Overexpression of the E2 ubiquitin-conjugating enzyme UbcH10 causes chromosome missegregation and tumor formation.

NARCIS (Netherlands)

Ree, J.H.; Jeganathan, K.B.; Malureanu, L.; Deursen, J.M.A. van

2010-01-01

The anaphase-promoting complex/cyclosome (APC/C) E3 ubiquitin ligase functions with the E2 ubiquitin-conjugating enzyme UbcH10 in the orderly progression through mitosis by marking key mitotic regulators for destruction by the 26-S proteasome. UbcH10 is overexpressed in many human cancer types and

Ectopic expression of ubiquitin-conjugating enzyme gene from wild rice, OgUBC1, confers resistance against UV-B radiation and Botrytis infection in Arabidopsis thaliana

International Nuclear Information System (INIS)

Jeon, En Hee; Pak, Jung Hun; Kim, Mi Jin; Kim, Hye Jeong; Shin, Sang Hyun; Lee, Jai Heon; Kim, Doh Hoon; Oh, Ju Sung; Oh, Boung-Jun; Jung, Ho Won; Chung, Young Soo

2012-01-01

Highlights: ► We isolated a novel E2 ubiquitin-conjugating enzyme from leaves of wild rice plants. ► The OgUBC1 was highly expressed in leaves treated with SA and UV-B radiation. ► The recombinant OgUBC1 has an enzymatic activity of E2 in vitro. ► The OgUBC1 could protect disruption of plant cells by UV-B radiation. ► OgUBC1 confers disease resistance and UV-B tolerance in transgenic Arabidopsis plants. -- Abstract: A previously unidentified gene encoding ubiquitin-conjugating enzyme was isolated from leaves of wild rice plant treated with wounding and microbe-associated molecular patterns. The OgUBC1 gene was composed of 148 amino acids and contained a typical active site and 21 ubiquitin thioester intermediate interaction residues and 4 E3 interaction residues. Both exogenous application of salicylic acid and UV-B irradiation triggered expression of OgUBC1 in leaves of wild rice. Recombinant OgUBC1 proteins bound to ubiquitins in vitro, proposing that the protein might act as E2 enzyme in planta. Heterologous expression of the OgUBC1 in Arabidopsis thaliana protected plants from cellular damage caused by an excess of UV-B radiation. A stable expression of chalcone synthase gene was detected in leaves of OgUBC1-expressing Arabidopsis, resulting in producing higher amounts of anthocyanin than those in wild-type Col-0 plants. Additionally, both pathogenesis-related gene1 and 5 were transcribed in the transgenic Arabidopsis in the absence of pathogen infection. The OgUBC1-expressing plants were resistant to the infection of Botrytis cinerea. Taken together, we suggested that the OgUBC1 is involved in ubiquitination process important for cellular response against biotic and abiotic stresses in plants.

Ectopic expression of ubiquitin-conjugating enzyme gene from wild rice, OgUBC1, confers resistance against UV-B radiation and Botrytis infection in Arabidopsis thaliana

Energy Technology Data Exchange (ETDEWEB)

Jeon, En Hee; Pak, Jung Hun; Kim, Mi Jin; Kim, Hye Jeong [Department of Genetic Engineering, Dong-A University, Busan 604-714 (Korea, Republic of); Shin, Sang Hyun [National Crop Experiment Station, Rural Development Administration, Suwon 441-100 (Korea, Republic of); Lee, Jai Heon; Kim, Doh Hoon; Oh, Ju Sung [Department of Genetic Engineering, Dong-A University, Busan 604-714 (Korea, Republic of); Oh, Boung-Jun [BioControl Center, Jeonnam 516-942 (Korea, Republic of); Jung, Ho Won, E-mail: hwjung@dau.ac.kr [Department of Genetic Engineering, Dong-A University, Busan 604-714 (Korea, Republic of); Chung, Young Soo, E-mail: chungys@dau.ac.kr [Department of Genetic Engineering, Dong-A University, Busan 604-714 (Korea, Republic of)

2012-10-19

Highlights: Black-Right-Pointing-Pointer We isolated a novel E2 ubiquitin-conjugating enzyme from leaves of wild rice plants. Black-Right-Pointing-Pointer The OgUBC1 was highly expressed in leaves treated with SA and UV-B radiation. Black-Right-Pointing-Pointer The recombinant OgUBC1 has an enzymatic activity of E2 in vitro. Black-Right-Pointing-Pointer The OgUBC1 could protect disruption of plant cells by UV-B radiation. Black-Right-Pointing-Pointer OgUBC1 confers disease resistance and UV-B tolerance in transgenic Arabidopsis plants. -- Abstract: A previously unidentified gene encoding ubiquitin-conjugating enzyme was isolated from leaves of wild rice plant treated with wounding and microbe-associated molecular patterns. The OgUBC1 gene was composed of 148 amino acids and contained a typical active site and 21 ubiquitin thioester intermediate interaction residues and 4 E3 interaction residues. Both exogenous application of salicylic acid and UV-B irradiation triggered expression of OgUBC1 in leaves of wild rice. Recombinant OgUBC1 proteins bound to ubiquitins in vitro, proposing that the protein might act as E2 enzyme in planta. Heterologous expression of the OgUBC1 in Arabidopsis thaliana protected plants from cellular damage caused by an excess of UV-B radiation. A stable expression of chalcone synthase gene was detected in leaves of OgUBC1-expressing Arabidopsis, resulting in producing higher amounts of anthocyanin than those in wild-type Col-0 plants. Additionally, both pathogenesis-related gene1 and 5 were transcribed in the transgenic Arabidopsis in the absence of pathogen infection. The OgUBC1-expressing plants were resistant to the infection of Botrytis cinerea. Taken together, we suggested that the OgUBC1 is involved in ubiquitination process important for cellular response against biotic and abiotic stresses in plants.

Estrogen receptor alpha and nuclear factor Y coordinately regulate the transcription of the SUMO-conjugating UBC9 gene in MCF-7 breast cancer cells.

Science.gov (United States)

Ying, Shibo; Dünnebier, Thomas; Si, Jing; Hamann, Ute

2013-01-01

UBC9 encodes a protein that conjugates small ubiquitin-related modifier (SUMO) to target proteins thereby changing their functions. Recently, it was noted that UBC9 expression and activity play a role in breast tumorigenesis and response to anticancer drugs. However, the underlying mechanism is poorly understood. To investigate the transcriptional regulation of the UBC9 gene, we identified and characterized its promoter and cis-elements. Promoter activity was tested using luciferase reporter assays. The binding of transcription factors to the promoter was detected by chromatin immunoprecipitation (ChIP), and their functional role was confirmed by siRNA knockdown. UBC9 mRNA and protein levels were measured by quantitative reverse transcription PCR and Western blot analysis, respectively. An increased expression of UBC9 mRNA and protein was found in MCF-7 breast cancer cells treated with 17β-estradiol (E2). Analysis of various deletion mutants revealed a 137 bp fragment upstream of the transcription initiation site to be sufficient for reporter gene transcription. Mutations of putative estrogen receptor α (ER-α) (one imperfect estrogen response element, ERE) and/or nuclear factor Y (NF-Y) binding sites (two CCAAT boxes) markedly reduced promoter activity. Similar results were obtained in ER-negative MDA-MB-231 cells except that the ERE mutation did not affect promoter activity. Additionally, promoter activity was stimulated upon E2 treatment and overexpression of ER-α or NF-YA in MCF-7 cells. ChIP confirmed direct binding of both transcription factors to the UBC9 promoter in vivo. Furthermore, UBC9 expression was diminished by ER-α and NF-Y siRNAs on the mRNA and protein levels. In conclusion, we identified the proximal UBC9 promoter and provided evidence that ER-α and NF-Y regulate UBC9 expression on the transcriptional level in response to E2 in MCF-7 cells. These findings may contribute to a better understanding of the regulation of UBC9 in ER

2013 Alan Blizzard Award Feature Article--Enriching Educational Experiences through UBC's First Year Seminar in Science (SCIE113)

Science.gov (United States)

Fox, Joanne; Birol, Gülnur; Han, Andrea; Cassidy, Alice; Nakonechny, Joanne; Berger, Jim; Peacock, Simon; Samuels, Lacey

2014-01-01

The First Year Seminar in Science (SCIE113) was developed during 2009/2010 academic year through an exemplary collaboration between faculty, administrators and educational support staff in the Faculty of Science at the University of British Columbia (UBC). SCIE113 reflects the vision and values of the Faculty of Science and UBC by offering an…

Estrogen receptor alpha and nuclear factor Y coordinately regulate the transcription of the SUMO-conjugating UBC9 gene in MCF-7 breast cancer cells.

Directory of Open Access Journals (Sweden)

Shibo Ying

Full Text Available UBC9 encodes a protein that conjugates small ubiquitin-related modifier (SUMO to target proteins thereby changing their functions. Recently, it was noted that UBC9 expression and activity play a role in breast tumorigenesis and response to anticancer drugs. However, the underlying mechanism is poorly understood. To investigate the transcriptional regulation of the UBC9 gene, we identified and characterized its promoter and cis-elements. Promoter activity was tested using luciferase reporter assays. The binding of transcription factors to the promoter was detected by chromatin immunoprecipitation (ChIP, and their functional role was confirmed by siRNA knockdown. UBC9 mRNA and protein levels were measured by quantitative reverse transcription PCR and Western blot analysis, respectively. An increased expression of UBC9 mRNA and protein was found in MCF-7 breast cancer cells treated with 17β-estradiol (E2. Analysis of various deletion mutants revealed a 137 bp fragment upstream of the transcription initiation site to be sufficient for reporter gene transcription. Mutations of putative estrogen receptor α (ER-α (one imperfect estrogen response element, ERE and/or nuclear factor Y (NF-Y binding sites (two CCAAT boxes markedly reduced promoter activity. Similar results were obtained in ER-negative MDA-MB-231 cells except that the ERE mutation did not affect promoter activity. Additionally, promoter activity was stimulated upon E2 treatment and overexpression of ER-α or NF-YA in MCF-7 cells. ChIP confirmed direct binding of both transcription factors to the UBC9 promoter in vivo. Furthermore, UBC9 expression was diminished by ER-α and NF-Y siRNAs on the mRNA and protein levels. In conclusion, we identified the proximal UBC9 promoter and provided evidence that ER-α and NF-Y regulate UBC9 expression on the transcriptional level in response to E2 in MCF-7 cells. These findings may contribute to a better understanding of the regulation of UBC9 in ER

MEL-18 interacts with HSF2 and the SUMO E2 UBC9 to inhibit HSF2 sumoylation.

Science.gov (United States)

Zhang, Jie; Goodson, Michael L; Hong, Yiling; Sarge, Kevin D

2008-03-21

In a previous study we found that sumoylation of the DNA-binding protein heat shock factor 2 (HSF2) is up-regulated during mitosis, but the mechanism that mediates this regulation was unknown. Here we show that HSF2 interacts with the polycomb protein MEL-18, that this interaction decreases during mitosis, and that overexpression and RNA interference-mediated reduction of MEL-18 result in decreased and increased HSF2 sumoylation, respectively. Other results suggest that MEL-18 may also function to inhibit the sumoylation of other cellular proteins. The results also show that MEL-18 is able to interact with the small ubiquitin-like modifier (SUMO) ubiquitin carrier protein (E2) enzyme UBC9 and that MEL-18 inhibits the ability of UBC9 to transfer the SUMO protein to target proteins. Together, the results in this work suggest a mechanism in which MEL-18 bound to HSF2 inhibits its sumoylation by binding to and inhibiting the activity of UBC9 enzymes in the vicinity of HSF2. These results provide an explanation for how mitotic HSF2 sumoylation is regulated and suggest that MEL-18, in contrast to the sumoylation-stimulating activities of the polycomb protein PC2, actually functions like an anti-SUMO ubiquitin-protein isopeptide ligase (E3), interacting both with HSF2 and the SUMO E2 UBC9 but acting to inhibit UBC9 activity to decrease sumoylation of a target protein, in this case that of HSF2.

Mutually exclusive STAT1 modifications identified by Ubc9/substrate dimerization-dependent SUMOylation.

Science.gov (United States)

Zimnik, Susan; Gaestel, Matthias; Niedenthal, Rainer

2009-03-01

Post-translational modifications control the physiological activity of the signal transducer and activator of transcription STAT1. While phosphorylation at tyrosine Y701 is a prerequisite for STAT1 dimerization, its SUMOylation represses the transcriptional activity. Recently, we have demonstrated that SUMOylation at lysine K703 inhibits the phosphorylation of nearby localized Y701 of STAT1. Here, we analysed the influence of phosphorylation of Y701 on SUMOylation of K703 in vivo. For that reason, an Ubc9/substrate dimerization-dependent SUMOylation (USDDS) system was developed, which consists of fusions of the SUMOylation substrate and of the SUMO-conjugating enzyme Ubc9 to the chemically activatable heterodimerization domains FKBP and FRB, respectively. When FKBP fusion proteins of STAT1, p53, CRSP9, FOS, CSNK2B, HES1, TCF21 and MYF6 are coexpressed with Ubc9-FRB, treatment of HEK293 cells with the rapamycin-related dimerizer compound AP21967 induces SUMOylation of these proteins in vivo. For STAT1-FKBP and p53-FKBP we show that this SUMOylation takes place at their specific SUMOylation sites in vivo. Using USDDS, we then demonstrate that STAT1 phosphorylation at Y701 induced by interferon-beta treatment inhibits SUMOylation of K703 in vivo. Thus, pY701 and SUMO-K703 of STAT1 represent mutually exclusive modifications, which prevent signal integration at this molecule and probably ensure the existence of differentially modified subpopulations of STAT1 necessary for its regulated nuclear cytoplasmic activation/inactivation cycle.

The fission yeast ubiquitin-conjugating enzymes UbcP3, Ubc15, and Rhp6 affect transcriptional silencing of the mating-type region

DEFF Research Database (Denmark)

Nielsen, Inga Sig; Nielsen, Olaf; Murray, Johanne M

2002-01-01

Genes transcribed by RNA polymerase II are silenced when introduced near the mat2 or mat3 mating-type loci of the fission yeast Schizosaccharomyces pombe. Silencing is mediated by a number of gene products and cis-acting elements. We report here the finding of novel trans-acting factors identified...... was not suppressed by a mutation in the 26S proteasome, suggesting that loss of silencing is not due to an increased degradation of silencing factors but rather to the posttranslational modification of proteins by ubiquitination. We discuss the implications of these results for the possible modes of action of UbcP3...

Are We Doing Any Good? A Value-Added Analysis of UBC's Science One Program

Directory of Open Access Journals (Sweden)

Chris Waltham

2012-12-01

Full Text Available Science One is a full academic year interdisciplinary alternative to the traditional first-year experience in the Faculty of Science at the University of British Columbia (UBC. Anecdotal reports suggest that alumni/ae of the program do very well in upper-level classes and many become successful graduate and medical students. The high faculty/student ratio makes the program an expensive one, however, and thus we have sought rigorous evidence of the benefits to our students. Our approach has been a value-added one; we have compared high-school and upper-level undergraduate grades for students in all UBC's first-year science programs. We have found a clear signal that there is a large benefit to participating in Science One, and conclude that this arises from a combination of the recruitment of enthusiastic students who are up for a challenge, the Science One admissions process, and taking the program itself.Science One consiste en une année scolaire interdisciplinaire complète qui représente une variante de l’expérience traditionnelle vécue en première année à la Faculté des sciences de l’Université de la Colombie-Britannique (UBC. Des rapports isolés suggèrent que les anciens étudiants du programme obtiennent de très bons résultats dans les cours de niveau supérieur et plusieurs obtiennent leur diplôme avec succès et étudient en médecine. Cependant, le ratio élevé enseignant/étudiant fait en sorte que le programme coûte cher, c’est pourquoi les auteurs ont cherché à obtenir des données probantes sur les avantages qu’il présente pour leurs étudiants. Ils ont employé la méthode de la valeur ajoutée; ont comparé les notes obtenues au secondaire et celles des étudiants de premier cycle inscrits à des cours de niveau supérieur dans tous les programmes scientifiques offerts à l’UBC. Ils ont découvert que la participation à Science One est très bénéfique et ont conclu que cela résulte d�

Structure of a SUMO-binding-motif mimic bound to Smt3p–Ubc9p: conservation of a noncovalent Ubiquitin-like protein–E2 complex as a platform for selective interactions within a SUMO pathway

Science.gov (United States)

Duda, David M.; van Waardenburg, Robert C. A. M.; Borg, Laura A.; McGarity, Sierra; Nourse, Amanda; Waddell, M. Brett; Bjornsti, Mary-Ann; Schulman, Brenda A.

2007-01-01

Summary The SUMO ubiquitin-like proteins play regulatory roles in cell division, transcription, DNA repair, and protein subcellular localization. Paralleling other ubiquitin-like proteins, SUMO proteins are proteolytically processed to maturity, conjugated to targets by E1-E2-E3 cascades, and subsequently recognized by specific downstream effectors containing a SUMO-binding motif (SBM). SUMO and its E2 from the budding yeast S. cerevisiae, Smt3p and Ubc9p, are encoded by essential genes. Here we describe the 1.9 Å resolution crystal structure of a noncovalent Smt3p–Ubc9p complex. Unexpectedly, a heterologous portion of the crystallized complex derived from the expression construct mimics an SBM, and binds Smt3p in a manner resembling SBM binding to human SUMO family members. In the complex, Smt3p binds a surface distal from Ubc9's catalytic cysteine. The structure implies that a single molecule of Smt3p cannot bind concurrently to both the noncovalent binding site and the catalytic cysteine of a single Ubc9p molecule. However, formation of higher-order complexes can occur, where a single Smt3p covalently linked to one Ubc9p's catalytic cysteine also binds noncovalently to another molecule of Ubc9p. Comparison with other structures from the SUMO pathway suggests that formation of the noncovalent Smt3p–Ubc9p complex occurs mutually exclusively with many other Smt3p and Ubc9p interactions in the conjugation cascade. By contrast, high-resolution insights into how Smt3p–Ubc9p can also interact with downstream recognition machineries come from contacts with the SBM mimic. Interestingly, the overall architecture of the Smt3p–Ubc9p complex is strikingly similar to recent structures from the ubiquitin pathway. The results imply that noncovalent ubiquitin-like protein–E2 complexes are conserved platforms, which function as parts of larger assemblies involved many protein post-translational regulatory pathways. PMID:17475278

Efficacy of DNA double-strand breaks repair in breast cancer is decreased in carriers of the variant allele of the UBC9 gene c.73G>A polymorphism

International Nuclear Information System (INIS)

Synowiec, Ewelina; Krupa, Renata; Morawiec, Zbigniew; Wasylecka, Maja; Dziki, Lukasz; Morawiec, Jan; Blasiak, Janusz; Wozniak, Katarzyna

2010-01-01

UBC9 (E2) SUMO conjugating enzyme plays an important role in the maintenance of genome stability and integrity. In the present work we examined the association between the c.73G>A (Val25Met) polymorphism of the UBC9 gene (rs11553473) and efficacy of DNA double-strand breaks (DSBs) repair (DRE) in breast cancer patients. We determined the level of endogenous (basal) and exogenous (induced by γ-irradiation) DSBs and efficacy of their repair in peripheral blood lymphocytes of 57 breast cancer patients and 70 healthy individuals. DNA damage and repair were studied by neutral comet assay. Genotypes were determined in DNA from peripheral blood lymphocytes by allele-specific PCR (ASO-PCR). We also correlated genotypes with the clinical characteristics of breast cancer patients. We observed a strong association between breast cancer occurrence and the variant allele carried genotypes in patients with elevated level of basal as well as induced DNA damage (OR 6.74, 95% CI 2.27-20.0 and OR 5.33, 95% CI 1.81-15.7, respectively). We also found statistically significant (p A polymorphism of the UBC9 gene in breast cancer patients. Carriers of variant allele have decreased DNA DRE as compared to wild type genotype carriers. We did not find any association with the UBC9 gene polymorphism and estrogen and progesterone receptor status. The variant allele of the UBC9 gene polymorphism was strongly inversely related to HER negative breast cancer patients (OR 0.03, 95% CI 0.00-0.23). Our results suggest that the c.73G>A polymorphism of the UBC9 gene may affect DNA DSBs repair efficacy in breast cancer patients.

