography

CERN Document Server

Kraft, James S

2013-01-01

IntroductionDiophantine EquationsModular ArithmeticPrimes and the Distribution of PrimesCryptographyDivisibilityDivisibilityEuclid's Theorem Euclid's Original Proof The Sieve of Eratosthenes The Division Algorithm The Greatest Common Divisor The Euclidean Algorithm Other BasesLinear Diophantine EquationsThe Postage Stamp Problem Fermat and Mersenne Numbers Chapter Highlights Problems Unique FactorizationPreliminary Results The Fundamental Theorem of Arithmetic Euclid and the Fundamental Theorem of ArithmeticChapter Highlights Problems Applications of Unique Factorization A Puzzle Irrationality Proofs The Rational Root Theorem Pythagorean Triples Differences of Squares Prime Factorization of Factorials The Riemann Zeta Function Chapter Highlights Problems CongruencesDefinitions and Examples Modular Exponentiation Divisibility TestsLinear Congruences The Chinese Remainder TheoremFractions mod m Fermat's Theorem Euler's Theorem Wilson's Theorem Queens on a Chessboard Chapter Highlights Problems Cryptographic App...

Influence of the Soil-Structure Interaction on the Design of Steel-Braced Building Foundation

International Nuclear Information System (INIS)

Azarbakht, Alireza; Ashtiany, Mohsen Ghafory

2008-01-01

The modeling and analysis of the superstructure and the foundation for the seismic lateral loads are traditionally done separately. This assumption is an important issue in the design/rehabilitate procedures especially for the short period structures, i.e. steel braced or shear wall systems, which may result to a conservative design. By using more advance procedures, i.e. nonlinear static method, and the incorporation of the soil-structure interaction (SSI), the seismic demand in the lateral resisting system decreases and the design will become more economic. This paper includes an investigation about the influence of the SSI effect on the design of the steel-braced building foundation. The presented example is a three-bay three-storey steel braced frame. Three design methods based on the FEMA 356 guideline and the UBC 97 code are taken in to consideration. The three methods are: (1) linear static analysis based on the UBC 97 code assuming the fixed based condition; (2) linear static analysis based on the FEMA 356 guideline assuming the fixed based condition; and (3) nonlinear static analysis assuming both fixed and flexible based assumptions. The results show that the influence of the SSI on the input demand of the short period building foundations is significant and the foundation design based on the linear static method with the fixed base assumption is so conservative. A simple method is proposed to take the SSI effect in to consideration in the linear static procedure with the fixed base assumption, which is a common method for the engineers. The advantage of this proposed method is the simplicity and the applicability for the engineering purposes

Identificação de marcas moleculares associadas à ausência de sementes em videira Identification of molecular markers associated to the absence of seeds in grapevine

Directory of Open Access Journals (Sweden)

Ana Veruska Cruz da Silva

2006-06-01

Full Text Available A ausência de sementes tem sido uma característica bastante exigida pelos consumidores de uvas de mesa. O objetivo deste trabalho foi identificar marcas moleculares associadas à ausência de sementes, utilizando as técnicas RAPD e fAFLP. Foram utilizadas folhas jovens de 19 cultivares. Na análise RAPD 30, iniciadores possibilitaram amplificação de todas as amostras, produzindo 392 bandas polimórficas. Foi possível encontrar uma marca específica para a ausência de sementes, utilizando o iniciador UBC 443, que poderá futuramente ser utilizado para o desenvolvimento de marcadores SCAR, possibilitando a criação de um teste de identificação rápida e precoce de apirenia em videira. A análise fAFLP proporcionou a visualização de um dendrograma com grupos específicos de cultivares com sementes, sem sementes e porta enxertos.Seedless has been an important characteristic of table grapes required by consumers. The objective was to identify molecular markers associated to seedless, by RAPD and fAFLP techniques with young leaves samples of 19 cultivars. Thirty primers were used for RAPD analysis, producing a total of 337 polymorphic bands. It was also to find a specific mark for seedless, using UBC 443 primer. This mark would be transformed in a scar marker, making possible the early identification of seedless grape possible. The fAFLP analysis provided a visualization of a dendrogram with specific groups, separated in three different cultivars: with seeds, without seeds and the rootstocks.

Human Homolog of Drosophila Ariadne (HHARI) is a marker of cellular proliferation associated with nuclear bodies

Energy Technology Data Exchange (ETDEWEB)

Elmehdawi, Fatima; Wheway, Gabrielle; Szymanska, Katarzyna [Division of Clinical Sciences, Leeds Institute of Molecular Medicine, Level 8, Wellcome Trust Brenner Building, University of Leeds, Leeds, LS9 7TF West Yorkshire (United Kingdom); Adams, Matthew [BioScreening Technology Group, Biomedical Health Research Center, Wellcome Trust Brenner Building, University of Leeds, Leeds, LS9 7TF West Yorkshire (United Kingdom); High, Alec S. [Department of Histopathology, Bexley Wing, St. James' s University Hospital, Beckett Street, Leeds, LS9 7TF West Yorkshire (United Kingdom); Johnson, Colin A., E-mail: c.johnson@leeds.ac.uk [Division of Clinical Sciences, Leeds Institute of Molecular Medicine, Level 8, Wellcome Trust Brenner Building, University of Leeds, Leeds, LS9 7TF West Yorkshire (United Kingdom); Robinson, Philip A. [Division of Clinical Sciences, Leeds Institute of Molecular Medicine, Level 8, Wellcome Trust Brenner Building, University of Leeds, Leeds, LS9 7TF West Yorkshire (United Kingdom)

2013-02-01

HHARI (also known as ARIH1) is an ubiquitin-protein ligase and is the cognate of the E2, UbcH7 (UBE2L3). To establish a functional role for HHARI in cellular proliferation processes, we performed a reverse genetics screen that identified n=86/522 (16.5%) ubiquitin conjugation components that have a statistically significant effect on cell proliferation, which included HHARI as a strong hit. We then produced and validated a panel of specific antibodies that establish HHARI as both a nuclear and cytoplasmic protein that is expressed in all cell types studied. HHARI was expressed at higher levels in nuclei, and co-localized with nuclear bodies including Cajal bodies (p80 coilin, NOPP140), PML and SC35 bodies. We confirmed reduced cellular proliferation after ARIH1 knockdown with individual siRNA duplexes, in addition to significantly increased levels of apoptosis, an increased proportion of cells in G2 phase of the cell cycle, and significant reductions in total cellular RNA levels. In head and neck squamous cell carcinoma biopsies, there are higher levels of HHARI expression associated with increased levels of proliferation, compared to healthy control tissues. We demonstrate that HHARI is associated with cellular proliferation, which may be mediated through its interaction with UbcH7 and modification of proteins in nuclear bodies. -- Highlights: ► We produce and validate new antibody reagents for the ubiquitin-protein ligase HHARI. ► HHARI colocalizes with nuclear bodies including Cajal, PML and SC35 bodies. ► We establish new functions in cell proliferation regulation for HHARI. ► Increased HHARI expression associates with squamous cell carcinoma and proliferation.

Current topics in DNA double-strand break repair

International Nuclear Information System (INIS)

Kobayashi, Junya; Takata, Minoru; Iwabuchi, Kuniyoshi; Miyagawa, Kiyoshi; Sonoda, Eiichiro; Suzuki, Keiji; Tauchi, Hiroshi

2008-01-01

DNA double strand break (DSB) is one of the most critical types of damage which is induced by ionizing radiation. In this review, we summarize current progress in investigations on the function of DSB repair-related proteins. We focused on recent findings in the analysis of the function of proteins such as 53BP1, histone H2AX, Mus81-Eme1, Fanc complex, and UBC13, which are found to be related to homologous recombination repair or to non-homologous end joining. In addition to the function of these proteins in DSB repair, the biological function of nuclear foci formation following DSB induction is discussed. (author)

Histone H1 couples initiation and amplification of ubiquitin signalling after DNA damage

DEFF Research Database (Denmark)

Thorslund, Tina; Ripplinger, Anita; Hoffmann, Saskia

2015-01-01

DNA double-strand breaks (DSBs) are highly cytotoxic DNA lesions that trigger non-proteolytic ubiquitylation of adjacent chromatin areas to generate binding sites for DNA repair factors. This depends on the sequential actions of the E3 ubiquitin ligases RNF8 and RNF168 (refs 1-6), and UBC13 (also...... known as UBE2N), an E2 ubiquitin-conjugating enzyme that specifically generates K63-linked ubiquitin chains. Whereas RNF168 is known to catalyse ubiquitylation of H2A-type histones, leading to the recruitment of repair factors such as 53BP1 (refs 8-10), the critical substrates of RNF8 and K63-linked...

Ramón y Cajal erroneously identified as Camillo Golgi on a souvenir postage stamp.

Science.gov (United States)

Triarhou, Lazaros C; del Cerro, Manuel

2012-01-01

Focusing on a philatelic oddity that erringly identifies a picture of Santiago Ramón y Cajal as that of Camillo Golgi, this brief article examines official and unofficial stamp issues honoring the two great neuroanatomists, one from Spain and the other from Italy, who were early Nobel Prize winners in Physiology or Medicine.

New Site Coefficients and Site Classification System Used in Recent Building Seismic Code Provisions

Science.gov (United States)

Dobry, R.; Borcherdt, R.D.; Crouse, C.B.; Idriss, I.M.; Joyner, W.B.; Martin, G.R.; Power, M.S.; Rinne, E.E.; Seed, R.B.

2000-01-01

Recent code provisions for buildings and other structures (1994 and 1997 NEHRP Provisions, 1997 UBC) have adopted new site amplification factors and a new procedure for site classification. Two amplitude-dependent site amplification factors are specified: Fa for short periods and Fv for longer periods. Previous codes included only a long period factor S and did not provide for a short period amplification factor. The new site classification system is based on definitions of five site classes in terms of a representative average shear wave velocity to a depth of 30 m (V?? s). This definition permits sites to be classified unambiguously. When the shear wave velocity is not available, other soil properties such as standard penetration resistance or undrained shear strength can be used. The new site classes denoted by letters A - E, replace site classes in previous codes denoted by S1 - S4. Site classes A and B correspond to hard rock and rock, Site Class C corresponds to soft rock and very stiff / very dense soil, and Site Classes D and E correspond to stiff soil and soft soil. A sixth site class, F, is defined for soils requiring site-specific evaluations. Both Fa and Fv are functions of the site class, and also of the level of seismic hazard on rock, defined by parameters such as Aa and Av (1994 NEHRP Provisions), Ss and S1 (1997 NEHRP Provisions) or Z (1997 UBC). The values of Fa and Fv decrease as the seismic hazard on rock increases due to soil nonlinearity. The greatest impact of the new factors Fa and Fv as compared with the old S factors occurs in areas of low-to-medium seismic hazard. This paper summarizes the new site provisions, explains the basis for them, and discusses ongoing studies of site amplification in recent earthquakes that may influence future code developments.

Climate change impact on river flows in Chitral watershed

International Nuclear Information System (INIS)

Shakir, A.S.; Rehman, H.U.; Ehsan, S.

2010-01-01

The impact of climate change has always been very important for water resources in the world. In countries like Pakistan where different weather conditions exist, the effects of climate change can be more crucial. Generally, the climate changes are considered in terms of global warming i.e. increase in the average temperature of earth's near surface air. The global warming can have a strong impact on river flows in Pakistan. This may be due to the melting of snow and glaciers at a higher rate and changes in precipitation patterns. Glaciers in Pakistan cover about 13,680 km/sup 2/, which is 13% of the mountainous regions of the Upper Indus Basin. Glacier and Snow melt water from these glaciers contributes significantly to the river flows in Pakistan. Due to climate change, the changes in temperature and the amount of precipitation could have diversified effects on river flows of arid and semi-arid regions of Pakistan. This paper reviews the existing research studies on climate change impact on water resources of Pakistan. The past trend of river flows in Pakistan has been discussed with respect to the available data. Further, different projections about future climate changes in terms of glacier melting and changes in temperature and precipitation have also been taken into consideration in order to qualitatively assess the future trend of river flows in Pakistan. As a case study, the flows were generated for the Chitral watershed using UBC Watershed Model. Model was calibrated for the year 2002, which is an average flow year. Model results show good agreement between simulated and observed flows. UBC watershed model was applied to a climate change scenario of 1 deg. C increase in temperature and 15% decrease in glaciated area. Results of the study reveal that the flows were decreased by about 4.2 %. (author)

A Novel Minimally Invasive Technique for Treatment of Unicameral Bone Cysts.

Science.gov (United States)

Zaghloul, Ahmed; Haddad, Behrooz; Khan, Wasim; Grimes, Lisa; Tucker, Keith

2015-01-01

Management of unicameral bone cysts (UBC) remain controversial. These cysts seldom heal spontaneously or even after pathological fracture. Sometimes these cysts can be very large and incredibly troublesome to the patient. Various treatments exist with variable success rates. We present our experience of treating these lesions by continuous drainage. Over a seven year period, six patients with unicameral bone cysts were treated by inserting a modified drain into the wall of the cyst. The aim of surgery was to place the drain in a dependent area of the cyst, through the cortex allowing for continuous drainage. This was achieved through a small incision under radiographic control. A cement restrictor (usually used for femoral canal plugging during total hip replacements) was modified and inserted to prevent closure of the drain site. A redivac drain was passed through the plug into the cyst. The drain was left in place for a week to establish an epithelialized pathway which hopefully would remain patent, into the subcutaneous tissues, after the drain had been removed. There were four males and two females in the group and the age range was 6 -12 years. Four of the lesions were in the upper humerus, one in the proximal femur and the other one in the proximal tibia. Healing was rated according to the modified Neer classification. Grade 1 (healed) and Grade 2 (healed with defect) was defined as excellent outcome. Persistent /Recurrent cysts (Grade 3 and 4) were noted as unsatisfactory. Five cases were completely healed. Only one had a further fracture and there were no recurrent fractures. All the patients reported complete comfort and they all were able to re-engage in recreational activities without restriction. We think that reducing the intra-medullary pressure in these lesions will lead to healing. We report a safe and minimally invasive technique for the management of UBC.

Experimental study and calculation of boiling heat transfer on steel plates during runout table operation

International Nuclear Information System (INIS)

Liu, Z.D.; Fraser, D.; Samarasekera, I.V.

2002-01-01

Within a hot strip steel mill, red hot steel is hot rolled into a long continuous slab that is led onto what is called the runout table. Temperatures of the steel at the beginning of this table are around 900 o C. Above and below the runout table are banks of water jets, sprays or water curtains that rapidly cool the steel slab. The heat transfer process itself may be considered one of the most complicated in the industrial world. The cooling process that occurs on the runout table is crucial and governs the final mechanical properties and flatness of a steel strip. However, very limited data of industrial conditions has been available and that which is available is poorly understood. To study heat transfer during runout table cooling, an industrial scale pilot runout table facility was constructed at the University of British Columbia (UBC). This paper describes the experimental details, data acquisition and data handling techniques for steel plates during water jet impingement cooling by one circular water jet from industrial headers. The effect of cooling water temperature and initial steel plate temperature as well as varying water jet diameters on heat transfer was systematically investigated. A two-dimensional finite element scheme based inverse heat conduction model was developed to calculate surface heat transfer coefficients along the impinging surface. Heat flux curves at the stagnation area were obtained for selected tests. A quantitative relationship between adjustable processing parameters and heat transfer coefficients along the impinging surface during runout table operation is discussed. The results of the study were used to upgrade an extensive process model developed at UBC. The model ties in the cooling rate and hence two dimensional temperature gradients to the resulting microstructure and final mechanical properties of the steel. This process model is widely used by major steel industries in Canada and the United States. (author)

Merkel Cell Polyomavirus Small T Antigen Induces Cancer and Embryonic Merkel Cell Proliferation in a Transgenic Mouse Model.

Science.gov (United States)

Shuda, Masahiro; Guastafierro, Anna; Geng, Xuehui; Shuda, Yoko; Ostrowski, Stephen M; Lukianov, Stefan; Jenkins, Frank J; Honda, Kord; Maricich, Stephen M; Moore, Patrick S; Chang, Yuan

2015-01-01

Merkel cell polyomavirus (MCV) causes the majority of human Merkel cell carcinomas (MCC) and encodes a small T (sT) antigen that transforms immortalized rodent fibroblasts in vitro. To develop a mouse model for MCV sT-induced carcinogenesis, we generated transgenic mice with a flox-stop-flox MCV sT sequence homologously recombined at the ROSA locus (ROSAsT), allowing Cre-mediated, conditional MCV sT expression. Standard tamoxifen (TMX) administration to adult UbcCreERT2; ROSAsT mice, in which Cre is ubiquitously expressed, resulted in MCV sT expression in multiple organs that was uniformly lethal within 5 days. Conversely, most adult UbcCreERT2; ROSAsT mice survived low-dose tamoxifen administration but developed ear lobe dermal hyperkeratosis and hypergranulosis. Simultaneous MCV sT expression and conditional homozygous p53 deletion generated multi-focal, poorly-differentiated, highly anaplastic tumors in the spleens and livers of mice after 60 days of TMX treatment. Mouse embryonic fibroblasts from these mice induced to express MCV sT exhibited anchorage-independent cell growth. To examine Merkel cell pathology, MCV sT expression was also induced during mid-embryogenesis in Merkel cells of Atoh1CreERT2/+; ROSAsT mice, which lead to significantly increased Merkel cell numbers in touch domes at late embryonic ages that normalized postnatally. Tamoxifen administration to adult Atoh1CreERT2/+; ROSAsT and Atoh1CreERT2/+; ROSAsT; p53flox/flox mice had no effects on Merkel cell numbers and did not induce tumor formation. Taken together, these results show that MCV sT stimulates progenitor Merkel cell proliferation in embryonic mice and is a bona fide viral oncoprotein that induces full cancer cell transformation in the p53-null setting.

Sumoylation of IkB attenuates NF-kB-induced nitrosative stress at rostral ventrolateral medulla and cardiovascular depression in experimental brain death.

Science.gov (United States)

Tsai, Ching-Yi; Li, Faith C H; Wu, Carol H Y; Chang, Alice Y W; Chan, Samuel H H

2016-09-22

Small ubiquitin-related modifier (SUMO) is a group of proteins that participates in post-translational modifications. One known SUMO target is the transcription factor nuclear factor-kB (NF-kB) that plays a pivotal role in many disease processes; sumoylation inactivates NF-kB by conjugation with inhibitors of NF-kB (IkB). Our laboratory demonstrated previously that transcriptional upregulation of nitric oxide synthase II (NOS II) by NF-kB, leading to nitrosative stress by the formation of peroxynitrite in the rostral ventrolateral medulla (RVLM), underpins the defunct brain stem cardiovascular regulation that precedes brain death. Based on an experimental endotoxemia model, this study evaluated the hypothesis that sumoylation plays a pro-life role in brain death by interacting with the NF-kB/NOS II/peroxynitrite signaling pathway in the RVLM. In Sprague-Dawley rats, intravenous administration of Escherichia coli lipopolysaccharide (LPS; 10 mg kg -1 ) elicited an augmentation of SUMO-1 and ubiquitin-conjugase 9 (Ubc9) mRNA or protein levels, alongside SUMO-1-conjugated proteins in the RVLM. Immunoneutralization of SUMO-1 or Ubc9 in the RVLM significantly potentiated the already diminished sumoylation of IkBα and intensified NF-kB activation and NOS II/peroxynitrite expression in this brain stem substrate, together with exacerbated fatality, cardiovascular depression and reduction of an experimental index of a life-and-death signal detected from arterial pressure that disappears in comatose patients signifying failure of brain stem cardiovascular regulation before brain death. We conclude that sumoylation of IkB in the RVLM ameliorates the defunct brain stem cardiovascular regulation that underpins brain death in our experimental endotoxemia modal by reducing nitrosative stress via inhibition of IkB degradation that diminishes the induction of the NF-kB/NOS II/peroxynitrite signaling cascade.

Estimation of folate binding capacity (unsaturated and total) in normal human serum and in β-thalassaemia

International Nuclear Information System (INIS)

Moulopoulos, S.; Mantzos, J.; Gyftaki, E.; Kesse-Elias, M.; Alevizou-Terzaki, V.; Souli-Tsimili, E.

1978-01-01

A method is described for measuring the total serum folate binding capacity (TBC) after treating the serum with urea at pH5.5, the unsaturated serum folate binding capacity (UBC) being determined without treatment with urea. The method was applied to 50 normal controls and 20 patients with homozygous β-thalassaemia. The results show an increase in folate binding capacity after treating the serum with urea in all cases studied. There is no correlation between serum folic acid level and total or unsaturated folate binding capacity or per cent saturation. The method described is a simple and rapid one for screening the different groups studied for saturated and unsaturated specific folate-binding proteins. (author)

MAGIC MOORE-PENROSE INVERSES AND PHILATELIC MAGIC SQUARES WITH SPECIAL EMPHASIS ON THE DANIELS–ZLOBEC MAGIC SQUARE

Directory of Open Access Journals (Sweden)

Ka Lok Chu

2011-02-01

Full Text Available We study singular magic matrices in which the numbers in the rows and columns and in the two main diagonals all add up to the same sum. Our interest focuses on such magic matrices for which the Moore–Penrose inverse is also magic. Special attention is given to the “Daniels–Zlobec magic square’’ introduced by the British magician and television performer Paul Daniels (b. 1938 and considered by Zlobec (2001; see also Murray (1989, pp. 30–32. We introduce the concept of a “philatelic magic square” as a square arrangement of images of postage stamps so that the associated nominal values form a magic square. Three philatelic magic squares with stamps especially chosen for Sanjo Zlobec are presented in celebration of his 70th birthday; most helpful in identifying these stamps was an Excel checklist by Männikkö (2009.

Back to the future – feasibility of recruitment and retention to patient education and telephone follow-up after hip fracture: a pilot randomized controlled trial

Directory of Open Access Journals (Sweden)

Langford DP

2015-09-01

Full Text Available Dolores P Langford,1,2 Lena Fleig,3–5 Kristin C Brown,3,4 Nancy J Cho,1,2 Maeve Frost,1 Monique Ledoyen,1 Jayne Lehn,1 Kostas Panagiotopoulos,1,6 Nina Sharpe,1 Maureen C Ashe3,4 1Vancouver Coastal Health, 2Department of Physical Therapy, The University of British Columbia (UBC, 3Department of Family Practice, The University of British Columbia (UBC, 4Centre for Hip Health and Mobility, Vancouver, BC, Canada; 5Freie Universität Berlin, Health Psychology, Berlin, Germany; 6Department of Orthopaedics, The University of British Columbia (UBC, Vancouver, BC, Canada Objectives: Our primary aim of this pilot study was to test feasibility of the planned design, the interventions (education plus telephone coaching, and the outcome measures, and to facilitate a power calculation for a future randomized controlled trial to improve adherence to recovery goals following hip fracture.Design: This is a parallel 1:1 randomized controlled feasibility study.Setting: The study was conducted in a teaching hospital in Vancouver, BC, Canada.Participants: Participants were community-dwelling adults over 60 years of age with a recent hip fracture. They were recruited and assessed in hospital, and then randomized after hospital discharge to the intervention or control group by a web-based randomization service. Treatment allocation was concealed to the investigators, measurement team, and data entry assistants and analysts. Participants and the research physiotherapist were aware of treatment allocation.Intervention: Intervention included usual care for hip fracture plus a 1-hour in-hospital educational session using a patient-centered educational manual and four videos, and up to five postdischarge telephone calls from a physiotherapist to provide recovery coaching. The control group received usual care plus a 1-hour in-hospital educational session using the educational manual and videos.Measurement: Our primary outcome was feasibility, specifically recruitment

77 FR 56554 - Revisions to the Requirements for Authority to Manufacture and Distribute Postage Evidencing Systems

Science.gov (United States)

2012-09-13

... auditor shall provide the RC and the Postal Service with an opinion on the design and operating... about the work performed with the service auditor. The Postal Service requires that all remediation... related to the examinations conducted by the service auditor and the RC. * * * * * Stanley F. Mires...

Seismic assessment of selected buildings and equipment contents of a DOE facility in UBC zone 2A

International Nuclear Information System (INIS)

Tong, W.H.; Deneff, C.; Griffin, M.J.

1991-01-01

A preliminary seismic risk assessment for selected buildings and representative equipment contents in Allied-Signal Kansas City Division was performed to identify potential seismic hazard and weakness. The site is located in the Uniform Building Code Zone 2A. The selected building structures were constructed between 1940s to 1980s. The performance goal was to qualitatively assess the potential for loss of toxic or hazardous materials and injury to plant personnel due to an earthquake event

Albert Einstein Centenary

CERN Document Server

Amati, Daniele; Weisskopf, Victor Frederick; CERN. Geneva

1979-01-01

The scientist and his work by D. AMATI and S. FUBINI. A socially engaged scientist by V. F. WEISSKOPF. This week, we pay homage to Albert Einstein, the giant of twentieth-century physics born exactly 100 years ago on 14 March 1879 in Ulm, Germany. At the height of his career, Einstein made a whole series of monumental contributions to physics, including the elaborate theories of special and general relativity which revolutionized human thought and marked a major breakthrough in our understanding to the Universe. Along with quantum mechanics, relativity is one of the twin pillars of understanding which allow us here at CERN to study the behaviour of the tiniest components of matter. The development of quantum mechanics took the combined efforts of some of the greatest scientists the world has known, while relativity was developed almost single-handed by Einstein. The centenary of his birth is being commemorated all over the world. Exhibitions and symposia are being organized, books published, postage stamps is...

UMG Lenti: novel lentiviral vectors for efficient transgene- and reporter gene expression in human early hematopoietic progenitors.

Directory of Open Access Journals (Sweden)

Emanuela Chiarella

Full Text Available Lentiviral vectors are widely used to investigate the biological properties of regulatory proteins and/or of leukaemia-associated oncogenes by stably enforcing their expression in hematopoietic stem and progenitor cells. In these studies it is critical to be able to monitor and/or sort the infected cells, typically via fluorescent proteins encoded by the modified viral genome. The most popular strategy to ensure co-expression of transgene and reporter gene is to insert between these cDNAs an IRES element, thus generating bi-cistronic mRNAs whose transcription is driven by a single promoter. However, while the product of the gene located upstream of the IRES is generally abundantly expressed, the translation of the downstream cDNA (typically encoding the reporter protein is often inconsistent, which hinders the detection and the isolation of transduced cells. To overcome these limitations, we developed novel lentiviral dual-promoter vectors (named UMG-LV5 and -LV6 where transgene expression is driven by the potent UBC promoter and that of the reporter protein, EGFP, by the minimal regulatory element of the WASP gene. These vectors, harboring two distinct transgenes, were tested in a variety of human haematopoietic cell lines as well as in primary human CD34+ cells in comparison with the FUIGW vector that contains the expression cassette UBC-transgene-IRES-EGFP. In these experiments both UMG-LV5 and UMG-LV6 yielded moderately lower transgene expression than FUIGW, but dramatically higher levels of EGFP, thereby allowing the easy distinction between transduced and non-transduced cells. An additional construct was produced, in which the cDNA encoding the reporter protein is upstream, and the transgene downstream of the IRES sequence. This vector, named UMG-LV11, proved able to promote abundant expression of both transgene product and EGFP in all cells tested. The UMG-LVs represent therefore useful vectors for gene transfer-based studies in

UMG Lenti: novel lentiviral vectors for efficient transgene- and reporter gene expression in human early hematopoietic progenitors.