Caspase recruitment domain of procaspase-2 could be a target for SUMO-1 modification through Ubc9

International Nuclear Information System (INIS)

Shirakura, Hiromi; Hayashi, Naoko; Ogino, Shin-ichi; Tsuruma, Kazuhiro; Uehara, Takashi; Nomura, Yasuyuki

2005-01-01

To identify the binding proteins that regulate the function of procaspase-2, we screened for proteins using the yeast two-hybrid method and isolated human Ubc9 and SUMO-1 as the candidates. Ubc9 and SUMO-1 interacted with the caspase recruitment domain of procaspase-2 in its N-terminal. We elucidated the covalent modification of procaspase-2 by SUMO-1 in mammalian cells by immunoprecipitation followed by Western blot analysis. Procaspase-2 and SUMO-1 were co-localized by dot-like structures in the nucleus that are related to promyelocytic leukemia bodies. Interestingly, a conjugation-deficient mutant (K60R) procaspase-2 resulted in a delay of its enzyme maturation (appearance of p12 subunit) compared to that of wild-type. Thus, the modification with SUMO-1 may play a critical role in the nuclear localization and the activation (maturation) of procaspase-2

Efficacy of DNA double-strand breaks repair in breast cancer is decreased in carriers of the variant allele of the UBC9 gene c.73G>A polymorphism

Energy Technology Data Exchange (ETDEWEB)

Synowiec, Ewelina [Department of Molecular Genetics, University of Lodz, Lodz (Poland); Krupa, Renata [Laboratory of DNA Repair, Department of Molecular Genetics, University of Lodz, Banacha 12/16, Lodz (Poland); Morawiec, Zbigniew; Wasylecka, Maja [Department of Surgical Oncology, N. Copernicus Hospital, Lodz (Poland); Dziki, Lukasz; Morawiec, Jan [Department of General and Colorectal Surgery, Medical University of Lodz, Lodz (Poland); Blasiak, Janusz [Department of Molecular Genetics, University of Lodz, Lodz (Poland); Wozniak, Katarzyna, E-mail: wozniak@biol.uni.lodz.pl [Laboratory of DNA Repair, Department of Molecular Genetics, University of Lodz, Banacha 12/16, Lodz (Poland)

2010-12-10

UBC9 (E2) SUMO conjugating enzyme plays an important role in the maintenance of genome stability and integrity. In the present work we examined the association between the c.73G>A (Val25Met) polymorphism of the UBC9 gene (rs11553473) and efficacy of DNA double-strand breaks (DSBs) repair (DRE) in breast cancer patients. We determined the level of endogenous (basal) and exogenous (induced by {gamma}-irradiation) DSBs and efficacy of their repair in peripheral blood lymphocytes of 57 breast cancer patients and 70 healthy individuals. DNA damage and repair were studied by neutral comet assay. Genotypes were determined in DNA from peripheral blood lymphocytes by allele-specific PCR (ASO-PCR). We also correlated genotypes with the clinical characteristics of breast cancer patients. We observed a strong association between breast cancer occurrence and the variant allele carried genotypes in patients with elevated level of basal as well as induced DNA damage (OR 6.74, 95% CI 2.27-20.0 and OR 5.33, 95% CI 1.81-15.7, respectively). We also found statistically significant (p < 0.05) difference in DRE related to the c.73G>A polymorphism of the UBC9 gene in breast cancer patients. Carriers of variant allele have decreased DNA DRE as compared to wild type genotype carriers. We did not find any association with the UBC9 gene polymorphism and estrogen and progesterone receptor status. The variant allele of the UBC9 gene polymorphism was strongly inversely related to HER negative breast cancer patients (OR 0.03, 95% CI 0.00-0.23). Our results suggest that the c.73G>A polymorphism of the UBC9 gene may affect DNA DSBs repair efficacy in breast cancer patients.

Leading Online: An Autoethnography Focused on Leading an Instructional Focus on Student Learning in an Online School

Science.gov (United States)

Lancaster, Sally Ann

2012-01-01

The purpose in writing this autoethnography was to describe, analyze and interpret one leader's experience in leading a group of online teachers. I specifically wanted to identify the characteristics of an online learning environment that triggered teachers to focus on management issues rather than instructional learning issues; that is what…

Kinetics of cesium lead halide perovskite nanoparticle growth; focusing and de-focusing of size distribution

Science.gov (United States)

Koolyk, Miriam; Amgar, Daniel; Aharon, Sigalit; Etgar, Lioz

2016-03-01

In this work we study the kinetics of cesium lead halide perovskite nanoparticle (NP) growth; the focusing and de-focusing of the NP size distribution. Cesium lead halide perovskite NPs are considered to be attractive materials for optoelectronic applications. Understanding the kinetics of the formation of these all-inorganic perovskite NPs is critical for reproducibly and reliably generating large amounts of uniformly sized NPs. Here we investigate different growth durations for CsPbI3 and CsPbBr3 NPs, tracking their growth by high-resolution transmission electron microscopy and size distribution analysis. As a result, we are able to provide a detailed model for the kinetics of their growth. It was observed that the CsPbI3 NPs exhibit focusing of the size distribution in the first 20 seconds of growth, followed by de-focusing over longer growth durations, while the CsPbBr3 NPs show de-focusing of the size distribution starting from the beginning of the growth. The monomer concentration is depleted faster in the case of CsPbBr3 than in the case of CsPbI3, due to faster diffusion of the monomers, which increases the critical radius and results in de-focusing of the population. Accordingly, focusing is not observed within 40 seconds of growth in the case of CsPbBr3. This study provides important knowledge on how to achieve a narrow size distribution of cesium lead halide perovskite NPs when generating large amounts of these promising, highly luminescent NPs.In this work we study the kinetics of cesium lead halide perovskite nanoparticle (NP) growth; the focusing and de-focusing of the NP size distribution. Cesium lead halide perovskite NPs are considered to be attractive materials for optoelectronic applications. Understanding the kinetics of the formation of these all-inorganic perovskite NPs is critical for reproducibly and reliably generating large amounts of uniformly sized NPs. Here we investigate different growth durations for CsPbI3 and CsPbBr3 NPs, tracking

Space Focus Lead Report

Energy Technology Data Exchange (ETDEWEB)

Reeves, Geoffrey D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-08-10

The Space Focus team is tasked with the definition of the Space Focused Science Topics, and with the review and ranking of the CSES proposals received in all the program areas. This is achieved by dedicated meetings or a series of informal discussions and/or e-mail reviews.

SUMO modification through rapamycin-mediated heterodimerization reveals a dual role for Ubc9 in targeting RanGAP1 to nuclear pore complexes

International Nuclear Information System (INIS)

Zhu Shanshan; Zhang Hong; Matunis, Michael J.

2006-01-01

SUMOs (small ubiquitin-related modifiers) are eukaryotic proteins that are covalently conjugated to other proteins and thereby regulate a wide range of important cellular processes. The molecular mechanisms by which SUMO modification influences the functions of most target proteins and cellular processes, however, remain poorly defined. A major obstacle to investigating the effects of SUMO modification is the availability of a system for selectively inducing the modification or demodification of an individual protein. To address this problem, we have developed a procedure using the rapamycin heterodimerizer system. This procedure involves co-expression of rapamycin-binding domain fusion proteins of SUMO and candidate SUMO substrates in living cells. Treating cells with rapamycin induces a tight association between SUMO and a single SUMO substrate, thereby allowing specific downstream effects to be analyzed. Using RanGAP1 as a model SUMO substrate, the heterodimerizer system was used to investigate the molecular mechanism by which SUMO modification targets RanGAP1 from the cytoplasm to nuclear pore complexes (NPCs). Our results revealed a dual role for Ubc9 in targeting RanGAP1 to NPCs: In addition to conjugating SUMO-1 to RanGAP1, Ubc9 is also required to form a stable ternary complex with SUMO-1 modified RanGAP1 and Nup358. As illustrated by our studies, the rapamycin heterodimerizer system represents a novel tool for studying the molecular effects of SUMO modification

Over-accumulation of nuclear IGF-1 receptor in tumor cells requires elevated expression of the receptor and the SUMO-conjugating enzyme Ubc9

Energy Technology Data Exchange (ETDEWEB)

Deng, Hua; Lin, Yingbo; Badin, Margherita; Vasilcanu, Daiana; Stroemberg, Thomas [Department of Oncology and Pathology, The Karolinska Institute, Cancer Center Karolinska, SE-17176 Stockholm (Sweden); Jernberg-Wiklund, Helena [Department of Genetics and Pathology, Rudbeck Laboratory, Uppsala University, Uppsala (Sweden); Sehat, Bita [Department of Oncology and Pathology, The Karolinska Institute, Cancer Center Karolinska, SE-17176 Stockholm (Sweden); Larsson, Olle, E-mail: olle.larsson@ki.se [Department of Oncology and Pathology, The Karolinska Institute, Cancer Center Karolinska, SE-17176 Stockholm (Sweden)

2011-01-14

Research highlights: {yields} SUMOylation mediates nuclear translocation of IGF-1R which activates transcription. {yields} Here we show that nuclear IGF-1R over-accumulates in tumor cells. {yields} This requires overexpression of the receptor that is a common feature in tumor cells. {yields} An increased expression of the SUMO ligase Ubc9 seems to be an involved mechanism too. -- Abstract: The insulin-like growth factor 1 receptor (IGF-1R) plays crucial roles in tumor cell growth and is overexpressed in many cancers. IGF-1R's trans-membrane kinase signaling pathways have been well characterized. Very recently, we showed that SUMOylation mediates nuclear translocation of the IGF-1R, and that nuclear IGF-1R (nIGF-1R) binds to enhancer regions and activates transcription. We identified three lysine residues in the {beta}-subunit of the receptor and that mutation of these blocks nuclear translocation and gene activation. Furthermore, accumulation of nIGF-1R was proven strongly dependent on the specific SUMO-conjugating enzyme Ubc9. Here we show that nIGF-1R originates solely from the cell membrane and that phosphorylation of the core tyrosine residues of the receptor kinase is crucial for nuclear accumulation. We also compared the levels of nIGF-1R, measured as nuclear/membrane ratios, in tumor and normal cells. We found that the breast cancer cell line MCF-7 has 13-fold higher amounts of nIGF-1R than breast epithelial cells (IME) which showed only a small amount of nIGF-1R. In comparison, the total expression of IGF-1R was only 3.7- higher in MCF-7. Comparison of several other tumor and normal cell lines showed similar tumor cell over-accumulation of nIGF-1R, exceeding the total receptor expression substantially. Ectopic overexpression (>10-fold) of the receptor increased nIGF-1R in IME cells but not to that high level as in wild type MCF-7. The levels of Ubc9 were higher in all tumor cell lines, compared to the normal cells, and this probably contributes to over

Over-accumulation of nuclear IGF-1 receptor in tumor cells requires elevated expression of the receptor and the SUMO-conjugating enzyme Ubc9

International Nuclear Information System (INIS)

Deng, Hua; Lin, Yingbo; Badin, Margherita; Vasilcanu, Daiana; Stroemberg, Thomas; Jernberg-Wiklund, Helena; Sehat, Bita; Larsson, Olle

2011-01-01

Research highlights: → SUMOylation mediates nuclear translocation of IGF-1R which activates transcription. → Here we show that nuclear IGF-1R over-accumulates in tumor cells. → This requires overexpression of the receptor that is a common feature in tumor cells. → An increased expression of the SUMO ligase Ubc9 seems to be an involved mechanism too. -- Abstract: The insulin-like growth factor 1 receptor (IGF-1R) plays crucial roles in tumor cell growth and is overexpressed in many cancers. IGF-1R's trans-membrane kinase signaling pathways have been well characterized. Very recently, we showed that SUMOylation mediates nuclear translocation of the IGF-1R, and that nuclear IGF-1R (nIGF-1R) binds to enhancer regions and activates transcription. We identified three lysine residues in the β-subunit of the receptor and that mutation of these blocks nuclear translocation and gene activation. Furthermore, accumulation of nIGF-1R was proven strongly dependent on the specific SUMO-conjugating enzyme Ubc9. Here we show that nIGF-1R originates solely from the cell membrane and that phosphorylation of the core tyrosine residues of the receptor kinase is crucial for nuclear accumulation. We also compared the levels of nIGF-1R, measured as nuclear/membrane ratios, in tumor and normal cells. We found that the breast cancer cell line MCF-7 has 13-fold higher amounts of nIGF-1R than breast epithelial cells (IME) which showed only a small amount of nIGF-1R. In comparison, the total expression of IGF-1R was only 3.7- higher in MCF-7. Comparison of several other tumor and normal cell lines showed similar tumor cell over-accumulation of nIGF-1R, exceeding the total receptor expression substantially. Ectopic overexpression (>10-fold) of the receptor increased nIGF-1R in IME cells but not to that high level as in wild type MCF-7. The levels of Ubc9 were higher in all tumor cell lines, compared to the normal cells, and this probably contributes to over-accumulation of nIGF-1R

Engaging Focus Group Methodology: The 4-H Middle School-Aged Youth Learning and Leading Study

Science.gov (United States)

Scott, Siri; Grant, Samantha; Nippolt, Pamela Larson

2015-01-01

With young people, discussing complex issues such as learning and leading in a focus group can be a challenge. To help prime youth for the discussion, we created a focus group approach that featured a fun, interactive activity. This article includes a description of the focus group activity, lessons learned, and suggestions for additional…

Inhibition of Ubc13-mediated Ubiquitination by GPS2 Regulates Multiple Stages of B Cell Development.

Science.gov (United States)

Lentucci, Claudia; Belkina, Anna C; Cederquist, Carly T; Chan, Michelle; Johnson, Holly E; Prasad, Sherry; Lopacinski, Amanda; Nikolajczyk, Barbara S; Monti, Stefano; Snyder-Cappione, Jennifer; Tanasa, Bogdan; Cardamone, M Dafne; Perissi, Valentina

2017-02-17

Non-proteolytic ubiquitin signaling mediated by Lys 63 ubiquitin chains plays a critical role in multiple pathways that are key to the development and activation of immune cells. Our previous work indicates that GPS2 (G-protein Pathway Suppressor 2) is a multifunctional protein regulating TNFα signaling and lipid metabolism in the adipose tissue through modulation of Lys 63 ubiquitination events. However, the full extent of GPS2-mediated regulation of ubiquitination and the underlying molecular mechanisms are unknown. Here, we report that GPS2 is required for restricting the activation of TLR and BCR signaling pathways and the AKT/FOXO1 pathway in immune cells based on direct inhibition of Ubc13 enzymatic activity. Relevance of this regulatory strategy is confirmed in vivo by B cell-targeted deletion of GPS2, resulting in developmental defects at multiple stages of B cell differentiation. Together, these findings reveal that GPS2 genomic and non-genomic functions are critical for the development and cellular homeostasis of B cells. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

Letting Students Take the Lead: A User-Centred Approach to Evaluating Subject Guides

Directory of Open Access Journals (Sweden)

Kimberley Hintz

2010-12-01

Full Text Available Objective – What do students need and want from library subject guides? Options such as Web 2.0 enhancement are now available to librarians creating subject-specific web pages. Librarians may be eager to implement these new tools, but are such add-ons a priority forstudents? This paper aims to start a dialogue on this issue by presenting the findings of the University of British Columbia (UBC Library’s Subject Guides Working Group (SGWG, which was tasked with assessing current library subject guides in order to make recommendations for the update and future development of UBC Library subject guides.Methods – The working group solicited feedback through a questionnaire that was distributed to undergraduate and graduate students from a variety of disciplines at UBC. The questionnaire included an evaluation of UBC subject guides, as well as guides from other academic libraries that used various platforms such as LibGuides and SubjectsPlus.Results – Respondents to the student questionnaire indicated that a simple and clean layout was of primary importance. Students also desired succinct annotations to resources and limited page scrolling. Meanwhile, few students identified Web 2.0 features such as rating systems and discussion forums as being important for their needs. The working group used the questionnaire data to create a “Top Ten” list of student recommendations.Conclusions – The “Top Ten” list of student recommendations was combined with stakeholder feedback from faculty, liaison librarians and Library Systems and Information Technology representatives to create the SGWG’s final recommendation for subject guide revision and enhancement. For the SGWG these findings called into question the necessity of Web 2.0 technologies within subject guide pages and highlighted the need for further research on the topic of subject guide usability and effectiveness.

Influence of additives on the increase of the heating value of Bayah’s coal with upgrading brown coal (UBC) method

International Nuclear Information System (INIS)

Heriyanto, Heri; Widya Ernayati, K.; Umam, Chairul; Margareta, Nita

2015-01-01

UBC (upgrading brown coal) is a method of improving the quality of coal by using oil as an additive. Through processing in the oil media, not just the calories that increase, but there is also water repellent properties and a decrease in the tendency of spontaneous combustion of coal products produced. The results showed a decrease in the water levels of natural coal bayah reached 69%, increase in calorific value reached 21.2%. Increased caloric value and reduced water content caused by the water molecules on replacing seal the pores of coal by oil and atoms C on the oil that is bound to increase the percentage of coal carbon. As a result of this experiment is, the produced coal has better calorific value, the increasing of this new calorific value up to 23.8% with the additive waste lubricant, and the moisture content reduced up to 69.45%

Influence of additives on the increase of the heating value of Bayah’s coal with upgrading brown coal (UBC) method

Energy Technology Data Exchange (ETDEWEB)

Heriyanto, Heri [Chemical Engineering of University Sultan AgengTirtayasa, Indonesia Email: herfais@yahoo.com (Indonesia); Widya Ernayati, K.; Umam, Chairul; Margareta, Nita

2015-12-29

UBC (upgrading brown coal) is a method of improving the quality of coal by using oil as an additive. Through processing in the oil media, not just the calories that increase, but there is also water repellent properties and a decrease in the tendency of spontaneous combustion of coal products produced. The results showed a decrease in the water levels of natural coal bayah reached 69%, increase in calorific value reached 21.2%. Increased caloric value and reduced water content caused by the water molecules on replacing seal the pores of coal by oil and atoms C on the oil that is bound to increase the percentage of coal carbon. As a result of this experiment is, the produced coal has better calorific value, the increasing of this new calorific value up to 23.8% with the additive waste lubricant, and the moisture content reduced up to 69.45%.

The plasma focus - numerical experiments leading technology

International Nuclear Information System (INIS)

Saw, S.H.; Lee, S.

2013-01-01

Numerical experiments on the plasma focus are now used routinely to assist design and provide reference points for diagnostics. More importantly guidance has been given regarding the implementation of technology for new generations of plasma focus devices. For example intensive series of experiments have shown that it is of no use to reduce static bank inductance L0 below certain values because of the consistent loading effects of the plasma focus dynamics on the capacitor bank. Thus whilst it was thought that the PF1000 could receive major benefits by reducing its bank inductance L 0 , numerical experiments have shown to the contrary that its present L 0 of 30 nH is already optimum and that reducing L 0 would be a very expensive fruitless exercise. This knowledge gained from numerical experiments now acts as a general valuable guideline to all high performance (ie low inductance) plasma focus devices not to unnecessarily attempt to further lower the static inductance L 0 . The numerical experiments also show that the deterioration of the yield scaling law (e.g. the fusion neutron yield scaling with storage energy) is inevitable again due to the consistent loading effect of the plasma focus, which becomes more and more dominant as capacitor bank impedance reduces with increasing capacitance C 0 as storage energy is increased. This line of thinking has led to the suggestion of using higher voltages (as an alternative to increasing C 0 ) and to seeding of Deuterium with noble gases in order to enhance compression through thermodynamic mechanisms and through radiation cooling effects of strong line radiation. Circuit manipulation e.g. to enhance focus pinch compression by current-stepping is also being numerically experimented upon. Ultimately however systems have to be built, guided by numerical experiments, so that the predicted technology may be proven and realized. (author)

Subsurface Contaminants Focus Area (SCFA) Lead Laboratory Providing Technical Assistance to the DOE Weapons Complex in Subsurface Contamination

International Nuclear Information System (INIS)

Wright, J. A. Jr.; Corey, J. C.

2002-01-01

The Subsurface Contaminants Focus Area (SCFA), a DOE-HQ EM-50 organization, is hosted and managed at the Savannah River Site in Aiken, South Carolina. SCFA is an integrated program chartered to find technology and scientific solutions to address DOE subsurface environmental restoration problems throughout the DOE Weapons Complex. Since its inception in 1989, the SCFA program has resulted in a total of 269 deployments of 83 innovative technologies. Until recently, the primary thrust of the program has been to develop, demonstrate, and deploy those remediation technology alternatives that are solutions to technology needs identified by the DOE Sites. Over the last several years, the DOE Sites began to express a need not only for innovative technologies, but also for technical assistance. In response to this need, DOE-HQ EM-50, in collaboration with and in support of a Strategic Lab Council recommendation directed each of its Focus Areas to implement a Lead Laboratory Concept to enhance their technical capabilities. Because each Focus Area is unique as defined by the contrast in either the type of contaminants involved or the environments in which they are found, the Focus Areas were given latitude in how they set up and implemented the Lead Lab Concept. The configuration of choice for the SCFA was a Lead-Partner Lab arrangement. Savannah River Technology Center (SRTC) teamed with the SCFA as the Focus Area's Lead Laboratory. SRTC then partnered with the DOE National Laboratories to create a virtual consulting function within DOE. The National Laboratories were established to help solve the Nation's most difficult problems, drawing from a resource pool of the most talented and gifted scientists and engineers. Following that logic, SRTC, through the Lead-Partner Lab arrangement, has that same resource base to draw from to provide assistance to any SCFA DOE customer throughout the Complex. This paper briefly describes how this particular arrangement is organized and

MR imaging of simple bone cysts in children: not so simple

Energy Technology Data Exchange (ETDEWEB)

Margau, R. [Faculty of Medicine, University of Toronto, Toronto, ON (Canada); Babyn, P. [Department of Diagnostic Imaging, The Hospital for Sick Children, Toronto, ON (Canada); Cole, W.; Lee, F. [Division of Orthopaedic Surgery, Department of Surgery, The Hospital for Sick Children and University of Toronto, Toronto, ON (Canada); Smith, C. [Department of Pathology, The Hospital for Sick Children and University of Toronto, Toronto, ON (Canada)

2000-08-01

Objective. The unicameral bone cyst (UBC) is a common cystic bone lesion seen in children. We review and summarize its MR findings, focusing on their appearance following contrast enhancement, and correlating them to known histologic features of UBC. Subjects and methods. A retrospective review of 20 cases (13 boys, 7 girls; age range, 1-17 years; mean age, 8.9) diagnosed as UBC was conducted. Clinical histories, radiographic and MR features, follow-up data, and available pathologic findings were noted. Results. At initial presentation 18 (90 %) of the patients with UBC had a history of acute or remote pathologic fracture. Cysts with history of fracture displayed heterogeneous fluid signals on T1- (n = 9, 50 %), and T2-weighted (n = 15, 83 %) MR images. Gadolinium-enhanced images were obtained in 15 of the 18 UBC cases with history of previous fracture. All showed enhancement with focal, thick peripheral, heterogeneous, or subcortical patterns. Focal nodules of homogeneous enhancement (diameter > 1 cm) within the UBC (n = 5) correlated with areas of ground-glass opacification on plain film. Other interesting MR features were fluid-fluid levels (n = 11), ''fallen-leaf'' sign (n = 1), soft-tissue changes (n = 2), and detection of septations not seen on plain film (n = 2). Conclusion. UBCs frequently appear complicated on MR imaging, with heterogeneous fluid signals and regions of nodular and thick peripheral enhancement related to previous pathologic fracture and early healing. (orig.)

MR imaging of simple bone cysts in children: not so simple

International Nuclear Information System (INIS)

Margau, R.; Babyn, P.; Cole, W.; Lee, F.; Smith, C.

2000-01-01

Objective. The unicameral bone cyst (UBC) is a common cystic bone lesion seen in children. We review and summarize its MR findings, focusing on their appearance following contrast enhancement, and correlating them to known histologic features of UBC. Subjects and methods. A retrospective review of 20 cases (13 boys, 7 girls; age range, 1-17 years; mean age, 8.9) diagnosed as UBC was conducted. Clinical histories, radiographic and MR features, follow-up data, and available pathologic findings were noted. Results. At initial presentation 18 (90 %) of the patients with UBC had a history of acute or remote pathologic fracture. Cysts with history of fracture displayed heterogeneous fluid signals on T1- (n = 9, 50 %), and T2-weighted (n = 15, 83 %) MR images. Gadolinium-enhanced images were obtained in 15 of the 18 UBC cases with history of previous fracture. All showed enhancement with focal, thick peripheral, heterogeneous, or subcortical patterns. Focal nodules of homogeneous enhancement (diameter > 1 cm) within the UBC (n = 5) correlated with areas of ground-glass opacification on plain film. Other interesting MR features were fluid-fluid levels (n = 11), ''fallen-leaf'' sign (n = 1), soft-tissue changes (n = 2), and detection of septations not seen on plain film (n = 2). Conclusion. UBCs frequently appear complicated on MR imaging, with heterogeneous fluid signals and regions of nodular and thick peripheral enhancement related to previous pathologic fracture and early healing. (orig.)

Controversial roles played by toll like receptor 4 in urinary bladder cancer; A systematic review.

Science.gov (United States)

Afsharimoghaddam, Amin; Soleimani, Mohammad; Lashay, Alireza; Dehghani, Mahdi; Sepehri, Zahra

2016-08-01

Urinary bladder cancer (UBC) is a prevalent human cancer. The main mechanisms which lead to eradication or progression the disease has yet to be clarified. Toll like receptor (TLR) 4 is a membrane receptor which is expressed either on immune cells or tumor cells. This review article was aimed to clear the main mechanisms played by TLR4 and its related intracellular pathways on outcome of UBC. PubMed, Scopus and Google scholar databases have been used for searching related research articles which have evaluated the roles played by TLR4 and its related intracellular pathways on outcome of UBC. Collected information from the related articles revealed that TLR4 either participates in induction of immune responses against UBC or development of the malignancy. There are limited investigations regarding the genetic variations of TLR4 in UBC. According to the results it seems that TLR4/ligands interaction outcome is dependent on several factors including TLR4 ligand doses, interaction of TLR4 with its ligands on immune cells or tumor cells, and other TLRs/ligand interaction simultaneously. Copyright © 2016 Elsevier Inc. All rights reserved.

Unusual localizations of unicameral bone cysts and aneurysmal bone cysts: A retrospective review of 451 cases.

Science.gov (United States)

Aycan, Osman Emre; Çamurcu, İsmet Yalkın; Özer, Devrim; Arıkan, Yavuz; Kabukçuoğlu, Yavuz Selim

2015-06-01

Unicameral bone cysts (UBC) and aneurysmal bone cysts (ABC) are benign cystic lesions of bone which are easily diagnosed. However, unusual locations may lead to a false diagnosis. Therefore the aim of this retrospective study was to determine the frequency of unusual localizations. The authors studied 451 cases with histopathologically confirmed diagnosis of UBC or ABC, seen between 1981 and 2012. In the UBC group (352 cases) humerus, femur and calcaneus were found to be the most common sites, while acetabulum, scapula, scaphoid, lunatum, metacarpals, metatarsals, toe phalanges and ulna each accounted for less than 1%. In the ABC group (99 cases) the most common sites of involvement were femur, humerus and tibia, while finger phalanges, ilium, acetabulum, pubis, calcaneus, cuboid, and toe phalanges each accounted for only 1%. The differential diagnosis of cystic bone lesions should include both UBC and ABC. Pain complaints plead for the latter, except in case of fracture.

Role for sumoylation in systemic inflammation and immune homeostasis in Drosophila larvae.

Directory of Open Access Journals (Sweden)

Indira Paddibhatla

2010-12-01

Full Text Available To counter systemic risk of infection by parasitic wasps, Drosophila larvae activate humoral immunity in the fat body and mount a robust cellular response resulting in encapsulation of the wasp egg. Innate immune reactions are tightly regulated and are resolved within hours. To understand the mechanisms underlying activation and resolution of the egg encapsulation response and examine if failure of the latter develops into systemic inflammatory disease, we correlated parasitic wasp-induced changes in the Drosophila larva with systemic chronic conditions in sumoylation-deficient mutants. We have previously reported that loss of either Cactus, the Drosophila (IκB protein or Ubc9, the SUMO-conjugating enzyme, leads to constitutive activation of the humoral and cellular pathways, hematopoietic overproliferation and tumorogenesis. Here we report that parasite infection simultaneously activates NF-κB-dependent transcription of Spätzle processing enzyme (SPE and cactus. Endogenous Spätzle protein (the Toll ligand is expressed in immune cells and excessive SPE or Spätzle is pro-inflammatory. Consistent with this function, loss of Spz suppresses Ubc9⁻ defects. In contrast to the pro-inflammatory roles of SPE and Spätzle, Cactus and Ubc9 exert an anti-inflammatory effect. We show that Ubc9 maintains steady state levels of Cactus protein. In a series of immuno-genetic experiments, we demonstrate the existence of a robust bidirectional interaction between blood cells and the fat body and propose that wasp infection activates Toll signaling in both compartments via extracellular activation of Spätzle. Within each organ, the IκB/Ubc9-dependent inhibitory feedback resolves immune signaling and restores homeostasis. The loss of this feedback leads to chronic inflammation. Our studies not only provide an integrated framework for understanding the molecular basis of the evolutionary arms race between insect hosts and their parasites, but also offer

The present and future burden of urinary bladder cancer in the world.

NARCIS (Netherlands)

Ploeg, M.; Aben, K.K.H.; Kiemeney, L.A.L.M.

2009-01-01

Urinary bladder cancer (UBC) is a common disease worldwide. At any point in time 2.7 million people have a history of UBC. The incidence of UBC varies over the world with highest rates in developed communities. But the burden of UBC will increase in less developed areas of the world. These changes

SENSITIVITY AND SPECIFICITY OF URINARY BLADDER CANCER ANTIGEN FOR DIAGNOSIS OF BLADDER TUMOR;A COMPARATIVE STUDY WITH URINARY CYTOLOGY

Directory of Open Access Journals (Sweden)

K. Radkhah

2005-06-01

Full Text Available Cystoscopy and urinary cytology are currently the basis for diagnosis and ‎follow-up of bladder tumors. Research to find a sensitive and specific tumor ‎marker for diagnosis of bladder tumor is actively underway, however, due to low sensitivity ‎and high cost of cytology. This cross-sectional study was performed in 65 patients to evaluate whether urinary bladder ‎cancer (UBC antigen level can predict the presence of active bladder tumor. In patients with ‎inactive tumor, UBC antigen level was determined in addition to standard cystoscopy ‎and cytology for follow-up. Patients with active tumor were ‎subjected to standard treatment and UBC antigen level determination. UBC antigen ‎ levels were measured by ELISA, using monoclonal antibodies ‎specific for UBC antigen. As a control group, UBC antigen level ‎was also determined in 65 persons who had been referred for urinalysis for other reasons. ‎UBC antigen level more than 1 μg/L which was regarded as ‎positive was found in 49.4% of the patients. In control group, 96.9% had UBC antigen < 1μg/L‎. Mean UBC antigen level in patients was ‎3.77 μg/L while it was 0.508 μg/L in controls (P < 0.0001. Sensitivity of ‎UBC antigen was 53.3% and its specificity was 40%. Sensitivity and specificity of urinary cytology was 17.3% and 88.2%, respectively. This difference was statistically ‎significant (P < 0.001. UBC antigen is more sensitive than urinary cytology, although cytology still ‎retains its priority in specificity. It is not yet recommended to replace UBC antigen for ‎cytology due to its low specificity and not favorable sensitivity.

Development of a compact HTS lead unit for the SC correction coils of the SuperKEKB final focusing magnet system

Energy Technology Data Exchange (ETDEWEB)

Zong, Zhanguo, E-mail: zhanguo.zong@kek.jp; Ohuchi, Norihito; Tsuchiya, Kiyosumi; Arimoto, Yasushi

2016-09-11

Forty-three superconducting (SC) correction coils with maximum currents of about 60 A are installed in the SuperKEKB final focusing magnet system. Current leads to energize the SC correction coils should have an affordable heat load and fit the spatial constraints in the service cryostat where the current leads are installed. To address the requirements, design optimization of individual lead was performed with vapor cooled current lead made of a brass material, and a compact unit was designed to accommodate eight current leads together in order to be installed with one port in the service cryostat. The 2nd generation high temperature SC (HTS) tape was adopted and soldered at the cold end of the brass current lead to form a hybrid HTS lead structure. A prototype of the compact lead unit with HTS tape was constructed and tested with liquid helium (LHe) environment. This paper presents a cryogenic measurement system to simulate the real operation conditions in the service cryostat, and analysis of the experimental results. The measured results showed excellent agreement with the theoretical analysis and numerical simulation. In total, 11 sets of the compact HTS lead units were constructed for the 43 SC correction coils at KEK. One set from the mass production was tested in cryogenic conditions, and exhibited the same performance as the prototype. The compact HTS lead unit can feed currents to four SC correction coils simultaneously with the simple requirement of controlling and monitoring helium vapor flow, and has a heat load of about 0.762 L/h in terms of LHe consumption. - Highlights: • The requirements of the SC correction coils on current leads are introduced. • The optimum design of the brass vapor cooled current lead is described. • The compact structure of eight leads with HTS tape is presented. • The theoretical, numerical, and experimental results are compared. • The current lead heat load is evaluated for cryogenic system.

The Ubiquitin-Conjugating Enzyme Gene Family in Longan (Dimocarpus longan Lour.: Genome-Wide Identification and Gene Expression during Flower Induction and Abiotic Stress Responses

Directory of Open Access Journals (Sweden)

Dengwei Jue

2018-03-01

Full Text Available Ubiquitin-conjugating enzymes (E2s or UBC enzymes play vital roles in plant development and combat various biotic and abiotic stresses. Longan (Dimocarpus longan Lour. is an important fruit tree in the subtropical region of Southeast Asia and Australia; however the characteristics of the UBC gene family in longan remain unknown. In this study, 40 D. longan UBC genes (DlUBCs, which were classified into 15 groups, were identified in the longan genome. An RNA-seq based analysis showed that DlUBCs showed distinct expression in nine longan tissues. Genome-wide RNA-seq and qRT-PCR based gene expression analysis revealed that 11 DlUBCs were up- or down-regualted in the cultivar “Sijimi” (SJ, suggesting that these genes may be important for flower induction. Finally, qRT-PCR analysis showed that the mRNA levels of 13 DlUBCs under SA (salicylic acid treatment, seven under methyl jasmonate (MeJA treatment, 27 under heat treatment, and 16 under cold treatment were up- or down-regulated, respectively. These results indicated that the DlUBCs may play important roles in responses to abiotic stresses. Taken together, our results provide a comprehensive insight into the organization, phylogeny, and expression patterns of the longan UBC genes, and therefore contribute to the greater understanding of their biological roles in longan.

Measurement of erosion of stainless steel by molten lead-free solder using micro-focus x-ray CT system

International Nuclear Information System (INIS)

Nishikawa, Hiroshi; Takemoto, Tadashi; Kang, Songai

2009-01-01

The severe erosion damage, which is caused by a molten lead-free solder, of wave solder equipment made into stainless steel has been encountered in operation. Then, the higher maintenance frequency and reduced life time of wave solder machine component is a serious issue in a manufacturing process. In this study, the evaluation method of erosion of stainless steel by molten lead-free solders was investigated using micro-focus X-ray systems for fluoroscopic and computed tomography (CT). As a result, it was found that the fluoroscopic image could truly reconstruct the cross-shape of the stainless steel sample after immersion test without destruction. In the case of X-ray systems for fluoroscopic and CT used in this study, three-dimensional data can be obtained. Therefore, it was possible to easily check the whole picture of the test sample after immersion test and to decide the maximum erosion depth of test sample. (author)

The UBCTM test may be useful for diagnosis of recurred urinary bladder cancer

International Nuclear Information System (INIS)

Kang, Do Young; Jung, Se Il; Hwang, Joon Seong; Gil, Myung Cheol; Yoon, Jin Han; Kim, Duk Kyu

2001-01-01

Previously we reported the usefulness of UBC TM test compared to urinary cytology for diagnosis of transitional cell carcinoma (TCC) of the bladder in patients with hematuria. Now we evaluated the usefulness of the UBC TM test for diagnosis of recurred urinary bladder cancer. 146 patients with hematuria were included in our study. UNC TM test (IDL Biotech, Sweden) were assayed in mid-stream urine according to the ordinary assay protocol. 33 patients were confirmed as TCC by cystoscopic examination and underwent transurethral resection (Group A). Other patients had various benign urinary tract conditions (Group B). Samples were considered positive as the UBC concentration was greater than 12 μ g/L. We compared UBC TM level with previous value 6 months later in patients whom diagnosed with TCC. UBC levels were significantly different between group A (95.9±166.4 μ g/L) and group B (19.2±85.6 μ g/L) (p TM test and 100% (97/97) in cytology. UBC TM test was significantly more sensitive in stage Ta. T 1 tumors (80 vs 20 %, p TM test showed tendency to be more sensitive as the stage and grade was higher (80% in Ta, 83.3% in T1 and 100% in T2, 80% in Grade I, 85.7% in Grade II and 100% in Grade III). We follow-up UBC TM test in 5 patients after 6 months. UBC TM levels and recurrence were correlated in 4 patient (80%). Follow-up levels of UBC TM were increased in two recurred patients and normalized in non-recurred patients. One patient showed increased level of UBC TM test but clinically no evidence of recurrence. Although Also our patients were small, UBC TM test may be useful method for detecting the recurrence of TCC and further follow-up is necessary

Selection of Reference Genes for qRT-PCR Analysis of Gene Expression in Stipa grandis during Environmental Stresses.

Directory of Open Access Journals (Sweden)

Dongli Wan

Full Text Available Stipa grandis P. Smirn. is a dominant plant species in the typical steppe of the Xilingole Plateau of Inner Mongolia. Selection of suitable reference genes for the quantitative real-time reverse transcription polymerase chain reaction (qRT-PCR is important for gene expression analysis and research into the molecular mechanisms underlying the stress responses of S. grandis. In the present study, 15 candidate reference genes (EF1 beta, ACT, GAPDH, SamDC, CUL4, CAP, SNF2, SKIP1, SKIP5, SKIP11, UBC2, UBC15, UBC17, UCH, and HERC2 were evaluated for their stability as potential reference genes for qRT-PCR under different stresses. Four algorithms were used: GeNorm, NormFinder, BestKeeper, and RefFinder. The results showed that the most stable reference genes were different under different stress conditions: EF1beta and UBC15 during drought and salt stresses; ACT and GAPDH under heat stress; SKIP5 and UBC17 under cold stress; UBC15 and HERC2 under high pH stress; UBC2 and UBC15 under wounding stress; EF1beta and UBC17 under jasmonic acid treatment; UBC15 and CUL4 under abscisic acid treatment; and HERC2 and UBC17 under salicylic acid treatment. EF1beta and HERC2 were the most suitable genes for the global analysis of all samples. Furthermore, six target genes, SgPOD, SgPAL, SgLEA, SgLOX, SgHSP90 and SgPR1, were selected to validate the most and least stable reference genes under different treatments. Our results provide guidelines for reference gene selection for more accurate qRT-PCR quantification and will promote studies of gene expression in S. grandis subjected to environmental stress.

Arkansas People Participating in Lead Education (APPLE): results of a lead-safe training program.

Science.gov (United States)

Ferguson, Alesia; Bursac, Zoran; Kern, David F

2011-06-01

Lead is still seen as one of the most harmful environmental toxins for young children, with the predominant source being deteriorating lead-based paint. Those at continued risk include those living in homes built before 1978, renovators and remodelers, and especially those with limited access to proper healthcare and diets. Proper training on lead-safe work practices focused on preventing and reducing the spread of lead dust can help reduce lead exposure. Presented in this paper are experiences in delivering lead-safe work practices training in six Arkansas cities, and results from pre- and post- surveys delivered before and immediately after the training. Pre- and post-surveys assess strong and weak areas of training. Participants demonstrated positive shifts in attitude and behavior towards lead-safe work practices following training. However, our research found that more emphasis should be focused on clarifying current lead exposure sources and routes for children.

Verification of radiation exposure using lead shields

International Nuclear Information System (INIS)

Hayashida, Keiichi; Yamamoto, Kenyu; Azuma, Masami

2016-01-01

A long time use of radiation during IVR (intervention radiology) treatment leads up to an increased exposure on IVR operator. In order to prepare good environment for the operator to work without worry about exposure, the authors examined exposure reduction with the shields attached to the angiography instrument, i. e. lead curtain and lead glass. In this study, the lumber spine phantom was radiated using the instrument and the radiation leaked outside with and without shields was measured by the ionization chamber type survey meter. The meter was placed at the position which was considered to be that for IVR operator, and changed vertically 20-100 cm above X-ray focus by 10 cm interval. The radiation at the position of 80 cm above X-ray focus was maximum without shield and was hardly reduced with lead curtain. However, it was reduced with lead curtain plus lead glass. Similar reduction effects were observed at the position of 90-100 cm above X-ray focus. On the other hand, the radiation at the position of 70 cm above X-ray focus was not reduced with either shield, because that position corresponded to the gap between lead curtain and lead glass. The radiation at the position of 20-60 cm above X-ray focus was reduced with lead curtain, even if without lead glass. These results show that lead curtain and lead glass attached to the instrument can reduce the radiation exposure on IVR operator. Using these shields is considered to be one of good means for IVR operator to work safely. (author)

Molecular Genetic Analysis of Somaclonal Lines Genotypes of Silver Birch and Hybrid Birch

Directory of Open Access Journals (Sweden)

A. V. Konstantinov

2014-08-01

Full Text Available Enrichment of genetic diversity by means of somaclonal variation can allow selection of individuals with increased adaptability to various unfavorable conditions. Twenty shoot cultures differing in organogenesis and morphological features were selected for two studied clones. Multilocus genetic passports of somaclonal lines were developed according to RAPD analysis. Among the samples derived from clone № 52-84/8 shoot cultures the changes in RAPD-spectra were detected over primers UBC-106 and UBC-254. In the case of clone № 6-161/3 the same changes were detected over primers UBC-268 and UBC-154. UBC-203 primer didn’t show any variation.

Usefulness of the UBCTM (urinary bladder cancer) test compared to urinary cytology for transitional cell carcinoma of the bladder in patients with hematuria

International Nuclear Information System (INIS)

Gil, Myung Cheol; Kang, Do Young; Seong, Youl Koon

2001-01-01

Urinary cytology and cystoscopic exam are effective methods for diagnosis of transitional cell carcinoma (TCC). But the former shows drawbacks such as the need for a well-trained examiner, and wide imprecision related to the variability of microscopic exam; the latter is a invasive method. UBC TM test detects the epitope on specific cytokeratin fragments released from epithelium of bladder cancer by immunoradiometric assay. We compared UBC TM test with urinary cytology for diagnosis of TCC to evaluate the utility of UBC TM test. Eighty-four patients with hematuria were included in our study, UBC TM tests (IDL Biotech, Sweden) were assayed in mid-stream urine according to the ordinary assay protocol. Nineteen patients were confirmed as TCC by cystoscopic examination and underwent transurethral resection (Group A). Other patients had various benign urinary tract conditions (Group B). Samples were considered positive as the UBC TM concentration was greater than 12 μg/L. UBC TM levels were significantly different between group A (95.9 ±166.4 μg/L) and group B (19.2 ± 85.6 μg/L)(p TM test and 100% (65/65) in cytology. UBC TM test was significantly more sensitive in stage Ta, T 1 tumors (84.6 vs 38.5%, p TM test showed a tendency to be more sensitive as the grade was higher (83.3% in Grade 1, 90% in Grade II and 100% in Grade III). UBC TM test could be a useful method in distinguishing TCC from other benign genitourinary diseases. Moreover, UBC TM test could be an especially valuable marker for diagnosis of TCC in patients with early TCC of low grade TCC compared to urinary cytology. Therefore, mbined use of UBC TM test in association with cytology is helpful to overcome the limited sensitivity of cytology

α-Synuclein expression in the mouse cerebellum is restricted to VGluT1 excitatory terminals and is enriched in unipolar brush cells.