Science.gov (United States)

Chiarella, Emanuela; Carrà, Giovanna; Scicchitano, Stefania; Codispoti, Bruna; Mega, Tiziana; Lupia, Michela; Pelaggi, Daniela; Marafioti, Maria G; Aloisio, Annamaria; Giordano, Marco; Nappo, Giovanna; Spoleti, Cristina B; Grillone, Teresa; Giovannone, Emilia D; Spina, Raffaella; Bernaudo, Francesca; Moore, Malcolm A S; Bond, Heather M; Mesuraca, Maria; Morrone, Giovanni

2014-01-01

Lentiviral vectors are widely used to investigate the biological properties of regulatory proteins and/or of leukaemia-associated oncogenes by stably enforcing their expression in hematopoietic stem and progenitor cells. In these studies it is critical to be able to monitor and/or sort the infected cells, typically via fluorescent proteins encoded by the modified viral genome. The most popular strategy to ensure co-expression of transgene and reporter gene is to insert between these cDNAs an IRES element, thus generating bi-cistronic mRNAs whose transcription is driven by a single promoter. However, while the product of the gene located upstream of the IRES is generally abundantly expressed, the translation of the downstream cDNA (typically encoding the reporter protein) is often inconsistent, which hinders the detection and the isolation of transduced cells. To overcome these limitations, we developed novel lentiviral dual-promoter vectors (named UMG-LV5 and -LV6) where transgene expression is driven by the potent UBC promoter and that of the reporter protein, EGFP, by the minimal regulatory element of the WASP gene. These vectors, harboring two distinct transgenes, were tested in a variety of human haematopoietic cell lines as well as in primary human CD34+ cells in comparison with the FUIGW vector that contains the expression cassette UBC-transgene-IRES-EGFP. In these experiments both UMG-LV5 and UMG-LV6 yielded moderately lower transgene expression than FUIGW, but dramatically higher levels of EGFP, thereby allowing the easy distinction between transduced and non-transduced cells. An additional construct was produced, in which the cDNA encoding the reporter protein is upstream, and the transgene downstream of the IRES sequence. This vector, named UMG-LV11, proved able to promote abundant expression of both transgene product and EGFP in all cells tested. The UMG-LVs represent therefore useful vectors for gene transfer-based studies in hematopoietic stem and

Sumoylation of hypoxia-inducible factor-1α ameliorates failure of brain stem cardiovascular regulation in experimental brain death.

Directory of Open Access Journals (Sweden)

Julie Y H Chan

2011-03-01

Full Text Available One aspect of brain death is cardiovascular deregulation because asystole invariably occurs shortly after its diagnosis. A suitable neural substrate for mechanistic delineation of this aspect of brain death resides in the rostral ventrolateral medulla (RVLM. RVLM is the origin of a life-and-death signal that our laboratory detected from blood pressure of comatose patients that disappears before brain death ensues. At the same time, transcriptional upregulation of heme oxygenase-1 in RVLM by hypoxia-inducible factor-1α (HIF-1α plays a pro-life role in experimental brain death, and HIF-1α is subject to sumoylation activated by transient cerebral ischemia. It follows that sumoylation of HIF-1α in RVLM in response to hypoxia may play a modulatory role on brain stem cardiovascular regulation during experimental brain death.A clinically relevant animal model that employed mevinphos as the experimental insult in Sprague-Dawley rat was used. Biochemical changes in RVLM during distinct phenotypes in systemic arterial pressure spectrum that reflect maintained or defunct brain stem cardiovascular regulation were studied. Western blot analysis, EMSA, ELISA, confocal microscopy and immunoprecipitation demonstrated that drastic tissue hypoxia, elevated levels of proteins conjugated by small ubiquitin-related modifier-1 (SUMO-1, Ubc9 (the only known conjugating enzyme for the sumoylation pathway or HIF-1α, augmented sumoylation of HIF-1α, nucleus-bound translocation and enhanced transcriptional activity of HIF-1α in RVLM neurons took place preferentially during the pro-life phase of experimental brain death. Furthermore, loss-of-function manipulations by immunoneutralization of SUMO-1, Ubc9 or HIF-1α in RVLM blunted the upregulated nitric oxide synthase I/protein kinase G signaling cascade, which sustains the brain stem cardiovascular regulatory machinery during the pro-life phase.We conclude that sumoylation of HIF-1α in RVLM ameliorates brain stem

Systemic insulin sensitivity is regulated by GPS2 inhibition of AKT ubiquitination and activation in adipose tissue.

Science.gov (United States)

Cederquist, Carly T; Lentucci, Claudia; Martinez-Calejman, Camila; Hayashi, Vanessa; Orofino, Joseph; Guertin, David; Fried, Susan K; Lee, Mi-Jeong; Cardamone, M Dafne; Perissi, Valentina

2017-01-01

Insulin signaling plays a unique role in the regulation of energy homeostasis and the impairment of insulin action is associated with altered lipid metabolism, obesity, and Type 2 Diabetes. The main aim of this study was to provide further insight into the regulatory mechanisms governing the insulin signaling pathway by investigating the role of non-proteolytic ubiquitination in insulin-mediated activation of AKT. The molecular mechanism of AKT regulation through ubiquitination is first dissected in vitro in 3T3-L1 preadipocytes and then validated in vivo using mice with adipo-specific deletion of GPS2, an endogenous inhibitor of Ubc13 activity (GPS2-AKO mice). Our results indicate that K63 ubiquitination is a critical component of AKT activation in the insulin signaling pathway and that counter-regulation of this step is provided by GPS2 preventing AKT ubiquitination through inhibition of Ubc13 enzymatic activity. Removal of this negative checkpoint, through GPS2 downregulation or genetic deletion, results in sustained activation of insulin signaling both in vitro and in vivo . As a result, the balance between lipid accumulation and utilization is shifted toward storage in the adipose tissue and GPS2-AKO mice become obese under normal laboratory chow diet. However, the adipose tissue of GPS2-AKO mice is not inflamed, the levels of circulating adiponectin are elevated, and systemic insulin sensitivity is overall improved. Our findings characterize a novel layer of regulation of the insulin signaling pathway based on non-proteolytic ubiquitination of AKT and define GPS2 as a previously unrecognized component of the insulin signaling cascade. In accordance with this role, we have shown that GPS2 presence in adipocytes modulates systemic metabolism by restricting the activation of insulin signaling during the fasted state, whereas in absence of GPS2, the adipose tissue is more efficient at lipid storage, and obesity becomes uncoupled from inflammation and insulin

[Family and psychosocial variables in the choice of university studies].

Science.gov (United States)

González-Pinto Arrillaga, A; Yllá Segura, L; Ortiz Jáuregi, A; Zupiria Gorostidi, X

2003-01-01

Family order of the children and family size as well as other psychosocial variables on University of the Basque Country (UBC) students are compared in order to relate these data with the choice of type of university studies. As a sample, we studied 6,013 students from the UBC in different careers and courses. Mean age was 20.26 years. The following instruments were used: a sociodemographic questionnaire, the Eysenck Personality Scale and Yllá Alexithymia Scale. All them were validated for our country. The presence of women was greater in all the career studies except for engineering where the proportion of men was greater. The data verify the relationship between being the youngest or intermediate child of a family of three or more children and studying Journalism and Fine Arts and that the first born of families of two or more children are more represented in Engineering. It is interesting that there are fewer only children in Medicine where children of families of three or more, both first-born as well as intermediate, go. These variables, as well as extraversion, neuroticism and alexithymia, were different in the different career studies. It was also observed that the female university students scored higher in the neuroticism scale and that the levels of Alexithymia were higher among the men. Further, relations were found between child birth order and family size and personality, in the sense that the Medical and Odontology careers presented lower scores in Alexithymia while the more technical careers such as Engineering are those that present a higher alexithymia. Medicine and Odontology, followed by Mathematics and Journalism, obtained the highest scores in neuroticism. Engineering students obtain the lowest neuroticism. The most extroverted students are those from Journalism, Chemistry, Economics and Odontology. The choice of university studies is associated to gender, birth order, family size and personality patterns. Personality variables are related to

Diagnostic and prognostic value of long noncoding RNAs as biomarkers in urothelial carcinoma.

Science.gov (United States)

Droop, Johanna; Szarvas, Tibor; Schulz, Wolfgang A; Niedworok, Christian; Niegisch, Günter; Scheckenbach, Kathrin; Hoffmann, Michèle J

2017-01-01

Many long noncoding RNAs (lncRNAs) are deregulated in cancer and contribute to oncogenesis. In urothelial carcinoma (UC), several lncRNAs have been reported to be overexpressed and proposed as biomarkers. As most reports have not been confirmed independently in large tissue sets, we aimed to validate the diagnostic and prognostic value of lncRNA upregulation in independent cohorts of UC patients. Thus, expression of seven lncRNA candidates (GAS5, H19, linc-UBC1, MALAT1, ncRAN, TUG1, UCA1) was measured by RT-qPCR in cell lines and tissues and correlated to clinicopathological parameters including follow-up data (set 1: N n = 10; T n = 106). Additionally, publicly available TCGA data was investigated for differential expression in UC tissues (set 2: N n = 19; T n = 252,) and correlation to overall survival (OS). All proposed candidates tended to be upregulated in tumour tissues, with the exception of MALAT1, which was rather diminished in cancer tissues of both data sets. However, strong overexpression was generally limited to individual tumour tissues and statistically significant overexpression was only observed for UCA1, TUG1, ncRAN and linc-UBC1 in tissue set 2, but for no candidate in set 1. Altered expression of individual lncRNAs was associated with overall survival, but not consistently between both patient cohorts. Interestingly, lower expression of TUG1 in a subset of UC patients with muscle-invasive tumours was significantly correlated with worse OS in both cohorts. Further analysis revealed that tumours with low TUG1 expression are characterized by a basal-squamous-like subtype signature accounting for the association with poor outcome. In conclusion, our study demonstrates that overexpression of the candidate lncRNAs is found in many UC cases, but does not occur consistently and strongly enough to provide reliable diagnostic or prognostic value as an individual biomarker. Subtype-dependent expression patterns of lncRNAs like TUG1 could become useful to

Novel E3 ubiquitin ligases that regulate histone protein levels in the budding yeast Saccharomyces cerevisiae.

Directory of Open Access Journals (Sweden)

Rakesh Kumar Singh

Full Text Available Core histone proteins are essential for packaging the genomic DNA into chromatin in all eukaryotes. Since multiple genes encode these histone proteins, there is potential for generating more histones than what is required for chromatin assembly. The positively charged histones have a very high affinity for negatively charged molecules such as DNA, and any excess of histone proteins results in deleterious effects on genomic stability and cell viability. Hence, histone levels are known to be tightly regulated via transcriptional, posttranscriptional and posttranslational mechanisms. We have previously elucidated the posttranslational regulation of histone protein levels by the ubiquitin-proteasome pathway involving the E2 ubiquitin conjugating enzymes Ubc4/5 and the HECT (Homologous to E6-AP C-Terminus domain containing E3 ligase Tom1 in the budding yeast. Here we report the identification of four additional E3 ligases containing the RING (Really Interesting New Gene finger domains that are involved in the ubiquitylation and subsequent degradation of excess histones in yeast. These E3 ligases are Pep5, Snt2 as well as two previously uncharacterized Open Reading Frames (ORFs YKR017C and YDR266C that we have named Hel1 and Hel2 (for Histone E3 Ligases respectively. Mutants lacking these E3 ligases are sensitive to histone overexpression as they fail to degrade excess histones and accumulate high levels of endogenous histones on histone chaperones. Co-immunoprecipitation assays showed that these E3 ligases interact with the major E2 enzyme Ubc4 that is involved in the degradation related ubiquitylation of histones. Using mutagenesis we further demonstrate that the RING domains of Hel1, Hel2 and Snt2 are required for histone regulation. Lastly, mutants corresponding to Hel1, Hel2 and Pep5 are sensitive to replication inhibitors. Overall, our results highlight the importance of posttranslational histone regulatory mechanisms that employ multiple E3

Diagnostic and prognostic value of long noncoding RNAs as biomarkers in urothelial carcinoma.

Directory of Open Access Journals (Sweden)

Johanna Droop

Full Text Available Many long noncoding RNAs (lncRNAs are deregulated in cancer and contribute to oncogenesis. In urothelial carcinoma (UC, several lncRNAs have been reported to be overexpressed and proposed as biomarkers. As most reports have not been confirmed independently in large tissue sets, we aimed to validate the diagnostic and prognostic value of lncRNA upregulation in independent cohorts of UC patients. Thus, expression of seven lncRNA candidates (GAS5, H19, linc-UBC1, MALAT1, ncRAN, TUG1, UCA1 was measured by RT-qPCR in cell lines and tissues and correlated to clinicopathological parameters including follow-up data (set 1: N n = 10; T n = 106. Additionally, publicly available TCGA data was investigated for differential expression in UC tissues (set 2: N n = 19; T n = 252, and correlation to overall survival (OS. All proposed candidates tended to be upregulated in tumour tissues, with the exception of MALAT1, which was rather diminished in cancer tissues of both data sets. However, strong overexpression was generally limited to individual tumour tissues and statistically significant overexpression was only observed for UCA1, TUG1, ncRAN and linc-UBC1 in tissue set 2, but for no candidate in set 1. Altered expression of individual lncRNAs was associated with overall survival, but not consistently between both patient cohorts. Interestingly, lower expression of TUG1 in a subset of UC patients with muscle-invasive tumours was significantly correlated with worse OS in both cohorts. Further analysis revealed that tumours with low TUG1 expression are characterized by a basal-squamous-like subtype signature accounting for the association with poor outcome. In conclusion, our study demonstrates that overexpression of the candidate lncRNAs is found in many UC cases, but does not occur consistently and strongly enough to provide reliable diagnostic or prognostic value as an individual biomarker. Subtype-dependent expression patterns of lncRNAs like TUG1 could

MMS2, Encoding a ubiquitin-conjugating-enzyme-like protein, is a member of the yeast error-free postreplication repair pathway

International Nuclear Information System (INIS)

Broomfield, S.; Chow, B.L.; Xiao, W.

1998-01-01

Among the three Saccharomyces cerevisiae DNA repair epistasis groups, the RAD6 group is the most complicated and least characterized, primarily because it consists of two separate repair pathways: an error-free postreplication repair pathway, and a mutagenesis pathway. The rad6 and rad18 mutants are defective in both pathways, and the rev3 mutant affects only the mutagenesis pathway, but a yeast gene that is involved only in error-free postreplication repair has not been reported. We cloned the MMS2 gene from a yeast genomic library by functional complementation of the mms2-1 mutant [Prakash, L. and Prakash, S. (1977) Genetics 86, 33-55]. MMS2 encodes a 137-amino acid, 15.2-kDa protein with significant sequence homology to a conserved family of ubiquitin-conjugating (Ubc) proteins. However, Mms2 does not appear to possess Ubc activity. Genetic analyses indicate that the mms2 mutation is hypostatic to rad6 and rad18 but is synergistic with the rev3 mutation, and the mms2 mutant is proficient in UV-induced mutagenesis. These phenotypes are reminiscent of a pol30-46 mutant known to be impaired in postreplication repair. The mms2 mutant also displayed a REV3-dependent mutator phenotype, strongly suggesting that the MMS2 gene functions in the error-free postreplication repair pathway, parallel to the REV3 mutagenesis pathway. Furthermore, with respect to UV sensitivity, mms2 was found to be hypostatic to the rad6 delta 1-9 mutation, which results in the absence of the first nine amino acids of Rad6. On the basis of these collective results, we propose that the mms2 null mutation and two other allele-specific mutations, rad6 delta 1-9 and pol30-46, define the error-free mode of DNA postreplication repair, and that these mutations may enhance both spontaneous and DNA damage-induced mutagenesis

Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula.

Directory of Open Access Journals (Sweden)

Wun S Chao

Full Text Available Quantitative real-time polymerase chain reaction (qRT-PCR is the most important tool in measuring levels of gene expression due to its accuracy, specificity, and sensitivity. However, the accuracy of qRT-PCR analysis strongly depends on transcript normalization using stably expressed reference genes. The aim of this study was to find internal reference genes for qRT-PCR analysis in various experimental conditions for seed, adventitious underground bud, and other organs of leafy spurge. Eleven candidate reference genes (BAM4, PU1, TRP-like, FRO1, ORE9, BAM1, SEU, ARF2, KAPP, ZTL, and MPK4 were selected from among 171 genes based on expression stabilities during seed germination and bud growth. The other ten candidate reference genes were selected from three different sources: (1 3 stably expressed leafy spurge genes (60S, bZIP21, and MD-100 identified from the analyses of leafy spurge microarray data; (2 3 orthologs of Arabidopsis "general purpose" traditional reference genes (GAPDH_1, GAPDH_2, and UBC; and (3 4 orthologs of Arabidopsis stably expressed genes (UBC9, SAND, PTB, and F-box identified from Affymetrix ATH1 whole-genome GeneChip studies. The expression stabilities of these 21 genes were ranked based on the C(T values of 72 samples using four different computation programs including geNorm, Normfinder, BestKeeper, and the comparative ΔC(T method. Our analyses revealed SAND, PTB, ORE9, and ARF2 to be the most appropriate reference genes for accurate normalization of gene expression data. Since SAND and PTB were obtained from 4 orthologs of Arabidopsis, while ORE9 and ARF2 were selected from 171 leafy spurge genes, it was more efficient to identify good reference genes from the orthologs of other plant species that were known to be stably expressed than that of randomly testing endogenous genes. Nevertheless, the two newly identified leafy spurge genes, ORE9 and ARF2, can serve as orthologous candidates in the search for reference genes

Evaluation of suitable reference genes for gene expression studies in bovine muscular tissue

Directory of Open Access Journals (Sweden)

Dunner Susana

2008-09-01

Full Text Available Abstract Background Real-time reverse transcriptase quantitative polymerase chain reaction (real-time RTqPCR is a technique used to measure mRNA species copy number as a way to determine key genes involved in different biological processes. However, the expression level of these key genes may vary among tissues or cells not only as a consequence of differential expression but also due to different factors, including choice of reference genes to normalize the expression levels of the target genes; thus the selection of reference genes is critical for expression studies. For this purpose, ten candidate reference genes were investigated in bovine muscular tissue. Results The value of stability of ten candidate reference genes included in three groups was estimated: the so called 'classical housekeeping' genes (18S, GAPDH and ACTB, a second set of genes used in expression studies conducted on other tissues (B2M, RPII, UBC and HMBS and a third set of novel genes (SF3A1, EEF1A2 and CASC3. Three different statistical algorithms were used to rank the genes by their stability measures as produced by geNorm, NormFinder and Bestkeeper. The three methods tend to agree on the most stably expressed genes and the least in muscular tissue. EEF1A2 and HMBS followed by SF3A1, ACTB, and CASC3 can be considered as stable reference genes, and B2M, RPII, UBC and GAPDH would not be appropriate. Although the rRNA-18S stability measure seems to be within the range of acceptance, its use is not recommended because its synthesis regulation is not representative of mRNA levels. Conclusion Based on geNorm algorithm, we propose the use of three genes SF3A1, EEF1A2 and HMBS as references for normalization of real-time RTqPCR in muscle expression studies.

Low temperature oxidation and spontaneous combustion characteristics of upgraded low rank coal

Energy Technology Data Exchange (ETDEWEB)

Choi, H.K.; Kim, S.D.; Yoo, J.H.; Chun, D.H.; Rhim, Y.J.; Lee, S.H. [Korea Institute of Energy Research, Daejeon (Korea, Republic of)

2013-07-01

The low temperature oxidation and spontaneous combustion characteristics of dried coal produced from low rank coal using the upgraded brown coal (UBC) process were investigated. To this end, proximate properties, crossing-point temperature (CPT), and isothermal oxidation characteristics of the coal were analyzed. The isothermal oxidation characteristics were estimated by considering the formation rates of CO and CO{sub 2} at low temperatures. The upgraded low rank coal had higher heating values than the raw coal. It also had less susceptibility to low temperature oxidation and spontaneous combustion. This seemed to result from the coating of the asphalt on the surface of the coal, which suppressed the active functional groups from reacting with oxygen in the air. The increasing upgrading pressure negatively affected the low temperature oxidation and spontaneous combustion.

Annual report scientific activities 1999

International Nuclear Information System (INIS)

2000-07-01

This report summarizes the activities at TRIUMF for the year 1999. The science program at ISAC started in earnest and several preliminary results were achieved. The TRIUMF collaboration with CERN on the provision of a Canadian contribution to the Large Hadron Collider (LHC) continues to be a major success. The parity experiment achieved a final result for its measurement of the longitudinal polarization asymmetry in elastic p-p scattering at 221 MeV, and charge asymmetry breaking experiment collected all of its data. The condensed matter program using the technique of uSR continues to have a very large appetite for beam and pursues a varied menu of science. The life science activities at TRIUMF are dominated by the PET group which collaborates with the Neurodegenerative Disorders Centre at the UBC Hospital

Event for the launch of the Georges Charpak postage stamp | 26-27 February | Prévessin site

CERN Multimedia

2016-01-01

At the end of February, the French post office is releasing a new €0.70 stamp featuring an image of Georges Charpak. CERN is taking part in this event by hosting a temporary post office on the Prévessin site, which will sell the stamp with a special “first day” postmark before it goes on general sale.     Georges Charpak arrived at CERN in 1959 and, in the late 1960s, revolutionised particle detection technology by developing the multiwire proportional chamber. This technique brought particle detectors into the electronic era, setting physicists free from the laborious task of studying photographs one by one. In 1992, he was awarded the Nobel Prize in Physics for his invention. Charpak chambers are still used today in the LHC detectors and have paved the way for the technology in numerous other modern detectors. In the 1990s, Charpak was involved in developing medical applications based on particle detection technology. He was als...

The long-term preservation of the digital heritage: the case of universities institutional repositories

Directory of Open Access Journals (Sweden)

Luciana Duranti

2010-03-01

Full Text Available L'articolo affronta le tematiche legate ai problemi della conservazione a lungo termine del contenuto degli archivi digitali. Il materiale d'archivio richiede un'attenzione speciale ad aspetti quali la credibilità, il valore giuridico, i diritti morali e legali e la privacy. La necessità di assicurare accessibilità e integrità ai dati informatici è tuttavia una problematica che attraversa tutti i campi dell'informatizzazione ed è strettamente legata a fattori come la frequente duplicazione e la corretta scelta dei metadadi. Attraverso l'analisi del caso di studio rappresentato da cIRcle, l'istitutional digital repository della University of British Columbia (UBC, il contributo mostra problemi, rischi e soluzioni utili nella gestione di un archivio digitale, mostrando che l'esperienza degli archivisti può essere utile per sviluppare sistemi legati a depositi di informazione non prettamente archivistici.

An incentive mechanism for electricity transmission expansion in Mexico

International Nuclear Information System (INIS)

Rosellon, Juan

2007-01-01

This study proposes an incentive regulatory framework for expanding electricity transmission in Mexico. A two-part pricing model is implemented within a combined merchant-regulatory structure. Three cases are considered. In the first, a monopolist with 'postage stamp tariffs' serves the whole country using uniform prices. In the second case, one firm holds a regional monopoly in each of the five electricity areas. In the third, a monopolist operates in all areas of the national electricity system and discriminates in the prices it charges in each of the regions. This approach is described and then applied to the Mexican electricity transmission network. Using real data, the study compares all three cases in terms of profits, capacity increases, and network expansion. The results are found to depend on two effects: the 'economies-of-scale effect', in which the maximum level is reached with a single network; and the 'discriminatory effect' that results when a firm can discriminate among types of consumers. The economies-of-scale effect produces greater capacity and network expansion, whereas the discriminatory effect increases profits

Bulk Electric Load Cost Calculation Methods: Iraqi Network Comparative Study

Directory of Open Access Journals (Sweden)

Qais M. Alias

2016-09-01

Full Text Available It is vital in any industry to regain the spent capitals plus running costs and a margin of profits for the industry to flourish. The electricity industry is an everyday life touching industry which follows the same finance-economic strategy. Cost allocation is a major issue in all sectors of the electric industry, viz, generation, transmission and distribution. Generation and distribution service costing’s well documented in the literature, while the transmission share is still of need for research. In this work, the cost of supplying a bulk electric load connected to the EHV system is calculated. A sample basic lump-average method is used to provide a rough costing guide. Also, two transmission pricing methods are employed, namely, the postage-stamp and the load-flow based MW-distance methods to calculate transmission share in the total cost of each individual bulk load. The three costing methods results are then analyzed and compared for the 400kV Iraqi power grid considered for a case study.

Combinatory effect of BRCA1 and HERC2 expression on outcome in advanced non-small-cell lung cancer

International Nuclear Information System (INIS)

Bonanno, Laura; Costa, Carlota; Majem, Margarita; Sanchez, Jose-Javier; Rodriguez, Ignacio; Gimenez-Capitan, Ana; Molina-Vila, Miquel Angel; Vergnenegre, Alain; Massuti, Bartomeu; Favaretto, Adolfo; Rugge, Massimo; Pallares, Cinta; Taron, Miquel; Rosell, Rafael

2016-01-01

BRCA1 is a main component of homologous recombination and induces resistance to platinum in preclinical models. It has been studied as a potential predictive marker in lung cancer. Several proteins modulate the function of BRCA1. The E3 ubiquitin ligase HERC2 facilitates the assembly of the RNF8-UBC13 complex to recruit BRCA1 to DNA damage sites. The combined analysis of multiple components of the pathway leading to the recruitment of BRCA1 at DNA damage sites has the potentiality to improve the BRCA1 predictive model. We retrospectively analyzed 71 paraffin-embedded tumor samples from advanced non-small-cell lung cancer patients treated with first-line platinum based chemotherapy and measured the mRNA expression levels of BRCA1, RNF8, UBC13 and HERC2 using real-time PCR. The mRNA expression was categorized using median value as cut-off point. The median progression-free survival of all 71 patients was 7.2 months whereas the median overall survival of the study population was 10.7 months. Among patients with low BRCA1 expression, the median PFS was 7.4 months in the presence of low HERC2 levels and 5.9 months for patients expressing high HERC2 levels (p = 0.01). The median OS was 15.3 months for patients expressing low levels of both genes and 7.4 months for those with low BRCA1 but high HERC2 (p = 0.008). The multivariate analysis showed that among patients with Eastern Cooperative Oncology Group performance status 0–1, the combined low expression of both BRCA1 and HERC2 clearly reduced the risk of progression (p = 0.03) and of death (p = 0.004). These findings confirm the potentiality of integrated DNA repair components analysis in predicting the sensitivity to platinum in lung cancer. The study indicates a predictive role for HERC2 mRNA expression and paves the way for further refinement of the BRCA1 predictive model. The online version of this article (doi:10.1186/s12885-016-2339-5) contains supplementary material, which is available to authorized users

Geophysical surveying in the Sacramento Delta for earthquake hazard assessment and measurement of peat thickness

Science.gov (United States)

Craig, M. S.; Kundariya, N.; Hayashi, K.; Srinivas, A.; Burnham, M.; Oikawa, P.