Science.gov (United States)

Lee, Sun Kyong; Sillitoe, Roy V; Silva, Coralie; Martina, Marco; Sekerkova, Gabriella

2015-10-01

α-Synuclein has a crucial role in synaptic vesicle release and synaptic membrane recycling. Although its general expression pattern has been described in the cerebellum, the precise cerebellar structures where α-synuclein is localized are poorly understood. To address this question, we used α-synuclein immunohistochemistry in adult mice cerebellar sections. We found that α-synuclein labels glutamatergic but not glycinergic and GABAergic synaptic terminals in the molecular and granule cell layers. α-Synuclein was preferentially expressed in parallel and mossy fiber synaptic terminals that also express vesicular glutamate transporter 1 (VGluT1), while it was not detected in VGluT2-positive climbing fibers. α-Synuclein was particularly enriched in lobules IX and X, a region known to contain a high density of unipolar brush cells (UBCs). To elucidate whether the α-synuclein-positive mossy fibers belong to UBCs, we double-labeled cerebellar sections with antibodies to α-synuclein and UBC-type-specific markers (calretinin for type I and metabotropic glutamate receptor 1α (mGluR1α) for type II UBCs) and took advantage of organotypic cerebellar cultures (in which all mossy fibers are UBC axons) and moonwalker mice (in which almost all UBCs are ablated) and found that both type I and type II UBCs express α-synuclein. In moonwalker mutant cerebella, the α-synuclein/VGluT1 immunolabeling showed a dramatic decrease in the vestibulocerebellum that correlated with the absence of UBC. α-Synuclein appears to be an excellent marker for intrinsic mossy fibers of the VGluT1 subset in conjunction with UBCs of both subtypes.

Focusing on Student Performance Through Accountability. Challenge to Lead Series

Science.gov (United States)

Diaz, Alicia; Lord, Joan

2005-01-01

This report, Focusing on Student Performance Through Accountability, shows that more students, in all groups, are meeting state standards. And parents, communities and education leaders are better informed about student performance than ever before. It shows that large gaps remain in every state. If the state is to reach the No Child Left Behind…

Asthma status is associated with decreased risk of aggressive urothelial bladder cancer.

Science.gov (United States)

Rava, Marta; Czachorowski, Maciej J; Silverman, Debra; Márquez, Mirari; Kishore, Sirish; Tardón, Adonina; Serra, Consol; García-Closas, Montse; Garcia-Closas, Reina; Carrato, Alfredo; Rothman, Nathaniel; Real, Francisco X; Kogevinas, Manolis; Malats, Núria

2018-02-01

Previous studies suggested an association between atopic conditions and specific cancers. The results on the association with urothelial bladder cancer (UBC) are scarce and inconsistent. To evaluate the association between asthma and risk of UBC, we considered 936 cases and 1,022 controls from the Spanish Bladder Cancer/EPICURO Study (86% males, mean age 65.4 years), a multicenter and hospital-based case-control study conducted during 1998-2001. Participants were asked whether they had asthma and detailed information about occupational exposures, smoking habits, dietary factors, medical conditions and history of medication was collected through face-to-face questionnaires performed by trained interviewers. Since asthma and UBC might share risk factors, association between patients' characteristics and asthma was studied in UBC controls. Association between UBC and asthma was assessed using logistic regression unadjusted and adjusted for potential confounders. The complex interrelationships, direct and mediating effect of asthma on UBC, were appraised using counterfactual mediation models. Asthma was associated with a reduced risk of UBC (odds ratio (OR) = 0.54, 95% confidence interval (CI) 0.37, 0.79) after adjusting for a wide range of confounders. No mediating effect was identified. The reduced risk associated with asthma was restricted to patients with high-risk non-muscle invasive (OR = 0.25, 95%CI 0.10, 0.62) and muscle invasive UBC (OR = 0.32, 95%CI 0.15, 0.69). Our results support that asthma is associated with a decreased risk of UBC, especially among aggressive tumors. Further work on the relationship between asthma and other atopic conditions and cancer risk should shed light on the relationship between immune response mechanisms and bladder carcinogenesis. © 2017 UICC.

Degradation signals for ubiquitin system proteolysis in Saccharomyces cerevisiae.

Science.gov (United States)

Gilon, T; Chomsky, O; Kulka, R G

1998-01-01

Combinations of different ubiquitin-conjugating (Ubc) enzymes and other factors constitute subsidiary pathways of the ubiquitin system, each of which ubiquitinates a specific subset of proteins. There is evidence that certain sequence elements or structural motifs of target proteins are degradation signals which mark them for ubiquitination by a particular branch of the ubiquitin system and for subsequent degradation. Our aim was to devise a way of searching systematically for degradation signals and to determine to which ubiquitin system subpathways they direct the proteins. We have constructed two reporter gene libraries based on the lacZ or URA3 genes which, in Saccharomyces cerevisiae, express fusion proteins with a wide variety of C-terminal extensions. From these, we have isolated clones producing unstable fusion proteins which are stabilized in various ubc mutants. Among these are 10 clones whose products are stabilized in ubc6, ubc7 or ubc6ubc7 double mutants. The C-terminal extensions of these clones, which vary in length from 16 to 50 amino acid residues, are presumed to contain degradation signals channeling proteins for degradation via the UBC6 and/or UBC7 subpathways of the ubiquitin system. Some of these C-terminal tails share similar sequence motifs, and a feature common to almost all of these sequences is a highly hydrophobic region such as is usually located inside globular proteins or inserted into membranes. PMID:9582269

The mechanism of OTUB1-mediated inhibition of ubiquitination

Energy Technology Data Exchange (ETDEWEB)

Wiener, Reuven; Zhang, Xiangbin; Wang, Tao; Wolberger, Cynthia (JHU)

2013-04-08

Histones are ubiquitinated in response to DNA double-strand breaks (DSB), promoting recruitment of repair proteins to chromatin. UBC13 (also known as UBE2N) is a ubiquitin-conjugating enzyme (E2) that heterodimerizes with UEV1A (also known as UBE2V1) and synthesizes K63-linked polyubiquitin (K63Ub) chains at DSB sites in concert with the ubiquitin ligase (E3), RNF168 (ref. 3). K63Ub synthesis is regulated in a non-canonical manner by the deubiquitinating enzyme, OTUB1 (OTU domain-containing ubiquitin aldehyde-binding protein 1), which binds preferentially to the UBC13-Ub thiolester. Residues amino-terminal to the OTU domain, which had been implicated in ubiquitin binding, are required for binding to UBC13-Ub and inhibition of K63Ub synthesis. Here we describe structural and biochemical studies elucidating how OTUB1 inhibits UBC13 and other E2 enzymes. We unexpectedly find that OTUB1 binding to UBC13-Ub is allosterically regulated by free ubiquitin, which binds to a second site in OTUB1 and increases its affinity for UBC13-Ub, while at the same time disrupting interactions with UEV1A in a manner that depends on the OTUB1 N terminus. Crystal structures of an OTUB1-UBC13 complex and of OTUB1 bound to ubiquitin aldehyde and a chemical UBC13-Ub conjugate show that binding of free ubiquitin to OTUB1 triggers conformational changes in the OTU domain and formation of a ubiquitin-binding helix in the N terminus, thus promoting binding of the conjugated donor ubiquitin in UBC13-Ub to OTUB1. The donor ubiquitin thus cannot interact with the E2 enzyme, which has been shown to be important for ubiquitin transfer. The N-terminal helix of OTUB1 is positioned to interfere with UEV1A binding to UBC13, as well as with attack on the thiolester by an acceptor ubiquitin, thereby inhibiting K63Ub synthesis. OTUB1 binding also occludes the RING E3 binding site on UBC13, thus providing a further component of inhibition. The general features of the inhibition mechanism explain how OTUB1

Risk of bladder cancer in patients with diabetes

DEFF Research Database (Denmark)

Goossens, Maria E; Zeegers, Maurice P; Bazelier, Marloes T

2015-01-01

Statistics (ONS). Patients diagnosed with diabetes mellitus type 1 or 2, or using antidiabetic drugs (ADDs), were compared to matched non-diabetic controls. Cox proportional hazards models were used to estimate the risk and mortality of UBC. We adjusted for age, sex, smoking status and body mass index....... RESULTS: The cohort included 329,168 patients using ADD, and 307,315 controls with 1295 and 1071 patients, respectively, diagnosed as having UBC during follow-up. The adjusted HRs of UBC were 0.77 (95% CI 0.57 to 1.05) and 1.04 (95% CI 0.96 to 1.14) for type 1 and 2 diabetes, respectively. These results...... haemoglobin. Mortality of UBC was not increased for patients with either type 1 (HR=0.95 (95% CI 0.39 to 2.34)) or type 2 diabetes (HR=1.16 (95% CI 0.91 to 1.46)). CONCLUSIONS: Neither the risk of UBC nor the mortality from UBC was increased in patients with type 1 and patients with type 2 diabetes...

Exaggerated inflammatory response after use of recombinant bone morphogenetic protein in recurrent unicameral bone cysts.

Science.gov (United States)

MacDonald, Kevin M; Swanstrom, Morgan M; McCarthy, James J; Nemeth, Blaise A; Guliani, Teresa A; Noonan, Kenneth J

2010-03-01

Recurrent unicameral bone cysts (UBCs) can result in significant morbidity during a child's physical and emotional development. Multiple treatment options are available and a review of the literature fails to clearly define the optimal treatment for UBCs. Recombinant bone morphogenetic protein (BMP) has been used with success in other disorders of poor bone formation. This manuscript is the first to report on the use of recombinant BMP in the treatment of UBCs. Three patients with recurrent UBCs underwent revision surgery with recombinant BMP. Radiographic and medical review was performed and is reported here. In these patients, the use of BMP failed to fully resolve their UBC; 2 patients had complete recurrence that required further surgery. In addition to poor radiographic results, all patients developed exaggerated inflammatory responses in the acute postoperative period. Each child developed clinically significant limb swelling and pain that mimicked infection. On the basis of our poor radiographic results and a paradoxical clinical result, we no longer recommend the use of recombinant BMP in the manner reported here for the treatment of recurrent UBCs. Level IV, case series.

Lead user projects in practice

DEFF Research Database (Denmark)

Brem, Alexander; Gutstein, Adele

2018-01-01

Earlier research on the lead user method is focused on individual case studies and how the method was applied in a specific context. In this paper, we take a broader approach, analyzing a sample of 24 lead user projects, which included working with 188 lead users. These projects were analyzed...

ALICE: Simulated lead-lead collision

CERN Multimedia

2003-01-01

This track is an example of simulated data modelled for the ALICE detector on the Large Hadron Collider (LHC) at CERN, which will begin taking data in 2008. ALICE will focus on the study of collisions between nuclei of lead, a heavy element that produces many different particles when collided. It is hoped that these collisions will produce a new state of matter known as the quark-gluon plasma, which existed billionths of a second after the Big Bang.

The refining of secondary lead for use in advanced lead-acid batteries

International Nuclear Information System (INIS)

Ellis, Timothy W.; Mirza, Abbas H.

2010-01-01

Secondary lead, i.e. material produced by the recycling of lead-acid batteries has become the primary source of lead in much of the world. This has been important to the secondary lead industry as other uses have dwindled, e.g. lead based pigments, chemicals, fuel additives, solders and CRT glasses. Presently, battery manufacturing accounts for greater than 80% of lead consumption while recycled lead accounts for approximately the same market share of lead supply. These two facts strongly demonstrate the battery manufacturing and recycled lead are intimately coupled in everyday life. In this paper we will explore how recycled lead has become the material of choice for battery construction through the development of a recovery and refining process that exceeds the industries requirements. Particular focus will be on addressing the results presented by Prengaman on the effects of contaminant or tramp elements on gassing in lead-acid batteries. (author)

Improving Performance: Leading from the Bottom. PISA in Focus. No. 2

Science.gov (United States)

OECD Publishing (NJ1), 2011

2011-01-01

Since the PISA (Programme for International Student Assessment) 2000 and 2009 surveys both focused on reading, one can track in detail how student reading performance has changed over that period. Among the 26 OECD (Organisation for Economic Cooperation and Development) countries with comparable results in both assessments, Chile, Germany,…

Risk of urinary bladder cancer: a case-control analysis of industry and occupation

Directory of Open Access Journals (Sweden)

Wu Xifeng

2009-12-01

Full Text Available Abstract Background Uncertainty remains about urinary bladder cancer (UBC risk for many occupations. Here, we investigate the association between occupation, industry and UBC. Methods Lifetime occupational history was collected by in-person interview for 604 newly diagnosed UBC patients and 604 cancer-free controls. Each job title was assigned a two-digit industry code and a three-digit occupation code. Odds ratios (ORs for UBC associated with ever being employed in an industry or occupation were calculated by unconditional logistic regression adjusting for age, gender and smoking status. We also examined UBC risk by duration of employment (>0 to Results Significantly increased risk of UBC was observed among waiters and bartenders (OR 2.87; 95% CI 1.05 to 7.72 and occupations related to medicine and health (OR 2.17; 95% CI 1.21 to 3.92, agricultural production, livestock and animal specialties (OR 1.90; 95% CI 1.03 to 3.49, electrical assembly, installation and repair (OR 1.69; 95% CI 1.07 to 2.65, communications (OR 1.74; 95% CI 1.00 to 3.01, and health services (OR 1.58; 95% CI 1.02 to 2.44. For these occupations we also observed a significant excess risk of UBC for long-term work (i.e. ≥10 years, with the exception of waiters and bartenders. Employment for 10 years or more was associated with increased risk of UBC in general farmers (OR 9.58; 95% CI 2.18 to 42.05, agricultural production of crops (OR 3.36; 95% CI 1.10 to 10.27, occupations related to bench working (OR 4.76; 95% CI 1.74 to 13.01, agricultural, fishery, forestry & related (OR 4.58; 95% CI 1.97 to 10.65, transportation equipment (OR 2.68; 95% CI 1.03 to 6.97, and structural work (OR 1.85; 95% CI 1.16 to 2.95. Conclusions This study provides evidence of increased risk of UBC for occupations that were previously reported as at-risk. Workers in several occupation and industry groups have a significantly higher risk of UBC, particularly when duration of employment is 10 years or

Comparison of three surgical treatment options for unicameral bone cysts in humerus.

Science.gov (United States)

Mavčič, Blaž; Saraph, Vinay; Gilg, Magdalena M; Bergovec, Marko; Brecelj, Janez; Leithner, Andreas

2018-04-23

Treatment of unicameral bone cysts (UBC) in the humerus with drainage screws is scarcely reported in the literature. The aim of this retrospective study was to compare drainage screws and alternative treatment methods with respect to the number of required surgical procedures to achieve sufficient UBC healing, postoperative fractures/recurrences/complications, and radiological outcome. Medical archives of two tertiary orthopedic referral centers were screened for all patients who were treated surgically for humeral UBC in the period 1991-2015 with a histologically/cytologically confirmed diagnosis. Sex, age, all surgical procedures, fractures, complications, recurrences, and the final radiological outcome were compared between patients treated with drainage screws, elastic intramedullary nails, or curettage with optional grafting. The study included 106 operated patients with a mean age of 10.3 years, with a mean follow-up of 5.7 years. The average number of UBC-related surgical procedures in sex-matched and age-matched treatment groups was 2.7 with drainage screws, 2.8 with intramedullary nails, and 3.5 with curettage/grafting (P=0.54). Intramedullary nails (odds ratio 0.20) and older age (odds ratio for each year 0.83) predicted a lower risk of postoperative UBC recurrence. Patients with drainage screws had the highest UBC recurrence rates and the lowest rates of changed initial treatment method. There was no difference between the treatment groups in the postoperative fracture rate, complications, or the final radiological outcome. UBC treatment in the humerus therefore requires approximately three surgical procedures, irrespective of the treatment modality chosen. Adding an elastic intramedullary nail to a humeral UBC cyst may reduce recurrence risk and prevent further fractures. Level III - therapeutic retrospective comparative study.

UBC-Nepal expedition

DEFF Research Database (Denmark)

Hansen, Alexander B; Hoiland, Ryan L; Lewis, Nia C S

2018-01-01

the course of acclimatization to the hypoxia of terrestrial high altitude has not been examined. Thus, the purpose of the present study was to examine the influence of orally ingested antioxidants at clinically relevant doses (vitamins C and E and α-lipoic acid) on cerebrovascular regulation at sea level...... (344 m; n = 12; female n = 2 participants) and at high altitude (5050 m; n = 9; female n = 2) in a randomized, placebo-controlled and double-blinded crossover design. Hypercapnic and hypoxic cerebrovascular reactivity tests of the internal carotid artery (ICA) were conducted at sea level, and global...... that an oral antioxidant cocktail known to attenuate systemic oxidative stress failed to alter cerebrovascular function at sea level and CBF during acclimatization to high altitude....

Unicameral Bone Cysts in the Humerus: Treatment Outcomes.

Science.gov (United States)

Kadhim, Muayad; Sethi, Samir; Thacker, Mihir M

2016-06-01

Several treatment modalities have been described for the treatment of unicameral bone cysts (UBC). The aim of this study was to examine the outcome of various treatment modalities of UBC in a specific anatomic location, the humerus. This study is a retrospective case-only study of patients with humeral UBC with minimum follow-up of 1 year. Medical records and radiographs were assessed and UBC healing status was determined based on most recent follow-up radiographs and divided into 3 groups (healed, partially healed, and not healed). Descriptive statistics were utilized to summarize study outcome. Sixty-eight patients (54 boys and 14 girls) with humeral UBC comprised the study population. Sixty-four cases (94.1%) presented with a pathologic fracture. Fifty-one cases were in the proximal metaphysis and 17 were in the diaphysis. Mean age at diagnosis was 9.2±3.7 years, and mean follow-up was 4.0±2.6 years. Twenty-five patients were treated with observation, 38 by injection (27 with steroids and 11 with bone marrow), and 5 by open surgery. Patients who underwent open surgery had relatively larger cyst length, width, and cyst index, and all healed or partially healed at last follow-up. UBC persistence was observed in 29% of diaphyseal and 27.5% of metaphyseal cysts. Of the 19 patients with persistence, 8 were treated with observation, 9 with steroid injection, and 2 with bone marrow injection. Inner wall disruption before injection was performed in 17 patients (24% did not heal), whereas 21 patients did not have inner wall disruption (33% did not heal). Twenty patients received >1 injection. Eleven patients complained of pain at the last visit (8 had a persistent cyst, 2 were partially healed, and 1 had a healed UBC). Complete healing of humeral UBC is challenging to achieve irrespective of treatment modality. UBCs treated with open surgery tended to heal better. Unhealed cysts were more likely to be associated with pain. Level III-a retrospective comparative study.

Enactment of one-to-many communication may induce self-focused attention that leads to diminished perspective taking: The case of Facebook

Directory of Open Access Journals (Sweden)

Wen-Bin Chiou

2013-05-01

Full Text Available Social networking sites (SNSs provide users with an efficient interface for distributing information, such as photos or wall posts, to many others simultaneously. We demonstrated experimentally that this type of indiscriminate one-to-many (i.e., monologue communication may induce self-focused attention and thereby impair perspective taking. The present study used multiple paradigms to explore the link between engaging in online one-to-many communication and a decrease in perspective taking. Experiment 1 revealed that Facebookers who published a personal photo to the public or their friends were less likely to adopt another person's visual perspective than were those in the control group. Experiment 2 showed that Facebookers who engaged in indiscriminate one-to-many wall posting were more likely than those in the control group to rely heavily on their own perspectives. A state of self-focus, as measured by greater Stroop interference in naming the color of self-relevant versus neutral words, mediated the detrimental effect of indiscriminate one-to-many communication on cognitive perspective taking. These findings suggest that indiscriminate one-to-many communication on SNSs may promote public self-focus, leading to self-referential processing when making social judgments. Online monologue communication may be more harmful to perspective taking than previously understood.

The prognostic value of family history among patients with urinary bladder cancer.

Science.gov (United States)

Egbers, Lieke; Grotenhuis, Anne J; Aben, Katja K; Alfred Witjes, J; Kiemeney, Lambertus A; Vermeulen, Sita H

2015-03-01

A history of urinary bladder cancer (UBC) in first-degree relatives increases UBC risk by twofold. The influence of positive family history on UBC prognosis is unknown. Here, we investigated association of first-degree UBC family history with clinicopathological characteristics and prognosis of UBC patients. Detailed clinical data of 1,465 non-muscle-invasive bladder cancer (NMIBC) and 250 muscle-invasive or metastatic bladder cancer (MIBC) patients, diagnosed from 1995 to 2010, were collected through medical file review. Competing risk analyses were used to compare recurrence-free survival (RFS) and progression-free survival (PFS) of NMIBC patients according to self-reported UBC family history. Overall survival in MIBC patients was estimated using Kaplan-Meier analysis. The added value of family history in prediction of NMIBC prognosis was quantified with Harrell's concordance-index. Hundred (6.8%) NMIBC and 14 (5.6%) MIBC patients reported UBC in first-degree relatives. Positive family history was statistically significantly associated with smaller tumor size and non-significantly with more favorable distribution of other tumor characteristics. In univariable analyses, positive family history correlated with longer RFS (p = 0.11) and PFS (p = 0.04). Hazard ratios for positive vs. negative family history after adjustment for clinicopathological characteristics were 0.75 (95% CI = 0.53-1.07) and 0.45 (95% CI = 0.18-1.12) for RFS and PFS, respectively. Five familial and 48 sporadic MIBC patients (Kaplan-Meier 10-year risk: 41% and 25%) died within 10 years. Family history did not improve the c-index of prediction models. This study shows that a first-degree family history of UBC is not clearly associated with NMIBC prognosis. Family history does not aid in prediction of NMIBC recurrence or progression. © 2014 The Authors. Published by Wiley Periodicals, Inc. on behalf of UICC.

The dual effects of leading for safety: The mediating role of employee regulatory focus.

Science.gov (United States)

Kark, Ronit; Katz-Navon, Tal; Delegach, Marianna

2015-09-01

This study examined the underlying mechanisms through which transformational and transactional leadership influence employee safety behaviors. Linking leadership theory with self-regulatory focus (SRF) theory, we examined a model of dual effects of leadership on safety initiative and safety compliance behaviors as mediated by promotion and prevention self-regulations. We conducted an experimental study (N = 107), an online study (N = 99) and a field study (N = 798 employees and 49 managers). Results demonstrated that followers' situational promotion focus mediated the positive relationship between transformational leadership and safety initiative behaviors. Through all 3 studies, transactional active leadership was positively associated with followers' situational prevention focus, however, the association between followers' prevention focus and safety compliance behaviors was inconsistent, showing the expected mediation relationships in the experimental setting, but not in the online and field studies. We discuss theoretical and practical implications of the findings. (c) 2015 APA, all rights reserved).

Lead user projects in practice

DEFF Research Database (Denmark)

Brem, Alexander; Gutstein, Adele

2018-01-01

Earlier research on the lead user method is focused on individual case studies and how the method was applied in a specific context. In this paper, we take a broader approach, analyzing a sample of 24 lead user projects, which included working with 188 lead users. These projects were analyzed....... Moreover, crowdsourcing contests and netnography proved to be of significant value for the need, trend, and lead user identification phases. This paper concludes by discussing theoretical and practical implications, the limitations of this study, and recommendations for future studies....

Case report: unicameral bone cysts in a young patient with acquired generalized lipodystrophy.

Science.gov (United States)

Gregory, James M; Arkader, Alexandre; Bokhari, Aqiba; Bothari, Aqiba; Dormans, John P

2010-05-01

We report the case of a 13-year-old boy with bilateral distal femoral unicameral bone cysts (UBCs) associated with acquired generalized lipodystrophy. As opposed to congenital generalized lipodystrophy, cystic bone lesions in acquired generalized lipodystrophy are rare. After radiographic and histologic confirmation of the UBCs, we performed percutaneous intramedullary decompression, curettage, and grafting. UBCs can be an important manifestation of acquired generalized lipodystrophy. Cystic bone lesions appear to be less common in acquired generalized lipodystrophy than in congenital generalized lipodystrophy, and intramedullary adipose tissue loss may be a predisposing factor for the development of bone lesions in patients with acquired generalized lipodystrophy. When evaluating a patient with lipodystrophy, doctors should recognize the clinical course may include the development of UBCs.

Unicameral Bone Cyst in the Calcaneus of Mirror Image Twins.

Science.gov (United States)

Lenze, Ulrich; Stolberg-Stolberg, Josef; Pohlig, Florian; Lenze, Florian; von Eisenhart-Rothe, Rüdiger; Rechl, Hans; Toepfer, Andreas

2015-01-01

Unicameral bone cysts (UBCs) are benign tumor-like lesions that commonly occur in the diaphyseal or metaphyseal region of the long bones within the first 2 decades of life. Until today, the pathogenesis of UBC has been unclear, but mechanisms such as vascular occlusion or a response to trauma have been supposed. During the past decade, in particular, the genetic aspects of the development of this rare lesion have been discussed. We present the first case of mirror image monozygotic twins with a mirror image UBC of the calcaneus. Our findings reinforce the importance of additional studies to understand the significance of cytogenetic factors in the etiology of UBC. Copyright © 2015 American College of Foot and Ankle Surgeons. Published by Elsevier Inc. All rights reserved.

A Highly Expressed High-Molecular-Weight S-Layer Complex of Pelosinus sp. Strain UFO1 Binds Uranium

Energy Technology Data Exchange (ETDEWEB)

Thorgersen, Michael P. [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology; Lancaster, W. Andrew [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology; Rajeev, Lara [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Systems and Engineering Division; Ge, Xiaoxuan [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology; Vaccaro, Brian J. [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology; Poole, Farris L. [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology; Arkin, Adam P. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Systems and Engineering Division; Mukhopadhyay, Aindrila [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Biological Systems and Engineering Division; Adams, Michael W. W. [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemistry and Molecular Biology

2016-12-02

Cell suspensions of Pelosinus sp. strain UFO1 were previously shown, using spectroscopic analysis, to sequester uranium as U(IV) complexed with carboxyl and phosphoryl group ligands on proteins. The goal of our present study was to characterize the proteins involved in uranium binding. Virtually all of the uranium in UFO1 cells was associated with a heterodimeric protein, which was termed the uranium-binding complex (UBC). The UBC was composed of two S-layer domain proteins encoded by UFO1_4202 and UFO1_4203. Samples of UBC purified from the membrane fraction contained 3.3 U atoms/heterodimer, but significant amounts of phosphate were not detected. The UBC had an estimated molecular mass by gel filtration chromatography of 15 MDa, and it was proposed to contain 150 heterodimers (UFO1_4203 and UFO1_4202) and about 500 uranium atoms. The UBC was also the dominant extracellular protein, but when purified from the growth medium, it contained only 0.3 U atoms/heterodimer. The two genes encoding the UBC were among the most highly expressed genes within the UFO1 genome, and their expressions were unchanged by the presence or absence of uranium. Therefore, the UBC appears to be constitutively expressed and is the first line of defense against uranium, including by secretion into the extracellular medium. Although S-layer proteins were previously shown to bind U(VI), here we showed that U(IV) binds to S-layer proteins, we identified the proteins involved, and we quantitated the amount of uranium bound. Widespread uranium contamination from industrial sources poses hazards to human health and to the environment. Here in this paper, we identified a highly abundant uranium-binding complex (UBC) from Pelosinus sp. strain UFO1. The complex makes up the primary protein component of the S-layer of strain UFO1 and binds 3.3 atoms of U(IV) per heterodimer. Finally, while other bacteria have been shown to bind U(VI) on their S-layer, we demonstrate here an example of U(IV) bound by

Treatment of unicameral bone cyst: systematic review and meta analysis.

Science.gov (United States)

Kadhim, Muayad; Thacker, Mihir; Kadhim, Amjed; Holmes, Laurens

2014-03-01

Different treatment modalities have been utilized to treat unicameral bone cyst (UBC), but evidence has not been fully described to support one treatment over another and the optimal treatment is controversial. The aim of this quantitative systematic review was to assess the effectiveness of different UBC treatment modalities. We utilized Pubmed to isolate retrospective studies on patients with UBC who received any kind of treatment. The included studies needed to have a minimum sample size of 15 patients, and have provided data on radiographic healing outcome. Sixty-two articles were selected for the meta-analysis from a total of 463 articles. The cumulative sample size was 3,211 patients with 3,217 UBC, and male to female ratio was 2.2:1. The summary or pool estimate of methylprednisolone acetate (MPA) injection resulted in a healing rate of (77.4 %) that was comparable to bone marrow injection (77.9 %). A higher healing rate was observed with MPA injection when inner wall disruption was performed. The pool estimate of bone marrow with demineralized bone matrix injection was high (98.7 %). UBC healing rate after surgical curettage was comparable whether autograft or allograft was utilized (90 %). UBC treatment with flexible intramedullary nails without curettage provided almost 100% healing rate, while continuous decompression with cannulated screws provided 89 % healing rate. Conservative treatment indicated a healing rate of 64.2, 95 % CI (26.7-101.8). Active treatment for UBC provided variable healing rates and the outcomes were favorable relative to conservative treatment. Due to the heterogeneity of the studies and reporting bias, the interpretation of these findings should be handled with caution.

Can You Lead Me Now? Leading in the Complex World of Homeland Security

National Research Council Canada - National Science Library

Joyce, Nola

2007-01-01

This thesis focuses on a theory of leading and the activities and processes used to move a bureaucratic, public agency to a higher level of fitness in the contexts of dynamic equilibrium and the edge of chaos...

CDM Project Opportunities in Thailand

DEFF Research Database (Denmark)

2009-01-01

Interview on Channel 2 UBC Thailand Fysisk medie: .dat mpeg video file Tidspunkt for udsendelse: 2003/06/28......Interview on Channel 2 UBC Thailand Fysisk medie: .dat mpeg video file Tidspunkt for udsendelse: 2003/06/28...

Decontamination & decommissioning focus area

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-08-01

In January 1994, the US Department of Energy Office of Environmental Management (DOE EM) formally introduced its new approach to managing DOE`s environmental research and technology development activities. The goal of the new approach is to conduct research and development in critical areas of interest to DOE, utilizing the best talent in the Department and in the national science community. To facilitate this solutions-oriented approach, the Office of Science and Technology (EM-50, formerly the Office of Technology Development) formed five Focus AReas to stimulate the required basic research, development, and demonstration efforts to seek new, innovative cleanup methods. In February 1995, EM-50 selected the DOE Morgantown Energy Technology Center (METC) to lead implementation of one of these Focus Areas: the Decontamination and Decommissioning (D & D) Focus Area.

Genome-Wide Identification, Phylogenetic and Expression Analyses of the Ubiquitin-Conjugating Enzyme Gene Family in Maize

Science.gov (United States)

Jue, Dengwei; Sang, Xuelian; Lu, Shengqiao; Dong, Chen; Zhao, Qiufang; Chen, Hongliang; Jia, Liqiang

2015-01-01

Background Ubiquitination is a post-translation modification where ubiquitin is attached to a substrate. Ubiquitin-conjugating enzymes (E2s) play a major role in the ubiquitin transfer pathway, as well as a variety of functions in plant biological processes. To date, no genome-wide characterization of this gene family has been conducted in maize (Zea mays). Methodology/Principal Findings In the present study, a total of 75 putative ZmUBC genes have been identified and located in the maize genome. Phylogenetic analysis revealed that ZmUBC proteins could be divided into 15 subfamilies, which include 13 ubiquitin-conjugating enzymes (ZmE2s) and two independent ubiquitin-conjugating enzyme variant (UEV) groups. The predicted ZmUBC genes were distributed across 10 chromosomes at different densities. In addition, analysis of exon-intron junctions and sequence motifs in each candidate gene has revealed high levels of conservation within and between phylogenetic groups. Tissue expression analysis indicated that most ZmUBC genes were expressed in at least one of the tissues, indicating that these are involved in various physiological and developmental processes in maize. Moreover, expression profile analyses of ZmUBC genes under different stress treatments (4°C, 20% PEG6000, and 200 mM NaCl) and various expression patterns indicated that these may play crucial roles in the response of plants to stress. Conclusions Genome-wide identification, chromosome organization, gene structure, evolutionary and expression analyses of ZmUBC genes have facilitated in the characterization of this gene family, as well as determined its potential involvement in growth, development, and stress responses. This study provides valuable information for better understanding the classification and putative functions of the UBC-encoding genes of maize. PMID:26606743

Unicameral (simple) and aneurysmal bone cysts: the effect of insufficient curettage on recurrence.

Science.gov (United States)

Çelik, Suat; Uludağ, Abuzer; Tosun, Hacı Bayram; Serbest, Sancar; Gürger, Murat; Kılıç, Sabahattin

2016-01-01

Curettage of the cyst and bone grafting are the most common methods used in the treatment of unicameral bone cysts (UBC) and aneurysmal bone cysts (ABC). Recurrence of these cysts is often associated with insufficient curettage of the cyst during surgery. In this study, we aimed to evaluate the effect of insufficient curettage on recurrence in patients with UBC and ABC. The retrospective study included 18 patients with UBC and 14 patients with ABC that were surgically treated by curettage and bone grafting in our clinic between 2006-2013. Mean age was 19.80 (range, 4-50) years in the patients with UBC and 21.76 (range, 4-56) in the patients with ABC. The diagnosis of the cysts was established both clinically and radiologically. Mean follow-up period was 36 (range, 6-60) months both in the patients with UBC and ABC. The patients with recurrence underwent a second curettage and grafting procedure. Healing and recurrence were evaluated according to modified Neer's scale. Recurrence occurred in 8 patients. Of these, 5 patients underwent a second curettage and grafting procedure and 3 patients were lost to follow-up. Complete healing occurred in all the patients that underwent a second curettage and grafting procedure. The achievement of complete healing in the patients that underwent a second curettage and grafting procedure indicates that the recurrence of UBC and ABC is associated with insufficient curettage.

Clinical factors affecting pathological fracture and healing of unicameral bone cysts.

Science.gov (United States)

Urakawa, Hiroshi; Tsukushi, Satoshi; Hosono, Kozo; Sugiura, Hideshi; Yamada, Kenji; Yamada, Yoshihisa; Kozawa, Eiji; Arai, Eisuke; Futamura, Naohisa; Ishiguro, Naoki; Nishida, Yoshihiro

2014-05-17

Unicameral bone cyst (UBC) is the most common benign lytic bone lesion seen in children. The aim of this study is to investigate clinical factors affecting pathological fracture and healing of UBC. We retrospectively reviewed 155 UBC patients who consulted Nagoya musculoskeletal oncology group hospitals in Japan. Sixty of the 155 patients had pathological fracture at presentation. Of 141 patients with follow-up periods exceeding 6 months, 77 were followed conservatively and 64 treated by surgery. The fracture risk was significantly higher in the humerus than other bones. In multivariate analysis, ballooning of bone, cyst in long bone, male sex, thin cortical thickness and multilocular cyst were significant adverse prognostic factors for pathological fractures at presentation. The healing rates were 30% and 83% with observation and surgery, respectively. Multivariate analysis revealed that fracture at presentation and history of biopsy were good prognostic factors for healing of UBC in patients under observation. The present results suggest that mechanical disruption of UBC such as fracture and biopsy promotes healing, and thus watchful waiting is indicated in these patients, whereas patients with poor prognostic factors for fractures should be considered for surgery.

Telomerase reverse transcriptase promoter mutations in bladder cancer

DEFF Research Database (Denmark)

Allory, Yves; Beukers, Willemien; Sagrera, Ana

2014-01-01

for detection of recurrences in urine in patients with urothelial bladder cancer (UBC). DESIGN, SETTING, AND PARTICIPANTS: A set of 111 UBCs of different stages was used to assess TERT promoter mutations by Sanger sequencing and TERT messenger RNA (mRNA) expression by reverse transcription...... surveillance after diagnosis of non-muscle-invasive UBC (n=194), was tested using a SNaPshot assay. OUTCOME MEASUREMENTS AND STATISTICAL ANALYSIS: Association of mutation status with age, sex, tobacco, stage, grade, fibroblast growth factor receptor 3 (FGFR3) mutation, progression-free survival, disease...... frequent among FGFR3 mutant tumors (p=0.0002). There was no association between TERT mutations and mRNA expression (p=0.3). Mutations were not associated with clinical outcome. In urine, TERT mutations had 90% specificity in subjects with hematuria but no bladder tumor, and 73% in recurrence-free UBC...

Energy efficient technologies for the mining industry

Energy Technology Data Exchange (ETDEWEB)

Klein, B.; Bamber, A.; Weatherwax, T.; Dozdiak, J.; Nadolski, S.; Roufail, R.; Parry, J.; Roufail, R.; Tong, L.; Hall, R. [British Columbia Univ., Vancouver, BC (Canada). Centre for Environmental Research in Minerals, Metals and Materials, Norman B. Keevil Inst. of Mining Engineering

2010-07-01

Mining in British Columbia is the second largest industrial electricity consumer. This presentation highlighted methods to help the mining industry reduce their energy requirements by limiting waste and improving efficiency. The measures are aimed at optimizing energy-use and efficiency in mining and processing and identifying opportunities and methods of improving this efficiency. Energy conservation in comminution and beneficiation is a primary focus of research activities at the University of British Columbia (UBC). The objective is to reduce energy usage in metal mines by 20 per cent overall. Open pit copper, gold and molybdenum mines are being targeted. Projects underway at UBC were outlined, with particular reference to energy usage, recovery and alternative energy sources; preconcentration; reducing energy usage from comminution in sorting, high pressure grinding rolls and high speed stirred mills; Hydromet; other energy efficient technologies such as control and flotation; and carbon dioxide sequestration. Studies were conducted at various mining facilities, including mines in Sudbury, Ontario. tabs., figs.

Lead-free piezoelectric materials and ultrasonic transducers for medical imaging

Directory of Open Access Journals (Sweden)

Elaheh Taghaddos

2015-06-01

Full Text Available Piezoelectric materials have been vastly used in ultrasonic transducers for medical imaging. In this paper, firstly, the most promising lead-free compositions with perovskite structure for medical imaging applications have been reviewed. The electromechanical properties of various lead-free ceramics, composites, and single crystals based on barium titanate, bismuth sodium titanate, potassium sodium niobate, and lithium niobate are presented. Then, fundamental principles and design considerations of ultrasonic transducers are briefly described. Finally, recent developments in lead-free ultrasonic probes are discussed and their acoustic performance is compared to lead-based transducers. Focused transducers with different beam focusing methods such as lens focusing and mechanical shaping are explained. Additionally, acoustic characteristics of lead-free probes including the pulse-echo results as well as their imaging capabilities for various applications such as phantom imaging, in vitro intravascular ultrasound imaging of swine aorta, and in vivo or ex vivo imaging of human eyes and skin are reviewed.

Elastic stable intramedullary nailing is the best treatment of unicameral bone cysts of the long bones in children?: Prospective long-term follow-up study.

Science.gov (United States)

de Sanctis, Nando; Andreacchio, Antonio

2006-01-01

Since Virchow first described the unicameral bone cyst (UBC) in 1876, several methods for management were proposed. Currently performed surgical procedures include curettage combined with bone grafting, allografting with freeze-dried crushed cortical bone, use of homologous cancellous bone chips, the application of high-porosity hydroxyapatite, and cryosurgery. Decompression with multiple drill holes and intralesional injections of either steroids or bone marrow have also been used to treat UBC, with variable success rates. Elastic stable intramedullary nailing for the treatment of UBC in long bones has been rapidly gaining popularity. Elastic stable intramedullary nailing for the treatment of a UBC was performed in 56 patients between 1994 and 2003. The follow-up is between 2.1 and 11 years. Nine children were excluded because of short period of follow-up or were lost. The study population consisted of 47 children. The cyst was located in the humerus in 36 patients, in the femur in 11. The mean age of the patients at the time of surgery was 8.9 years. Results were evaluated on plain radiographs according to the classification system of Capanna et al. In our study population of 47 UBCs, 31 (65.9 %) were classified as completely healed, and 16 (34.1%) were healed with residual radiolucency. No recurrence or no response was observed. Each lesion responded to treatment after the nailing. This method can solve in time the pathology, and we feel that, with skilled hands, this method is the best one for UBC treatment in the long bones of the children.

Leading healthcare in complexity.

Science.gov (United States)

Cohn, Jeffrey

2014-12-01

Healthcare institutions and providers are in complexity. Networks of interconnections from relationships and technology create conditions in which interdependencies and non-linear dynamics lead to surprising, unpredictable outcomes. Previous effective approaches to leadership, focusing on top-down bureaucratic methods, are no longer effective. Leading in complexity requires leaders to accept the complexity, create an adaptive space in which innovation and creativity can flourish and then integrate the successful practices that emerge into the formal organizational structure. Several methods for doing adaptive space work will be discussed. Readers will be able to contrast traditional leadership approaches with leading in complexity. They will learn new behaviours that are required of complexity leaders, along with challenges they will face, often from other leaders within the organization.

Progress in engineering high strain lead-free piezoelectric ceramics

International Nuclear Information System (INIS)

Leontsev, Serhiy O; Eitel, Richard E

2010-01-01

Environmental concerns are strongly driving the need to replace the lead-based piezoelectric materials currently employed as multilayer actuators. The current review describes both compositional and structural engineering approaches to achieve enhanced piezoelectric properties in lead-free materials. The review of the compositional engineering approach focuses on compositional tuning of the properties and phase behavior in three promising families of lead-free perovskite ferroelectrics: the titanate, alkaline niobate and bismuth perovskites and their solid solutions. The 'structural engineering' approaches focus instead on optimization of microstructural features including grain size, grain orientation or texture, ferroelectric domain size and electrical bias field as potential paths to induce large piezoelectric properties in lead-free piezoceramics. It is suggested that a combination of both compositional and novel structural engineering approaches will be required in order to realize viable lead-free alternatives to current lead-based materials for piezoelectric actuator applications. (topical review)

Progress in engineering high strain lead-free piezoelectric ceramics

Science.gov (United States)

Leontsev, Serhiy O; Eitel, Richard E

2010-01-01

Environmental concerns are strongly driving the need to replace the lead-based piezoelectric materials currently employed as multilayer actuators. The current review describes both compositional and structural engineering approaches to achieve enhanced piezoelectric properties in lead-free materials. The review of the compositional engineering approach focuses on compositional tuning of the properties and phase behavior in three promising families of lead-free perovskite ferroelectrics: the titanate, alkaline niobate and bismuth perovskites and their solid solutions. The ‘structural engineering’ approaches focus instead on optimization of microstructural features including grain size, grain orientation or texture, ferroelectric domain size and electrical bias field as potential paths to induce large piezoelectric properties in lead-free piezoceramics. It is suggested that a combination of both compositional and novel structural engineering approaches will be required in order to realize viable lead-free alternatives to current lead-based materials for piezoelectric actuator applications. PMID:27877343

Considering University-Business Cooperation Modes from the Perspective of Enterprises

Science.gov (United States)

Pavlin, Samo

2016-01-01

This article analyses enterprises' engagement in university-business cooperation (UBC) activities: research and development, mobility of academics and students, curriculum development and lifelong learning. It first provides an introductory overview of university-business cooperation policy. It then presents a selection of UBC models, elements and…

A new avenue for classification and prediction of olive cultivars using supervised and unsupervised algorithms.