2017-12-01

Near surface geophysical surveys were conducted in the Sacramento-San Joaquin Delta for earthquake hazard assessment and to provide estimates of peat thickness for use in carbon models. Delta islands have experienced 3-8 meters of subsidence during the past century due to oxidation and compaction of peat. Projected sea level rise over the next century will contribute to an ongoing landward shift of the freshwater-saltwater interface, and increase the risk of flooding due to levee failure or overtopping. Seismic shear wave velocity (VS) was measured in the upper 30 meters to determine Uniform Building Code (UBC)/ National Earthquake Hazard Reduction Program (NEHRP) site class. Both seismic and ground penetrating radar (GPR) methods were employed to estimate peat thickness. Seismic surface wave surveys were conducted at eight sites on three islands and GPR surveys were conducted at two of the sites. Combined with sites surveyed in 2015, the new work brings the total number of sites surveyed in the Delta to twenty.Soil boreholes were made at several locations using a hand auger, and peat thickness ranged from 2.1 to 5.5 meters. Seismic surveys were conducted using the multichannel analysis of surface wave (MASW) method and the microtremor array method (MAM). On Bouldin Island, VS of the surficial peat layer was 32 m/s at a site with pure peat and 63 m/s at a site peat with higher clay and silt content. Velocities at these sites reached a similar value, about 125 m/s, at a depth of 10 m. GPR surveys were performed at two sites on Sherman Island using 100 MHz antennas, and indicated the base of the peat layer at a depth of about 4 meters, consistent with nearby auger holes.The results of this work include VS depth profiles and UBC/NEHRP site classifications. Seismic and GPR methods may be used in a complementary fashion to estimate peat thickness. The seismic surface wave method is a relatively robust method and more effective than GPR in many areas with high clay

SU-E-I-59: Image Quality and Dose Measurement for Partial Cone-Beam CT

Energy Technology Data Exchange (ETDEWEB)

Abouei, E; Ford, N [University of British Columbia, Vancouver, BC (Canada)

2014-06-01

Purpose: To characterize performance of cone beam CT (CBCT) used in dentistry investigating quantitatively the image quality and radiation dose during dental CBCT over different settings for partial rotation of the x-ray tube. Methods: Image quality and dose measurements were done on a variable field of view (FOV) dental CBCT (Carestream 9300). X-ray parameters for clinical settings were adjustable for 2–10 mA, 60–90 kVp, and two optional voxel size values, but time was fixed for each FOV. Image quality was assessed by scanning cylindrical poly-methyl methacrylate (PMMA) image quality phantom (SEDENTEXCT IQ), and then the images were analyzed using ImageJ to calculate image quality parameters such as noise, uniformity, and contrast to noise ratio (CNR). A protocol proposed by SEDENTEXCT, dose index 1 (DI1), was applied to dose measurements obtained using a thimble ionization chamber and cylindrical PMMA dose index phantom (SEDENTEXCT DI). Dose distributions were obtained using Gafchromic film. The phantoms were positioned in the FOV to imitate a clinical positioning. Results: The image noise was 6–12.5% which, when normalized to the difference of mean voxel value of PMMA and air, was comparable between different FOVs. Uniformity was 93.5ß 99.7% across the images. CNR was 1.7–4.2 and 6.3–14.3 for LDPE and Aluminum, respectively. Dose distributions were symmetric about the rotation angle's bisector. For large and medium FOVs at 4 mA and 80–90 kVp, DI1 values were in the range of 1.26–3.23 mGy. DI1 values were between 1.01–1.93 mGy for small FOV (5×5 cm{sup 2}) at 4–5 mA and 75–84 kVp. Conclusion: Noise decreased by increasing kVp, and the CNR increased for each FOV. When FOV size increased, image noise increased and CNR decreased. DI1 values were increased by increasing tube current (mA), tube voltage (kVp), and/or FOV. Funding for this project from NSERC Discovery grant, UBC Faculty of Dentistry Research Equipment Grant and UBC Faculty of

Validation of putative reference genes for gene expression studies in human hepatocellular carcinoma using real-time quantitative RT-PCR

International Nuclear Information System (INIS)

Cicinnati, Vito R; Shen, Qingli; Sotiropoulos, Georgios C; Radtke, Arnold; Gerken, Guido; Beckebaum, Susanne

2008-01-01

Reference genes, which are often referred to as housekeeping genes are frequently used to normalize mRNA levels between different samples in quantitative reverse transcription polymerase chain reaction (qRT-PCR). The selection of reference genes is critical for gene expression studies because the expression of these genes may vary among tissues or cells and may change under certain circumstances. Here, a systematic evaluation of six putative reference genes for gene expression studies in human hepatocellular carcinoma (HCC) is presented. Six genes, beta-2-microglobulin (B2M), glyceraldehyde-3-phosphate dehydrogenase (GAPDH), hydroxymethyl-bilane synthase (HMBS), hypoxanthine phosphoribosyl-transferase 1 (HPRT1), succinate dehydrogenase complex, subunit A (SDHA) and ubiquitin C (UBC), with distinct functional characteristics and expression patterns were evaluated by qRT-PCR. Inhibitory substances in RNA samples were quantitatively assessed and controlled using an external RNA control. The stability of selected reference genes was analyzed using both geNorm and NormFinder software. HMBS and GAPDH were identified as the optimal reference genes for normalizing gene expression data between paired tumoral and adjacent non-tumoral tissues derived from patients with HCC. HMBS, GAPDH and UBC were identified to be suitable for the normalization of gene expression data among tumor tissues; whereas the combination of HMBS, B2M, SDHA and GAPDH was suitable for normalizing gene expression data among five liver cancer cell lines, namely Hep3B, HepG2, HuH7, SK-HEP-1 and SNU-182. The determined gene stability was increased after exclusion of RNA samples containing relatively higher inhibitory substances. Of six genes studied, HMBS was found to be the single best reference gene for gene expression studies in HCC. The appropriate choice of combination of more than one reference gene to improve qRT-PCR accuracy depends on the kind of liver tissues or cells under investigation

Validation of putative reference genes for gene expression studies in human hepatocellular carcinoma using real-time quantitative RT-PCR

Directory of Open Access Journals (Sweden)

Radtke Arnold

2008-11-01

Full Text Available Abstract Background Reference genes, which are often referred to as housekeeping genes are frequently used to normalize mRNA levels between different samples in quantitative reverse transcription polymerase chain reaction (qRT-PCR. The selection of reference genes is critical for gene expression studies because the expression of these genes may vary among tissues or cells and may change under certain circumstances. Here, a systematic evaluation of six putative reference genes for gene expression studies in human hepatocellular carcinoma (HCC is presented. Methods Six genes, beta-2-microglobulin (B2M, glyceraldehyde-3-phosphate dehydrogenase (GAPDH, hydroxymethyl-bilane synthase (HMBS, hypoxanthine phosphoribosyl-transferase 1 (HPRT1, succinate dehydrogenase complex, subunit A (SDHA and ubiquitin C (UBC, with distinct functional characteristics and expression patterns were evaluated by qRT-PCR. Inhibitory substances in RNA samples were quantitatively assessed and controlled using an external RNA control. The stability of selected reference genes was analyzed using both geNorm and NormFinder software. Results HMBS and GAPDH were identified as the optimal reference genes for normalizing gene expression data between paired tumoral and adjacent non-tumoral tissues derived from patients with HCC. HMBS, GAPDH and UBC were identified to be suitable for the normalization of gene expression data among tumor tissues; whereas the combination of HMBS, B2M, SDHA and GAPDH was suitable for normalizing gene expression data among five liver cancer cell lines, namely Hep3B, HepG2, HuH7, SK-HEP-1 and SNU-182. The determined gene stability was increased after exclusion of RNA samples containing relatively higher inhibitory substances. Conclusion Of six genes studied, HMBS was found to be the single best reference gene for gene expression studies in HCC. The appropriate choice of combination of more than one reference gene to improve qRT-PCR accuracy depends on the

Validation of putative reference genes for gene expression studies in human hepatocellular carcinoma using real-time quantitative RT-PCR

Science.gov (United States)

Cicinnati, Vito R; Shen, Qingli; Sotiropoulos, Georgios C; Radtke, Arnold; Gerken, Guido; Beckebaum, Susanne

2008-01-01

Background Reference genes, which are often referred to as housekeeping genes are frequently used to normalize mRNA levels between different samples in quantitative reverse transcription polymerase chain reaction (qRT-PCR). The selection of reference genes is critical for gene expression studies because the expression of these genes may vary among tissues or cells and may change under certain circumstances. Here, a systematic evaluation of six putative reference genes for gene expression studies in human hepatocellular carcinoma (HCC) is presented. Methods Six genes, beta-2-microglobulin (B2M), glyceraldehyde-3-phosphate dehydrogenase (GAPDH), hydroxymethyl-bilane synthase (HMBS), hypoxanthine phosphoribosyl-transferase 1 (HPRT1), succinate dehydrogenase complex, subunit A (SDHA) and ubiquitin C (UBC), with distinct functional characteristics and expression patterns were evaluated by qRT-PCR. Inhibitory substances in RNA samples were quantitatively assessed and controlled using an external RNA control. The stability of selected reference genes was analyzed using both geNorm and NormFinder software. Results HMBS and GAPDH were identified as the optimal reference genes for normalizing gene expression data between paired tumoral and adjacent non-tumoral tissues derived from patients with HCC. HMBS, GAPDH and UBC were identified to be suitable for the normalization of gene expression data among tumor tissues; whereas the combination of HMBS, B2M, SDHA and GAPDH was suitable for normalizing gene expression data among five liver cancer cell lines, namely Hep3B, HepG2, HuH7, SK-HEP-1 and SNU-182. The determined gene stability was increased after exclusion of RNA samples containing relatively higher inhibitory substances. Conclusion Of six genes studied, HMBS was found to be the single best reference gene for gene expression studies in HCC. The appropriate choice of combination of more than one reference gene to improve qRT-PCR accuracy depends on the kind of liver tissues

Final results of the Twist experiment at TRIUMF Precision measurements of the muon decay μ+→e+νeνμ

International Nuclear Information System (INIS)

Depommier, P.

2011-01-01

The title needs some explanation: TRIUMF = TRI-University Meson Factory: the meson factory of the three universities Twist = TRIUMF Weak Interaction Symmetry Test The TRIUMF Laboratory was founded in 1968 by three universities of the province of British Columbia, Canada: . The University of British Columbia (UBC), in the city of Vancouver, . Simon Fraser University (SFU) also in the city of Vancouver, . The University of Victoria (UVIC) in the city of Victoria. The University of Alberta (in Edmonton, province of Alberta) joined the TRIUMF consortium almost immediately. The name of the laboratory (TRIUMF) did not change. Several other Canadian universities have joined TRIUMF, which can now be considered as a national laboratory in Canada. For more information consult the TRIUMF web site: www.TRIUMF.ca. Universities affiliated with TRIUMF (from west to east): . University of Victoria, Victoria, British Columbia . UBC (University of British Columbia), Vancouver, British Columbia . SFU (Simon Fraser University), Vancouver, British Columbia . University of Alberta, Edmonton, Alberta . University of Manitoba, Winnipeg, Manitoba . University of Guelph, Guelph, Ontario . University of Toronto, Toronto, Ontario . York University, Toronto, Ontario . Queen's University, Kingston, Ontario . Carleton University, Ottawa, Ontario . University Le de Montreal, Montreal, Quebe Associate members (from west to east): . University of Northern British Columbia, Prince George, British Columbia . University of Calgary, Calgary, Alberta . University of Regina, Regina, Saskatchewan . University of Winnipeg, Winnipeg, Manitoba . McMaster University, Hamilton, Ontario . Saint Mary's University, Halifax, Nova Scotia TRIUMF activities outside Canada: At CERN (Geneva): participation in the ATLAS group activities with the LHC. At JPARC (Japan Proton Accelerator Research complex): - Participation in the TREK experiment: TREK = Time Reversal Experiment with Kaons, a measurement of the transverse

SU-E-I-59: Image Quality and Dose Measurement for Partial Cone-Beam CT

International Nuclear Information System (INIS)

Abouei, E; Ford, N

2014-01-01

Purpose: To characterize performance of cone beam CT (CBCT) used in dentistry investigating quantitatively the image quality and radiation dose during dental CBCT over different settings for partial rotation of the x-ray tube. Methods: Image quality and dose measurements were done on a variable field of view (FOV) dental CBCT (Carestream 9300). X-ray parameters for clinical settings were adjustable for 2–10 mA, 60–90 kVp, and two optional voxel size values, but time was fixed for each FOV. Image quality was assessed by scanning cylindrical poly-methyl methacrylate (PMMA) image quality phantom (SEDENTEXCT IQ), and then the images were analyzed using ImageJ to calculate image quality parameters such as noise, uniformity, and contrast to noise ratio (CNR). A protocol proposed by SEDENTEXCT, dose index 1 (DI1), was applied to dose measurements obtained using a thimble ionization chamber and cylindrical PMMA dose index phantom (SEDENTEXCT DI). Dose distributions were obtained using Gafchromic film. The phantoms were positioned in the FOV to imitate a clinical positioning. Results: The image noise was 6–12.5% which, when normalized to the difference of mean voxel value of PMMA and air, was comparable between different FOVs. Uniformity was 93.5ß 99.7% across the images. CNR was 1.7–4.2 and 6.3–14.3 for LDPE and Aluminum, respectively. Dose distributions were symmetric about the rotation angle's bisector. For large and medium FOVs at 4 mA and 80–90 kVp, DI1 values were in the range of 1.26–3.23 mGy. DI1 values were between 1.01–1.93 mGy for small FOV (5×5 cm 2 ) at 4–5 mA and 75–84 kVp. Conclusion: Noise decreased by increasing kVp, and the CNR increased for each FOV. When FOV size increased, image noise increased and CNR decreased. DI1 values were increased by increasing tube current (mA), tube voltage (kVp), and/or FOV. Funding for this project from NSERC Discovery grant, UBC Faculty of Dentistry Research Equipment Grant and UBC Faculty of Dentistry

UBC-Nepal expedition: The use of oral antioxidants does not alter cerebrovascular function at sea level or high altitude.

Science.gov (United States)

Hansen, Alexander B; Hoiland, Ryan L; Lewis, Nia C S; Tymko, Michael M; Tremblay, Joshua C; Stembridge, Michael; Nowak-Flück, Daniela; Carter, Howard H; Bailey, Damian M; Ainslie, Philip N

2018-04-01

What is the central question of the study? Does the use of antioxidants alter cerebrovascular function and blood flow at sea level (344 m) and/or high altitude (5050 m)? What is the main finding and its importance? This is the first study to investigate whether antioxidant administration alters cerebrovascular regulation and blood flow in response to hypercapnia, acute hypoxia and chronic hypoxia in healthy humans. We demonstrate that an acute dose of antioxidants does not alter cerebrovascular function and blood flow at sea level (344 m) or after 12 days at high altitude (5050 m). Hypoxia is associated with an increase in systemic and cerebral formation of free radicals and associated reactants that may be linked to impaired cerebral vascular function and neurological sequelae. To what extent oral antioxidant prophylaxis impacts cerebrovascular function in humans throughout the course of acclimatization to the hypoxia of terrestrial high altitude has not been examined. Thus, the purpose of the present study was to examine the influence of orally ingested antioxidants at clinically relevant doses (vitamins C and E and α-lipoic acid) on cerebrovascular regulation at sea level (344 m; n = 12; female n = 2 participants) and at high altitude (5050 m; n = 9; female n = 2) in a randomized, placebo-controlled and double-blinded crossover design. Hypercapnic and hypoxic cerebrovascular reactivity tests of the internal carotid artery (ICA) were conducted at sea level, and global and regional cerebral blood flow (CBF; i.e. ICA and vertebral artery) were assessed 10-12 days after arrival at 5050 m. At sea level, acute administration of antioxidants did not alter cerebral hypoxic cerebrovascular reactivity (pre versus post: 1.5 ± 0.7 versus 1.2 ± 0.8%∆CBF/-%∆SpO2; P = 0.96) or cerebral hypercapnic cerebrovascular reactivity (pre versus post: 5.7 ± 2.0 versus 5.8 ± 1.9%∆CBF/∆mmHg; P = 0.33). Furthermore, global CBF (P = 0.43) and cerebral vascular conductance (ICA P = 0.08; vertebral artery P = 0.32) were unaltered at 5050 m after antioxidant administration. In conclusion, these data show that an oral antioxidant cocktail known to attenuate systemic oxidative stress failed to alter cerebrovascular function at sea level and CBF during acclimatization to high altitude. © 2018 The Authors. Experimental Physiology © 2018 The Physiological Society.

Defining a Closed-Loop U.S. Aluminum Can Supply Chain Through Technical Design and Supply Chain Innovation

Science.gov (United States)

Buffington, Jack; Peterson, Ray

2013-08-01

The purpose of this study is to conduct a supply chain material flow analysis (MFA) for the U.S. aluminum can market, consistent with studies conducted for the overall worldwide aluminum industry. A technical definition of the use of alloys 5182 and 3104 is conducted by metallurgists for use in the "aluminum can" MFA. Four propositions are created: technical, economic, and supply chain factors are as important to secondary aluminum recycling in an aluminum can as higher recycling rates (P1); the development of a unialloy aluminum can will increase reuse rates, but recycling rates must increase for this to happen (P2); a closed-loop aluminum can supply chain is not able to be fully realized in today's environment but is very useful for understanding improvement through both supply and demand (P3); and UBC supply can improve through a "voluntary deposit-refund system" approach (P4).

Ubiquitin-dependent system controls radiation induced apoptosis

International Nuclear Information System (INIS)

Delic, J.; Magdelenat, H.; Glaisner, S.; Magdelenat, H.; Maciorowski, Z.

1997-01-01

The selective proteolytic pathway, dependent upon 'N-end rule' protein recognition/ubiquitination and on the subsequent proteasome dependent processing of ubiquitin conjugates, operates in apoptosis induced by γ-irradiation. The proteasome inhibitor peptide aldehyde, MG132, efficiently induced apoptosis and was also able (at doses lower than those required for apoptosis induction) to potentiate apoptosis induced by DNA damage. Its specificity is suggested by the induction of the ubiquitin (UbB and UbC) and E1 (ubiquitin activating enzyme) genes and by an altered ubiquitination pattern. More selectively, a di-peptide competitor of the 'N-end rule' of ubiquitin dependent protein processing inhibited radiation induced apoptosis. This inhibition is also followed by an altered ubiquitination pattern and by activation of Poly (ADP-ribose) polymerase (PARP). These data strongly suggest that early apoptosis radiation induced events are controlled by ubiquitin-dependent proteolytic processing. (author)

Using social media to promote international student partnerships.

Science.gov (United States)

Garrett, Bernard M; Cutting, Roger

2012-11-01

This paper describes a project to establish and evaluate online study partnerships, using social networking applications, between final year Canadian nursing students at the University of British Columbia (UBC) and second year undergraduate science education students at the University of Plymouth (UoP) in the UK. The project took place between 2009 and 2010 and evaluated the use of social networking applications with international interdisciplinary partnerships between Canadian and UK students. A multi-method evaluation strategy incorporating questionnaires, online focus groups and web analytics was used to explore the value of social media to promote the exchange of ideas and discussion of scientific philosophy in different contexts, between students working in disciplines with differing philosophical perspectives principally modern/post-modern, quantitative/qualitative, empirical/theoretical. This project resulted in a very successful collaborative partnership between UK and Canadian students. Copyright © 2012 Elsevier Ltd. All rights reserved.

ALPHA experiment facility and Prof. Jeffrey Hangst.

CERN Multimedia

Maximilien Brice

2010-01-01

Picture 01-07: General views of the ALPHA experiment Picture 5: Andrea Gutierrez, a PhD student from UBC, transfers liquid helium from a storage dewar into the cryostat containing the superconducting magnetic trap used by the ALPHA experiment.Picture 08-11: Jeffery Hangst, spokesperson for ALPHA Picture 12: The ALPHA silicon detector, which surrounds the trapping resion and is used for imaging antiproton annihilations (Credit University of Liverpool) Picture 13: Untrapped antihydrogen atoms annihilating on the inner surface of the ALPHA trap. These are measured by the ALPHA annihilation detector. The events are concentrated at the electrode radius of about 22.3 mm. The coordinates are defined in the Nature article, Figure 1b. Picture 14: The electrodes (gold) for the ALPHA Penning trap being inserted into the vacuum chamber and cryostat assembly. This is the trap used to combine or "mix" positrons and antiprotons to make antihydrogen. (Credit: Niels Madsen ALPHA/Swansea.) Picture 15: Top, a diagram of the...

Coxsackievirus B5 induced apoptosis of HeLa cells: Effects on p53 and SUMO

International Nuclear Information System (INIS)

Gomes, Rogerio; Guerra-Sa, Renata; Arruda, Eurico

2010-01-01

Coxsackievirus B5 (CVB5), a human enterovirus of the family Picornaviridae, is a frequent cause of acute and chronic human diseases. The pathogenesis of enteroviral infections is not completely understood, and the fate of the CVB5-infected cell has a pivotal role in this process. We have investigated the CVB5-induced apoptosis of HeLa cells and found that it happens by the intrinsic pathway by a mechanism dependent on the ubiquitin-proteasome system, associated with nuclear aggregation of p53. Striking redistribution of both SUMO and UBC9 was noted at 4 h post-infection, simultaneously with a reduction in the levels of the ubiquitin-ligase HDM2. Taken together, these results suggest that CVB5 infection of HeLa cells elicit the intrinsic pathway of apoptosis by MDM2 degradation and p53 activation, destabilizing protein sumoylation, by a mechanism that is dependent on a functional ubiquitin-proteasome system.

Different Tc response profiles are associated with survival in the murine lymphocytic choriomeningitis virus infection

DEFF Research Database (Denmark)

Thomsen, Allan Randrup; Marker, O; Pfau, C J

1987-01-01

to produce early and high virus-specific Tc activity. However, in the present studies we demonstrate that even though this holds true in many mouse/virus combinations, it does not apply in others. Thus, in C3H mice infected with (moderately) high doses of Traub strain LCMV, early and high Tc activity...... was found despite a mortality rate of only 10-20%. Similarly, in C3H mice inoculated with the aggressive and docile substrains of UBC strain LCMV, which differ markedly in their pathogenicity for this mouse strain, similar kinetics of Tc induction were observed. Finally, in DBA/2 mice which do not die...... following infection with the otherwise lethal aggressive substrain, Tc induction could be found to be as efficient as in BALB/c mice, all of which die from acute LCM disease when infected with this virus isolate. The results indicate, therefore, that early and high Tc activity does not constitute...

Seismic assessment of Technical Area V (TA-V).

Energy Technology Data Exchange (ETDEWEB)

Medrano, Carlos S.

2014-03-01

The Technical Area V (TA-V) Seismic Assessment Report was commissioned as part of Sandia National Laboratories (SNL) Self Assessment Requirement per DOE O 414.1, Quality Assurance, for seismic impact on existing facilities at Technical Area-V (TA-V). SNL TA-V facilities are located on an existing Uniform Building Code (UBC) Seismic Zone IIB Site within the physical boundary of the Kirtland Air Force Base (KAFB). The document delineates a summary of the existing facilities with their safety-significant structure, system and components, identifies DOE Guidance, conceptual framework, past assessments and the present Geological and Seismic conditions. Building upon the past information and the evolution of the new seismic design criteria, the document discusses the potential impact of the new standards and provides recommendations based upon the current International Building Code (IBC) per DOE O 420.1B, Facility Safety and DOE G 420.1-2, Guide for the Mitigation of Natural Phenomena Hazards for DOE Nuclear Facilities and Non-Nuclear Facilities.

Postural loading assessment in assembly workers of an Iranian telecommunication manufacturing company.

Science.gov (United States)

Kamalinia, Mojtaba; Nasl Saraji, Gebreal; Kee, Dohyung; Hosseini, Mostafa; Choobineh, Alireza

2013-01-01

Changes in industries and work practices have coincided with work-related musculoskeletal disorders (MSDs). This study was conducted to determine the prevalence of MSDs and to assess postural loading in assembly workers of an Iranian telecommunication manufacturing company. Data were collected from 193 randomly selected workers in 4 units of the company. The Nordic musculoskeletal disorders questionnaire and the UBC ergonomic checklist were used as data collection tools. Loading on the upper body assessment (LUBA) was used to assess postural loading. Lower back symptoms were the most prevalent problems among the workers (67.9%). LUBA showed that most assembly workers (94.3%) had experienced considerable and high postural loading (postural load index, PLI > 5). Regression analyses revealed that lighting, rotation, contact stress, repetition, gender and age were factors associated with symptoms. Work-related MSDs occurred at a high rate among workers. Postural loading requires consideration. Any ergonomic intervention should focus on eliminating ergonomic factors associated with symptoms.

A SUMOylation Motif in Aurora-A: Implications for Spindle Dynamics and Oncogenesis

Energy Technology Data Exchange (ETDEWEB)

Pérez de Castro, Ignacio; Aguirre-Portolés, Cristina [Molecular Oncology Programme, Cell Division and Cancer Group, Centro Nacional de Investigaciones Oncológicas, Madrid (Spain); Martin, Benedicte [CNRS-UMR 6061, Institut de Génétique et Développement de Rennes, IFR 140 GFAS, Faculté de Médecine, Université Rennes 1, Rennes (France); Fernández-Miranda, Gonzalo [Molecular Oncology Programme, Cell Division and Cancer Group, Centro Nacional de Investigaciones Oncológicas, Madrid (Spain); Klotzbucher, Andrea; Kubbutat, Michael H. G. [ProQinase GmBH, Freiburg (Germany); Megías, Diego [Confocal Microscopy Core Unit, Centro Nacional de Investigaciones Oncológicas, Madrid (Spain); Arlot-Bonnemains, Yannick [CNRS-UMR 6061, Institut de Génétique et Développement de Rennes, IFR 140 GFAS, Faculté de Médecine, Université Rennes 1, Rennes (France); Malumbres, Marcos, E-mail: mmm@cnio.es, E-mail: iperez@cnio.es [Molecular Oncology Programme, Cell Division and Cancer Group, Centro Nacional de Investigaciones Oncológicas, Madrid (Spain)

2011-12-14

Aurora-A is a serine/threonine kinase that plays critical roles in centrosome maturation, spindle dynamics, and chromosome orientation and it is frequently over-expressed in human cancers. In this work, we show that Aurora-A interacts with the SUMO-conjugating enzyme UBC9 and co-localizes with SUMO1 in mitotic cells. Aurora-A can be SUMOylated in vitro and in vivo. Mutation of the highly conserved SUMOylation residue lysine 249 significantly disrupts Aurora-A SUMOylation and mitotic defects characterized by defective and multipolar spindles ensue. The Aurora-A{sup K249R} mutant has normal kinase activity but displays altered dynamics at the mitotic spindle. In addition, ectopic expression of the Aurora-A{sup K249R} mutant results in a significant increase in susceptibility to malignant transformation induced by the Ras oncogene. These data suggest that modification by SUMO residues may control Aurora-A function at the spindle and that deficiency of SUMOylation of this kinase may have important implications for tumor development.

Spontaneous recombinase activity of Cre-ERT2 in vivo.

Science.gov (United States)

Kristianto, Jasmin; Johnson, Michael G; Zastrow, Ryley K; Radcliff, Abigail B; Blank, Robert D

2017-06-01

Inducible Cre-ERT recombinase technology is widely used for gene targeting studies. The second generation of inducible Cre-ERT recombinase, hemizygous B6.129S-Tg(UBC-cre/ERT2)1Ejb/J (hereafter abbreviated as Cre-ERT2), a fusion of a mutated estrogen receptor and Cre recombinase, was engineered to be more efficient and specific than the original Cre-ERT. The putative mechanism of selective Cre-mediated recombination is Cre sequestration in the cytoplasm in the basal state with translocation to the nucleus only in the presence of tamoxifen. We utilized both a reporter mouse (B6.129 (Cg)-Gt(ROSA)26Sor tm4(ACTB-tdTomato,-EGFP)Luo /J) and endothelin converting enzyme-1 floxed transgenic mouse line to evaluate Cre-ERT2 activity. We observed spontaneous Cre activity in both settings. Unintended Cre activity is a confounding factor that has a potentially large impact on data interpretation. Thus, it is important to consider background Cre activity in experimental design.

Defining a Cancer Dependency Map.

Science.gov (United States)

Tsherniak, Aviad; Vazquez, Francisca; Montgomery, Phil G; Weir, Barbara A; Kryukov, Gregory; Cowley, Glenn S; Gill, Stanley; Harrington, William F; Pantel, Sasha; Krill-Burger, John M; Meyers, Robin M; Ali, Levi; Goodale, Amy; Lee, Yenarae; Jiang, Guozhi; Hsiao, Jessica; Gerath, William F J; Howell, Sara; Merkel, Erin; Ghandi, Mahmoud; Garraway, Levi A; Root, David E; Golub, Todd R; Boehm, Jesse S; Hahn, William C

2017-07-27

Most human epithelial tumors harbor numerous alterations, making it difficult to predict which genes are required for tumor survival. To systematically identify cancer dependencies, we analyzed 501 genome-scale loss-of-function screens performed in diverse human cancer cell lines. We developed DEMETER, an analytical framework that segregates on- from off-target effects of RNAi. 769 genes were differentially required in subsets of these cell lines at a threshold of six SDs from the mean. We found predictive models for 426 dependencies (55%) by nonlinear regression modeling considering 66,646 molecular features. Many dependencies fall into a limited number of classes, and unexpectedly, in 82% of models, the top biomarkers were expression based. We demonstrated the basis behind one such predictive model linking hypermethylation of the UBB ubiquitin gene to a dependency on UBC. Together, these observations provide a foundation for a cancer dependency map that facilitates the prioritization of therapeutic targets. Copyright © 2017 Elsevier Inc. All rights reserved.

Experimental observations and modelling of thermal history within a steel plate during water jet impingement

International Nuclear Information System (INIS)

Liu, Z.D.; Fraser, D.; Samarasekera, I.V.; Lockhart, G.T.