Directory of Open Access Journals (Sweden)

Amir H Beiki

Full Text Available Various methods have been used to identify cultivares of olive trees; herein we used different bioinformatics algorithms to propose new tools to classify 10 cultivares of olive based on RAPD and ISSR genetic markers datasets generated from PCR reactions. Five RAPD markers (OPA0a21, OPD16a, OP01a1, OPD16a1 and OPA0a8 and five ISSR markers (UBC841a4, UBC868a7, UBC841a14, U12BC807a and UBC810a13 selected as the most important markers by all attribute weighting models. K-Medoids unsupervised clustering run on SVM dataset was fully able to cluster each olive cultivar to the right classes. All trees (176 induced by decision tree models generated meaningful trees and UBC841a4 attribute clearly distinguished between foreign and domestic olive cultivars with 100% accuracy. Predictive machine learning algorithms (SVM and Naïve Bayes were also able to predict the right class of olive cultivares with 100% accuracy. For the first time, our results showed data mining techniques can be effectively used to distinguish between plant cultivares and proposed machine learning based systems in this study can predict new olive cultivars with the best possible accuracy.

Optimization of an electrostatic quadrupole doublet focusing systems

Energy Technology Data Exchange (ETDEWEB)

Hussein, Oday A., E-mail: oah@sc.nahrainuniv.edu.iq [Department of Physics, College of Science, Al-Nahrain University, Baghdad (Iraq); Sise, Omer [Department of Science Education, Faculty of Education, Suleyman Demirel University, Isparta (Turkey)

2017-05-15

Highlights: • The imaging properties of an electrostatic quadrupole doublet lens were analyzed with the aid of computer simulation. • The optimal electrode voltages which lead to stigmatic image in both planes of the quadrupole doublet lens with minimum spot size at position sensitive detector (PSD) were found for two operation modes: point-to-point focusing and parallel-to-point focusing. • The imaging properties of are very sensitive to the lunching angle of the electron-beam. - Abstract: The imaging properties of an electrostatic quadrupole doublet lens were analyzed with the aid of computer simulation. The optimal electrode voltages which lead to stigmatic image in both planes of the quadrupole doublet lens with minimum spot size at position sensitive detector (PSD) were found for two operation modes: point-to-point focusing and parallel-to-point focusing. The optical properties as: Magnifications, spot sizes in the image plane and aberration figures were discussed. The results showed that the focusing of the lens was strong in the xy-plane in comparison with the focusing in the xz-plane. The distortion of the image was greater when the image position will be close to the lens in comparison with object position. Also, the imaging properties were very sensitive to the lunching angle of the electron-beam.

Establishment of dna fingerprinting in clonal tea improved cultivars from yunnan of china using issr markers

International Nuclear Information System (INIS)

Liu, B.Y.; Zhao, C.M.; Sun, X.M.; Jiang, H.B.

2015-01-01

In this study, DNA fingerprints were constructed by using ISSR markers for 20 clonal improved varieties developed by two breeding institutes in Yunnan province. Seven core ISSR primers were selected from 15 primers. A total of 110 bands were generated by PAGE with seven core primers, 93 of which were polymorphic bands, the percentage of polymorphic band (PPB) was 84.54%, and the mean value of polymorphism information content (PIC) reached 0.417; the genetic similarity coefficient of the cultivars was 0.574-0.854. The two primers, UBC835 and ISSR2, had high PIC values, and could be used to distinguish all cultivars, presenting the most efficient single primers. Among the all of primer combinations from the seven core primers, the three combinations, UBC835/UBC811, UBC835/ISSR2, and UBC835/ISSR3 showed lower similar coefficients, and more efficient in identifying the 20 improved varieties than the other primer combinations. Then these three primer combinations were further scored in 15 traditional cultivars. The results showed that UBC835/ISSR2 was the optimal primer combination, which could be used to distinguish each material among the 20 clonal improved varieties and 15 traditional cultivals. Finally, the DNA fingerprints of the 20 clonal improved varieties were constructed based on country and region code, breeding institute, core primer name and ISSR marker data. The established fingerprints could provide reliable scientific base for the protection of intellectual property right for these clonal improved varieties, and the important molecular information contained in these fingerprints would be useful for the authenticity identification and genetic relationship analysis of tea varieties. (author)

Treatment of Unicameral Bone Cysts of the Calcaneus: A Systematic Review.

Science.gov (United States)

Levy, David M; Gross, Christopher E; Garras, David N

2015-01-01

The calcaneus is the most common tarsal affected by unicameral bone cysts (UBCs); however, the treatment of calcaneal UBCs remains controversial. The purpose of the present systematic review was to evaluate the treatment modalities for calcaneal UBCs. A systematic review was performed using clinical studies of calcaneal UBCs with a minimum of 1 year of follow-up and level I to IV evidence. Ten studies with 171 patients (181 cysts) were selected. Heel pain and radiographic cyst consolidation were the primary outcomes. A series of Z tests were used to compare the outcomes in the nonoperative and operative groups, cannulated screw and bone augmentation groups, and autografting and allografting groups. All patients treated with open curettage and bone augmentation had significant improvements in heel pain (p < .001). Only 1.1% ± 1.0% of the cysts treated conservatively had healed on radiographs compared with 93.0% ± 13.0% of the cysts after surgery (p < .001). A greater percentage of patients treated with bone augmentation had preoperative heel pain and resolution of that pain than did patients treated with cannulated screws (p < .001). Autografting had a significantly greater percentage of radiographic cyst consolidation than did allografting (97.4% ± 11.1% versus 85.1% ± 15.8%, p < .001, Z = 3.5). Objective outcomes data on calcaneal UBCs are relatively sparse. The results of the present review suggest that open curettage with autograft bone augmentation is the most effective procedure. We would encourage future comparative clinical studies to elucidate differences in UBC treatment modalities. Copyright © 2015 American College of Foot and Ankle Surgeons. Published by Elsevier Inc. All rights reserved.

Latino Nursing Leadership: A Leading-Following Perspective.

Science.gov (United States)

Ortiz, Mario R

2017-10-01

Nurse leaders have many demands that must be attended to in a manner that is focused, so that organizational, professional, and personal visions are moved forward. The focus emerges from the values and beliefs of the nurse leaders. These values and beliefs embrace nursing models and theories that are the foundation from which they lead others.

Barriers and Pathways to Creating Sustainability Education Programs: Policy, Rhetoric and Reality

Science.gov (United States)

Moore, Janet

2005-01-01

This article outlines an action-oriented research project regarding the University of British Columbia's engagement with sustainability. In 1997, the University of British Columbia (UBC) created a sustainability policy that suggests all UBC students should be educated about sustainability. Using data from a series of in-depth interviews the author…

An elastic, low-background vertical focusing element for a doubly focusing neutron monochromator

International Nuclear Information System (INIS)

Smee, Stephen A.; Brand, Paul C.; Barry, Dwight D.; Broholm, Collin L.; Anand, Dave K.

2001-01-01

A novel, variable radius of curvature, device for the focusing of neutrons is presented. This elastic element consists of a thin variable thickness, constant width, aluminum blade to which diffracting crystals can be attached. When buckled, the blade assumes a circular focal shape, the radius of which is easily controlled by the relative displacement of supporting pivots. Precision electromechanical and optical measurements show that the slope of the buckled blade conforms to a circular arc to within 0.15 degree sign for radii in the range 900 mm< R<10 000 mm. This easily scalable, low mass mechanism is well suited for use in a focusing neutron monochromator, as the parasitic scattering typically associated with traditional lead screw and lever mechanisms is greatly reduced

The Hamlet dilemma for aluminium cans in the circular economy: to be or not to be in a closed loop?

DEFF Research Database (Denmark)

Niero, Monia; Hoffmeyer, Simon B.; Langen, Håkon

2015-01-01

In the context of circular economy the focus is not only on recycling from a quantitative point of view, but also on improving the quality of materials. We considered the case of aluminium cans, and quantified the influence of alloying elements on the overall environmental performances of alumini...... the use of UBC scraps. This suggests that in a circular economy context for aluminium cans it is better to be in a closed loop....

Attentional Focusing Instructions and Force Production

Directory of Open Access Journals (Sweden)

David C Marchant

2011-01-01

Full Text Available Research progress assessing the role of attentional focusing instructions on skill acquisition and performance has lead researchers to apply this approach to force production tasks. Initial converging evidence indicates that force production tasks are sensitive to verbal instruction; externally focused instructions (onto movement outcomes, or onto the object force is being exerted against are shown to be more beneficial than internally focused instructions (focusing attention onto the movements being executed. These benefits are observed for maximal and accurate force production, as well as the maintenance of force production in prolonged tasks. A range of mechanisms are identified supporting the proposal that an external focus promotes movement efficiency in line with energy and effort conservation. Future research is required to assess how this developing body of work interacts with the broader understanding of psychological and physiological factors implicated in the effective production, maintenance and limitation of maximal or sub-maximal forces.

Computational modeling predicts the ionic mechanism of late-onset responses in Unipolar Brush Cells

Directory of Open Access Journals (Sweden)

Sathyaa eSubramaniyam

2014-08-01

Full Text Available Unipolar Brush Cells (UBCs have been suggested to have a strong impact on cerebellar granular layer functioning, yet the corresponding cellular mechanisms remain poorly understood. UBCs have recently been reported to generate, in addition to early-onset glutamatergic synaptic responses, a late-onset response (LOR composed of a slow depolarizing ramp followed by a spike burst (Locatelli et al., 2013. The LOR activates as a consequence of synaptic activity and involves an intracellular cascade modulating H- and TRP-current gating. In order to assess the LOR mechanisms, we have developed a UBC multi-compartmental model (including soma, dendrite, initial segment and axon incorporating biologically realistic representations of ionic currents and a generic coupling mechanism regulating TRP and H channel gating. The model finely reproduced UBC responses to current injection, including a low-threshold spike sustained by CaLVA currents, a persistent discharge sustained by CaHVA currents, and a rebound burst following hyperpolarization sustained by H- and CaLVA-currents. Moreover, the model predicted that H- and TRP-current regulation was necessary and sufficient to generate the LOR and its dependence on the intensity and duration of mossy fiber activity. Therefore, the model showed that, using a basic set of ionic channels, UBCs generate a rich repertoire of delayed bursts, which could take part to the formation of tunable delay-lines in the local microcircuit.

Computational modeling predicts the ionic mechanism of late-onset responses in unipolar brush cells.

Science.gov (United States)

Subramaniyam, Sathyaa; Solinas, Sergio; Perin, Paola; Locatelli, Francesca; Masetto, Sergio; D'Angelo, Egidio

2014-01-01

Unipolar Brush Cells (UBCs) have been suggested to play a critical role in cerebellar functioning, yet the corresponding cellular mechanisms remain poorly understood. UBCs have recently been reported to generate, in addition to early-onset glutamate receptor-dependent synaptic responses, a late-onset response (LOR) composed of a slow depolarizing ramp followed by a spike burst (Locatelli et al., 2013). The LOR activates as a consequence of synaptic activity and involves an intracellular cascade modulating H- and TRP-current gating. In order to assess the LOR mechanisms, we have developed a UBC multi-compartmental model (including soma, dendrite, initial segment, and axon) incorporating biologically realistic representations of ionic currents and a cytoplasmic coupling mechanism regulating TRP and H channel gating. The model finely reproduced UBC responses to current injection, including a burst triggered by a low-threshold spike (LTS) sustained by CaLVA currents, a persistent discharge sustained by CaHVA currents, and a rebound burst following hyperpolarization sustained by H- and CaLVA-currents. Moreover, the model predicted that H- and TRP-current regulation was necessary and sufficient to generate the LOR and its dependence on the intensity and duration of mossy fiber activity. Therefore, the model showed that, using a basic set of ionic channels, UBCs generate a rich repertoire of bursts, which could effectively implement tunable delay-lines in the local microcircuit.

Spent lead-acid battery recycling in China - A review and sustainable analyses on mass flow of lead.

Science.gov (United States)

Sun, Zhi; Cao, Hongbin; Zhang, Xihua; Lin, Xiao; Zheng, Wenwen; Cao, Guoqing; Sun, Yong; Zhang, Yi

2017-06-01

Lead is classified to be one of the top heavy metal pollutants in China. The corresponding environmental issues especially during the management of spent lead-acid battery have already caused significant public awareness and concern. This research gives a brief overview on the recycling situation based on an investigation of the lead industry in China and also the development of technologies for spent lead-acid batteries. The main principles and research focuses of different technologies including pyrometallurgy, hydrometallurgy and greener technologies are summarized and compared. Subsequently, the circulability of lead based on the entire life cycle analyses of lead-acid battery is calculated. By considering different recycling schemes, the recycling situation of spent lead-acid battery in China can be understood semi-quantitatively. According to this research, 30% of the primary lead production can be shut down that the lead production can still ensure consecutive life cycle operation of lead-acid battery, if proper management of the spent lead-acid battery is implemented according to current lead industry situation in China. This research provides a methodology on the view of lead circulability in the whole life cycle of a specific product and is aiming to contribute more quantitative guidelines for efficient organization of lead industry in China. Copyright © 2017 Elsevier Ltd. All rights reserved.

Slagging behavior of upgraded brown coal and bituminous coal in 145 MW practical coal combustion boiler

Energy Technology Data Exchange (ETDEWEB)

Akiyama, Katsuya; Pak, Haeyang; Takubo, Yoji [Kobe Steel, Ltd, Kobe (Japan). Mechanical Engineering Research Lab.; Tada, Toshiya [Kobe Steel, Ltd, Takasago (Japan). Coal and Energy Technology Dept.; Ueki, Yasuaki [Nagoya Univ. (Japan). Energy Science Div.; Yoshiie, Ryo; Naruse, Ichiro [Nagoya Univ. (Japan). Dept. of Mechanical Science and Engineering

2013-07-01

The purpose of this study is to quantitatively evaluate behaviors of ash deposition during combustion of Upgraded Brown Coal (UBC) and bituminous coal in a 145 MW practical coal combustion boiler. A blended coal consisting 20 wt% of the UBC and 80 wt% of the bituminous coal was burned for the combustion tests. Before the actual ash deposition tests, the molten slag fractions of ash calculated by chemical equilibrium calculations under the combustion condition was adopted as one of the indices to estimate the tendency of ash deposition. The calculation results showed that the molten slag fraction for UBC ash reached approximately 90% at 1,523 K. However, that for the blended coal ash became about 50%. These calculation results mean that blending the UBC with a bituminous coal played a role in decreasing the molten slag fraction. Next, the ash deposition tests were conducted, using a practical pulverized coal combustion boiler. A water-cooled stainless-steel tube was inserted in locations at 1,523 K in the boiler to measure the amount of ash deposits. The results showed that the mass of deposited ash for the blended coal increased and shape of the deposited ash particles on the tube became large and spherical. This is because the molten slag fraction in ash for the blended coal at 1,523 K increased and the surface of deposited ash became sticky. However, the mass of the deposited ash for the blended coal did not greatly increase and no slagging problems occurred for 8 days of boiler operation under the present blending conditions. Therefore, appropriate blending of the UBC with a bituminous coal enables the UBC to be used with a low ash melting point without any ash deposition problems in a practical boiler.

HINS Linac front end focusing system R&D

Energy Technology Data Exchange (ETDEWEB)

Apollinari, G.; Carcagno, R.H.; Dimarco, J.; Huang, Y.; Kashikhin, V.V.; Orris, D.F.; Page, T.M.; Rabehl, R.; Sylvester, C.; Tartaglia, M.A.; Terechkine, I.; /Fermilab /Argonne

2008-08-01

This report summarizes current status of an R&D program to develop a focusing system for the front end of a superconducting RF linac. Superconducting solenoids will be used as focusing lenses in the low energy accelerating sections of the front end. The development of focusing lenses for the first accelerating section is in the production stage, and lens certification activities are in preparation at FNAL. The report contains information about the focusing lens design and performance, including solenoid, dipole corrector, and power leads, and about cryogenic system design and performance. It also describes the lens magnetic axis position measurement technique and discusses scope of an acceptance/certification process.

From Exam to Education: The Math Exam/Education Resources

Science.gov (United States)

Bruni, Carmen; Koch, Christina; Konrad, Bernhard; Lindstrom, Michael; Moyles, Iain; Thompson, Will

2016-01-01

The Math Exam/Education Resources (MER) is an open online learning resource hosted at The University of British Columbia (UBC), aimed at providing mathematics education resources for students and instructors at UBC. In this paper, there will be a discussion of the motivation for creating this resource on the MediaWiki platform, key features of the…

76 FR 25711 - Proposed Exemptions from Certain Prohibited Transaction Restrictions

Science.gov (United States)

2011-05-05

... the supervision of various governmental and self-regulatory bodies. Northern has a network of 79... Council is aligned with the UBC, as mentioned above, it is a separate and autonomous entity from UBC. As a.... Situated on the 19.25 acre tract are a car rental facility, which has a passenger terminal, a car wash, a...

A self-focusing mercury jet target

CERN Document Server

Johnson, C

2002-01-01

Mercury jet production targets have been studied in relation to antiproton production and, more recently, pion production for a neutrino factory. There has always been a temptation to include some self-focusing of the secondaries by passing a current through the mercury jet analogous to the already proven lithium lens. However, skin heating of the mercury causes fast vaporization leading to the development of a gliding discharge along the surface of the jet. This external discharge can, nevertheless, provide some useful focusing of the secondaries in the case of the neutrino factory. The technical complications must not be underestimated.

TOPICAL REVIEW: Progress in engineering high strain lead-free piezoelectric ceramics

Science.gov (United States)

Leontsev, Serhiy O.; Eitel, Richard E.

2010-08-01

Environmental concerns are strongly driving the need to replace the lead-based piezoelectric materials currently employed as multilayer actuators. The current review describes both compositional and structural engineering approaches to achieve enhanced piezoelectric properties in lead-free materials. The review of the compositional engineering approach focuses on compositional tuning of the properties and phase behavior in three promising families of lead-free perovskite ferroelectrics: the titanate, alkaline niobate and bismuth perovskites and their solid solutions. The 'structural engineering' approaches focus instead on optimization of microstructural features including grain size, grain orientation or texture, ferroelectric domain size and electrical bias field as potential paths to induce large piezoelectric properties in lead-free piezoceramics. It is suggested that a combination of both compositional and novel structural engineering approaches will be required in order to realize viable lead-free alternatives to current lead-based materials for piezoelectric actuator applications.

Low awareness of risk factors among bladder cancer survivors: New evidence and a literature overview.

Science.gov (United States)

Westhoff, Ellen; Maria de Oliveira-Neumayer, Julia; Aben, Katja K; Vrieling, Alina; Kiemeney, Lambertus A

2016-06-01

Data on urinary bladder cancer (UBC) patients' perceptions about causes of bladder cancer is limited, while this may be important knowledge for health prevention and education. We evaluated self-reported perceptions and beliefs about the causes of bladder cancer among UBC survivors in the Netherlands. UBC survivors identified through the Netherlands Cancer Registry from 2007 to 2012 were invited to participate. Patients who consented were asked to fill out a questionnaire, including questions on lifestyle characteristics, occupational and medical history, and family history of cancer. The final question was 'You have been diagnosed with bladder cancer. Do you have any idea what may have been the cause of your cancer?'. Of the 1793 UBC survivors included, 366 (20%) reported a possible cause for their bladder cancer. The most frequently reported suspected causes were smoking (10%), occupational exposure (5%), and heredity (2%). Smoking, occupational exposure and heredity were mentioned only slightly more frequently by participants with these risk factors (11%, 8%, and 5%, respectively) compared to the total population. Most UBC survivors did not suspect any cause that might have contributed to the development of their cancer. Even among participants with established risk factors for bladder cancer, these risk factors were not commonly perceived. This finding probably reflects the superficial knowledge of risk factors for bladder cancer in the population and highlights the importance of effective education on cancer prevention. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

Stability of expanded plasma focus

International Nuclear Information System (INIS)

Soliman, H.M.

1994-01-01

In this study, the stabilization of the expanded plasma focus formed by 4.5 kJ plasma focus device of Mather type by magnetic field is presented. The experimental results of the induced axial magnetic field and electric probe measurements of the expanded plasma focus show that, the plasma consists of three plasmoids, electron temperature measurements off the plasmoids at a point close to the muzzle are 26 eV, 30 eV and 27 eV respectively and the electron densities are 6.6 x 10 14 , 6.1 x 10 14 / cm 3 respectively. The presence of external axial magnetic field (B 2 = 1.6 kg) at the mid distance between the breech and the muzzle has a less effect on the stability of expanded focus and it causes a restriction for the plasma motion. the electron temperature of the three plasmoids are found to increase in that case by 23%, 18.5% respectively. When this axial magnetic field is applied at the muzzle end, it leads to a more stable expanded plasma focus which consists mainly of one plasmoid with electron temperature of 39 eV and density of 3.4 x 10 14 / cm 3 . 5 figs

Implementation Guide: Leading School Change

Science.gov (United States)

Whitaker, Todd

2010-01-01

This two-part "Implementation Guide" will help to deepen your understanding and sharpen your ability to implement each of the strategies discussed in "Leading School Change: Nine Strategies to Bring Everybody on Board" (ED509821). Part One offers discussion questions and activities which focus on each of the nine strategies. They can be completed…

Influence of focus of attention, reinvestment and fall history on elderly gait stability

NARCIS (Netherlands)

de Melker Worms, Jonathan L.A.; Stins, John F.; van Wegen, Erwin E.H.; Loram, Ian D.; Beek, Peter J.