2002-01-01

In order to investigate heat transfer of steel plates under a water jet impingement and to further simulate runout table operation in a hot strip mill, a full-scale pilot runout table facility was designed and constructed at the University of British Columbia (UBC). This paper describes the experimental details, data acquisition and data handling techniques for steel plates during water jet impingement by one circular water jet from an industrial header. Recorded visual observations at the impinging surface were obtained. The effects of cooling water temperature and impingement velocity on the heat transfer from a steel plate were studied. A two-dimensional finite element method-based transient inverse heat conduction model was developed. With the help of the model, heat fluxes and heat transfer coefficients along the impinging surface under various cooling conditions were calculated. The microstructural evolution of the steel plate was also investigated for the varying cooling conditions. Samples were obtained from each plate, polished, etched and then photographed. (author)

Stabilization of Reversed Replication Forks by Telomerase Drives Telomere Catastrophe.

Science.gov (United States)

Margalef, Pol; Kotsantis, Panagiotis; Borel, Valerie; Bellelli, Roberto; Panier, Stephanie; Boulton, Simon J

2018-01-25

Telomere maintenance critically depends on the distinct activities of telomerase, which adds telomeric repeats to solve the end replication problem, and RTEL1, which dismantles DNA secondary structures at telomeres to facilitate replisome progression. Here, we establish that reversed replication forks are a pathological substrate for telomerase and the source of telomere catastrophe in Rtel1 -/- cells. Inhibiting telomerase recruitment to telomeres, but not its activity, or blocking replication fork reversal through PARP1 inhibition or depleting UBC13 or ZRANB3 prevents the rapid accumulation of dysfunctional telomeres in RTEL1-deficient cells. In this context, we establish that telomerase binding to reversed replication forks inhibits telomere replication, which can be mimicked by preventing replication fork restart through depletion of RECQ1 or PARG. Our results lead us to propose that telomerase inappropriately binds to and inhibits restart of reversed replication forks within telomeres, which compromises replication and leads to critically short telomeres. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

The forkhead transcription factor Foxl2 is sumoylated in both human and mouse: sumoylation affects its stability, localization, and activity.

Directory of Open Access Journals (Sweden)

Mara Marongiu

2010-03-01

Full Text Available The FOXL2 forkhead transcription factor is expressed in ovarian granulosa cells, and mutated FOXL2 causes the blepharophimosis, ptosis and epicanthus inversus syndrome (BPES and predisposes to premature ovarian failure. Inactivation of Foxl2 in mice demonstrated its indispensability for female gonadal sex determination and ovary development and revealed its antagonism of Sox9, the effector of male testis development. To help to define the regulatory activities of FOXL2, we looked for interacting proteins. Based on yeast two-hybrid screening, we found that FOXL2 interacts with PIAS1 and UBC9, both parts of the sumoylation machinery. We showed that human FOXL2 is sumoylated in transfected cell lines, and that endogenous mouse Foxl2 is comparably sumoylated. This modification changes its cellular localization, stability and transcriptional activity. It is intriguing that similar sumoylation and regulatory consequences have also been reported for SOX9, the male counterpart of FOXL2 in somatic gonadal tissues.

Centre of Excellence For Simulation Education and Innovation (CESEI).

Science.gov (United States)

Qayumi, A Karim

2010-01-01

Simulation is becoming an integral part of medical education. The American College of Surgeons (ACS) was the first organization to recognize the value of simulation-based learning, and to award accreditation for educational institutions that aim to provide simulation as part of the experiential learning opportunity. Centre of Excellence for Simulation Education and Innovation (CESEI) is a multidisciplinary and interprofessional educational facility that is based at the University of British Columbia (UBC) and Vancouver Costal Health Authority (VCH). Centre of Excellence for Simulation Education and Innovation's goal is to provide excellence in education, research, and healthcare delivery by providing a technologically advanced environment and learning opportunity using simulation for various groups of learners including undergraduate, postgraduate, nursing, and allied health professionals. This article is an attempt to describe the infrastructure, services, and uniqueness of the Centre of Excellence for Simulation Education and Innovation. Copyright 2010 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

NATO Advanced Study Institute on Relativistic and Electron Correlation Effects in Molecules and Solids

CERN Document Server

1994-01-01

The NATO Advanced Study Institute (ASI) on "R@lativistic and Electron Correlation Effects in Molecules and Solids", co-sponsored by Simon Fraser University (SFU) and the Natural Sciences and Engineering Research Council of Canada (NSERC) was held Aug 10- 21, 1992 at the University of British Columbia (UBC), Vancouver, Canada. A total of 90 lecturers and students with backgrounds in Chemistry, Physics, Mathematics and various interdisciplinary subjects attended the ASI. In my proposal submitted to NATO for financial support for this ASI, I pointed out that a NATO ASI on the effects of relativity in many-electron systems was held ten years ago, [See G.L. Malli, (ed) Relativistic Effects in Atoms, Molecules and Solids, Plenum Press, Vol B87, New York, 1983]. Moreover, at a NATO Advanced Research Workshop (ARW) on advanced methods for molecular electronic structure "an assessment of state-of­ the-art of Electron Correlation ... " was carried out [see C.E. Dykstra, (ed), Advanced Theories and Computational Approa...

An incentive mechanism for electricity transmission expansion in Mexico

Energy Technology Data Exchange (ETDEWEB)

Rosellon, Juan [Division de Economia, Centro de Investigacion y Docencia Economicas (CIDE), Carret. Mexico-Toluca 3655, Lomas de Santa Fe, C.P. 01210, Mexico DF (Mexico)

2007-05-15

This study proposes an incentive regulatory framework for expanding electricity transmission in Mexico. A two-part pricing model is implemented within a combined merchant-regulatory structure. Three cases are considered. In the first, a monopolist with ''postage stamp tariffs'' serves the whole country using uniform prices. In the second case, one firm holds a regional monopoly in each of the five electricity areas. In the third, a monopolist operates in all areas of the national electricity system and discriminates in the prices it charges in each of the regions. This approach is described and then applied to the Mexican electricity transmission network. Using real data, the study compares all three cases in terms of profits, capacity increases, and network expansion. The results are found to depend on two effects: the ''economies-of-scale effect'', in which the maximum level is reached with a single network; and the ''discriminatory effect'' that results when a firm can discriminate among types of consumers. The economies-of-scale effect produces greater capacity and network expansion, whereas the discriminatory effect increases profits. (author)

Policy statement on gas distribution in Nova Scotia

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-01-30

This paper presented Nova Scotia's policy related to gas distribution. The government of Nova Scotia views natural gas as an economic enabler and is committed to ensuring that natural gas is available and accessible to Nova Scotians where it is economically feasible. Natural gas will give the province an efficient and clean burning energy supply that will make existing businesses more competitive. The province will support and facilitate the construction and operation of a gas distribution system by the private sector and will ensure that there is regulatory oversight by the Nova Scotia Utility and Review Board to protect the public interest. The government will also develop a plan for early conversion of government buildings to natural gas. This paper described the province's policy on gas distribution in relation to: (1) a province-wide franchise, (2) a supplemental franchise, (3) cost of service/performance based rates, (4) postage stamp rates, (5) a Maritimes and Northeast lateral policy, (6) direct access/bypass, (7) existing direct access user, (8) bundling of gas sales and other products and services, (9) licensing of gas marketers, (10) benefits, (11), regulatory efficiency, (12) municipal taxes, and (13) municipal operating agreements.

From Word Alignment to Word Senses, via Multilingual Wordnets

Directory of Open Access Journals (Sweden)

Dan Tufis

2006-05-01

Full Text Available Most of the successful commercial applications in language processing (text and/or speech dispense with any explicit concern on semantics, with the usual motivations stemming from the computational high costs required for dealing with semantics, in case of large volumes of data. With recent advances in corpus linguistics and statistical-based methods in NLP, revealing useful semantic features of linguistic data is becoming cheaper and cheaper and the accuracy of this process is steadily improving. Lately, there seems to be a growing acceptance of the idea that multilingual lexical ontologisms might be the key towards aligning different views on the semantic atomic units to be used in characterizing the general meaning of various and multilingual documents. Depending on the granularity at which semantic distinctions are necessary, the accuracy of the basic semantic processing (such as word sense disambiguation can be very high with relatively low complexity computing. The paper substantiates this statement by presenting a statistical/based system for word alignment and word sense disambiguation in parallel corpora. We describe a word alignment platform which ensures text pre-processing (tokenization, POS-tagging, lemmatization, chunking, sentence and word alignment as required by an accurate word sense disambiguation.

Alternative approaches to transmission investment

Energy Technology Data Exchange (ETDEWEB)

Thon, S. [AltaLink Management Ltd., Calgary, AB (Canada)

2004-07-01

AltaLink is Canada's first stand-alone power transmission company, serving all major centres in Alberta and 85 per cent of Alberta's population. It has more than $1 billion in assets, 11,500 km of transmission lines and 300 substations. It was noted that there has not been any significant investment in power transmission in Alberta for the past 20 years, partly because transmission assets have a very long lifespan. The new role of the power grid is to ensure reliability, safety, efficiency, market effectiveness and supply diversity. The benefits and costs of AltaLink's 500 kV North-South upgrade project were outlined. It was noted that a healthy transmission system is the basis for economic growth throughout the province and for the development of Alberta's resource base. The transmission policy in Alberta endorses that all consumers pay postage stamp tariffs. It also promotes a proactive plan for transmission projects, the time to maximum rate (TMR) in limited cases only, a congestion-free grid under normal conditions, the financial commitment of generators, specific time limits on permitting processes, and regional interconnections to benefit all customers. tabs., figs.

UBC-Nepal expedition: markedly lower cerebral blood flow in high-altitude Sherpa children compared with children residing at sea level.

Science.gov (United States)

Flück, Daniela; Morris, Laura E; Niroula, Shailesh; Tallon, Christine M; Sherpa, Kami T; Stembridge, Mike; Ainslie, Philip N; McManus, Ali M

2017-10-01

Developmental cerebral hemodynamic adaptations to chronic high-altitude exposure, such as in the Sherpa population, are largely unknown. To examine hemodynamic adaptations in the developing human brain, we assessed common carotid (CCA), internal carotid (ICA), and vertebral artery (VA) flow and middle cerebral artery (MCA) velocity in 25 (9.6 ± 1.0 yr old, 129 ± 9 cm, 27 ± 8 kg, 14 girls) Sherpa children (3,800 m, Nepal) and 25 (9.9 ± 0.7 yr old, 143 ± 7 cm, 34 ± 6 kg, 14 girls) age-matched sea level children (344 m, Canada) during supine rest. Resting gas exchange, blood pressure, oxygen saturation and heart rate were assessed. Despite comparable age, height and weight were lower (both P sea level children. Mean arterial pressure, heart rate, and ventilation were similar, whereas oxygen saturation (95 ± 2 vs. 99 ± 1%, P sea level children. This was reflected in a lower ICA flow (283 ± 108 vs. 333 ± 56 ml/min, P = 0.05), VA flow (78 ± 26 vs. 118 ± 35 ml/min, P sea level children (425 ± 92 vs. 441 ± 81 ml/min, P = 0.52). Scaling flow and oxygen uptake for differences in vessel diameter and body size, respectively, led to the same findings. A lower cerebral blood flow in Sherpa children may reflect specific cerebral hemodynamic adaptations to chronic hypoxia. NEW & NOTEWORTHY Cerebral blood flow is lower in Sherpa children compared with children residing at sea level; this may reflect a cerebral hemodynamic pattern, potentially due to adaptation to a hypoxic environment. Copyright © 2017 the American Physiological Society.

Liquefaction mechanism induced by dynamic excitation modeled in Plaxis AE with the use of UBC and MOHR–coulomb constitutive relationships

Directory of Open Access Journals (Sweden)

Borowiec Anna

2016-03-01

Full Text Available Computer Aided Engineering (CAE is commonly used in modern design of the various types of structures. There are two main issues/aspects that should be consider while using CAE in Geotechnics: the basic theory and material model. The paper deals with a problem of choosing the proper constitutive relationships which according to the authors are equally important in obtaining correct and reasonable results. This problem is illustrated by an example of dynamic calculations of fully saturated non-cohesive soils where liquefaction phenomenon is most likely to occur.

Evaluación estructural y rehabilitación sísmica del Hotel Samarina de propiedad de la Universidad Península de Santa Elena, para la creación de un modelo disipador de energía.

Directory of Open Access Journals (Sweden)

Armando Saltos

2015-12-01

Full Text Available El Hotel Samarina está ubicado frente al mar, en la cota +12 m s.n.m., en el cantón La Libertad, Provincia de Santa Elena. Fue construido al final de la década de los 50. El hotel Samarina terminado en un 70%, se compone de planta baja y tres pisos altos y estructuras de hormigón armado. La superficie total del mencionado hotel es de 2638 m2. Actualmente, se conoce que en el Ecuador y principalmente en la Provincia de Santa Elena, presenta una alta sismicidad por estar ubicada cercana a la zona de subducción de la placa de nazca y la placa sudamericana. A través de una evaluación y diagnóstico estructural, conforme a las normas ecuatorianas NEC 2011 o códigos uniformes de edificación UBC 97 la actual edificación no cumple el diseño sismoresistente, y de acuerdo al conocimiento actual se elaboró un diseño moderno donde se mejoró su nivel de desempeño o comportamiento sismo resistente ante la acción de un sismo moderado, y con la aplicación de un software libre denominado ETAB's se implementó un modelo con sistema de reforzamiento, compuesto de disipadores de energía colocados en las caras laterales y reforzamiento de columnas en los cuatro niveles que componen el edificio.   ABSTRACT The Samarina Hotel is located close to the sea, at 12 m s.n.m., at La Libertad, Province of Santa Elena. It was constructed at the end of the decade of the 50. The hotel has a ground floor and three high floors and it has reinforced concrete structures with surface of 26382. In the Ecuador and principally at Province of Santa Elena, has a high seismicity conditions because of it are located near to the zone of subduction of the Nazca South plates. An evaluation and structural diagnosis was performed, according to NEC 2011 proceeding, and also with the uniform codes of building UBC97. It is important to indicate that the actual building does not fulfill the design seismic resistant requirements. To improve the level resistant earthquake was

Integration of a Hydrological Model within a Geographical Information System: Application to a Forest Watershed

Directory of Open Access Journals (Sweden)

Dimitris Fotakis

2014-03-01

Full Text Available Watershed simulation software used for operational purposes must possess both dependability of results and flexibility in parameter selection and testing. The UBC watershed model (UBCWM contains a wide spectrum of parameters expressing meteorological, geological, as well as ecological watershed characteristics. The hydrological model was coupled to the MapInfo GIS and the software created was named Watershed Mapper (WM. WM is endowed with several features permitting operational utilization. These include input data and basin geometry visualization, land use/cover and soil simulation, exporting of statistical results and thematic maps and interactive variation of disputed parameters. For the application of WM two hypothetical scenarios of forest fires were examined in a study watershed. Four major rainfall events were selected from 12-year daily precipitation data and the corresponding peak flows were estimated for the base line data and hypothetical scenarios. A significant increase was observed as an impact of forest fires on peak flows. Due to its flexibility the combined tool described herein may be utilized in modeling long-term hydrological changes in the context of unsteady hydrological analyses.

Penentuan Properties Bahan Bakar Batubara Cair untuk Bahan Bakar Marine Diesel Engine.

Directory of Open Access Journals (Sweden)

Nanang Juhantoro

2012-09-01

Full Text Available Coal water mixture (CWM adalah bahan bakar campuran antara batubara dan air dengan peambahan zat aditif yang dapat membentuk suspensi cairan homogen dan stabil selama penyimpanan, pengangkutan, dan pembakaran. Tahap pertama pembuatan bahan bakar batubara cair adalah dengan teknologi Upgrading Brown Coal (UBC. Pada proses upgrading ini digunakan larutan kerosen dan aspal sebagai media upgradingnya, sedangkan rasio antara larutan kerosen-aspal dengan batubara adalah 1,25. Kemudian dilanjutkan dengan pembuatan slurry bahan bakar batubara cair dengan teknologi Coal Water Mixtures (CWM. Pada proses CWM ini diameter batubara maximum 38 um. Komposisi antara batubara dengan air adalah 40% : 60%. Untuk menstabilkan CWM digunakan  bahan aditif berupa CarboMextyl Cellulose (CMC dan sebagai dipersant digunakan Alkyl Benzene Sulfonic  (ABS.  Perbandingan masing-masing aditif pada  komposisi campuran adalah 0.01% CMC dan 0.07% ABS. Dalam penelitian ini dilakukan variasi temperatur pemanasan untuk mengetahui hasil fisik maupun karakteristik bahan bakar batubara cair. Dari hasil fisik dan karakteristik diperoleh keadaan batubara cair memiliki kemiripan dengan Heavy Fuel Oil (HFO pada temperatur pemanasan 15 0C dan 50 0C.

Validation and comparison of reference genes for qPCR normalization of celery (Apium graveolens at different development stages

Directory of Open Access Journals (Sweden)

Meng-Yao eLi

2016-03-01

Full Text Available A suitable reference gene is an important prerequisite for guarantying accurate and reliable results in qPCR analysis. Celery is one of the representative vegetable in Apiaceae and is widely cultivated and consumed in the world. However, no reports have been previously published concerning reference genes in celery. In this study, the expression stabilities of nine candidate reference genes in leaf blade and petiole at different development stages were evaluated using three statistics algorithms geNorm, NormFinder, and BestKeeper. Our results showed that TUB-B, TUB-A, and UBC were the most reference genes among all tested samples. GAPDH represented the maximum stability for most individual sample, while the UBQ displayed the minimum stability. To further validate the stability of reference genes, the expression pattern of AgAP2-2 was calculated by using the selected genes for normalization. In addition, the expression patterns of several development-related genes were studied using the selected reference gene. Our results will be beneficial for further studies on gene transcription in celery.

Role of the NEDD8 Modification of Cul2 in the Sequential Activation of ECV Complex

Directory of Open Access Journals (Sweden)

Roxana I. Sufan

2006-11-01

Full Text Available ECV is an E3 ubiquitin ligase complex, which is composed of elongins B and C, Rbxi, Cul2, the substrate-conferring von Hippel-Lindau (VHL tumorsuppressor protein that targets the catalytic α subunit of hypoxia-inducible factor (HI F for oxygen-dependent ubiquitin-mediated destruction. Mutations in VHL that compromise proper HIFα regulation through ECV have been documented in the majority of renal cell carcinomas, underscoring the significance of the VHL-HIF pathway in renal epithelial oncogenesis. Recent evidence has shown that the modification of Cul2 by the ubiquitin-like molecule NEDD8 increases the activity of ECV to ubiquitylate HIFα. However, the underlying mechanism responsible for the NEDD8-mediated induction of ECV function is unknown. Here, we demonstrate that oxygen-dependent recognition of HIFα by VHL triggers Rbxi-dependent neddylation of Cul2, which preferentially engages the E2 ubiquitin-conjugating enzyme UbcH5a. These events establish a central role for the neddylation of Cul2 in a previously unrecognized, temporally coordinated activation of ECV with the recruitment of its substrate HIFα.

Uncoupling phototoxicity-elicited neural dysmorphology and death by insidious function and selective impairment of Ran-binding protein 2 (Ranbp2).

Science.gov (United States)

Cho, Kyoung-in; Haney, Victoria; Yoon, Dosuk; Hao, Yin; Ferreira, Paulo A

2015-12-21

Morphological disintegration of neurons is coupled invariably to neural death. In particular, disruption of outer segments of photoreceptor neurons triggers photoreceptor death regardless of the pathological stressors. We show that Ranbp2(-/-)::Tg-Ranbp2(CLDm-HA) mice with mutations in SUMO-binding motif (SBM) of cyclophilin-like domain (CLD) of Ran-binding protein 2 (Ranbp2) expressed in a null Ranbp2 background lack untoward effects in photoreceptors in the absence of light-stress. However, compared to wild type photoreceptors, light-stress elicits profound disintegration of outer segments of Ranbp2(-/-)::Tg-Ranbp2(CLDm-HA) with paradoxical age-dependent resistance of photoreceptors to death and genotype-independent activation of caspases. Ranbp2(-/-)::Tg-Ranbp2(CLDm-HA) exhibit photoreceptor death-independent changes in ubiquitin-proteasome system (UPS), but death-dependent increase of ubiquitin carrier protein 9(ubc9) levels. Hence, insidious functional impairment of SBM of Ranbp2's CLD promotes neuroprotection and uncoupling of photoreceptor degeneration and death against phototoxicity. Copyright © 2015 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

ALEA: a toolbox for allele-specific epigenomics analysis.

Science.gov (United States)

Younesy, Hamid; Möller, Torsten; Heravi-Moussavi, Alireza; Cheng, Jeffrey B; Costello, Joseph F; Lorincz, Matthew C; Karimi, Mohammad M; Jones, Steven J M

2014-04-15

The assessment of expression and epigenomic status using sequencing based methods provides an unprecedented opportunity to identify and correlate allelic differences with epigenomic status. We present ALEA, a computational toolbox for allele-specific epigenomics analysis, which incorporates allelic variation data within existing resources, allowing for the identification of significant associations between epigenetic modifications and specific allelic variants in human and mouse cells. ALEA provides a customizable pipeline of command line tools for allele-specific analysis of next-generation sequencing data (ChIP-seq, RNA-seq, etc.) that takes the raw sequencing data and produces separate allelic tracks ready to be viewed on genome browsers. The pipeline has been validated using human and hybrid mouse ChIP-seq and RNA-seq data. The package, test data and usage instructions are available online at http://www.bcgsc.ca/platform/bioinfo/software/alea CONTACT: : mkarimi1@interchange.ubc.ca or sjones@bcgsc.ca Supplementary information: Supplementary data are available at Bioinformatics online. © The Author 2013. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

Reference Gene Selection for qRT-PCR Normalization Analysis in kenaf (Hibiscus cannabinus L. under Abiotic Stress and Hormonal Stimuli

Directory of Open Access Journals (Sweden)

Xiaoping Niu

2017-05-01

Full Text Available Kenaf (Hibiscus cannabinus L., an environmental friendly and economic fiber crop, has a certain tolerance to abiotic stresses. Identification of reliable reference genes for transcript normalization of stress responsive genes expression by quantitative real-time PCR (qRT-PCR is important for exploring the molecular mechanisms of plants response to abiotic stresses. In this study, nine candidate reference genes were cloned, and their expression stabilities were assessed in 132 abiotic stress and hormonal stimuli samples of kenaf using geNorm, NormFinder, and BestKeeper algorithms. Results revealed that HcPP2A (Protein phosphatase 2A and HcACT7 (Actin 7 were the optimum reference genes across all samples; HcUBC (Ubiquitin-conjugating enzyme like protein was the worst reference gene for transcript normalization. The reliability of the selected reference genes was further confirmed by evaluating the expression profile of HcWRKY28 gene at different stress durations. This work will benefit future studies on discovery of stress-tolerance genes and stress-signaling pathways in this important fiber crop.

Seismic response analyses for reactor facilities at Savannah River

International Nuclear Information System (INIS)

Miller, C.A.; Costantino, C.J.; Xu, J.

1991-01-01

The reactor facilities at the Savannah River Plant (SRP) were designed during the 1950's. The original seismic criteria defining the input ground motion was 0.1 G with UBC [uniform building code] provisions used to evaluate structural seismic loads. Later ground motion criteria have defined the free field seismic motion with a 0.2 G ZPA [free field acceleration] and various spectral shapes. The spectral shapes have included the Housner spectra, a site specific spectra, and the US NRC [Nuclear Regulatory Commission] Reg. Guide 1.60 shape. The development of these free field seismic criteria are discussed in the paper. The more recent seismic analyses have been of the following type: fixed base response spectra, frequency independent lumped parameter soil/structure interaction (SSI), frequency dependent lumped parameter SSI, and current state of the art analyses using computer codes such as SASSI. The results from these computations consist of structural loads and floor response spectra (used for piping and equipment qualification). These results are compared in the paper and the methods used to validate the results are discussed. 14 refs., 11 figs

Blocking an N-terminal acetylation–dependent protein interaction inhibits an E3 ligase

Energy Technology Data Exchange (ETDEWEB)

Scott, Daniel C.; Hammill, Jared T.; Min, Jaeki; Rhee, David Y.; Connelly, Michele; Sviderskiy, Vladislav O.; Bhasin, Deepak; Chen, Yizhe; Ong, Su-Sien; Chai, Sergio C.; Goktug, Asli N.; Huang, Guochang; Monda, Julie K.; Low, Jonathan; Kim, Ho Shin; Paulo, Joao A.; Cannon, Joe R.; Shelat, Anang A.; Chen, Taosheng; Kelsall, Ian R.; Alpi, Arno F.; Pagala, Vishwajeeth; Wang, Xusheng; Peng, Junmin; Singh , Bhuvanesh; Harper, J. Wade; Schulman, Brenda A.; Guy, R. Kip (MSKCC); (Dundee); (SJCH); (Harvard-Med); (MXPL)

2017-06-05

N-terminal acetylation is an abundant modification influencing protein functions. Because ~80% of mammalian cytosolic proteins are N-terminally acetylated, this modification is potentially an untapped target for chemical control of their functions. Structural studies have revealed that, like lysine acetylation, N-terminal acetylation converts a positively charged amine into a hydrophobic handle that mediates protein interactions; hence, this modification may be a druggable target. We report the development of chemical probes targeting the N-terminal acetylation–dependent interaction between an E2 conjugating enzyme (UBE2M or UBC12) and DCN1 (DCUN1D1), a subunit of a multiprotein E3 ligase for the ubiquitin-like protein NEDD8. The inhibitors are highly selective with respect to other protein acetyl-amide–binding sites, inhibit NEDD8 ligation in vitro and in cells, and suppress anchorage-independent growth of a cell line with DCN1 amplification. Overall, our data demonstrate that N-terminal acetyl-dependent protein interactions are druggable targets and provide insights into targeting multiprotein E2–E3 ligases.

MetaPathways v2.5: quantitative functional, taxonomic and usability improvements.

Science.gov (United States)

Konwar, Kishori M; Hanson, Niels W; Bhatia, Maya P; Kim, Dongjae; Wu, Shang-Ju; Hahn, Aria S; Morgan-Lang, Connor; Cheung, Hiu Kan; Hallam, Steven J

2015-10-15

Next-generation sequencing is producing vast amounts of sequence information from natural and engineered ecosystems. Although this data deluge has an enormous potential to transform our lives, knowledge creation and translation need software applications that scale with increasing data processing and analysis requirements. Here, we present improvements to MetaPathways, an annotation and analysis pipeline for environmental sequence information that expedites this transformation. We specifically address pathway prediction hazards through integration of a weighted taxonomic distance and enable quantitative comparison of assembled annotations through a normalized read-mapping measure. Additionally, we improve LAST homology searches through BLAST-equivalent E-values and output formats that are natively compatible with prevailing software applications. Finally, an updated graphical user interface allows for keyword annotation query and projection onto user-defined functional gene hierarchies, including the Carbohydrate-Active Enzyme database. MetaPathways v2.5 is available on GitHub: http://github.com/hallamlab/metapathways2. shallam@mail.ubc.ca Supplementary data are available at Bioinformatics online. © The Author 2015. Published by Oxford University Press.

Molecular hierarchy in neurons differentiated from mouse ES cells containing a single human chromosome 21.

Science.gov (United States)

Wang, Chi Chiu; Kadota, Mitsutaka; Nishigaki, Ryuichi; Kazuki, Yasuhiro; Shirayoshi, Yasuaki; Rogers, Michael Scott; Gojobori, Takashi; Ikeo, Kazuho; Oshimura, Mitsuo

2004-02-06

Defects in neurogenesis and neuronal differentiation in the fetal brain of Down syndrome (DS) patients lead to the apparent neuropathological abnormalities and contribute to the phenotypic characters of mental retardation, and premature development of Alzheimer's disease, those being the most common phenotype in DS. In order to understand the molecular mechanism underlying the cause of phenotypic abnormalities in the DS brain, we have utilized an in vitro model of TT2F mouse embryonic stem cells containing a single human chromosome 21 (hChr21) to study neuron development and neuronal differentiation by microarray containing 15K developmentally expressed cDNAs. Defective neuronal differentiation in the presence of extra hChr21 manifested primarily the post-transcriptional and translational modification, such as Mrpl10, SNAPC3, Srprb, SF3a60 in the early neuronal stem cell stage, and Mrps18a, Eef1g, and Ubce8 in the late differentiated stage. Hierarchical clustering patterned specific expression of hChr21 gene dosage effects on neuron outgrowth, migration, and differentiation, such as Syngr2, Dncic2, Eif3sf, and Peg3.

For philatelists

International Nuclear Information System (INIS)

1969-01-01

From the beginning of October this year the United Nations Postal Administration has been able to issue Swiss-denomination stamps valid for correspondence posted at the Palais des Nations, Geneva. This is the first time that the UN in Geneva has been able to send mail using its own postage stamps and is therefore of great interest to philatelists. The principal aim of the UN Postal Administration is to make UN activities and those of the specialized agencies better known in the world through stamps. In 1969 there have been issues in honour of the UN Institute for Training and Research (UNITAR), the Economic Commission for Latin America, the International Law Commission and the International Labour Organisation (ILO). Among those next year will be a stamp to commemorate the efforts of the World Health Organization (WHO) to fight cancer. There are eight denominations in the new Swiss issue, each with special designs. They are 1 franc (designed by Rashid-ud-Din, Pakistan); 10 centimes, 30 centimes and 75 centime (Ole Hamann, Denmark); 5 centimes (Jozsef Vertel, Hungary); 3 francs, showing the statue in the Trusteeship Council Chamber, New York; 50 centimes (Olav S. Mathiesen, Denmark); and 20 centimes (Georges Hamori, Australia). (author)

Product competitiveness analysis for e-commerce platform of special agricultural products

Science.gov (United States)

Wan, Fucheng; Ma, Ning; Yang, Dongwei; Xiong, Zhangyuan

2017-09-01

On the basis of analyzing the influence factors of the product competitiveness of the e-commerce platform of the special agricultural products and the characteristics of the analytical methods for the competitiveness of the special agricultural products, the price, the sales volume, the postage included service, the store reputation, the popularity, etc. were selected in this paper as the dimensionality for analyzing the competitiveness of the agricultural products, and the principal component factor analysis was taken as the competitiveness analysis method. Specifically, the web crawler was adopted to capture the information of various special agricultural products in the e-commerce platform ---- chi.taobao.com. Then, the original data captured thereby were preprocessed and MYSQL database was adopted to establish the information library for the special agricultural products. Then, the principal component factor analysis method was adopted to establish the analysis model for the competitiveness of the special agricultural products, and SPSS was adopted in the principal component factor analysis process to obtain the competitiveness evaluation factor system (support degree factor, price factor, service factor and evaluation factor) of the special agricultural products. Then, the linear regression method was adopted to establish the competitiveness index equation of the special agricultural products for estimating the competitiveness of the special agricultural products.

Intelligent Chemical Sensor Systems for In-space Safety Applications

Science.gov (United States)

Hunter, G. W.; Xu, J. C.; Neudeck, P. G.; Makel, D. B.; Ward, B.; Liu, C. C.

2006-01-01

Future in-space and lunar operations will require significantly improved monitoring and Integrated System Health Management (ISHM) throughout the mission. In particular, the monitoring of chemical species is an important component of an overall monitoring system for space vehicles and operations. For example, in leak monitoring of propulsion systems during launch, inspace, and on lunar surfaces, detection of low concentrations of hydrogen and other fuels is important to avoid explosive conditions that could harm personnel and damage the vehicle. Dependable vehicle operation also depends on the timely and accurate measurement of these leaks. Thus, the development of a sensor array to determine the concentration of fuels such as hydrogen, hydrocarbons, or hydrazine as well as oxygen is necessary. Work has been on-going to develop an integrated smart leak detection system based on miniaturized sensors to detect hydrogen, hydrocarbons, or hydrazine, and oxygen. The approach is to implement Microelectromechanical Systems (MEMS) based sensors incorporated with signal conditioning electronics, power, data storage, and telemetry enabling intelligent systems. The final sensor system will be self-contained with a surface area comparable to a postage stamp. This paper discusses the development of this "Lick and Stick" leak detection system and it s application to In-Space Transportation and other Exploration applications.

Role of the provincial government of Saskatchewan in encouraging growth in the oil and gas sector

International Nuclear Information System (INIS)

Lautermilch, E.

1997-01-01

The year 1996 was one of the most successful years for the oil and gas industry in Saskatchewan. In the view of the author this may be said to be due, at least in part, to the provincial government's efforts to establish and implement policies that stimulate economic activity. Government regulation is essential to ensure safe and sensible development, a level playing field for all participants, and to ensure that residents of the province receive a fair share of the benefits of resource development. Some of the positive government actions taken in 1996 include: revisions to the royalty rate structure, simplification of the natural gas administration system, a program to encourage exploration in less-explored areas, re-balancing electrical rates, and a review of all regulations with the goal of streamlining or eliminating them. New technologies such as horizontal drilling were also encouraged. Issues presently before the government include postage stamp tolls, global warming, greenhouse gas emissions and environmental concerns from farmers. On the whole, the oil and gas industry received high marks for taking a responsible approach to self-regulation, but continued public support will depend on how well the industry addresses environmental concerns and demonstrates the benefits of oil and development to the people

Study of Genetic Diversity of Some Persian walnut Genotypes in Mashhad Commercial Orchards by using ISSR Marker

Directory of Open Access Journals (Sweden)

Shadi Attar

2018-02-01

scoring the bands, in which 0 used for showing the absence of a band and 1 showing the presence of a band in each sample, 1 and 0 numbers were changed to matrix by using NTedit software. Genetic similarities of samples were calculated by using NTSYSpc software, SIMQUAL method and DICE similarity coefficient. Dendrogram by cluster analysis was drawn by using UPGMA method. Principle coordinate analysis (PCO was performed using the NTSYS software and grouping samples were evaluated in a two-dimensional plot. Results and discussion: Results showed that from 9 primers in total, 118 bands amplified were in 300 to 3000 base pairs, while 29 bands were polymorphic. The number of amplified fragment for each primer was different so that UBC 844 (14 bands had the highest and UBC 890 (8 bands had the lowest amplified bands. The average amplified fragments for each primer was 9.83. The percentage of polymorphic in various primers was different. Maximum polymorphism (80% of the primers was observed in UBC830. In general, according to the percentage of polymorphic bands, low adjustment to any changes in the environment was indicated. This can be used as an indicator to determine the value of diversity and genetic erosion. In genotypes cluster analysis, clustering was performed based on Dice similarity coefficient and UPGMA method, and 10 clusters were formed. ISSR molecular marker somewhat revealed genetic diversity among walnuts genotypes, whereas the genetic diversity was lower than expected. In general, by reviewing the findings in other parts of the world about walnut genetic diversity and comparing them with the results of this study, despite existing high genetic diversity among walnuts in many areas, some reports of low genetic diversity among walnuts populations have been published and unfortunately in recent years these reports has made more attention. Based on the results of several studies reporting low genetic diversity among walnuts, the following factors can be effective in

Spanish utility turns customer bills into a strategic advantage with EDP

Energy Technology Data Exchange (ETDEWEB)

Stone, C. [StreamServe Inc., Burlington, MA (United States)

2007-03-15

Enterprise document presentments (EDPs) are now used at many utilities to enable the automated creation and presentment of documents in formats that suit the needs of their customers. Upgraded billing capabilities can reduce operational costs, as well as drive incremental revenue for utilities that offer a portfolio of services. EDP bills can also provide an adaptable vehicle for meeting regulatory information requirements, as well as for demonstrating the utility's community obligations. This paper discussed an EDP program used by the Spanish utility Hidroelectrica del Cantabrico. After consulting with various companies, the utility finally selected an EDP solution provided by StreamServe Utilities, which offered data source independence. SAP data was received in RDI format, which provided the ability to rapidly design and generate invoices, contracts, and other documents. The EDP system selected by the utility also allowed them to consolidate electricity and gas consumption into a single invoice. Invoices were classified by distinct criteria, and optical labels were inserted to provide greater flexibility for design changes. The EDP solution allowed the utility to improve its corporate image on each printed document and optimize its client relationships by establishing a new marketing channel through the invoice itself. It was concluded that the utility has also achieved significant cost savings on paper and postage, as promotional campaigns are now inserted into invoice envelopes. 1 fig.

Electricity transmission pricing: Tracing based point-of-connection tariff

International Nuclear Information System (INIS)

Abhyankar, A.R.; Khaparde, S.A.

2009-01-01

Point-of-connection (POC) scheme of transmission pricing in decentralized markets charges the participants a single rate per MW depending on their point-of-connection. Use of grossly aggregated postage stamp rates as POC charges fails to provide appropriate price signals. The POC tariff based on distribution of network sunk costs by employing conventional tracing assures recovery of sunk costs based on extent of use of network by participants. However, the POC tariff by this method does not accommodate economically efficient price signals which correspond to marginal costs. On the other hand, the POC tariff, if made proportional to marginal costs alone, fails to account for sunk costs and extent of use of network. This paper overcomes these lacunae by combining the above stated desired objectives under the recently proposed optimal tracing framework. Since real power tracing problem is amenable to multiple solutions, it is formulated as linearly constrained optimization problem. By employing this methodology, consideration of extent of network use and sunk cost recovery are guaranteed, while objective function is designed such that the spatial pattern of price signals closely follows the pattern of scaled locational marginal prices. The methodology is tested on IEEE 30 bus system, wherein average power flow pattern is established by running various simulation states on congested and un-congested network conditions. (author)

Effect of oxygen supply on the size of implantable islet-containing encapsulation devices.

Science.gov (United States)

Papas, Klearchos K; Avgoustiniatos, Efstathios S; Suszynski, Thomas M

2016-03-01

Beta-cell replacement therapy is a promising approach for the treatment of diabetes but is currently limited by the human islet availability and by the need for systemic immunosuppression. Tissue engineering approaches that will enable the utilization of islets or β-cells from alternative sources (such as porcine islets or human stem cell derived beta cells) and minimize or eliminate the need for immunosuppression have the potential to address these critical limitations. However, tissue engineering approaches are critically hindered by the device size (similar to the size of a large flat screen television) required for efficacy in humans. The primary factor dictating the device size is the oxygen availability to islets to support their viability and function (glucose-stimulated insulin secretion [GSIS]). GSIS is affected (inhibited) at a much higher oxygen partial pressure [pO2] than that of viability (e.g. 10 mmHg as opposed to 0.1 mmHg). Enhanced oxygen supply (higher pO2) than what is available in vivo at transplant sites can have a profound effect on the required device size (potentially reduce it to the size of a postage stamp). This paper summarizes key information on the effect of oxygen on islet viability and function within immunoisolation devices and describes the potential impact of enhanced oxygen supply to devices in vivo on device size reduction.

Spanish utility turns customer bills into a strategic advantage with EDP

International Nuclear Information System (INIS)

Stone, C.

2007-01-01

Enterprise document presentments (EDPs) are now used at many utilities to enable the automated creation and presentment of documents in formats that suit the needs of their customers. Upgraded billing capabilities can reduce operational costs, as well as drive incremental revenue for utilities that offer a portfolio of services. EDP bills can also provide an adaptable vehicle for meeting regulatory information requirements, as well as for demonstrating the utility's community obligations. This paper discussed an EDP program used by the Spanish utility Hidroelectrica del Cantabrico. After consulting with various companies, the utility finally selected an EDP solution provided by StreamServe Utilities, which offered data source independence. SAP data was received in RDI format, which provided the ability to rapidly design and generate invoices, contracts, and other documents. The EDP system selected by the utility also allowed them to consolidate electricity and gas consumption into a single invoice. Invoices were classified by distinct criteria, and optical labels were inserted to provide greater flexibility for design changes. The EDP solution allowed the utility to improve its corporate image on each printed document and optimize its client relationships by establishing a new marketing channel through the invoice itself. It was concluded that the utility has also achieved significant cost savings on paper and postage, as promotional campaigns are now inserted into invoice envelopes. 1 fig

Factors that influence nurses' job satisfaction.

Science.gov (United States)

Ma, Chen-Chung; Samuels, Michael E; Alexander, Judith W

2003-05-01

To examine factors affecting the job satisfaction of registered nurses (RNs). A growing recognition of job dissatisfaction among RNs in South Carolina hospitals has contributed to current problems with recruitment and retention. If administrators identify factors influencing RNs' job satisfaction in hospitals and implement strategies to address these factors, RN turnover rates will decrease and recruiting and retention rates will increase. A cross-sectional study of secondary data was designed to identify the individual, work, and geographic factors that impact nursing job satisfaction at the state level. A 27-question self-administered survey was sent to 17,500 RNs in South Carolina with postage-paid envelopes for their responses. Surveys from 3472 nurses were completed anonymously. Univariate statistics were used to describe the study sample. One-way and multivariable Analysis of Variance were used to determine which variables contributed the most to job satisfaction. For about two thirds of the RNs, job satisfaction remained the same or had lessened over the past 2 years. In addition, statistically significant differences were found between job satisfaction and years of service, job position, hospital retirement plan, and geographic area. The findings have implications for nurse managers and hospital administrators for planning and implementing effective health policies that will meet the unique needs of their staffs and organizations. Such research is particularly relevant in this difficult time of nursing shortages throughout the healthcare industry.

Use of 222Rn-resistant techniques in new home construction

International Nuclear Information System (INIS)

Watson, J.E. Jr.; Cote, R.A.

1999-01-01

The objective of this project was to assess the status of the use of 222 Rn-resistant construction techniques in new home construction in the eight Zone 1 counties of North Carolina. Zone 1 counties have an average predicted indoor 222 Rn screening potential greater than 148 Bq m -3 (4 pCi L -1 ). To facilitate a response from builders, a brief survey form was designed and printed on the back of a self-addressed, postage-paid postcard. This survey form was mailed to 460 home builders in the Zone 1 counties. The response rate was 17%, which can be compared to the 4.9% response rate obtained in a national survey conducted by the National Association of Home Builders Research Center. In their survey, 62% of the responding builders reported that they had built some or many homes in 1996 using construction techniques to reduce the entry of radon into homes, but only 10% of the builders reported using these techniques for many homes. The National Association of Home Builders survey determined that, nationally, 30% of homes built in Zone 1 counties had 222 Rn venting features. There is the potential for bias in the results of their survey (as well as in the results of the National Association of Home Builders survey) since the response rates were low

Electronic Commerce user manual

Energy Technology Data Exchange (ETDEWEB)

1992-04-10

This User Manual supports the Electronic Commerce Standard System. The Electronic Commerce Standard System is being developed for the Department of Defense of the Technology Information Systems Program at the Lawrence Livermore National Laboratory, operated by the University of California for the Department of Energy. The Electronic Commerce Standard System, or EC as it is known, provides the capability for organizations to conduct business electronically instead of through paper transactions. Electronic Commerce and Computer Aided Acquisition and Logistics Support, are two major projects under the DoD`s Corporate Information Management program, whose objective is to make DoD business transactions faster and less costly by using computer networks instead of paper forms and postage. EC runs on computers that use the UNIX operating system and provides a standard set of applications and tools that are bound together by a common command and menu system. These applications and tools may vary according to the requirements of the customer or location and may be customized to meet the specific needs of an organization. Local applications can be integrated into the menu system under the Special Databases & Applications option on the EC main menu. These local applications will be documented in the appendices of this manual. This integration capability provides users with a common environment of standard and customized applications.

Electronic Commerce user manual

Energy Technology Data Exchange (ETDEWEB)

1992-04-10

This User Manual supports the Electronic Commerce Standard System. The Electronic Commerce Standard System is being developed for the Department of Defense of the Technology Information Systems Program at the Lawrence Livermore National Laboratory, operated by the University of California for the Department of Energy. The Electronic Commerce Standard System, or EC as it is known, provides the capability for organizations to conduct business electronically instead of through paper transactions. Electronic Commerce and Computer Aided Acquisition and Logistics Support, are two major projects under the DoD's Corporate Information Management program, whose objective is to make DoD business transactions faster and less costly by using computer networks instead of paper forms and postage. EC runs on computers that use the UNIX operating system and provides a standard set of applications and tools that are bound together by a common command and menu system. These applications and tools may vary according to the requirements of the customer or location and may be customized to meet the specific needs of an organization. Local applications can be integrated into the menu system under the Special Databases Applications option on the EC main menu. These local applications will be documented in the appendices of this manual. This integration capability provides users with a common environment of standard and customized applications.

Paul Gauguin in Brittany

Science.gov (United States)

Asmus, John F.

2009-07-01

Ever since the dawn of the 20th Century there has been a universal consensus that Alphonse Mucha launched the sensation that became known as Art Nouveau. This event was associated with the appearance of his Gismonda poster promoting the Sarah Bernhardt play of that name in Paris in 1894. At an estate sale in 1954 a small collage bearing a likeness of Mucha's Gismonda was offered. It had been fabricated by gluing slivers cut from sixty postage stamps to a 20cm ceramic tile. Digital computer image enhancement was applied to the collage design, initials on a walking stick from the same estate collection, and the Mucha poster. These geometrical analyses revealed that the collage is more detailed than the Mucha "original". This led to our hypothesis that the famous poster was a hasty photographic plagiarism of the intricate ceramic-tile collage. Image analyses of the initials on the companion walking stick revealed conformity with the famous enigmatic "P GO" monogram of Paul Gauguin. We conclude that Gauguin rather than Mucha created the Gismonda composition. Historical evidence suggests that, while Gauguin was in Brittany recovering from injuries sustained in a fistfight, Annah la Javanese stole his possessions and took them to Paris where her next lover, Mucha, copied the collage and presented it as his original poster design.

Reference gene selection for real-time quantitative PCR analysis of the mouse uterus in the peri-implantation period.

Directory of Open Access Journals (Sweden)

Pengfei Lin

Full Text Available The study of uterine gene expression patterns is valuable for understanding the biological and molecular mechanisms that occur during embryo implantation. Real-time quantitative RT-PCR (qRT-PCR is an extremely sensitive technique that allows for the precise quantification of mRNA abundance; however, selecting stable reference genes suitable for the normalization of qRT-PCR data is required to avoid the misinterpretation of experimental results and erroneous analyses. This study employs several mouse models, including an early pregnancy, a pseudopregnancy, a delayed implantation and activation, an artificial decidualization and a hormonal treatment model; ten candidate reference genes (PPIA, RPLP0, HPRT1, GAPDH, ACTB, TBP, B2M, 18S, UBC and TUBA that are found in uterine tissues were assessed for their suitability as internal controls for relative qRT-PCR quantification. GeNorm(PLUS, NormFinder, and BestKeeper were used to evaluate these candidate reference genes, and all of these methods identified RPLP0 and GAPDH as the most stable candidates and B2M and 18S as the least stable candidates. However, when the different models were analyzed separately, the reference genes exhibited some variation in their expression levels.

Spatial adjustments of mountain channels to changes in the sediment supply regime

Science.gov (United States)

Elgueta, M. A.; Hassan, M. A.; von Flotow, C. M.

2012-12-01

Sediment supply is a key controlling factor in bed morphology and sediment mobility. Under a low supply regime, bed structuring develops and reduces sediment mobility. Under high supply, structuring is suppressed and the bed exhibits patchiness. This study examines the spatial response of a mountain stream channel to changes in the sediment supply regime. To achieve this goal, a flume experiment was conducted in the Mountain Channel Hydraulic Experimental Laboratory at the University of British Columbia. An 18 meter long, one meter wide flume, with a slope of three percent was used. Seven continuous runs were conducted. Each of them lasted 40 hours, under constant flow and different sediment supply regimes, which included no feed, constant feed and episodic supply. In each run, bed elevation, bed grain size distribution, flow resistance, sediment mobility and degree of armoring were determined. Flume results were compared to field data from a 600 meter channel reach that exhibits rapid, riffle-pool and step-pool morphology in UBC Malcolm Knapp Research Forest. The study gave the possibility to analyze in detail the spatial adjustment of a mountain channel to changes in the sediment supply regime, including episodic inputs.

'Chasing the Dragon' - imaging of heroin inhalation leukoencephalopathy

Energy Technology Data Exchange (ETDEWEB)

Hagel, J. [Vancouver General Hospital, Dept. of Radiology, Vancouver, British Columbia (Canada)]. E-mail: jeff_hagel@hotmail.com; Andrews, G. [UBC Hospital, Dept. of Radiology, Vancouver, British Columbia (Canada); Vertinsky, T. [Vancouver General Hospital, Dept. of Radiology, Vancouver, British Columbia (Canada); Heran, M.K.S. [Vancouver General Hospital, Div. of Neuroradiology, Vancouver, British Columbia (Canada); Keogh, C. [BC Cancer Agency, Dept. of Radiology, Vancouver, British Columbia (Canada)

2005-10-15

'Chasing the dragon' refers to the inhalation of heroin pyrolysate vapors produced when the freebase form of heroin is heated. Inhalation of these vapors can result in a rare toxic spongiform leukoencephalopathy. The patients may progress through 3 defined clinical stages, with one-quarter reaching the terminal stage, which invariably leads to death. Imaging and, in particular, magnetic resonance imaging (MRI) demonstrates white matter findings that are felt to be specific for this entity and essential in its early diagnosis. We present the typical imaging findings in a pictorial essay format, using images taken from 9 patients who presented within an 18-month period at UBC-affiliated hospitals. These findings include low computed tomography (CT) attenuation and high T2 MRI signal most commonly in the posterior cerebral and cerebellar white matter, cerebellar peduncles, splenium of the corpus callosum, and posterior limb of the internal capsules. In addition, there is often selective, symmetric involvement of the corticospinal tract, the medial lemniscus, and the tractus solitarius. We also present the variable diffusion-weighted imaging arid apparent diffusion coefficient findings from 4 of our patients, which to our knowledge, have not been described in the literature. (author)

Sea state indices for a coastal strait

Science.gov (United States)

Gemmrich, Johannes; Dewey, Richard

2017-04-01

The Strait of Georgia at the west coast of Canada is an enclosed coastal strait, about 250km long and 25 to 50 km wide, with great socio-economic importance. Regular freighter traffic, ferry services, commercial and sport fisheries, and recreational boating, makes the area one of the busiest marine areas in the world. Waves in SoG are generally small, with the median value of the significant wave height Hs=0.3m. However, strong outflows off the mountainous terrain can generate significant wave heights Hs > 2.5m, with high spatial and temporal variability. In addition, strong tidal currents and the Fraser River outflow generate localized regions of steep and breaking waves that are of particular concern. We have implemented the Wavewatch III model at 500m-resolution, forced by Environment Canada's high resolution atmospheric model winds and currents from the UBC NEMO implementation of the Salish Sea. The final output combines GIS layers of the predicted wave field (Hs, dominant wave length and direction), the modeled wind field and currents, observed currents from a set of CODAR systems, and a sea state index that highlights regions of potentially steep and dangerous waves.

Effect of dispersing and stabilizing additives on rheological characteristics of the upgraded brown coal water mixture

International Nuclear Information System (INIS)

Umar, Datin Fatia; Muta'alim; Usui, Hiromoto; Komoda, Yoshiyuki

2009-01-01

Upgraded brown coal water mixture (UBCWM) preparation by using an Indonesian upgraded coal produced by upgraded brown coal (UBC) process, was carried out to study the effect of dispersing and stabilizing additives on rheological behavior of the UBCWM. Three kinds of anionic dispersing additives, naphthalene sulfonic formaldehyde condensate (NSF), poly (meth) acrylate (PMA) and poly styrene sulfonic acid (PSS) and three kinds of stabilizing additives, carboxyl methyl cellulose (CMC), rhansam gum (S-194) and gellan gum (S-60) were used in this study. Results indicate that the addition of NSF 0.3 wt.% together with S-194 0.01 wt.% is effective in preparing UBCWM with good slurryability and stability, based on its rheological characteristics with the apparent viscosity at shear rate of 100 s - 1 and yield stress at zero point of shear rate. The rheological behavior of all of the UBCWM that prepared, exhibits non-Newtonian Bingham plastic. From the economical point of view, the price of S-194 is expensive. On the other hand, CMC is cheap and abundant. Therefore, the addition of CMC 0.01 wt.% together with NSF 0.3 wt.% is also effective in preparing UBCWM with good fluidity and stability. (author)

Local level sustainability policies in the Baltic Sea area: Local Agenda 21 within the Union of the Baltic Cities network.

Science.gov (United States)

Joas, M; Grönholm, B

2001-08-01

Local Agenda 21 (LA21) processes have 2 central goals. i) On the basis of some of the empirical evidence in this study, the primary goal is to improve democratic (environmental) policy-making processes in such a manner that a larger share of the population will be able to participate in planning and decision making and will also be able to understand the consequences of these decisions. ii) The LA21 processes seek to improve (at least indirectly) the broadly defined environmental situation locally in a manner that takes into account both the local and the global contexts. The first part of this article discusses the concept and methods of LA21 and sheds light on the different action areas that are central to the Baltic LA21 processes. In addition, the study will describe and display the LA21 situation within one network of cities, the Union of the Baltic Cities (UBC). Networking, including transfer of information, models and ideas, has been among the main tools for the diffusion of LA21 ideas especially into newly democratized societies. Finally, the article will conclude with an overall assessment of the LA21 situation on the Baltic rim.

Trace Metals in Urban Stormwater Runoff and their Management

Science.gov (United States)

Li, T.; Hall, K.; Li, L. Y.; Schreier, H.

2009-04-01

In past decades, due to the rapid urbanization, land development has replaced forests, fields and meadows with impervious surfaces such as roofs, parking lots and roads, significantly affecting watershed quality and having an impact on aquatic systems. In this study, non-point source pollution from a diesel bus loop was assessed for the extent of trace metal contamination of Cu, Mn, Fe, and Zn in the storm water runoff. The study was carried out at the University of British Columbia (UBC) in the Greater Vancouver Regional District (GVRD) of British Columbia, Canada. Fifteen storm events were monitored at 3 sites from the diesel bus loop to determine spatial and temporal variations of dissolved and total metal concentrations in the storm water runoff. The dissolved metal concentrations were compared with the provincial government discharge criteria and the bus loop storm water quality was also compared with previous studies conducted across the GVRD urban area. To prevent storm water with hazardous levels of contaminants from being discharged into the urban drainage system, a storm water catch basin filter was installed and evaluated for its efficiency of contaminants removal. The perlite filter media adsorption capacities for the trace metals, oil and grease were studied for better maintenance of the catch basin filter. Dissolved copper exceeded the discharge criteria limit in 2 out of 15 cases, whereas dissolved zinc exceeded the criteria in 4 out of 15 cases, and dissolved manganese was below the criteria in all of the events sampled. Dissolved Cu and Zn accounted for 36 and 45% of the total concentration, whereas Mn and Fe only accounted for 20 and 4% of their total concentration, respectively. Since they are more mobile and have higher bioaccumulation potentials, Zn and Cu are considered to be more hazardous to the aquatic environment than Fe and Mn. With high imperviousness (100%) and intensive traffic at the UBC diesel bus loop, trace metal concentrations

Nature and nurture in the family physician's choice of practice location.

Science.gov (United States)

Orzanco, Maria Gabriela; Lovato, Chris; Bates, Joanna; Slade, Steve; Grand'Maison, Paul; Vanasse, Alain

2011-01-01

An understanding of the contextual, professional, and personal factors that affect choice of practice location for physicians is needed to support successful strategies in addressing geographic maldistribution of physicians. This study compared two categories of predictors of family practice location in non-metropolitan areas among undergraduate medical students: individual characteristics (nature), and the rural program component of their training program (nurture). The study aimed to identify factors that predict the location of practice 2 years post-residency training and determine the predictive value of combining nature and nurture variables using administrative data from two undergraduate medical education programs. Databases were developed from available administrative sources for a retrospective analysis of two undergraduate medical education programs in Canada: Université de Sherbrooke (UdeS) and University of British Columbia (UBC). Both schools have a strong mandate to evaluate the impact of their programs on physician distribution. The dependent variable was location of practice 2 years after completing postgraduate training in family medicine. Independent variables included individual and program characteristics. Separate analyses were conducted for each program using multiple logistic regression. The nature and nurture variables considered in the models explained only 21% to 27% of the variance in the eventual location of practice of family physician graduates. For UdeS, having an address in a rural/small-town environment at application to medical school (OR=2.61, 95% CI: 1.24-6.06) and for UBC, location of high school in a rural/small town (OR=4.03, 95% CI: 1.05-15.41), both increased the chances of practicing in a non-metropolitan area. For UdeS the nurture variable (ie length of clerkship in a non-metropolitan area) was the most significant predictor (OR=1.14, 95% CI: 1.067-1.22). For both medical schools, adding a single nurture variable to the

Antimicrobial evaluation of new metallic complexes with xylitol active against P. aeruginosa and C. albicans: MIC determination, post-agent effect and Zn-uptake.