2017-01-01

Falls represent a substantial risk in the elderly. Previous studies have found that a focus on the outcome or effect of the movement (external focus of attention) leads to improved balance performance, whereas a focus on the movement execution itself (internal focus of attention) impairs balance

Leading change: 3--implementation.

Science.gov (United States)

Kerridge, Joanna

The potential for all staff to contribute to service improvement, irrespective of discipline, role or function, is outlined in the 2011 NHS leadership framework. This advocates developing the skills of the entire workforce to create a climate of continuous service improvement. As nurses are often required to take the lead in managing change in clinical practice, this final article in a three-part series focuses on implementing ande potentia reviewing change.

Discrete and modal focusing effects: principles and applications

DEFF Research Database (Denmark)

Stamate, Eugen

2012-01-01

Charge flux distribution on the surface of biased electrodes of different geometries immersed in a plasma is investigated by three-dimensional simulations and experiments. It is demonstrated that the sheath surrounding the electrodes that interface insulators acts as an electrostatic lens, focusing...... the charges to distinct locations on the electrode surface depending on the entrance coordinates at the sheath edge. Two focusing effects are identified. Discrete focusing leads to the formation of a passive surface of no ion impact, near the edge of the electrodes interfacing insulators. Modal focusing...... results in the formation of certain ‘modal spots’ and/or ‘modal lines’. Several phenomenological aspects and potential applications are reviewed and further discussed, including charge focusing by a three-dimensional plasma–sheath–lens, ion dose uniformity during plasma immersion ion implantation, mass...

Treated unicameral bone cysts

International Nuclear Information System (INIS)

Weinman, J.; Servaes, S.; Anupindi, S.A.

2013-01-01

Unicameral bone cysts (UBCs) are a common benign entity involving the metaphysis of growing bone, occurring within the first two decades of life. Assessment of these lesions, both before and after surgery, is performed routinely utilizing radiographs. We present a review of UBCs at various stages of treatment, including both successful and incomplete healing, and describe the imaging findings throughout their postoperative course

Lead contamination of inexpensive plastic jewelry

Energy Technology Data Exchange (ETDEWEB)

Yost, Jamie L. [Department of Chemistry, Ashland University, Ashland, Ohio (United States); Weidenhamer, Jeffrey D. [Department of Chemistry, Ashland University, Ashland, Ohio (United States)], E-mail: jweiden@ashland.edu

2008-04-15

The neurological hazards of lead to children are well-known. As a result of recent documented cases of lead poisoning, regulatory attention in the United States has focused on the lead content of children's metal jewelry. By contrast, little is known about the possible hazards of plastic jewelry items. The objective of this study was to determine whether inexpensive plastic jewelry is a possible source of toxic lead for children. Samples of more than 100 inexpensive plastic jewelry items were analyzed for lead content. Beads were screened by soaking in 1 M nitric acid. Nine items found to release more than 30 {mu}g of lead per bead were further tested for accessible lead, and scrapings of the bead coatings were analyzed for total lead content. The maximum accessible lead found was 49 {mu}g per bead, which is below the current US Consumer Product Safety Commission limit of 175 {mu}g. However, when the number of beads in each item was taken into account, six of the nine leaded samples contained more than 175 {mu}g accessible lead per item. The lead in these items appears to be associated with lead-based paints used to produce glossy coatings on imitation pearls and similar items. Coatings obtained by scraping individual beads contained 3.5-23% lead, which far exceeds the US regulatory limit of 0.06% lead in paints on items intended for children. Our results demonstrate that plastic jewelry items merit the attention of public health and consumer protection agencies seeking to limit the exposure of children to lead.

Lead contamination of inexpensive plastic jewelry

International Nuclear Information System (INIS)

Yost, Jamie L.; Weidenhamer, Jeffrey D.

2008-01-01

The neurological hazards of lead to children are well-known. As a result of recent documented cases of lead poisoning, regulatory attention in the United States has focused on the lead content of children's metal jewelry. By contrast, little is known about the possible hazards of plastic jewelry items. The objective of this study was to determine whether inexpensive plastic jewelry is a possible source of toxic lead for children. Samples of more than 100 inexpensive plastic jewelry items were analyzed for lead content. Beads were screened by soaking in 1 M nitric acid. Nine items found to release more than 30 μg of lead per bead were further tested for accessible lead, and scrapings of the bead coatings were analyzed for total lead content. The maximum accessible lead found was 49 μg per bead, which is below the current US Consumer Product Safety Commission limit of 175 μg. However, when the number of beads in each item was taken into account, six of the nine leaded samples contained more than 175 μg accessible lead per item. The lead in these items appears to be associated with lead-based paints used to produce glossy coatings on imitation pearls and similar items. Coatings obtained by scraping individual beads contained 3.5-23% lead, which far exceeds the US regulatory limit of 0.06% lead in paints on items intended for children. Our results demonstrate that plastic jewelry items merit the attention of public health and consumer protection agencies seeking to limit the exposure of children to lead

Potential uses of lead in nuclear waste disposal

International Nuclear Information System (INIS)

Goodwin, F.E.; Pool, K.H.; Westerman, R.E.; Pitman, S.G.; Telander, M.R.

1991-01-01

In order for lead to be considered as a nuclear waste packaging material, it must be shown that it has adequate corrosion resistance, and that it does not degrade the properties of other important structural or barrier elements in the waste package. The present work focused on determining (a) the corrosion resistance of commercial purity (CP) lead and a Pb-1.5% Sb alloy in irradiated, elevated-temperature tuff ground water environments; (b) the resistance of alloy 825, a candidate container alloy, to embrittlement by molten lead; and (c) the resistance of lead and the Pb-Sb alloy to localized (pitting, crevice) corrosion. The test results support the feasibility of using lead in nuclear waste containers

The Analysis on Leading industries in Central Java Province

Directory of Open Access Journals (Sweden)

Setyani Irmawati

2016-06-01

Full Text Available The purpose of this research is for identifying the types of industriesthat become leading industries in Central Java Province. The methods, used are LQ (SLQ and DLQ and Shift Share. The result of this research shows that the the leading industries in Central Java Province are beverage industry, tobacco processing industry, textile industry, apparel industry, wood industry, printing industry, furniture industry and other processing industries.In the future, the development of the industry should not only focus on the leading industries  but also onnon-leading industries, so that the non leading industries will not be left behind.

Discrete and modal focusing effects: principles and applications

International Nuclear Information System (INIS)

Stamate, E

2012-01-01

Charge flux distribution on the surface of biased electrodes of different geometries immersed in a plasma is investigated by three-dimensional simulations and experiments. It is demonstrated that the sheath surrounding the electrodes that interface insulators acts as an electrostatic lens, focusing the charges to distinct locations on the electrode surface depending on the entrance coordinates at the sheath edge. Two focusing effects are identified. Discrete focusing leads to the formation of a passive surface of no ion impact, near the edge of the electrodes interfacing insulators. Modal focusing results in the formation of certain ‘modal spots’ and/or ‘modal lines’. Several phenomenological aspects and potential applications are reviewed and further discussed, including charge focusing by a three-dimensional plasma–sheath–lens, ion dose uniformity during plasma immersion ion implantation, mass spectrometry and plasma monitoring. (paper)

HINS Linac front end focusing system R and D

International Nuclear Information System (INIS)

Apollinari, G.; Carcagno, R.H.; Dimarco, J.; Huang, Y.; Kashikhin, V.V.; Orris, D.F.; Page, T.M.; Rabehl, R.; Sylvester, C.; Tartaglia, M.A.; Terechkine, I.; Fermilab; Argonne

2008-01-01

This report summarizes current status of an R and D program to develop a focusing system for the front end of a superconducting RF linac. Superconducting solenoids will be used as focusing lenses in the low energy accelerating sections of the front end. The development of focusing lenses for the first accelerating section is in the production stage, and lens certification activities are in preparation at FNAL. The report contains information about the focusing lens design and performance, including solenoid, dipole corrector, and power leads, and about cryogenic system design and performance. It also describes the lens magnetic axis position measurement technique and discusses scope of an acceptance/certification process

Focus on integrated quantum optics

International Nuclear Information System (INIS)

O'Brien, Jeremy; Patton, Brian; Sasaki, Masahide; Vučković, Jelena

2013-01-01

A key goal of research into quantum information processing is the development of technologies that are scaleable in complexity while allowing the mass manufacture of devices that promise transformative effects on information science. The demonstration that integrated photonics circuits could be made to perform operations that exploit the quantum nature of the photon has turned them into leading candidates for practical quantum information processing technologies. To fully achieve their promise, however, requires research from diverse fields. This focus issue provides a snapshot of some of the areas in which key advances have been made. We are grateful for the contributions from leading teams based around the globe and hope that the degree of progress being made in a challenging and exciting field is apparent from the papers published here. (editorial)

Biofluorescence as a survey tool for cryptic marine species.

Science.gov (United States)

De Brauwer, Maarten; Hobbs, Jean-Paul A; Ambo-Rappe, Rohani; Jompa, Jamaluddin; Harvey, Euan S; McIlwain, Jennifer L

2017-10-06

As ecosystems come under increasing anthropogenic pressure, rare species face the highest risk of extinction. Paradoxically, data necessary to evaluate the conservation status of rare species are often lacking because of the challenges of detecting species with low abundance. One group of fishes subject to this undersampling bias are those with cryptic body patterns. Twenty-one percent of cryptic fish species assessed for their extinction risk (International Union for Conservation of Nature [IUCN]) are data deficient. We developed a nondestructive method for surveying cryptically patterned marine fishes based on the presence of biofluorescence (underwater biofluorescence census, UBC). Blue LED torches were used to investigate how widespread biofluorescence was in cryptic reef fishes in the Coral Triangle region. The effectiveness of UBC to generate abundance data was tested on a data-deficient pygmy seahorse species (Hippocampus bargibanti) and compared with data obtained from standard underwater visual census (UVC) surveys. We recorded 95 reef fish species displaying biofluorescence, 73 of which had not been previously described as biofluorescent. Of those fish with cryptic patterns, 87% were biofluorescent compared with 9% for noncryptic fishes. The probability of species displaying biofluorescence was 70.9 times greater for cryptic species than for noncryptic species. Almost twice the number of H. bargibanti was counted using the UBC compared with UVC. For 2 triplefin species (Ucla xenogrammus, Enneapterygius tutuilae), the abundance detected with UBC was triple that detected with UVC. The UBC method was effective at finding cryptic species that would otherwise be difficult to detect and thus will reduce interobserver variability inherent to UVC surveys. Biofluorescence is ubiquitous in cryptic fishes, making this method applicable across a wide range of species. Data collected using UBC could be used with multiple IUCN criteria to assess the extinction risk of

Mid- and long-term clinical results of surgical therapy in unicameral bone cysts

Directory of Open Access Journals (Sweden)

Hagmann Sébastien

2011-12-01

Full Text Available Abstract Background Unicameral (or simple bone cysts (UBC are benign tumours most often located in long bones of children and adolescents. Pathological fractures are common, and due to high recurrence rates, these lesions remain a challenge to treat. Numerous surgical procedures have been proposed, but there is no general consensus of the ideal treatment. The aim of this investigation therefore was to study the long-term outcome after surgical treatment in UBC. Methods A retrospective analysis of 46 patients surgically treated for UBC was performed for short and mid-term outcome. Clinical and radiological outcome parameters were studied according to a modified Neer classification system. Long-term clinical information was retrieved via a questionnaire at a minimum follow-up of 10 years after surgery. Results Forty-six patients (17 female, 29 male with a mean age of 10.0 ± 4.8 years and with histopathologically confirmed diagnosis of UBC were included. Pathological fractures were observed in 21 cases (46%. All patients underwent surgery for UBC (35 patients underwent curettage and bone grafting as a primary therapy, 4 curettage alone, 3 received corticoid instillation and 4 decompression by cannulated screws. Overall recurrence rate after the first surgical treatment was 39% (18/46, second (17.4% of all patients and third recurrence (4.3% were frequently observed and were addressed by revision surgery. Recurrence was significantly higher in young and in male patients as well as in active cysts. After a mean of 52 months, 40 out of 46 cysts were considered healed. Prognosis was significantly better when recurrence was observed later than 30 months after therapy. After a mean follow-up of 15.5 ± 6.2 years, 40 patients acknowledged clinically excellent results, while five reported mild and casual pain. Only one patient reported a mild limitation of range of motion. Conclusions Our results suggest satisfactory overall long-term outcome for the

Mid- and long-term clinical results of surgical therapy in unicameral bone cysts.

Science.gov (United States)

Hagmann, Sébastien; Eichhorn, Florian; Moradi, Babak; Gotterbarm, Tobias; Dreher, Thomas; Lehner, Burkhard; Zeifang, Felix

2011-12-13

Unicameral (or simple) bone cysts (UBC) are benign tumours most often located in long bones of children and adolescents. Pathological fractures are common, and due to high recurrence rates, these lesions remain a challenge to treat. Numerous surgical procedures have been proposed, but there is no general consensus of the ideal treatment. The aim of this investigation therefore was to study the long-term outcome after surgical treatment in UBC. A retrospective analysis of 46 patients surgically treated for UBC was performed for short and mid-term outcome. Clinical and radiological outcome parameters were studied according to a modified Neer classification system. Long-term clinical information was retrieved via a questionnaire at a minimum follow-up of 10 years after surgery. Forty-six patients (17 female, 29 male) with a mean age of 10.0 ± 4.8 years and with histopathologically confirmed diagnosis of UBC were included. Pathological fractures were observed in 21 cases (46%). All patients underwent surgery for UBC (35 patients underwent curettage and bone grafting as a primary therapy, 4 curettage alone, 3 received corticoid instillation and 4 decompression by cannulated screws). Overall recurrence rate after the first surgical treatment was 39% (18/46), second (17.4% of all patients) and third recurrence (4.3%) were frequently observed and were addressed by revision surgery. Recurrence was significantly higher in young and in male patients as well as in active cysts. After a mean of 52 months, 40 out of 46 cysts were considered healed. Prognosis was significantly better when recurrence was observed later than 30 months after therapy. After a mean follow-up of 15.5 ± 6.2 years, 40 patients acknowledged clinically excellent results, while five reported mild and casual pain. Only one patient reported a mild limitation of range of motion. Our results suggest satisfactory overall long-term outcome for the surgical treatment of UBC, although short-and mid

Flow over 50º Delta Wings with Different Leading-Edge Radii

NARCIS (Netherlands)

Verhaagen, N.G.

2011-01-01

The experimental study focuses on the effects of the leading-edge radius on the flow over 50º swept delta wing models. Three models were tested, one model has a sharp leading edge and two other have a semi-circular leading edge of different radius. The vortical flow on and off the surface of the

Instabilities in the plasma focus

International Nuclear Information System (INIS)

Kaeppeler, H.J.

1975-03-01

The plasma focus was studied by many research teams in view of a possible approach to controlled thermonuclear fusion. Though it is questionable whether the plasma focus will ever lead to a fusion reactor, it nevertheless constitutes a strong source of neutron, X- and gamma radiation for simulating fusion reactor conditions. Furthermore, the plasma focus yields very high temperatures (10 7 K) and densities (> 10 19 cm -3 ) and thus provides interesting conditions for the study of high density plasmas. This review paper starts with a description of the compression stage of the focussing plasma, using a snow-plough model. It is shown that sophisticated MHD calculations substantiate the snowplough theory, but are not suited to describe the phenomena in the final compressed stage. For this purpose, a particle-in-cell calculation is employed, yielding a beam-beam collision model for the neutron production. Experimental evidence indicates that neutron production is associated with the appearence of m = O instabilities and is the direct result of collisions between anomalously accelerated ions. One of the mechanisms of ion acceleration are strong local electric fields. Another possible mechanism can bee seen in beam-plasma instabilities caused by runaway electrons. The analytical derivation of the dispersion relation for plasma focus conditions including runaway effect is discussed (orig.) [de

Skin toxicology of lead species evaluated by their permeability and proteomic profiles: a comparison of organic and inorganic lead.

Science.gov (United States)

Pan, Tai-Long; Wang, Pei-Wen; Al-Suwayeh, Saleh A; Chen, Chih-Chieh; Fang, Jia-You

2010-08-01

Lead compounds are known to cause cytotoxicity and genotoxicity. Lead absorption by the skin is an important route through which this metal enters the body. The purpose of this work was to evaluate the skin permeability and toxicological profiles of two lead species, lead acetate and lead nitrate. This study assessed lead-induced toxicity mechanisms by focusing on the histopathology, proteomics, cell growth, and cellular ATP. In vitro skin permeation assays showed that there was no significant difference of lead accumulation within and across the skin between the two lead species. The presence of simulated sweat reduced the skin uptake of lead. The skin deposition of lead acetate was greater than that of lead nitrate with in vivo topical application. On the other hand, lead nitrate produced greater changes in the skin's histology and proteomic profiles compared to lead acetate. Four protein spots which showed significant changes were identified and are discussed in this study. These included glucose-related protein precursor (GRP) 78, K14, alpha-actin, and Rho GDP-dissociation inhibitor 2 (RhoGDI2). These proteins are respectively associated with oxidative stress, apoptosis, wound healing, and proliferation. Lead presented a biphasic pattern on cell growth and intracellular ATP content, with a stimulating effect at low concentrations and an inhibitory effect on cell proliferation at higher concentrations. Copyright 2010 Elsevier Ireland Ltd. All rights reserved.

Radiation reaction in a continuous focusing channel

International Nuclear Information System (INIS)

Huang, Z.; Chen, P.; Ruth, R.D.

1995-01-01

We show that the radiation damping rate of the transverse action of a particle in a straight, continuous focusing system is independent of the particle energy, and that no quantum excitation is induced. This absolute damping effect leads to the existence of a transverse ground state to which the particle inevitably decays and yields the minimum beam emittance that one can ever attain, γε min =ℎ/2mc, limited only by the uncertainty principle. Because of adiabatic invariance, the particle can be accelerated along the focusing channel in its ground state without any radiation energy loss

Identifying Lead Markets in the European Automotive Industry

DEFF Research Database (Denmark)

Cleff, Thomas; Grimpe, Christoph; Rammer, Christian

2015-01-01

for automobiles and national markets differ considerably in their lead market potential. The German market is found to be most promising to serve as a lead market, while other European countries with a strong automotive tradition like France, Italy, the UK, and Sweden score lower. Our findings suggest that firms......This paper presents an indicator-based methodology to identify lead markets in the European automotive industry. The lead market approach tries to explain why certain countries are better positioned than others for developing and launching new products. While much research stresses the role...... of excellence in technology and interaction among users and producers, the lead market approach focuses on the role of demand characteristics. Based on the concept of innovation design, a lead market is defined as a country where customers prefer that design which subsequently becomes the globally dominant...

Optical microscope illumination analysis using through-focus scanning optical microscopy.

Science.gov (United States)

Attota, Ravi Kiran; Park, Haesung

2017-06-15

Misalignment of the aperture diaphragm present in optical microscopes results in angular illumination asymmetry (ANILAS) at the sample plane. Here we show that through-focus propagation of ANILAS results in a lateral image shift with a focus position. This could lead to substantial errors in quantitative results for optical methods that use through-focus images such as three-dimensional nanoparticle tracking, confocal microscopy, and through-focus scanning optical microscopy (TSOM). A correlation exists between ANILAS and the slant in TSOM images. Hence, the slant in the TSOM image can be used to detect, analyze, and rectify the presence of ANILAS.

Maritime Load Dependent Lead Times - An Analysis

DEFF Research Database (Denmark)

Pahl, Julia; Voss, Stefan

2017-01-01

in production. Inspired by supply chain planning systems, we analyze the current state of (collaborative) planning in the maritime transport chain with focus on containers. Regarding the problem of congestion, we particularly emphasize on load dependent lead times (LDLT) which are well studied in production....

SPIRE - combining SGI-110 with cisplatin and gemcitabine chemotherapy for solid malignancies including bladder cancer: study protocol for a phase Ib/randomised IIa open label clinical trial

OpenAIRE

Crabb, Simon; Caddy, Joshua; Dunkley, Denise; Rajaram, Jessica; Ellis, Deborah; Hill, Stephanie; Whitehead, Amy; Huddart, Robert; Griffiths, Gareth; Kalevras, Michail

2018-01-01

Background: urothelial bladder cancer (UBC) accounts for 10,000 new diagnoses and 5000 deaths annually in the UK (Cancer Research UK, http://www.cancerresearchuk.org/health-professional/cancer-statistics/statistics-by-cancer-type/bladder-cancer , Cancer Research UK, Accessed 26 Mar 2018). Cisplatin-based chemotherapy is standard of care therapy for UBC for both palliative first-line treatment of advanced/metastatic disease and radical neoadjuvant treatment of localised muscle invasive bladder...