Science.gov (United States)

Santi, E; Facchin, G; Faccio, R; Barroso, R P; Costa-Filho, A J; Borthagaray, G; Torre, M H

2016-02-01

Xylitol (xylH5) is metabolized via the pentose pathway in humans, but it is unsuitable as an energy source for many microorganisms where it produces a xylitol-induced growth inhibition and disturbance in protein synthesis. For this reason, xylitol is used in the prophylaxis of several infections. In the search of better antimicrobial agents, new copper and zinc complexes with xylitol were synthesized and characterized by analytical and spectrosco pic methods: Na2[Cu3(xylH−4)2]·NaCl·4.5H2O (Cu-xyl) and [Zn4(xylH−4)2(H2O)2]·NaCl·3H2O (Zn-xyl). Both copper and zinc complexes presented higher MIC against Pseudomona aeruginosa than the free xylitol while two different behaviors were found against Candida albicans depending on the complex. The growth curves showed that Cu-xyl presented lower activity than the free ligand during all the studied period. In the case of Znxyl the growth curves showed that the inhibition of the microorganism growth in the first stage was equivalent to that of xylitol but in the second stage (after 18 h) Zn-xyl inhibited more. Besides, the PAE (post agent effect)obtained for Zn-xyl and xyl showed that the recovery from the damage of microbial cells had a delay of 14 and 13 h respectively. This behavior could be useful in prophylaxis treatments for infectious diseases where it is important that the antimicrobial effect lasts longer. With the aim to understand the microbiological activities the analysis of the particle size, lipophilicity and Zn uptake was performed.

Symptomatic improvement reported after receiving Reiki at a cancer infusion center.

Science.gov (United States)

Marcus, Dawn A; Blazek-O'Neill, Betsy; Kopar, Jennifer L

2013-03-01

To evaluate patient-perceived benefits from receiving Reiki at a cancer infusion center. During a 6-month period, adults at a university hospital receiving Reiki through volunteer services were invited to complete a survey asking about perceived changes after Reiki. Changes in pain, mood, distress, sleep, and appetite were rated on a 5-point scale from no benefit to great benefit. Surveys were distributed after completing treatment and were returned in postage-paid envelops. A total of 145 surveys were completed (34.5% response rate), with 47 participants seen in the cancer infusion center and 98 in other areas of the hospital. Reiki was rated as a positive experience by 94% at the cancer center and 93% of others, with 92% at the cancer center and 86% of others interested in receiving additional Reiki sessions. Symptomatic improvement was similar for people at the cancer center and others, respectively, with much to great improvement for 89% and 86% for relaxation, 75% and 75% for anxiety/worry, 81% and 78% for improved mood, 43% and 35% for improved sleep, 45% and 49% for reduced pain, 38% and 43% for reduced isolation/loneliness, 75% and 63% for improved attitude, and 30% and 30% for improved appetite. Response was unaffected by previous exposure to Reiki, massage, or other touch therapy. Reiki results in a broad range of symptomatic benefits, including improvements in common cancer-related symptoms.

Paul Gauguin and the origin of Art Noveau

Science.gov (United States)

Asmus, John F.

1997-10-01

Since the turn of the century there has been widespread acknowledgement that Alphonse Mucha inspired the birth of the Art Nouveau movement when he created the 'Gismonda' poster advertising the opening of the Sarah Bernhardt play of that name in Paris in 1894. At an estate sale in 1954 a small collage bearing a likeness of the Mucha 'Gismonda' was offered. It was composed of fragments of sixty postage stamps glued to a small ceramic tile. Digital computer image processing has been applied to the collage design, scratches on the handle of a walking stick in the same collection, and the Mucha poster. From comparative analyses of the enhanced 'Gismonda' images it is revealed that the little collage is considerably more detailed and compete than the Mucha 'original'. Thus, it is concluded that the poster is a hasty photographic plagiarism of the intricate collage. Further image processing of the scratches on the handle of the walking stick and the collage reveal them to conform to the famous and enigmatic 'P GO' monogram signature of the artist Paul Gauguin. Thus, it follows that the original design was created by Gauguin rather than by Mucha. It may be that while Gauguin was in Brittany recovering from injuries sustained in a brawl his former lover, Annah la Javanese, pilfered his belongings and took them with her to Paris and her next lover, photographer-designer, Alphonse Mucha, who copied the collage and offered it as the Gismonda Poster.

Listeria monocytogenes serotype prevalence and biodiversity in diverse food products.

Science.gov (United States)

Hadjilouka, Agni; Andritsos, Nikolaos D; Paramithiotis, Spiros; Mataragas, Marios; Drosinos, Eleftherios H

2014-12-01

The aim of this study was to assess serotype prevalence and biodiversity of Listeria monocytogenes strains isolated from diverse food products, i.e., minced pork, fruits, and vegetables. Three hundred twenty-six samples previously purchased from supermarkets and street markets within the Athens area were studied for L. monocytogenes prevalence. A total of 121 strains were isolated from the 36 samples that were positive for L. monocytogenes. Serotyping was performed with multiplex PCR, and biodiversity was assessed with random amplified polymorphic DNA (RAPD) PCR analysis using M13, UBC155, and HLWL85 as primers and with repetitive element palindromic (rep) PCR analysis using (GTG)5 as the primer. The majority (17 of 22) of the contaminated minced pork samples contained strains identified as serotype 1/2a, either alone or in combination with strains belonging to serotypes 1/2b, 4a, 4c, or 4ab. However, all L. monocytogenes isolates from fruits and vegetables belonged to serotype 4b. Rep-PCR provided better differentiation of the isolates than did RAPD PCR and resulted in discrimination of the isolates into a larger number of unique profiles. Complete differentiation was achieved only with the combination of these subtyping techniques.

Distribution of mating-type alleles and M13 PCR markers in the black leaf spot fungus Mycosphaerella fijiensis of bananas in Brazil.

Science.gov (United States)

Queiroz, C B; Miranda, E C; Hanada, R E; Sousa, N R; Gasparotto, L; Soares, M A; Silva, G F

2013-02-08

The fungus Mycosphaerella fijiensis is the causative agent of black sigatoka, which is one of the most destructive diseases of banana plants. Infection with this pathogen results in underdeveloped fruit, with no commercial value. We analyzed the distribution of the M. fijiensis mating-type system and its genetic variability using M13 phage DNA markers. We found a 1:1 distribution of mating-type alleles, indicating MAT1-1 and MAT1-2 idiomorphs. A polymorphism analysis using three different primers for M13 markers showed that only the M13 minisatellite primers generated polymorphic products. We then utilized this polymorphism to characterize 40 isolates from various Brazilian states. The largest genetic distances were found between isolates from the same location and between isolates from different parts of the country. Therefore, there was no correlation between the genetic similarity and the geographic origin of the isolates. The M13 marker was used to generate genetic fingerprints for five isolates; these fingerprints were compared with the band profiles obtained from inter-simple sequence repeat (UBC861) and inter-retrotransposon amplified polymorphism analyses. We found that the M13 marker was more effective than the other two markers for differentiating these isolates.

Inversion of potential field data using the finite element method on parallel computers

Science.gov (United States)

Gross, L.; Altinay, C.; Shaw, S.

2015-11-01

In this paper we present a formulation of the joint inversion of potential field anomaly data as an optimization problem with partial differential equation (PDE) constraints. The problem is solved using the iterative Broyden-Fletcher-Goldfarb-Shanno (BFGS) method with the Hessian operator of the regularization and cross-gradient component of the cost function as preconditioner. We will show that each iterative step requires the solution of several PDEs namely for the potential fields, for the adjoint defects and for the application of the preconditioner. In extension to the traditional discrete formulation the BFGS method is applied to continuous descriptions of the unknown physical properties in combination with an appropriate integral form of the dot product. The PDEs can easily be solved using standard conforming finite element methods (FEMs) with potentially different resolutions. For two examples we demonstrate that the number of PDE solutions required to reach a given tolerance in the BFGS iteration is controlled by weighting regularization and cross-gradient but is independent of the resolution of PDE discretization and that as a consequence the method is weakly scalable with the number of cells on parallel computers. We also show a comparison with the UBC-GIF GRAV3D code.

Health literacy and chronic disease management: drawing from expert knowledge to set an agenda.

Science.gov (United States)

Poureslami, Iraj; Nimmon, Laura; Rootman, Irving; Fitzgerald, Mark J

2017-08-01

Understanding the nature and impact of health literacy is a priority in health promotion and chronic disease prevention and treatment. Health literacy comprises the application of a broad set of skills to access, comprehend, evaluate, communicate and act on health information for improved health and well-being. A complex concept, it involves multiple participants and is enacted across a wide variety of contexts. Health literacy's complexity has given rise to challenges achieving a standard definition and developing means to measure all its dimensions. In May 2013, a group of health literacy experts, clinicians and policymakers convened at an Expert Roundtable to review the current state of health literacy research and practice, and make recommendations about refining its definition, expanding its measurement and integrating best practices into chronic disease management. The four-day knowledge exchange concluded that the successful integration of health literacy into policy and practice depends on the development of a more substantial evidence base. A review of the successes and gaps in health literacy research, education and interventions culminated in the identification of key priorities to further the health literacy agenda. The workshop was funded by the UBC Peter Wall Institute for Advanced Studies, Vancouver. © The Author 2016. Published by Oxford University Press.

Identification of the Drosophila skpA gene as a novel target of the transcription factor DREF

International Nuclear Information System (INIS)

Dang Thi Phuong Thao; Ida, Hiroyuki; Yoshida, Hideki; Yamaguchi, Masamitsu

2006-01-01

SKPa is component of a Drosophila SCF complex that functions in combination with the ubiquitin-conjugating enzyme UbcD1. skpA null mutation results in centrosome overduplication, unusual chromatin condensation, defective endoreduplication and cell-cycle progression. While the molecular mechanisms that regulate expression of the skpA gene are poorly understood, the DNA replication-related element (DRE) and the DRE-binding factor (DREF) play important roles in regulating proliferation-related genes in Drosophila and DRE (5'-TATCGATA) and DRE-like (5'-CATCGATT) sequences were here found to be involved in skpA promoter activity. Thus both luciferase transient expression assays in cultured Drosophila S2 cells using skpA promoter-luciferase fusion plasmids and anti-lacZ immunostaining of various tissues from transgenic third instar larvae carrying the skpA promoter-lacZ fusion genes provided supportive evidence. Furthermore, anti-SKPa immunostaining of eye imaginal discs from flies overexpressing DREF showed ectopic expression of protein in the region posterior to the morphogenetic furrow where DREF is overexpressed. Knockdown of DREF in some tissues where SKPa distribution is well known almost completely abrogated the skpA gene expression. These findings, taken together, indicate that the Drosophila skpA gene is a novel target of the transcription factor DREF

FY 2000 report on the potential survey of the environmentally-friendly coal utilization system. Survey of the applicability of low grade coal reformation technology in Indonesia; 2000 nendo kankyo chowagata sekitan riyo system kanosei chosa hokokusho. Indonesia ni okeru teihin'itan kaishitsu gijutsu no tekiyosei chosa

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-03-01

Survey was made of the case of applying the low grade coal reformation technology to commercial plants in Indonesia. In the survey, supposing the UBC process as reformation technology and 5,000 t/d as size of the commercial plant, studies were made of companies to be applied, schemes on the usable fund raising/governmental supporting policy, potential diffusion/effects of diffusion, facilities which can be domestically manufactured/subjects in promoting the domestic manufacture, economic F/S, etc. Different from the first generation coal companies, the second generation coal companies own low grade coal for the most part of the coal resource. Therefore, the companies are very much interested in the reformation technology. In the financial plan, the equipment cost of a commercial plant of this size was estimated at approximately 10 billion yen. This is a large initial investment for coal companies in Indonesia. So, it is necessary to consider a system of joint venture with Japanese users, etc. As to the study of the economical efficiency, the trial calculation indicated that the reformation cost was 7.35 US$/product ton and the price of reformed coal briquette product was 19.85 US$/product ton. In this case, ROI (return on investment) of 8.40%/year was expected. (NEDO)

Requirement of the coiled-coil domain of PML-RARα oncoprotein for localization, sumoylation, and inhibition of monocyte differentiation

International Nuclear Information System (INIS)

Kim, Young-Eui; Kim, Dong-Yeon; Lee, Jang-Mi; Kim, Seong-Tae; Han, Tae-Hee; Ahn, Jin-Hyun

2005-01-01

Homo-oligomerization via a coiled-coil (C-C) domain has been shown to be necessary for the promyelocytic leukemia (PML)-retinoic acid receptor-α (RARα) fusion protein to acquire oncogenic potential in acute promyelocytic leukemia. We show here that PML(ΔC-C)-RARα, which contains a deletion in its C-C domain, is neither localized as characteristic microspeckles nor modified by small ubiquitin-like modifiers (SUMO). The absence of sumoylation of the ΔC-C mutant was due to the lack of binding to Ubc9, a SUMO conjugation enzyme. The integrity of RING finger domain was also needed for both sumoylation and microspeckle formation. In GAL4-DNA tethering assays, the ΔC-C mutant completely lost the inhibitory effect on retinoic acid (RA)-mediated transactivation. Furthermore, the expression of CD14 in U937 cells expressing the ΔC-C mutant in response to vitamin D3 was markedly higher than in cells expressing PML-RARα. However, the RA-mediated induction of C/EBPβ in cells expressing the ΔC-C mutant was comparable to that of control cells. Thus, our results suggest that the C-C domain-associated functions of sumoylation, localization as microspeckles, and the inhibition of monocyte differentiation all contribute to the oncogenic activity of PML-RARα

An interactive Web-based radiation protection course in fluoroscopy

International Nuclear Information System (INIS)

Aldrich, J.

2001-01-01

The teaching of radiation protection to a large group of physicians, who are separated geographically and have complicated schedules, is a formidable problem. Therefore a Web-based solution is attractive, allowing access to the material at any time and place. In this implementation the didactic material is presented in a Web-based format. Subsequently, students attend a practical demonstration in one of the departments' fluoroscopy rooms. Because of local experience with distance education, WebCT was chosen to present the material. WebCT (Web Course Tools) was developed by the University of British Columbia (UBC) to allow educators, with or without technical expertise, to create a sophisticated Web-base. Authors use a standard Web browser to create courses, and students use their browsers to access course material. WebCT provides a wide variety of tools and features that can be added to a course. Among the most useful tools used in this fluoroscopy course are the glossary, multiple-choice questions for each section, and a final test which is scored by the computer. As with all Web-based material the courses can be viewed in the traditional linear fashion or in any random way through the use of linkages. (author)

Re-evaluation and updating of the seismic hazard of Lebanon

Science.gov (United States)

Huijer, Carla; Harajli, Mohamed; Sadek, Salah

2016-01-01

This paper presents the results of a study undertaken to evaluate the implications of the newly mapped offshore Mount Lebanon Thrust (MLT) fault system on the seismic hazard of Lebanon and the current seismic zoning and design parameters used by the local engineering community. This re-evaluation is critical, given that the MLT is located at close proximity to the major cities and economic centers of the country. The updated seismic hazard was assessed using probabilistic methods of analysis. The potential sources of seismic activities that affect Lebanon were integrated along with any/all newly established characteristics within an updated database which includes the newly mapped fault system. The earthquake recurrence relationships of these sources were developed from instrumental seismology data, historical records, and earlier studies undertaken to evaluate the seismic hazard of neighboring countries. Maps of peak ground acceleration contours, based on 10 % probability of exceedance in 50 years (as per Uniform Building Code (UBC) 1997), as well as 0.2 and 1 s peak spectral acceleration contours, based on 2 % probability of exceedance in 50 years (as per International Building Code (IBC) 2012), were also developed. Finally, spectral charts for the main coastal cities of Beirut, Tripoli, Jounieh, Byblos, Saida, and Tyre are provided for use by designers.

Assessing reference genes for accurate transcript normalization using quantitative real-time PCR in pearl millet [Pennisetum glaucum (L. R. Br].

Directory of Open Access Journals (Sweden)

Prasenjit Saha

Full Text Available Pearl millet [Pennisetum glaucum (L. R.Br.], a close relative of Panicoideae food crops and bioenergy grasses, offers an ideal system to perform functional genomics studies related to C4 photosynthesis and abiotic stress tolerance. Quantitative real-time reverse transcription polymerase chain reaction (qRT-PCR provides a sensitive platform to conduct such gene expression analyses. However, the lack of suitable internal control reference genes for accurate transcript normalization during qRT-PCR analysis in pearl millet is the major limitation. Here, we conducted a comprehensive assessment of 18 reference genes on 234 samples which included an array of different developmental tissues, hormone treatments and abiotic stress conditions from three genotypes to determine appropriate reference genes for accurate normalization of qRT-PCR data. Analyses of Ct values using Stability Index, BestKeeper, ΔCt, Normfinder, geNorm and RefFinder programs ranked PP2A, TIP41, UBC2, UBQ5 and ACT as the most reliable reference genes for accurate transcript normalization under different experimental conditions. Furthermore, we validated the specificity of these genes for precise quantification of relative gene expression and provided evidence that a combination of the best reference genes are required to obtain optimal expression patterns for both endogeneous genes as well as transgenes in pearl millet.

The Effect of Automation on Job Duties, Classifications, Staffing Patterns, and Labor Costs in the UBC Library's Cataloguing Divisions: A Comparison of 1973 and 1986.

Science.gov (United States)

de Bruijn, Erik

This report discusses an ex post facto study that was done to examine the effect that the implementation of automated systems has had on libraries and support staff, labor costs, and productivity in the cataloging divisions of the library of the University of British Columbia. A comparison was made between two years: 1973, a pre-automated period…

An advanced communication skills course for fourth-year, post-clerkship students.

Science.gov (United States)

Towle, Angela; Hoffman, Joanne

2002-11-01

A novel five-module advanced communication skills course entitled "Doctor-Patient Relationships" was planned and implemented in 2000-01 at the University of British Columbia (UBC). The course was part of the final four-month component of the new MD undergraduate program: Effective Skills for Medical Practice. The goals of the communication skills course were to (1) address problems experienced by the students so far; (2) address deficiencies in achieving the UBC exit competencies; (3) help the students pass the Medical Council of Canada examinations, in particular objectives related to the Considerations of the Legal, Ethical, and Organizational aspects of the practice of medicine (CLEO); and (4) help students prepare for their roles beyond undergraduate medicine (residency, independent practice). The course was developed by an interdisciplinary team (family practice, pathology, pediatrics, psychiatry, surgery) with input from students. The broad strengths and weaknesses of their communication skills training were identified by seven third-year medical students who kept logs over the course of their clinical clerkships to document their learning of communication skills. Analysis of these logs plus feedback meetings with the students revealed attitudinal and skills issues that needed to be addressed in the new course. The goals and principles of the course were in part agreed upon by focus groups with students, attended by faculty observers, to ensure their relevance to students. The first module "Beyond the Mask: Surviving and Thriving in Residency Training" is designed to focus students' attention on the personal relevance of developing excellence in communication skills in preparation for residency training. It includes a video of residents talking about their experiences of communication problems to trigger reflection and discussion. In the remaining four modules the students are required to put communication skills together with their medical knowledge. Each

NUCLEI OF DESERTIFICATION IN STATE OF PARAÍBA

Directory of Open Access Journals (Sweden)

Jose Jakson Amancio Alves

2009-06-01

Full Text Available The present work boards desertification problem in Paraíba who directly is related to degradation produced by the man in the stunted sparse forest and in the environmental terms and fitogeography of this geoecosystem. The domain geoecology of the stunted sparse forests extends for about 1037.517,80 km², under the latitudes between tropics, comprehended between 2º 45’ and 17º 21’ LS.  Its area corresponds to 54% of the region Northeast and to 11% of the brazilian territory; it constitutes the droughts called polygon. In the stunted sparse forest the woody species call the attention for their biological forms and by the dominant position in the formation structure. In magnitude function of these characteristic, that corresponds to the largest problem in desertification cores generation in state of Paraíba. These woody species of rickety postage are the appreciated most for the burning in coal-pits, bakeries oven, etc. they are fácies more drought and degraded of the stunted sparse forests. Another aspect to observe is that to the natural fragility of this ecosystem brings serious consequences for geótopos and for biocenoses, as well as, the devastation practice of great spaces by the burnt for the pasture areas, provoking great unbalance in the ecosystem and contributing with the earth’s degradation process. That work points a series of surveys that emphasize that process in state of Paraíba, as well as, a contribution for contention of their effects.

Barriers in the implementation of a physical activity intervention in primary care settings: lessons learned.

Science.gov (United States)

Josyula, Lakshmi K; Lyle, Roseann M

2013-01-01

Barriers encountered in implementing a physical activity intervention in primary health care settings, and ways to address them, are described in this paper. A randomized comparison trial was designed to examine the impact of health care providers' written prescriptions for physical activity, with or without additional physical activity resources, to adult, nonpregnant patients on preventive care or chronic disease monitoring visits. Following abysmal recruitment outcomes, the research protocol was altered to make it more appealing to all the participants, i.e., health care providers, office personnel, and patients. Various barriers--financial, motivational, and executive--to the implementation of health promotion interventions in primary health care settings were experienced and identified. These barriers have been classified by the different participants in the research process, viz., healthcare providers, administrative personnel, researchers, and patients. Some of the barriers identified were lack of time and reimbursement for health promotion activities, and inadequate practice capacity, for health care providers; increased time and labor demands for administrative personnel; constrained access to participants, and limited funding, for researchers; and superseding commitments, and inaccurate comprehension of the research protocol, for patients. Solutions suggested to overcome these barriers include financial support, e.g., funding for researchers, remuneration for health care organization personnel, reimbursement for providers, payment for participants, and free or subsidized postage, and use of health facilities; motivational strategies such as inspirational leadership, and contests within health care organizations; and partnerships, with other expert technical and creative entities, to improve the quality, efficiency, and acceptability of health promotion interventions.

A new methodology for establishing a system for cross-border transmission tariffication in the internal electricity market

International Nuclear Information System (INIS)

Glavitsch, H.; Andersson, G.

2001-01-01

Several organisations are working on a scheme for cross-border tariffication as the so-called Florence forum indicates. So far, a provisional concept created by ETSO (European Transmission System Operators) evolved which is oriented towards covering costs but is not quite cost-reflective and does not produce economic signals for the market players. In the present project a flow-oriented model and a corresponding methodology have been developed which derive compensations within super nodes standing for aggregated networks of the countries along transit and domestic paths. Specific fees are derived from overall network costs but may be applied in a flexible way to represent the realistic usage of the horizontal network for transits and domestic supply. Charging of costs can be oriented towards consumers or generators. A combination of shares of costs originally determined for consumers and generators is also possible. In such a way the model is flexible to fulfill the requirements of regulators, operators and the European Commission. Measured flow data of the UCTE network have been provided to check the concept in various directions, i.e. based on different parameters such as uniform and individual postage stamps, compensations for transits only and more elaborate networks of super nodes. The concept is also able to cope with circular flows within the real UCTE network. The methodology is suited for an application in a decentralised fashion as the transmission system operator needs to communicate with its neighboring operator only, i.e. there is no need for a centralised clearing office. (author)

Advertising postcards in the collections of the National Museum of the History of Moldova (late 19th c. - the 1st half of the 20th c.

Directory of Open Access Journals (Sweden)

Ana Griţco

2017-12-01

Full Text Available The subject of the paper is advertising postcards, discovered during the research of the museum collection of postcards. Performed in the style of their time, they reflect changes in both production and society. Unlike postage stamps and envelopes, the postcard is more convenient as a carrier of information, including advertising. The first classic promotional postcards appeared in Europe in the late 1870s, initially they presented advertising of hotels and restaurants. In Russia, including in Bessarabia, annexed by the Russian Empire in 1812, the first postcards with advertising content appeared in 1896. They can be divided into three categories: postcards with images similar to images in newspapers, postcards “as in a magazine” (a picture accompanied by text and postcards with the views of certain buildings, accompanied by an explanatory text. The first two categories were usually distributed by the owners of the advertised objects, and the third was sold by souvenir dealers. According to their purpose, illustrated postcards serve for iconographic popularization. On some postcards the image is not associated with the text of the ad, located, as a rule, on the reverse side. This includes postcards, which indicate the author of the image and the publisher, advertised via postcards. On other postcards the image itself serves as an advertisement and is not always accompanied by text. This includes postcards depicting places of entertainment, recreation areas, trading houses, outstanding buildings, etc. A special place is occupied by tourist advertising cards, the most popular and, as a rule, the most numerous in museum and private collections.

Impact of gas on utilities - competitive energy options

International Nuclear Information System (INIS)

Coolican, M.

1997-01-01

The initiatives taken by Nova Scotia Power to have natural gas as a generating fuel was discussed. Nova Scotia Power customers have indicated to the Utility that along with reduced energy costs, they want choices, better services and innovative products. It was noted that coal is currently Nova Scotia Power's principal fuel, but the utility is working with the Cape Breton Development Corporation, their supplier, to bring the cost of coal down. The utility is also exploring the potential of coal bed methane in Pictou and Cumberland counties of Nova Scotia. However, the most promising competitive energy option for their customers is Sable Offshore natural gas. To bring natural gas as the generating fuel for electricity, the Utility is taking steps to convert its Tufts Cove Thermal Generating Station to natural gas and to pipe natural gas to the Trenton Generating Station by November 1999. Bringing natural gas to these two stations would establish a critical base level of demand for natural gas in the Halifax and New Glasgow-Trenton area. One of the important ingredients of this plan is the cost of piping the gas to market. It was suggested that the 'postage stamp' tolling system (i.e. one price for the gas delivered anywhere along the pipeline) favored by some, would not give Nova Scotians the economic advantages that they deserve. For this reason, Nova Scotia Power favours the 'point to point' tolling system, a system that is considered fair and efficient, and the one that has a better chance of producing competitive energy prices

Oil and Gas field code master list 1995

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-12-01

This is the fourteenth annual edition of the Energy Information Administration`s (EIA) Oil and Gas Field Code Master List. It reflects data collected through October 1995 and provides standardized field name spellings and codes for all identified oil and/or gas fields in the US. The Field Code Index, a listing of all field names and the States in which they occur, ordered by field code, has been removed from this year`s publications to reduce printing and postage costs. Complete copies (including the Field Code Index) will be available on the EIA CD-ROM and the EIA World-Wide Web Site. Future editions of the complete Master List will be available on CD-ROM and other electronic media. There are 57,400 field records in this year`s Oil and Gas Field Code Master List. As it is maintained by EIA, the Master List includes the following: field records for each State and county in which a field resides; field records for each offshore area block in the Gulf of Mexico in which a field resides; field records for each alias field name (see definition of alias below); and fields crossing State boundaries that may be assigned different names by the respective State naming authorities. Taking into consideration the double-counting of fields under such circumstances, EIA identifies 46,312 distinct fields in the US as of October 1995. This count includes fields that no longer produce oil or gas, and 383 fields used in whole or in part for oil or gas Storage. 11 figs., 6 tabs.

Assessment of reference gene stability in Rice stripe virus and Rice black streaked dwarf virus infection rice by quantitative Real-time PCR.

Science.gov (United States)

Fang, Peng; Lu, Rongfei; Sun, Feng; Lan, Ying; Shen, Wenbiao; Du, Linlin; Zhou, Yijun; Zhou, Tong

2015-10-24

Stably expressed reference gene(s) normalization is important for the understanding of gene expression patterns by quantitative Real-time PCR (RT-qPCR), particularly for Rice stripe virus (RSV) and Rice black streaked dwarf virus (RBSDV) that caused seriously damage on rice plants in China and Southeast Asia. The expression of fourteen common used reference genes of Oryza sativa L. were evaluated by RT-qPCR in RSV and RBSDV infected rice plants. Suitable normalization reference gene(s) were identified by geNorm and NormFinder algorithms. UBQ 10 + GAPDH and UBC + Actin1 were identified as suitable reference genes for RT-qPCR normalization under RSV and RBSDV infection, respectively. When using multiple reference genes, the expression patterns of OsPRIb and OsWRKY, two virus resistance genes, were approximately similar with that reported previously. Comparatively, by using single reference gene (TIP41-Like), a weaker inducible response was observed. We proposed that the combination of two reference genes could obtain more accurate and reliable normalization of RT-qPCR results in RSV- and RBSDV-infected plants. This work therefore sheds light on establishing a standardized RT-qPCR procedure in RSV- and RBSDV-infected rice plants, and might serve as an important point for discovering complex regulatory networks and identifying genes relevant to biological processes or implicated in virus.

Molecular characterization of Anthurium genotypes by using DNA fingerprinting and SPAR markers.

Science.gov (United States)

Souza Neto, J D; Soares, T C B; Motta, L B; Cabral, P D S; Silva, J A

2014-07-02

We characterized single primer amplification reaction (SPAR) molecular markers from 20 genotypes of Anthurium andraeanum Lind., including 3 from commercial varieties and 17 from 2 communities in the State of Espírito Santo, Brazil. Twenty-four SPAR, consisting of 7 random amplified polymorphic DNA and 17 inter-simple sequence repeat markers were used to estimate the genetic diversity of 20 Anthurium accessions. The set of SPAR markers generated 288 bands and showed an average polymorphism percentage of 93.39%, ranging from 71.43 to 100%. The polymorphism information content (PIC) of the random amplified polymorphic DNA primers averaged 0.364 and ranged from 0.258 to 0.490. Primer OPF 06 showed the lowest PIC, while OPAM 14 was the highest. The average PIC of the inter-simple sequence repeat primers was 0.299, with values ranging from 0.196 to 0.401. Primer UBC 845 had the lowest PIC (0.196), while primer UCB 810 had the highest (0.401). By using the complement of Jaccard's similarity index and unweighted pair group method with arithmetic mean clustering, 5 clusters were formed with a cophenetic correlation coefficient of 0.8093, indicating an acceptable clustering consistency. However, no genotype clustering patterns agreed with the morphological data. The Anthurium genotypes investigated in this study are a germplasm source for conservational research and may be used in improvement programs for this species.

Accurate Modelling of Surface Currents and Internal Tides in a Semi-enclosed Coastal Sea

Science.gov (United States)

Allen, S. E.; Soontiens, N. K.; Dunn, M. B. H.; Liu, J.; Olson, E.; Halverson, M. J.; Pawlowicz, R.

2016-02-01

The Strait of Georgia is a deep (400 m), strongly stratified, semi-enclosed coastal sea on the west coast of North America. We have configured a baroclinic model of the Strait of Georgia and surrounding coastal waters using the NEMO ocean community model. We run daily nowcasts and forecasts and publish our sea-surface results (including storm surge warnings) to the web (salishsea.eos.ubc.ca/storm-surge). Tides in the Strait of Georgia are mixed and large. The baroclinic model and previous barotropic models accurately represent tidal sea-level variations and depth mean currents. The baroclinic model reproduces accurately the diurnal but not the semi-diurnal baroclinic tidal currents. In the Southern Strait of Georgia, strong internal tidal currents at the semi-diurnal frequency are observed. Strong semi-diurnal tides are also produced in the model, but are almost 180 degrees out of phase with the observations. In the model, in the surface, the barotropic and baroclinic tides reinforce, whereas the observations show that at the surface the baroclinic tides oppose the barotropic. As such the surface currents are very poorly modelled. Here we will present evidence of the internal tidal field from observations. We will discuss the generation regions of the tides, the necessary modifications to the model required to correct the phase, the resulting baroclinic tides and the improvements in the surface currents.

Identification and Evaluation of Reliable Reference Genes for Quantitative Real-Time PCR Analysis in Tea Plant (Camellia sinensis (L.) O. Kuntze)

Science.gov (United States)

Hao, Xinyuan; Horvath, David P.; Chao, Wun S.; Yang, Yajun; Wang, Xinchao; Xiao, Bin

2014-01-01

Reliable reference selection for the accurate quantification of gene expression under various experimental conditions is a crucial step in qRT-PCR normalization. To date, only a few housekeeping genes have been identified and used as reference genes in tea plant. The validity of those reference genes are not clear since their expression stabilities have not been rigorously examined. To identify more appropriate reference genes for qRT-PCR studies on tea plant, we examined the expression stability of 11 candidate reference genes from three different sources: the orthologs of Arabidopsis traditional reference genes and stably expressed genes identified from whole-genome GeneChip studies, together with three housekeeping gene commonly used in tea plant research. We evaluated the transcript levels of these genes in 94 experimental samples. The expression stabilities of these 11 genes were ranked using four different computation programs including geNorm, Normfinder, BestKeeper, and the comparative ∆CT method. Results showed that the three commonly used housekeeping genes of CsTUBULIN1, CsACINT1 and Cs18S rRNA1 together with CsUBQ1 were the most unstable genes in all sample ranking order. However, CsPTB1, CsEF1, CsSAND1, CsCLATHRIN1 and CsUBC1 were the top five appropriate reference genes for qRT-PCR analysis in complex experimental conditions. PMID:25474086

Cell cycle-dependent SUMO-1 conjugation to nuclear mitotic apparatus protein (NuMA)

Energy Technology Data Exchange (ETDEWEB)

Seo, Jae Sung; Kim, Ha Na; Kim, Sun-Jick; Bang, Jiyoung; Kim, Eun-A; Sung, Ki Sa [Department of Biological Sciences, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Yoon, Hyun-Joo [TissueGene Inc. 9605 Medical Center Dr., Rockville, MD 20850 (United States); Yoo, Hae Yong [Department of Health Sciences and Technology, Samsung Advanced Institute for Health Sciences and Technology, Samsung Medical Center, Sungkyunkwan University, Seoul 135-710 (Korea, Republic of); Choi, Cheol Yong, E-mail: choicy@skku.ac.kr [Department of Biological Sciences, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of)

2014-01-03

Highlights: •NuMA is modified by SUMO-1 in a cell cycle-dependent manner. •NuMA lysine 1766 is the primary target site for SUMOylation. •SUMOylation-deficient NuMA induces multiple spindle poles during mitosis. •SUMOylated NuMA induces microtubule bundling. -- Abstract: Covalent conjugation of proteins with small ubiquitin-like modifier 1 (SUMO-1) plays a critical role in a variety of cellular functions including cell cycle control, replication, and transcriptional regulation. Nuclear mitotic apparatus protein (NuMA) localizes to spindle poles during mitosis, and is an essential component in the formation and maintenance of mitotic spindle poles. Here we show that NuMA is a target for covalent conjugation to SUMO-1. We find that the lysine 1766 residue is the primary NuMA acceptor site for SUMO-1 conjugation. Interestingly, SUMO modification of endogenous NuMA occurs at the entry into mitosis and this modification is reversed after exiting from mitosis. Knockdown of Ubc9 or forced expression of SENP1 results in impairment of the localization of NuMA to mitotic spindle poles during mitosis. The SUMOylation-deficient NuMA mutant is defective in microtubule bundling, and multiple spindles are induced during mitosis. The mitosis-dependent dynamic SUMO-1 modification of NuMA might contribute to NuMA-mediated formation and maintenance of mitotic spindle poles during mitosis.

Identification of Sumoylated Proteins in the Silkworm Bombyx mori

Science.gov (United States)

Tang, Xudong; Fu, Xuliang; Hao, Bifang; Zhu, Feng; Xiao, Shengyan; Xu, Li; Shen, Zhongyuan

2014-01-01

Small ubiquitin-like modifier (SUMO) modification (SUMOylation) is an important and widely used reversible modification system in eukaryotic cells. It regulates various cell processes, including protein targeting, transcriptional regulation, signal transduction, and cell division. To understand its role in the model lepidoptera insect Bombyx mori, a recombinant baculovirus was constructed to express an enhanced green fluorescent protein (eGFP)-SUMO fusion protein along with ubiquitin carrier protein 9 of Bombyx mori (BmUBC9). SUMOylation substrates from Bombyx mori cells infected with this baculovirus were isolated by immunoprecipitation and identified by LC–ESI-MS/MS. A total of 68 candidate SUMOylated proteins were identified, of which 59 proteins were functionally categorized to gene ontology (GO) terms. Analysis of kyoto encyclopedia of genes and genomes (KEGG) pathways showed that 46 of the identified proteins were involved in 76 pathways that mainly play a role in metabolism, spliceosome and ribosome functions, and in RNA transport. Furthermore, SUMOylation of four candidates (polyubiquitin-C-like isoform X1, 3-hydroxyacyl-CoA dehydrogenase, cyclin-related protein FAM58A-like and GTP-binding nuclear protein Ran) were verified by co-immunoprecipitation in Drosophila schneide 2 cells. In addition, 74% of the identified proteins were predicted to have at least one SUMOylation site. The data presented here shed light on the crucial process of protein sumoylation in Bombyx mori. PMID:25470021

Parallel analysis of tagged deletion mutants efficiently identifies genes involved in endoplasmic reticulum biogenesis.

Science.gov (United States)

Wright, Robin; Parrish, Mark L; Cadera, Emily; Larson, Lynnelle; Matson, Clinton K; Garrett-Engele, Philip; Armour, Chris; Lum, Pek Yee; Shoemaker, Daniel D

2003-07-30

Increased levels of HMG-CoA reductase induce cell type- and isozyme-specific proliferation of the endoplasmic reticulum. In yeast, the ER proliferations induced by Hmg1p consist of nuclear-associated stacks of smooth ER membranes known as karmellae. To identify genes required for karmellae assembly, we compared the composition of populations of homozygous diploid S. cerevisiae deletion mutants following 20 generations of growth with and without karmellae. Using an initial population of 1,557 deletion mutants, 120 potential mutants were identified as a result of three independent experiments. Each experiment produced a largely non-overlapping set of potential mutants, suggesting that differences in specific growth conditions could be used to maximize the comprehensiveness of similar parallel analysis screens. Only two genes, UBC7 and YAL011W, were identified in all three experiments. Subsequent analysis of individual mutant strains confirmed that each experiment was identifying valid mutations, based on the mutant's sensitivity to elevated HMG-CoA reductase and inability to assemble normal karmellae. The largest class of HMG-CoA reductase-sensitive mutations was a subset of genes that are involved in chromatin structure and transcriptional regulation, suggesting that karmellae assembly requires changes in transcription or that the presence of karmellae may interfere with normal transcriptional regulation. Copyright 2003 John Wiley & Sons, Ltd.

Use of a wine yeast deletion collection reveals genes that influence fermentation performance under low-nitrogen conditions.

Science.gov (United States)

Peter, Josephine J; Watson, Tommaso L; Walker, Michelle E; Gardner, Jennifer M; Lang, Tom A; Borneman, Anthony; Forgan, Angus; Tran, Tina; Jiranek, Vladimir

2018-05-01

A deficiency of nitrogenous nutrients in grape juice can cause stuck and sluggish alcoholic fermentation, which has long been a problem in winemaking. Nitrogen requirements vary between wine yeast strains, and the ability of yeast to assimilate nitrogen depends on the nature and concentration of nitrogen present in the medium. In this study, a wine yeast gene deletion collection (1844 deletants in the haploid AWRI1631 background) was screened to identify genes whose deletion resulted in a reduction in the time taken to utilise all sugars when grown in a chemically defined grape juice medium supplemented with limited nitrogen (75 mg L-1 as a free amino acid mixture). Through micro-scale and laboratory-scale fermentations, 15 deletants were identified that completed fermentation in a shorter time than the wildtype (c.a. 15%-59% time reduction). This group of genes was annotated to biological processes including protein modification, transport, metabolism and ubiquitination (UBC13, MMS2, UBP7, UBI4, BRO1, TPK2, EAR1, MRP17, MFA2 and MVB12), signalling (MFA2) and amino acid metabolism (AAT2). Deletion of MFA2, encoding mating factor-a, resulted in a 55% decrease in fermentation duration. Mfa2Δ was chosen for further investigation to understand how this gene deletion conferred fermentation efficiency in limited nitrogen conditions.

Heterologous SUMO-2/3-ubiquitin chains optimize IκBα degradation and NF-κB activity.

Directory of Open Access Journals (Sweden)

Fabienne Aillet

Full Text Available The NF-κB pathway is regulated by SUMOylation at least at three levels: the inhibitory molecule IκBα, the IKK subunit γ/NEMO and the p52 precursor p100. Here we investigate the role of SUMO-2/3 in the degradation of IκBα and activation of NF-κB mediated by TNFα. We found that under conditions of deficient SUMOylation, an important delay in both TNFα-mediated proteolysis of IκBα and NF-κB dependent transcription occurs. In vitro and ex vivo approaches, including the use of ubiquitin-traps (TUBEs, revealed the formation of chains on IκBα containing SUMO-2/3 and ubiquitin after TNFα stimulation. The integration of SUMO-2/3 appears to promote the formation of ubiquitin chains on IκBα after activation of the TNFα signalling pathway. Furthermore, heterologous chains of SUMO-2/3 and ubiquitin promote a more efficient degradation of IκBα by the 26S proteasome in vitro compared to chains of either SUMO-2/3 or ubiquitin alone. Consistently, Ubc9 silencing reduced the capture of IκBα modified with SUMO-ubiquitin hybrid chains that display a defective proteasome-mediated degradation. Thus, hybrid SUMO-2/3-ubiquitin chains increase the susceptibility of modified IκBα to the action of 26S proteasome, contributing to the optimal control of NF-κB activity after TNFα-stimulation.

Smad3 recruits the anaphase-promoting complex for ubiquitination and degradation of SnoN

Energy Technology Data Exchange (ETDEWEB)

Stroschein, Shannon L.; Bonni, Shirin; Wrana, Jeffrey L.; Luo, Kunxin

2001-09-11

Smad proteins mediate transforming growth factor-b signaling to regulate cell growth and differentiation. SnoN is an important negative regulator of TGFb signaling that functions to maintain the repressed state of TGFb target genes in the absence of ligand. Upon TGFb stimulation, Smad3 and Smad2 translocate into the nucleus and induce a rapid degradation of SnoN, allowing activation of TGFb target genes. Here we show that Smad2- or Smad3-induced degradation of SnoN requires the ubiquitin-dependent proteasome and can be mediated by the anaphase promoting complex (APC) and the UbcH5 family of ubiquitin conjugating enzymes. Smad3 and to a lesser extent, Smad2, interact with both the APC and SnoN, resulting in the recruitment of the APC to SnoN and subsequent ubiquitination of SnoN in a destruction box-dependent manner. In addition to the destruction box, efficient degradation of SnoN also requires the Smad3 binding site in SnoN as well as key lysine residues necessary for ubiquitin attachment. Mutation of either the Smad3 binding site or lysine residues results in stabilization of SnoN and in enhanced antagonism of TGFb signaling. Our studies elucidate an important pathway for the degradation of SnoN and reveal a novel role of the APC in regulation of TGFb signaling.

Temporal Genetic Modifications after Controlled Cortical Impact—Understanding Traumatic Brain Injury through a Systematic Network Approach

Directory of Open Access Journals (Sweden)

Yung-Hao Wong

2016-02-01

Full Text Available Traumatic brain injury (TBI is a primary injury caused by external physical force and also a secondary injury caused by biological processes such as metabolic, cellular, and other molecular events that eventually lead to brain cell death, tissue and nerve damage, and atrophy. It is a common disease process (as opposed to an event that causes disabilities and high death rates. In order to treat all the repercussions of this injury, treatment becomes increasingly complex and difficult throughout the evolution of a TBI. Using high-throughput microarray data, we developed a systems biology approach to explore potential molecular mechanisms at four time points post-TBI (4, 8, 24, and 72 h, using a controlled cortical impact (CCI model. We identified 27, 50, 48, and 59 significant proteins as network biomarkers at these four time points, respectively. We present their network structures to illustrate the protein–protein interactions (PPIs. We also identified UBC (Ubiquitin C, SUMO1, CDKN1A (cyclindependent kinase inhibitor 1A, and MYC as the core network biomarkers at the four time points, respectively. Using the functional analytical tool MetaCore™, we explored regulatory mechanisms and biological processes and conducted a statistical analysis of the four networks. The analytical results support some recent findings regarding TBI and provide additional guidance and directions for future research.

Smad3 recruits the anaphase-promoting complex for ubiquitination and degradation of SnoN

International Nuclear Information System (INIS)

Stroschein, Shannon L.; Bonni, Shirin; Wrana, Jeffrey L.; Luo, Kunxin

2001-01-01

Smad proteins mediate transforming growth factor-b signaling to regulate cell growth and differentiation. SnoN is an important negative regulator of TGFb signaling that functions to maintain the repressed state of TGFb target genes in the absence of ligand. Upon TGFb stimulation, Smad3 and Smad2 translocate into the nucleus and induce a rapid degradation of SnoN, allowing activation of TGFb target genes. Here we show that Smad2- or Smad3-induced degradation of SnoN requires the ubiquitin-dependent proteasome and can be mediated by the anaphase promoting complex (APC) and the UbcH5 family of ubiquitin conjugating enzymes. Smad3 and to a lesser extent, Smad2, interact with both the APC and SnoN, resulting in the recruitment of the APC to SnoN and subsequent ubiquitination of SnoN in a destruction box-dependent manner. In addition to the destruction box, efficient degradation of SnoN also requires the Smad3 binding site in SnoN as well as key lysine residues necessary for ubiquitin attachment. Mutation of either the Smad3 binding site or lysine residues results in stabilization of SnoN and in enhanced antagonism of TGFb signaling. Our studies elucidate an important pathway for the degradation of SnoN and reveal a novel role of the APC in regulation of TGFb signaling

Small ubiquitin-like modifier (SUMO) conjugation impedes transcriptional silencing by the polycomb group repressor Sex Comb on Midleg.

Science.gov (United States)

Smith, Matthew; Mallin, Daniel R; Simon, Jeffrey A; Courey, Albert J

2011-04-01

The Drosophila protein Sex Comb on Midleg (Scm) is a member of the Polycomb group (PcG), a set of transcriptional repressors that maintain silencing of homeotic genes during development. Recent findings have identified PcG proteins both as targets for modification by the small ubiquitin-like modifier (SUMO) protein and as catalytic components of the SUMO conjugation pathway. We have found that the SUMO-conjugating enzyme Ubc9 binds to Scm and that this interaction, which requires the Scm C-terminal sterile α motif (SAM) domain, is crucial for the efficient sumoylation of Scm. Scm is associated with the major Polycomb response element (PRE) of the homeotic gene Ultrabithorax (Ubx), and efficient PRE recruitment requires an intact Scm SAM domain. Global reduction of sumoylation augments binding of Scm to the PRE. This is likely to be a direct effect of Scm sumoylation because mutations in the SUMO acceptor sites in Scm enhance its recruitment to the PRE, whereas translational fusion of SUMO to the Scm N terminus interferes with this recruitment. In the metathorax, Ubx expression promotes haltere formation and suppresses wing development. When SUMO levels are reduced, we observe decreased expression of Ubx and partial haltere-to-wing transformation phenotypes. These observations suggest that SUMO negatively regulates Scm function by impeding its recruitment to the Ubx major PRE.

Small Ubiquitin-like Modifier (SUMO) Conjugation Impedes Transcriptional Silencing by the Polycomb Group Repressor Sex Comb on Midleg*

Science.gov (United States)

Smith, Matthew; Mallin, Daniel R.; Simon, Jeffrey A.; Courey, Albert J.

2011-01-01

The Drosophila protein Sex Comb on Midleg (Scm) is a member of the Polycomb group (PcG), a set of transcriptional repressors that maintain silencing of homeotic genes during development. Recent findings have identified PcG proteins both as targets for modification by the small ubiquitin-like modifier (SUMO) protein and as catalytic components of the SUMO conjugation pathway. We have found that the SUMO-conjugating enzyme Ubc9 binds to Scm and that this interaction, which requires the Scm C-terminal sterile α motif (SAM) domain, is crucial for the efficient sumoylation of Scm. Scm is associated with the major Polycomb response element (PRE) of the homeotic gene Ultrabithorax (Ubx), and efficient PRE recruitment requires an intact Scm SAM domain. Global reduction of sumoylation augments binding of Scm to the PRE. This is likely to be a direct effect of Scm sumoylation because mutations in the SUMO acceptor sites in Scm enhance its recruitment to the PRE, whereas translational fusion of SUMO to the Scm N terminus interferes with this recruitment. In the metathorax, Ubx expression promotes haltere formation and suppresses wing development. When SUMO levels are reduced, we observe decreased expression of Ubx and partial haltere-to-wing transformation phenotypes. These observations suggest that SUMO negatively regulates Scm function by impeding its recruitment to the Ubx major PRE. PMID:21278366

Genetic similarity between coriander genotypes using ISSR markers Similaridade genética entre genótipos de coentro por marcadores ISSR

Directory of Open Access Journals (Sweden)

Roberto de A Melo

2011-12-01

Full Text Available With the development of new cultivars, a precise genetic characterization is essential for improvement programs or for cultivar registration and protection. Molecular markers have been complementing the traditional morphological and agronomic characterization techniques because they are virtually unlimited, cover the whole genome and are not environmentally influenced. Genetic characterization constitutes the basis for studies involving estimates of genetic similarity. Therefore, the objective of the present study was to evaluate the genetic similarity between ten coriander genotypes (nine cultivars and one line using ISSR markers. The cultivars used were: Americano, Asteca, Palmeira, Português, Santo, Supéria, Tabocas, Tapacurá, Verdão and the experimental line HTV-9299. The genetic similarity between the cultivars was estimated using 227 banded regions of ISSR molecular markers. The UBC 897 oligonucleotide generated the highest number of fragments (16, resulting in a higher polymorphism. The results indicate that the twenty-nine oligonucleotides chosen were satisfactory for detecting polymorphism. Based on the grouping analysis determined from the similarity data, there were two groups and two sub-groups. The calculated similarity for the genotypes varied from 52 to 75%. The lowest similarity was observed between Português and Verdão, at 52%. The highest similarity was found between Português and Palmeira, at 75%. The ISSR is efficient for identifying DNA polymorphism in coriander.Com o surgimento de novas cultivares, uma caracterização genética precisa é essencial, visando à utilização em programas de melhoramento ou para fins de registros e ou proteção de cultivares. Marcadores moleculares vêm complementando a caracterização morfológica e agronômica tradicional, uma vez que são virtualmente ilimitados, cobrem todo o genoma e não são influenciados pelo ambiente. A caracterização genética constitui a base para

Caracterização molecular de cultivares de cebola por marcadores RAPD Molecular characterization of onion cultivars by RAPD markers

Directory of Open Access Journals (Sweden)

Daniela L Leite

2009-12-01

Full Text Available Em plantas alógamas, as cultivares constituem uma fonte de variação genética planta-a-planta no qual o melhorista pode obter novos materiais. A variabilidade genética entre indivíduos ou populações tem sido medida através de marcadores moleculares. O objetivo deste trabalho foi avaliar molecularmente, através da análise de RAPD (Random Amplified Polimorphic DNA, a diversidade genética existente em um grupo de cultivares de cebola recomendadas para o cultivo na Região Sul do Brasil. Foram analisados 11 iniciadores em DNAs provenientes de um total de 90 plantas individuais oriundas das cultivares Baia Periforme, Bola Precoce, BRS Cascata, Crioula, Primavera e Roxa. As plantas foram genotipadas através dos produtos visualizados em gel de agarose e uma matriz de presença/ausência de bandas foi utilizada nas análises de similaridade genética (coeficiente de Jaccard e de agrupamento pelo método UPGMA. Os 11 iniciadores geraram 140 (86,4% bandas polimórficas. O número de fragmentos por iniciador variou de 10 (UBC105 até 18 (OPA10; OPC11; OPI1 com uma média de 15 bandas por iniciador. A técnica de RAPD mostrou-se eficiente na caracterização molecular, permitindo a formação de grupos de cultivares de acordo com a sua população de origem, com uma similaridade média de 63%. Conclui-se que as cultivares de cebola recomendadas para a Região Sul do Brasil, apresentam divergência genética, com potencial de serem exploradas por melhoristas, no desenvolvimento de genótipos superiores.In alogam plants, the cultivars constitute a source of plant-to-plant genetic variation from which the breeder can obtain new materials. Genetic variability among individuals or populations has been measured through molecular markers. The objective of this work was to evaluate the genetic diversity in a group of onion cultivars recommended for cultivation in the Southern Region of Brazil by RAPD (Random Amplified Polimorphic DNA analysis. Eleven

Health-related stigma as a determinant of functioning in young adults with narcolepsy.

Directory of Open Access Journals (Sweden)

Mary C Kapella

Full Text Available Symptoms of narcolepsy tend to arise during adolescence or young adulthood, a formative time in human development during which people are usually completing their education and launching a career. Little is known about the impact of narcolepsy on the social aspects of health-related quality of life in young adults. The purpose of this study was to examine relationships between health-related stigma, mood (anxiety and depression and daytime functioning in young adults with narcolepsy compared to those without narcolepsy. Young adults (age 18-35 with narcolepsy (N = 122 and without narcolepsy (N = 93 were mailed a packet that included questionnaires and a self-addressed postage paid envelope. The questionnaire included demographic information and a composite of instruments including the SF 36, Functional Outcomes of Sleep Questionnaire (FOSQ, Fife Stigma Scale (FSS, Epworth Sleepiness Scale (ESS and Hospital Anxiety and Depression Scale (HADS. Variable associations were assessed using descriptive statistics, ANOVA, Mann-Whitney U Test, correlations, stepwise multiple regression and path analysis. Young adults with narcolepsy perceived significantly more stigma and lower mood and health-related quality of life than young adults without narcolepsy (p<0.01. Health-related stigma was directly and indirectly associated with lower functioning through depressed mood. Fifty-two percent of the variance in functioning was explained by the final model in the young adults with narcolepsy. Health-related stigma in young adults with narcolepsy is at a level consistent with other chronic medical illnesses. Health-related stigma may be an important determinant of functioning in young adults with narcolepsy. Future work is indicated toward further characterizing stigma and developing interventions that address various domains of stigma in people with narcolepsy.

Health-related stigma as a determinant of functioning in young adults with narcolepsy.

Science.gov (United States)

Kapella, Mary C; Berger, Barbara E; Vern, Boris A; Vispute, Sachin; Prasad, Bharati; Carley, David W

2015-01-01

Symptoms of narcolepsy tend to arise during adolescence or young adulthood, a formative time in human development during which people are usually completing their education and launching a career. Little is known about the impact of narcolepsy on the social aspects of health-related quality of life in young adults. The purpose of this study was to examine relationships between health-related stigma, mood (anxiety and depression) and daytime functioning in young adults with narcolepsy compared to those without narcolepsy. Young adults (age 18-35) with narcolepsy (N = 122) and without narcolepsy (N = 93) were mailed a packet that included questionnaires and a self-addressed postage paid envelope. The questionnaire included demographic information and a composite of instruments including the SF 36, Functional Outcomes of Sleep Questionnaire (FOSQ), Fife Stigma Scale (FSS), Epworth Sleepiness Scale (ESS) and Hospital Anxiety and Depression Scale (HADS). Variable associations were assessed using descriptive statistics, ANOVA, Mann-Whitney U Test, correlations, stepwise multiple regression and path analysis. Young adults with narcolepsy perceived significantly more stigma and lower mood and health-related quality of life than young adults without narcolepsy (p<0.01). Health-related stigma was directly and indirectly associated with lower functioning through depressed mood. Fifty-two percent of the variance in functioning was explained by the final model in the young adults with narcolepsy. Health-related stigma in young adults with narcolepsy is at a level consistent with other chronic medical illnesses. Health-related stigma may be an important determinant of functioning in young adults with narcolepsy. Future work is indicated toward further characterizing stigma and developing interventions that address various domains of stigma in people with narcolepsy.

Workforce re-entry for Japanese unemployed dental hygienists.

Science.gov (United States)

Usui, Y; Miura, H

2015-02-01

The aim of this study was to define the profile of unemployed dental hygienists who could be enticed to re-enter the workforce and the factors that could facilitate their re-entry into the dental field in Japan. The questionnaire was mailed with a postage-paid return envelope to a sample of 3095 licensed dental hygienists. A 50.4% response rate (S = 1477) was observed. The rate of working dental hygienists was 60.3% (n = 891), and of unemployed dental hygienists was 39.7% (n = 586). Of the latter, 31.9% (n = 187) stated intentions of returning to the workplace. The unemployed dental hygienists seeking employment were more often married and had more children, compared with working dental hygienists currently. This group also had significantly fewer total service years. Moreover, only 11.96% of them belonged to the Japan Dental Hygienists' Association, and 41.3% of those attended training workshops. According to their response, they perceived their top three major barriers to re-entry as 'lack sufficient dental hygiene skill', 'child rearing' and 'poor working atmosphere'. 'Flexibility in the work schedule' and 'location' were the most important factors for re-entry from their perspective. There were not many dental hygienists hoping to return to the dental field. The findings suggested that strategies to encourage non-practicing dental hygienists to re-entry should be emphasized in the areas of a flexible working atmosphere, easy access to information on how to return to practice and guidance on how to maintain professionalism during inactivity. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Phase 0 Clinical Chemoprevention Trial of the AKT Inhibitor SR13668

Science.gov (United States)

Reid, Joel M.; Walden, Chad; Qin, Rui; Allen Ziegler, Katie L.; Haslam, John L.; Rajewski, Roger A.; Warndahl, Roger; Fitting, Cindy L.; Boring, Daniel; Szabo, Eva; Crowell, James; Perloff, Marjorie; Jong, Ling; Mandrekar, Sumithra J.; Ames, Matthew M.; Limburg, Paul J.

2011-01-01

Purpose SR13668, an orally active AKT pathway inhibitor, has demonstrated cancer chemopreventive potential in preclinical studies. To accelerate the clinical development of this promising agent, we designed and conducted the first-ever phase 0 chemoprevention trial to evaluate and compare the effects of food and formulation on SR13668 bioavailability. Patients and Methods Healthy adult volunteers were randomly assigned to receive a single, 38 mg oral dose of SR13668 in one of five different formulations, with or without food. Based on existing animal data, SR13668 in a PEG400/Labrasol® oral solution was defined as the reference formulation. Blood samples were obtained pre- and post-agent administration for pharmacokinetic analyses. Area under the plasma concentration-time curve (AUC0-∞) was defined as the primary endpoint. Data were analyzed and compared using established statistical methods for phase 0 trials with a limited sample size. Results Participants (N=20) were rapidly accrued over a 5-month period. Complete pharmacokinetic data were available for 18 randomized participants. AUC0-∞ values were highest in the fed state (range = 122–439 ng/mL × hours) and were statistically significantly different across formulations (p = 0.007), with Solutol® HS15 providing the highest bioavailability. SR13668 time to peak plasma concentration (3 hours; range, 2 – 6 hours) and half-life were (11.2 ± 3.1 hours) were not formulation dependent. Conclusions Using a novel, highly efficient study design, we rapidly identified a lead formulation of SR13668 for further clinical testing. Our findings support application of the phase 0 trial paradigm to accelerate chemoprevention agent development. PMID:21372034

Survey of Australians using cannabis for medical purposes

Directory of Open Access Journals (Sweden)

Dillon Paul

2005-10-01

Full Text Available Abstract Background The New South Wales State Government recently proposed a trial of the medical use of cannabis. Australians who currently use cannabis medicinally do so illegally and without assurances of quality control. Given the dearth of local information on this issue, this study explored the experiences of medical cannabis users. Methods Australian adults who had used cannabis for medical purposes were recruited using media stories. A total of 147 respondents were screened by phone and anonymous questionnaires were mailed, to be returned by postage paid envelope. Results Data were available for 128 participants. Long term and regular medical cannabis use was frequently reported for multiple medical conditions including chronic pain (57%, depression (56%, arthritis (35%, persistent nausea (27% and weight loss (26%. Cannabis was perceived to provide "great relief" overall (86%, and substantial relief of specific symptoms such as pain, nausea and insomnia. It was also typically perceived as superior to other medications in terms of undesirable effects, and the extent of relief provided. However, nearly one half (41% experienced conditions or symptoms that were not helped by its use. The most prevalent concerns related to its illegality. Participants reported strong support for their use from clinicians and family. There was almost universal interest (89% in participating in a clinical trial of medical cannabis, and strong support (79% for investigating alternative delivery methods. Conclusion Australian medical cannabis users are risking legal ramifications, but consistent with users elsewhere, claim moderate to substantial benefits from its use in the management of their medical condition. In addition to strong public support, medical cannabis users show strong interest in clinical cannabis research, including the investigation of alternative delivery methods.

GREAT3 results - I. Systematic errors in shear estimation and the impact of real galaxy morphology

Energy Technology Data Exchange (ETDEWEB)

Mandelbaum, R.; Rowe, B.; Armstrong, R.; Bard, D.; Bertin, E.; Bosch, J.; Boutigny, D.; Courbin, F.; Dawson, W. A.; Donnarumma, A.; Fenech Conti, I.; Gavazzi, R.; Gentile, M.; Gill, M. S. S.; Hogg, D. W.; Huff, E. M.; Jee, M. J.; Kacprzak, T.; Kilbinger, M.; Kuntzer, T.; Lang, D.; Luo, W.; March, M. C.; Marshall, P. J.; Meyers, J. E.; Miller, L.; Miyatake, H.; Nakajima, R.; Ngole Mboula, F. M.; Nurbaeva, G.; Okura, Y.; Paulin-Henriksson, S.; Rhodes, J.; Schneider, M. D.; Shan, H.; Sheldon, E. S.; Simet, M.; Starck, J. -L.; Sureau, F.; Tewes, M.; Zarb Adami, K.; Zhang, J.; Zuntz, J.

2015-05-01

We present first results from the third GRavitational lEnsing Accuracy Testing (GREAT3) challenge, the third in a sequence of challenges for testing methods of inferring weak gravitational lensing shear distortions from simulated galaxy images. GREAT3 was divided into experiments to test three specific questions, and included simulated space- and ground-based data with constant or cosmologically varying shear fields. The simplest (control) experiment included parametric galaxies with a realistic distribution of signal-to-noise, size, and ellipticity, and a complex point spread function (PSF). The other experiments tested the additional impact of realistic galaxy morphology, multiple exposure imaging, and the uncertainty about a spatially varying PSF; the last two questions will be explored in Paper II. The 24 participating teams competed to estimate lensing shears to within systematic error tolerances for upcoming Stage-IV dark energy surveys, making 1525 submissions overall. GREAT3 saw considerable variety and innovation in the types of methods applied. Several teams now meet or exceed the targets in many of the tests conducted (to within the statistical errors). We conclude that the presence of realistic galaxy morphology in simulations changes shear calibration biases by ~1 per cent for a wide range of methods. Other effects such as truncation biases due to finite galaxy postage stamps, and the impact of galaxy type as measured by the Sérsic index, are quantified for the first time. Our results generalize previous studies regarding sensitivities to galaxy size and signal-to-noise, and to PSF properties such as seeing and defocus. Almost all methods’ results support the simple model in which additive shear biases depend linearly on PSF ellipticity.

Blog: occupational therapy tool

Directory of Open Access Journals (Sweden)

Miryam Bonadiu Pelosi

2012-12-01

Full Text Available A blog is a site whose structure allows fast articles postage update, or posts. In a blog, texts, images, videosand links to other blogs can be combined, and what makes it a potential therapeutic working tool are the users’ friendlyresources provided for creating and editing systems, which do not require complex knowledge of programmingresources. As in any activity, the professional needs to know it well before being able to use it as a therapeutic resource,but this one is free of charge and it can be performed in gradual steps at different complexity levels. A blog can beused as an idea-organizer, a site where the user decides what is pertinent to be posted, which vocabulary to be used,and the target public, as in a space to share experiences or an integral part in the elaboration of a history book. Tosupport this discussion, three cases where blogs were used as therapeutic resources were presented. In the first case, a12-year-old boy diagnosed with Asperger’s Syndrome created a blog about children characters; on the second, a groupof adolescents with school and social inclusion difficulties developed a blog to tell their adventures; finally, the thirdcase told the story of a girl with cerebral palsy who wrote and published a book and a blog with the help of alternativecommunication strategies. The following themes were addressed as topics for the discussion: activity as therapeuticresource; the different uses of blogs in the worldwide computers net; and the possibility of using blogs as occupationaltherapeutic resources for people with singular life histories, with very diverse abilities, limitations and desires.

A separable domain of the p150 subunit of human chromatin assembly factor-1 promotes protein and chromosome associations with nucleoli.

Science.gov (United States)

Smith, Corey L; Matheson, Timothy D; Trombly, Daniel J; Sun, Xiaoming; Campeau, Eric; Han, Xuemei; Yates, John R; Kaufman, Paul D

2014-09-15

Chromatin assembly factor-1 (CAF-1) is a three-subunit protein complex conserved throughout eukaryotes that deposits histones during DNA synthesis. Here we present a novel role for the human p150 subunit in regulating nucleolar macromolecular interactions. Acute depletion of p150 causes redistribution of multiple nucleolar proteins and reduces nucleolar association with several repetitive element-containing loci. Of note, a point mutation in a SUMO-interacting motif (SIM) within p150 abolishes nucleolar associations, whereas PCNA or HP1 interaction sites within p150 are not required for these interactions. In addition, acute depletion of SUMO-2 or the SUMO E2 ligase Ubc9 reduces α-satellite DNA association with nucleoli. The nucleolar functions of p150 are separable from its interactions with the other subunits of the CAF-1 complex because an N-terminal fragment of p150 (p150N) that cannot interact with other CAF-1 subunits is sufficient for maintaining nucleolar chromosome and protein associations. Therefore these data define novel functions for a separable domain of the p150 protein, regulating protein and DNA interactions at the nucleolus. © 2014 Smith et al. This article is distributed by The American Society for Cell Biology under license from the author(s). Two months after publication it is available to the public under an Attribution–Noncommercial–Share Alike 3.0 Unported Creative Commons License (http://creativecommons.org/licenses/by-nc-sa/3.0).

Novel method to leukoreduce murine blood for transfusion: how to reduce animal usage.

Science.gov (United States)

Fischer, Dania; Büssow, Julian; Meybohm, Patrick; Zacharowski, Kai; Jennewein, Carla

2016-01-01

Basic research on the pathomechanisms of transfusion-related adverse events depends on murine transfusion models, in which leukoreduction (LR) is a prevalent standard. The commonly used neonatal LR filter (LRF) is associated with considerable animal numbers. A more efficient method would help support the guiding principles of "replacement, reduction, refinement" (3Rs). Blood from C57BL/6 and C57BL/6-Tg(UBC-GFP)30Scha/J mice was leukoreduced using (1) a neonatal LRF, (2) a syringe LRF, or (3) CD45 microbeads. Product quality was assessed according to US Food and Drug Administration (FDA) standards. White blood cell numbers were analyzed by flow cytometry; hemoglobin concentrations and hematocrit were measured and in vivo posttransfusion recoveries were determined after 2 weeks of storage. Using the neonatal filter, a LR of 99.56% was achieved with wastage of 12.4 mL in comparison to 99.68% and 1-mL hold-up volume with the syringe filter and 99.11 ± 0.24% LR and 0.1-mL wastage using microbeads. All techniques achieved FDA quality standards, apart from posttransfusion recovery rate, which was only reached by the microbeads-based technique. LR with CD45 microbeads not only reduces animal usage but also provides a more efficacious method regarding posttransfusion red blood cell recovery and, hence, provides a promising alternative to commonly used methods. © 2015 AABB.

RNF4-mediated polyubiquitination regulates the Fanconi anemia/BRCA pathway.

Science.gov (United States)

Xie, Jenny; Kim, Hyungjin; Moreau, Lisa A; Puhalla, Shannon; Garber, Judy; Al Abo, Muthana; Takeda, Shunichi; D'Andrea, Alan D

2015-04-01

The Fanconi anemia/BRCA (FA/BRCA) pathway is a DNA repair pathway that is required for excision of DNA interstrand cross-links. The 17 known FA proteins, along with several FA-associated proteins (FAAPs), cooperate in this pathway to detect, unhook, and excise DNA cross-links and to subsequently repair the double-strand breaks generated in the process. In the current study, we identified a patient with FA with a point mutation in FANCA, which encodes a mutant FANCA protein (FANCAI939S). FANCAI939S failed to bind to the FAAP20 subunit of the FA core complex, leading to decreased stability. Loss of FAAP20 binding exposed a SUMOylation site on FANCA at amino acid residue K921, resulting in E2 SUMO-conjugating enzyme UBC9-mediated SUMOylation, RING finger protein 4-mediated (RNF4-mediated) polyubiquitination, and proteasome-mediated degradation of FANCA. Mutation of the SUMOylation site of FANCA rescued the expression of the mutant protein. Wild-type FANCA was also subject to SUMOylation, RNF4-mediated polyubiquitination, and degradation, suggesting that regulated release of FAAP20 from FANCA is a critical step in the normal FA pathway. Consistent with this model, cells lacking RNF4 exhibited interstrand cross-linker hypersensitivity, and the gene encoding RNF4 was epistatic with the other genes encoding members of the FA/BRCA pathway. Together, the results from our study underscore the importance of analyzing unique patient-derived mutations for dissecting complex DNA repair processes.

Regulation of HTLV-1 Tax Stability, Cellular Trafficking and NF-κB Activation by the Ubiquitin-Proteasome Pathway

Science.gov (United States)

Lavorgna, Alfonso; Harhaj, Edward William

2014-01-01

Human T-cell leukemia virus type 1 (HTLV-1) is a complex retrovirus that infects CD4+ T cells and causes adult T-cell leukemia/lymphoma (ATLL) in 3%–5% of infected individuals after a long latent period. HTLV-1 Tax is a trans-activating protein that regulates viral gene expression and also modulates cellular signaling pathways to enhance T-cell proliferation and cell survival. The Tax oncoprotein promotes T-cell transformation, in part via constitutive activation of the NF-κB transcription factor; however, the underlying mechanisms remain unknown. Ubiquitination is a type of post-translational modification that occurs in a three-step enzymatic cascade mediated by E1, E2 and E3 enzymes and regulates protein stability as well as signal transduction, protein trafficking and the DNA damage response. Emerging studies indicate that Tax hijacks the ubiquitin machinery to activate ubiquitin-dependent kinases and downstream NF-κB signaling. Tax interacts with the E2 conjugating enzyme Ubc13 and is conjugated on C-terminal lysine residues with lysine 63-linked polyubiquitin chains. Tax K63-linked polyubiquitination may serve as a platform for signaling complexes since this modification is critical for interactions with NEMO and IKK. In addition to NF-κB signaling, mono- and polyubiquitination of Tax also regulate its subcellular trafficking and stability. Here, we review recent advances in the diverse roles of ubiquitin in Tax function and how Tax usurps the ubiquitin-proteasome pathway to promote oncogenesis. PMID:25341660

Improvement of open and semi-open core wall system in tall buildings by closing of the core section in the last story

Science.gov (United States)

Kheyroddin, A.; Abdollahzadeh, D.; Mastali, M.

2014-09-01

Increasing number of tall buildings in urban population caused development of tall building structures. One of the main lateral load resistant systems is core wall system in high-rise buildings. Core wall system has two important behavioral aspects where the first aspect is related to reduce the lateral displacement by the core bending resistance and the second is governed by increasing of the torsional resistance and core warping of buildings. In this study, the effects of closed section core in the last story have been considered on the behavior of models. Regarding this, all analyses were performed by ETABS 9.2.v software (Wilson and Habibullah). Considering (a) drift and rotation of the core over height of buildings, (b) total and warping stress in the core body, (c) shear in beams due to warping stress, (d) effect of closing last story on period of models in various modes, (e) relative displacement between walls in the core system and (f) site effects in far and near field of fault by UBC97 spectra on base shear coefficient showed that the bimoment in open core is negative in the last quarter of building and it is similar to wall-frame structures. Furthermore, analytical results revealed that closed section core in the last story improves behavior of the last quarter of structure height, since closing of core section in the last story does not have significant effect on reducing base shear value in near and far field of active faults.

Hypoxia Is a Critical Parameter for Chondrogenic Differentiation of Human Umbilical Cord Blood Mesenchymal Stem Cells in Type I/III Collagen Sponges

Directory of Open Access Journals (Sweden)

Tangni Gómez-Leduc

2017-09-01

Full Text Available Umbilical cord blood (UCB is an attractive alternative to bone marrow for isolation of mesenchymal stem cells (MSCs to treat articular cartilage defects. Here, we set out to determine the growth factors (bone morphogenetic protein 2 (BMP-2 and transforming growth factor-β (TGF-β1 and oxygen tension effects during chondrogenesis of human UCB-MSCs for cartilage engineering. Chondrogenic differentiation was induced using 3D cultures in type I/III collagen sponges with chondrogenic factors in normoxia (21% O2 or hypoxia (<5% O2 for 7, 14 and 21 days. Our results show that UCB-MSCs can be committed to chondrogenesis in the presence of BMP-2+TGF-β1. Normoxia induced the highest levels of chondrocyte-specific markers. However, hypoxia exerted more benefit by decreasing collagen X and matrix metalloproteinase-13 (MMP13 expression, two chondrocyte hypertrophy markers. However, a better chondrogenesis was obtained by switching oxygen conditions, with seven days in normoxia followed by 14 days in hypoxia, since these conditions avoid hypertrophy of hUCB-MSC-derived chondrocytes while maintaining the expression of chondrocyte-specific markers observed in normoxia. Our study demonstrates that oxygen tension is a key factor for chondrogenesis and suggests that UBC-MSCs 3D-culture should begin in normoxia to obtain a more efficient chondrocyte differentiation before placing them in hypoxia for chondrocyte phenotype stabilization. UCB-MSCs are therefore a reliable source for cartilage engineering.

Automated recognition of brain region mentions in neuroscience literature

Directory of Open Access Journals (Sweden)

Leon French

2009-09-01

Full Text Available The ability to computationally extract mentions of neuroanatomical regions from the literature would assist linking to other entities within and outside of an article. Examples include extracting reports of connectivity or region-specific gene expression. To facilitate text mining of neuroscience literature we have created a corpus of manually annotated brain region mentions. The corpus contains 1,377 abstracts with 18,242 brain region annotations. Interannotator agreement was evaluated for a subset of the documents, and was 90.7% and 96.7% for strict and lenient matching respectively. We observed a large vocabulary of over 6,000 unique brain region terms and 17,000 words. For automatic extraction of brain region mentions we evaluated simple dictionary methods and complex natural language processing techniques. The dictionary methods based on neuroanatomical lexicons recalled 36% of the mentions with 57% precision. The best performance was achieved using a conditional random field (CRF with a rich feature set. Features were based on morphological, lexical, syntactic and contextual information. The CRF recalled 76% of mentions at 81% precision, by counting partial matches recall and precision increase to 86% and 92% respectively. We suspect a large amount of error is due to coordinating conjunctions, previously unseen words and brain regions of less commonly studied organisms. We found context windows, lemmatization and abbreviation expansion to be the most informative techniques. The corpus is freely available at http://www.chibi.ubc.ca/WhiteText/.

An automated approach to network features of protein structure ensembles

Science.gov (United States)

Bhattacharyya, Moitrayee; Bhat, Chanda R; Vishveshwara, Saraswathi

2013-01-01

Network theory applied to protein structures provides insights into numerous problems of biological relevance. The explosion in structural data available from PDB and simulations establishes a need to introduce a standalone-efficient program that assembles network concepts/parameters under one hood in an automated manner. Herein, we discuss the development/application of an exhaustive, user-friendly, standalone program package named PSN-Ensemble, which can handle structural ensembles generated through molecular dynamics (MD) simulation/NMR studies or from multiple X-ray structures. The novelty in network construction lies in the explicit consideration of side-chain interactions among amino acids. The program evaluates network parameters dealing with topological organization and long-range allosteric communication. The introduction of a flexible weighing scheme in terms of residue pairwise cross-correlation/interaction energy in PSN-Ensemble brings in dynamical/chemical knowledge into the network representation. Also, the results are mapped on a graphical display of the structure, allowing an easy access of network analysis to a general biological community. The potential of PSN-Ensemble toward examining structural ensemble is exemplified using MD trajectories of an ubiquitin-conjugating enzyme (UbcH5b). Furthermore, insights derived from network parameters evaluated using PSN-Ensemble for single-static structures of active/inactive states of β2-adrenergic receptor and the ternary tRNA complexes of tyrosyl tRNA synthetases (from organisms across kingdoms) are discussed. PSN-Ensemble is freely available from http://vishgraph.mbu.iisc.ernet.in/PSN-Ensemble/psn_index.html. PMID:23934896

Morphological alterations in the caudate, putamen, pallidum and thalamus in Parkinson’s disease.

Directory of Open Access Journals (Sweden)

Amanmeet eGarg

2015-03-01

Full Text Available Like many neurodegenerative diseases, the clinical symptoms of Parkinson’s disease (PD do not manifest until significant progression of the disease has already taken place, motivating the need for sensitive biomarkers of the disease. While structural imaging is a potentially attractive method due to its widespread availability and non-invasive nature, global morphometric measures (e.g. volume have proven insensitive to subtle disease change. Here we use individual surface displacements from deformations of an average surface model to capture disease related changes in shape of the subcortical structures in Parkinson’s disease. Data were obtained from both the University of British Columbia (UBC (n=54 healthy controls (HC & n=55 Parkinson’s disease (PD patients and the publicly available Parkinson’s Progression Marker’s Initiative (PPMI(n=137(HC & n=189 (PD database. A high dimensional non-rigid registration algorithm was used to register target segmentation labels (caudate, putamen, pallidum and thalamus to a set of segmentation labels defined on the average-template. The vertex-wise surface displacements were significantly different between PD and HC in thalamic and caudate structures. However overall displacements did not correlate with disease severity, as assessed by the Unified Parkinson's Disease Rating Scale (UPDRS. The results from this study suggest disease-relevant shape abnormalities can be robustly detected in subcortical structures in Parkinson’s disease. Future studies will be required to determine if shape changes in subcortical structures are seen in the prodromal phases of the disease.

Assessment of Genetic Diversity among Pleurotus spp. Isolates from Jordan

Directory of Open Access Journals (Sweden)

Hanan Aref Hasan

2018-04-01

Full Text Available Pleurotus is considered an important genus that belongs to the family Pleurotaceae and includes the edible King Oyster mushroom (Pleurotus eryngii. In the present study, 19 Pleurotus isolates were collected from two locations in the north of Jordan (Tell ar-Rumman and Um-Qais. The morphological characteristics among collected isolates revealed that there was a morphological similarity among the collected isolates. Nucleotide sequence analysis of the internal transcribed spacer (ITS1–5.8S rDNA–ITS4 region and 28S nuclear large subunit (nLSU in the ribosomal DNA gene of the isolated stains showed that all of them share over 98% sequence similarity with P. eryngii. Genetic diversity among the collected strains was assessed using inter simple sequence repeat (ISSR analysis using 18 different primer pairs. Using this approach, 141 out of 196 bands obtained were considered polymorphic and the highest percentage of polymorphism was observed using primer UBC827 (92.3% with an overall Polymorphism Information Content (PIC value of 70.56%. Cluster analysis showed that the Jordanian Pleurotus isolates fall into two main clades with a coefficient of similarity values ranging from 0.59 to 0.74 with a clear clustering based on collection sites. The results of the present study reveal that molecular techniques of ISSR and rDNA sequencing can greatly aid in classification and identification of Pleurotus spp. in Jordan.

Burnout among public doctors in Hong Kong: cross-sectional survey.

Science.gov (United States)

Siu, Christina F Y; Yuen, S K; Cheung, Andy

2012-06-01

The stressful life of doctors makes them prone to burnout. We evaluated the prevalence of burnout among Hong Kong public hospital doctors and correlated burnout with job characteristics, working hours, stressors, and stress-relieving strategies. Cross-sectional survey. Hong Kong. One thousand doctors were randomly sampled from the Hong Kong Public Doctors' Association registry. Self-administered, anonymous questionnaires with postage-paid envelopes were mailed twice in early 2009. The Maslach Burnout Inventory-Human Services Survey was used for burnout assessment. According to this scale, burnout is defined as emotional exhaustion, depersonalisation, and a reduced sense of personal accomplishment. Correlation analysis, as well as univariate and multivariate analyses, were performed to assess factors associated with high degrees of burnout. RESULTS. A total of 226 questionnaires were analysed, of which 31.4% of the respondents satisfied the criteria for high burnout. They were younger and needed to work shifts, and their median year of practice was 8.5. High-burnout doctors worked similar hours per week to non-high-burnout doctors (mean ± standard deviation, 56.2 ± 12.7 vs 54.7 ± 10.9; P=0.413) and reported suicidal thoughts more often (9.9% vs 2.6%; P=0.033). Moreover, 52.2% of high-burnout doctors were dissatisfied or very dissatisfied with their jobs. 'Excessive stress due to global workload' and 'feeling that their own work was not valued by others' were the most significant stressors associated with high emotional exhaustion and depersonalisation, while 'feeling that their own work was not valued by others' and 'poor job security' correlated with low personal accomplishment. A high proportion of public doctors who responded to our survey endured high burnout. Trainees with some experience were at heightened risk. Stressors identified in this study should be addressed, so as to improve job satisfaction.

Access to the scientific literature

Science.gov (United States)

Albarède, Francis

The Public Library of Science Open Letter (http://www.publiclibraryofscience.org) is a very generous initiative, but, as most similar initiatives since the advent of electronic publishing, it misses the critical aspects of electronic publishing.Ten years ago, a Publisher would be in charge of running a system called a “scientific journal.” In such a system, the presence of an Editor and peer Reviewers secures the strength of the science and the rigor of writing; the Publisher guarantees the professional quality of printing, efficient dissemination, and long-term archiving. Publishing used to be in everyone's best interest, or nearly everyone. The Publisher, because he/she is financially motivated, ensures widespread dissemination of the journal amongst libraries and individual subscribers. The interest of the Author is that the system guarantees a broad potential readership. The interest of the Reader is that a line is drawn between professionally edited literature, presumably of better quality, and gray literature or home publishing, so that he/she does not waste time going through ‘low yield’ ungraded information. The Publisher could either be a private company, an academic institution, or a scholarly society. My experience is that, when page charges and subscription rates are compounded, journals published by scholarly societies are not necessarily cheaper. The difference between these cases is not the cost of running an office with rents, wages, printing, postage, advertisement, and archiving, but that a private Publisher pays shareholders. Shareholders have the bad habit of minding their own business and, therefore, they may interfere negatively with scientific publishing. Nevertheless, while the stranglehold imposed by private Publishers on our libraries over the last 10 years by increasing subscription rates may in part be due to shareholders' greed, this is true only in part. The increases are also a consequence of the booming number of pages being

UV-TO-FIR ANALYSIS OF SPITZER/IRAC SOURCES IN THE EXTENDED GROTH STRIP. II. PHOTOMETRIC REDSHIFTS, STELLAR MASSES, AND STAR FORMATION RATES

International Nuclear Information System (INIS)

Barro, G.; Perez-Gonzalez, P. G.; Gallego, J.; Villar, V.; Zamorano, J.; Ashby, M. L. N.; Kajisawa, M.; Yamada, T.; Miyazaki, S.

2011-01-01

Based on the ultraviolet to far-infrared photometry already compiled and presented in a companion paper (Paper I), we present a detailed spectral energy distribution (SED) analysis of nearly 80,000 IRAC 3.6 + 4.5 μm selected galaxies in the Extended Groth Strip. We estimate photometric redshifts, stellar masses, and star formation rates (SFRs) separately for each galaxy in this large sample. The catalog includes 76,936 sources with [3.6] ≤ 23.75 (85% completeness level of the IRAC survey) over 0.48 deg 2 . The typical photometric redshift accuracy is Δz/(1 + z) = 0.034, with a catastrophic outlier fraction of just 2%. We quantify the systematics introduced by the use of different stellar population synthesis libraries and initial mass functions in the calculation of stellar masses. We find systematic offsets ranging from 0.1 to 0.4 dex, with a typical scatter of 0.3 dex. We also provide UV- and IR-based SFRs for all sample galaxies, based on several sets of dust emission templates and SFR indicators. We evaluate the systematic differences and goodness of the different SFR estimations using the deep FIDEL 70 μm data available in the Extended Groth Strip. Typical random uncertainties of the IR-bases SFRs are a factor of two, with non-negligible systematic effects at z ∼> 1.5 observed when only MIPS 24 μm data are available. All data products (SEDs, postage stamps from imaging data, and different estimations of the photometric redshifts, stellar masses, and SFRs of each galaxy) described in this and the companion paper are publicly available, and they can be accessed through our the Web interface utility Rainbow-navigator.