The 1994 Forum on Appropriate Criteria and Methods for Seismic Design of Nuclear Piping

International Nuclear Information System (INIS)

Slagis, G.C.

1995-01-01

A record of the 1994 Forum on Appropriate Criteria and Methods for Seismic Design of Nuclear Piping is provided. The focus of the forum was the design-by-rule method for seismic design of piping. Issues such as acceptance criteria, ductility considerations, demonstration of margin, training, verification and costs were discussed. The use of earthquake experience data, including the recent Northridge earthquake, to justify a design-by-rule method was explored. The majority of the participants felt there are not significant advantages to developing a design-by-rule approach for new plant design. One major disadvantage was considered by many to be training. Extensive training will be required to properly implement a design-by-rule approach. Verification of designs was considered by the majority to be equally important for design-by-rule as for design-by-analysis. If a design-by-rule method is going to be effective, the method will have to be based on ductility considerations (UBC approach). A significant issue will be justification of seismic margins with liberal rules. The UBC approach is being questioned by some because of the recent structural cracking problems in the Northridge earthquake

Leading change: 2--planning.

Science.gov (United States)

Kerridge, Joanna

National initiatives have outlined the importance of involving frontline staff in service improvement, and the ability to influence and manage change has been identified as an essential skill for delivering new models of care. Nurses often have to take the lead in managing change in clinical practice. The second in a three-part series is designed to help nurses at all levels develop the knowledge and skills to function as change agents within their organisations. This article focuses on planning the change and dealing with resistance.

Wing Leading Edge Concepts for Noise Reduction

Science.gov (United States)

Shmilovich, Arvin; Yadlin, Yoram; Pitera, David M.

2010-01-01

This study focuses on the development of wing leading edge concepts for noise reduction during high-lift operations, without compromising landing stall speeds, stall characteristics or cruise performance. High-lift geometries, which can be obtained by conventional mechanical systems or morphing structures have been considered. A systematic aerodynamic analysis procedure was used to arrive at several promising configurations. The aerodynamic design of new wing leading edge shapes is obtained from a robust Computational Fluid Dynamics procedure. Acoustic benefits are qualitatively established through the evaluation of the computed flow fields.

Clinical Experiences of Korean Medicine Treatment against Urinary Bladder Cancer in General Practice

Directory of Open Access Journals (Sweden)

Taeyeol Park

2016-01-01

Full Text Available Urinary bladder cancer (UBC is one of the most common cancers, with 1 out of every 26 men and 1 out of every 80 women worldwide developing the disease during their lifetime. Moreover, it is a disease that predominantly affects the elderly and is becoming a major health problem as the elderly population continues to rapidly increase. In spite of the rapid development of medical science, the 5-year survival rate has remained around 75% since the 1990s, and the FDA has approved no new drugs for UBC over the last 10 years. In addition, most patients experience frequent recurrence and poor quality of life after diagnosis. Therefore, in order to solve unmet needs by alternative methods, we present our clinical cases of UBC where we observed outstanding results including regression and recurrence prevention exclusively through Traditional Korean Medicine such as (1 herbal therapy, (2 acupuncture, (3 pharmacopuncture and needle-embedding therapy, (4 moxibustion, and (5 cupping therapy. From our experience, it appears that multimodal strategies for synergistic efficiency are more effective than single Korean Medicine treatment. We hope this will encourage investigation of the efficacy of Korean Medicine treatment in clinical trials for UBC patients.

Evaluation of reference genes for real-time quantitative PCR studies in Candida glabrata following azole treatment

Directory of Open Access Journals (Sweden)

Li Qingdi

2012-06-01

Full Text Available Abstract Background The selection of stable and suitable reference genes for real-time quantitative PCR (RT-qPCR is a crucial prerequisite for reliable gene expression analysis under different experimental conditions. The present study aimed to identify reference genes as internal controls for gene expression studies by RT-qPCR in azole-stimulated Candida glabrata. Results The expression stability of 16 reference genes under fluconazole stress was evaluated using fold change and standard deviation computations with the hkgFinder tool. Our data revealed that the mRNA expression levels of three ribosomal RNAs (RDN5.8, RDN18, and RDN25 remained stable in response to fluconazole, while PGK1, UBC7, and UBC13 mRNAs showed only approximately 2.9-, 3.0-, and 2.5-fold induction by azole, respectively. By contrast, mRNA levels of the other 10 reference genes (ACT1, EF1α, GAPDH, PPIA, RPL2A, RPL10, RPL13A, SDHA, TUB1, and UBC4 were dramatically increased in C. glabrata following antifungal treatment, exhibiting changes ranging from 4.5- to 32.7-fold. We also assessed the expression stability of these reference genes using the 2-ΔΔCT method and three other software packages. The stability rankings of the reference genes by geNorm and the 2-ΔΔCT method were identical to those by hkgFinder, whereas the stability rankings by BestKeeper and NormFinder were notably different. We then validated the suitability of six candidate reference genes (ACT1, PGK1, RDN5.8, RDN18, UBC7, and UBC13 as internal controls for ten target genes in this system using the comparative CT method. Our validation experiments passed for all six reference genes analyzed except RDN18, where the amplification efficiency of RDN18 was different from that of the ten target genes. Finally, we demonstrated that the relative quantification of target gene expression varied according to the endogenous control used, highlighting the importance of the choice of internal controls in such

Chronic tinnitus and unipolar brush cell alterations in the cerebellum and dorsal cochlear nucleus.

Science.gov (United States)

Brozoski, Thomas; Brozoski, Daniel; Wisner, Kurt; Bauer, Carol

2017-07-01

Animal model research has shown that the central features of tinnitus, the perception of sound without an acoustic correlate, include elevated spontaneous and stimulus-driven activity, enhanced burst-mode firing, decreased variance of inter-spike intervals, and distortion of tonotopic frequency representation. Less well documented are cell-specific correlates of tinnitus. Unipolar brush cell (UBC) alterations in animals with psychophysical evidence of tinnitus has recently been reported. UBCs are glutamatergic interneurons that appear to function as local-circuit signal amplifiers. UBCs are abundant in the dorsal cochlear nucleus (DCN) and very abundant in the flocculus (FL) and paraflocculus (PFL) of the cerebellum. In the present research, two indicators of UBC structure and function were examined: Doublecortin (DCX) and epidermal growth factor receptor substrate 8 (Eps8). DCX is a protein that binds to microtubules where it can modify their assembly and growth. Eps8 is a cell-surface tyrosine kinase receptor mediating the response to epidermal growth factor; it appears to have a role in actin polymerization as well as cytoskeletal protein interactions. Both functions could contribute to synaptic remodeling. In the present research UBC Eps8 and DCX immunoreactivity (IR) were determined in 4 groups of rats distinguished by their exposure to high-level sound and psychophysical performance: Unexposed, exposed to high-level sound with behavioral evidence of tinnitus, and two exposed groups without behavioral evidence of tinnitus. Compared to unexposed controls, exposed animals with tinnitus had Eps8 IR elevated in their PFL; other structures were not affected, nor was DCX IR affected. This was interpreted as UBC upregulation in animals with tinnitus. Exposure that failed to produce tinnitus did not increase either Eps8 or DCX IR. Rather Eps8 IR was decreased in the FL and DCN of one subgroup (Least-Tinnitus), while DCX IR decreased in the FL of the other subgroup (No

Treated unicameral bone cysts.

Science.gov (United States)

Weinman, J; Servaes, S; Anupindi, S A

2013-06-01

Unicameral bone cysts (UBCs) are a common benign entity involving the metaphysis of growing bone, occurring within the first two decades of life. Assessment of these lesions, both before and after surgery, is performed routinely utilizing radiographs. We present a review of UBCs at various stages of treatment, including both successful and incomplete healing, and describe the imaging findings throughout their postoperative course. Copyright © 2012 The Royal College of Radiologists. Published by Elsevier Ltd. All rights reserved.

Influence of metformin intake on the risk of bladder cancer in type 2 diabetes patients

DEFF Research Database (Denmark)

Goossens, Maria E; Buntinx, Frank; Zeegers, Maurice P

2015-01-01

, SUs, insulin or more than one combination), all metformin users (1 + 2) was compared with SU only users using Cox proportional hazards models. The estimates were adjusted for age, gender, smoking status, BMI and diabetes duration. RESULTS: The inception cohort included 165,398 participants of whom 132...... users, even after adjustment for diabetes duration (HR = 1.13, 95% CI 0.90, 1.40). We found a pattern of decreasing risk of UBC with increasing duration of metformin intake, which was statistically not significant. CONCLUSION: Metformin has no influence on the risk of UBC compared with SU in type 2...... Practice Research Datalink (CPRD) including all patients with at least one prescription of oral anti-diabetic drugs (ADD) and/or insulin. The risk of UBC in different groups of ADD users (metformin alone (one), metformin in combination (two) with other ADD medication (glinides, glitazones, DPP-4-inhibitors...

Investigation and Evaluation of Children’s Blood Lead Levels around a Lead Battery Factory and Influencing Factors

Directory of Open Access Journals (Sweden)

Feng Zhang

2016-05-01

Full Text Available Lead pollution incidents have occurred frequently in mainland China, which has caused many lead poisoning incidents. This paper took a battery recycling factory as the subject, and focused on measuring the blood lead levels of environmental samples and all the children living around the factory, and analyzed the relationship between them. We collected blood samples from the surrounding residential area, as well as soil, water, vegetables. The atomic absorption method was applied to measure the lead content in these samples. The basic information of the generation procedure, operation type, habit and personal protect equipment was collected by an occupational hygiene investigation. Blood lead levels in 43.12% of the subjects exceeded 100 μg/L. The 50th and the 95th percentiles were 89 μg/L and 232 μg/L for blood lead levels in children, respectively, and the geometric mean was 94 μg/L. Children were stratified into groups by age, gender, parents’ occupation, distance and direction from the recycling plant. The difference of blood lead levels between groups was significant (p < 0.05. Four risk factors for elevated blood lead levels were found by logistic regression analysis, including younger age, male, shorter distance from the recycling plant, and parents with at least one working in the recycling plant. The rate of excess lead concentration in water was 6.25%, 6.06% in soil and 44.44% in leaf vegetables, which were all higher than the Chinese environment standards. The shorter the distance to the factory, the higher the value of BLL and lead levels in vegetable and environment samples. The lead level in the environmental samples was higher downwind of the recycling plant.

Expression of the Long Non-Coding RNA HOTAIR Correlates with Disease Progression in Bladder Cancer and Is Contained in Bladder Cancer Patient Urinary Exosomes.

Directory of Open Access Journals (Sweden)

Claudia Berrondo

Full Text Available Exosomes are 30-150nM membrane-bound secreted vesicles that are readily isolated from biological fluids such as urine (UEs. Exosomes contain proteins, micro RNA (miRNA, messenger RNA (mRNA, and long non-coding RNA (lncRNA from their cells of origin. Although miRNA, protein and lncRNA have been isolated from serum as potential biomarkers for benign and malignant disease, it is unknown if lncRNAs in UEs from urothelial bladder cancer (UBC patients can serve as biomarkers. lncRNAs are > 200 nucleotide long transcripts that do not encode protein and play critical roles in tumor biology. As the number of recognized tumor-associated lncRNAs continues to increase, there is a parallel need to include lncRNAs into biomarker discovery and therapeutic target algorithms. The lncRNA HOX transcript antisense RNA (HOTAIR has been shown to facilitate tumor initiation and progression and is associated with poor prognosis in several cancers. The importance of HOTAIR in cancer biology has sparked interest in using HOTAIR as a biomarker and potential therapeutic target. Here we show HOTAIR and several tumor-associated lncRNAs are enriched in UEs from UBC patients with high-grade muscle-invasive disease (HGMI pT2-pT4. Knockdown of HOTAIR in UBC cell lines reduces in vitro migration and invasion. Importantly, loss of HOTAIR expression in UBC cell lines alters expression of epithelial-to-mesenchyme transition (EMT genes including SNAI1, TWIST1, ZEB1, ZO1, MMP1 LAMB3, and LAMC2. Finally, we used RNA-sequencing to identify four additional lncRNAs enriched in UBC patient UEs. These data, suggest that UE-derived lncRNA may potentially serve as biomarkers and therapeutic targets.

Self-focusing of electron bunches in a nonlinear plasma

International Nuclear Information System (INIS)

Krasovitskii, V.B.; Osmolovsky, S.I.

1994-01-01

The phenomena of self-focusing of previously bunched electron beam in hot nonlinear plasma with the frequency which less than the plasma one is studied. It is established that influence of the Miller's force nonlinearity of the plasma don't leads to self-focusing breaking. However in the case of a dense beam, the appearance strong resonant electric field is followed by the change of the sign of the plasma dielectric constant to positive at the beam axis. But the dielectric constant remain negative at the outer of the beam

Preliminary Hazard Classification of the 1714-N, Lead Storage

International Nuclear Information System (INIS)

Kerr, N. R.

1999-01-01

The 1714-N, -NA and -NB is a building segment that was deactivated under the N Area Deactivation Project. During the deactivation the building was designated as an area to store recycled or reused lead products. This document presents the Preliminary Hazard Classification (PHC) for the continued storage of lead products by Bechtel Hanford, Inc. (BHI). Two types of hazardous substances are the focus of this PHC: lead and residual radiological contamination. An evaluation contained in this PHC concludes that there is little risk from the remaining hazardous substances. It was further concluded that standard institutional controls that are implemented under the BHI contract provide adequate protection to people and the environment. No further safety analysis documentation is required for the continued lead storage

"Common" lead isotopic measurements in silicate glasses and minerals by laser ablation double-focusing SC-ICPMS (2017)

Data.gov (United States)

Department of the Interior — This dataset is related to a 2017 journal article by A. J. Pietruszka and L. A. Neymark titled "Evaluation of laser ablation double-focusing SC-ICPMS for “common”...

LEADING EFFECTIVE MEETINGS IN A HOSPITALITY ORGANIZATION

Directory of Open Access Journals (Sweden)

Slobodan Ivanovic

2010-06-01

Full Text Available Today’s business environment demands of the individual manager to lead effective meetings. This is a skill which has to be studied and to be used and constantly optimized in order to keep the team focused on the goals that were set. Meetings keep track of a teams and the organizations goals that are being met or not being met. The specific focus of a certain meeting depends on what on what is to be achieved, whether that be setting goals or keeping evidence of what is being done, and to do this one needs the proper information tolead it correctly and efficiently.

Biochemical function of typical and variant Arabidopsis thaliana U-box E3 ubiquitin-protein ligases

DEFF Research Database (Denmark)

Wiborg, Jakob; O'Shea, Charlotte; Skriver, Karen

2008-01-01

of the distant U-box protein, AtPUB49, representing a large family of eukaryotic proteins containing a U-box linked to a cyclophilin-like peptidyl-prolyl cis-trans isomerase domain, was characterized biochemically. AtPUB49 functioned both as a prolyl isomerase and a chaperone by catalysing cis......The variance of the U-box domain in 64 Arabidopsis thaliana (thale cress) E3s (ubiquitin-protein ligases) was used to examine the interactions between E3s and E2s (ubiquitin-conjugating enzymes). E2s and E3s are components of the ubiquitin protein degradation pathway. Seven U-box proteins were...... analysed for their ability to ubiquitinate proteins in vitro in co-operation with different E2s. All U-box domains exhibited ubiquitination activity and interacted productively with UBC4/5-type E2s. Three and four of the U-box domains mediated ubiquitin addition in the presence of UBC13 and UBC7 E2s...

[Simultaneous existence of unicameral bone cysts involving the femur and ischium].

Science.gov (United States)

Makris, Vassilios; Papavasiliou, Kyriakos A; Bobos, Mattheos; Hytiroglou, Prodromos; Kirkos, John M; Kapetanos, George A

2009-01-01

We report a 30-year-old male patient with two unicameral bone cysts (UBC) simultaneously located in the proximal third of the right femur and ipsilateral ischium ramus, respectively. Fine needle biopsies were attempted for both lesions. Biopsy of the femoral lesion under local anesthesia was unsuccessful, so an open biopsy was performed which confirmed the diagnosis of UBC. Biopsy of the ischial lesion was not sufficient for diagnosis. Cytological examination of both specimens showed no other benign or malignant pathology. The femoral lesion was treated with intralesional (due to its large size) excision-curettage, bone grafting, and the introduction of a long gamma locking intramedullary nail to prevent the occurrence of a pathological fracture. The ischial lesion was left untreated and followed conservatively. The patient was free of any symptoms and complications three years postoperatively. This is the first report of an adult patient with UBCs simultaneously located both in a long tubular bone (femur) and a flat bone (ischium ramus).

Steroid injections in the treatment of humeral unicameral bone cysts: long-term follow-up and review of the literature.

Science.gov (United States)

Pavone, V; Caff, G; Di Silvestri, C; Avondo, S; Sessa, G

2014-05-01

Retrospective evaluation of long-term effectiveness of the steroid injections treatment in patients with unicameral bone cysts (UBC). From January 1993 to April 2005, 23 children affected by proximal humeral UBC were evaluated according to the Neer-Cole classification system and treated with serial methylprednisolone acetate's injections. The patients were followed up at 1, 3, 6 and 12 months and then every year until the adolescence. After treatment, in 15 out of 23 patients (65.2%), the humeral cysts were referred, respectively, as Grade 1 and in four as Grade 2. In 4 patients, a refracture occurred. Statistical analysis showed an overall good response in 82.6% of patients at the end of the follow-up. Minor complication including skin discoloration accounted for 13.04%. The steroid injections showed to be an alternative excellent treatment for UBC, with complete healing of the lesions in the majority of cases. This procedure is not expensive, mini-invasive, with low surgical risk and short hospitalization.

Atomic structure of the APC/C and its mechanism of protein ubiquitination

Science.gov (United States)

Yang, Jing; McLaughlin, Stephen H.; Barford, David

2015-01-01

The anaphase-promoting complex (APC/C) is a multimeric RING E3 ubiquitin ligase that controls chromosome segregation and mitotic exit. Its regulation by coactivator subunits, phosphorylation, the mitotic checkpoint complex, and interphase inhibitor Emi1 ensures the correct order and timing of distinct cell cycle transitions. Here, we used cryo-electron microscopy to determine atomic structures of APC/C-coactivator complexes with either Emi1 or a UbcH10-ubiquitin conjugate. These structures define the architecture of all APC/C subunits, the position of the catalytic module, and explain how Emi1 mediates inhibition of the two E2s UbcH10 and Ube2S. Definition of Cdh1 interactions with the APC/C indicates how they are antagonized by Cdh1 phosphorylation. The structure of the APC/C with UbcH10-ubiquitin reveals insights into the initiating ubiquitination reaction. Our results provide a quantitative framework for the design of experiments to further investigate APC/C functions in vivo. PMID:26083744

Leading Change with Slogans: Border University in Transition

Science.gov (United States)

Gonzales, Leslie D.; Pacheco, Arturo

2012-01-01

In this study, the authors problematize the use of slogans when it comes to leading major organizational change. Specifically, they outline the slogans that Border University leaders used to explain and justify the university's transition from a regional, primarily teaching-focused university to an aspiring nationally recognized, Tier One research…

High Performance Lead--free Piezoelectric Materials

OpenAIRE

Gupta, Shashaank

2013-01-01

Piezoelectric materials find applications in number of devices requiring inter-conversion of mechanical and electrical energy.  These devices include different types of sensors, actuators and energy harvesting devices. A number of lead-based perovskite compositions (PZT, PMN-PT, PZN-PT etc.) have dominated the field in last few decades owing to their giant piezoresponse and convenient application relevant tunability. With increasing environmental concerns, in the last one decade, focus has be...

Focusing mechanisms in the Pulselac CU accelerator

International Nuclear Information System (INIS)

Johnson, D.J.; Lockner, T.R.

1986-06-01

The post-acceleration of a 400 keV, 10 kA proton beam by a 200 kV magnetically insulated gap is investigated. The deflection from self and applied E and B fields are measured and compared to calculated values. We find that the beam is inadequately space-charge neutralized without gas puffs in regions of applied-B field to allow efficient transport. The beam is also non-current neutralized in these regions leading to self-magnetic deflection. The applied-B field is used to focus the beam both directly as a solenoidal lens and indirectly by defining the equipotential surfaces in the accelerating gap. It is also pointed out how azimuthal asymmetries in the beam current density and cathode plasma cause beam self-field asymmetries that lead to emittance growth. 4 refs., 4 figs

The role of prevention focus under stereotype threat: Initial cognitive mobilization is followed by depletion.

Science.gov (United States)

Ståhl, Tomas; Van Laar, Colette; Ellemers, Naomi

2012-06-01

Previous research has demonstrated that stereotype threat induces a prevention focus and impairs central executive functions. The present research examines how these 2 consequences of stereotype threat are related. The authors argue that the prevention focus is responsible for the effects of stereotype threat on executive functions and cognitive performance. However, because the prevention focus is adapted to deal with threatening situations, the authors propose that it also leads to some beneficial responses to stereotype threat. Specifically, because stereotype threat signals a high risk of failure, a prevention focus initiates immediate recruitment of cognitive control resources. The authors further argue that this response initially facilitates cognitive performance but that the additional cognitive demands associated with working under threat lead to cognitive depletion over time. Study 1 demonstrates that stereotype threat (vs. control) facilitates immediate cognitive control capacity during a stereotype-relevant task. Study 2 experimentally demonstrates the process by showing that stereotype threat (vs. control) facilitates cognitive control as a default, as well as when a prevention focus has been experimentally induced, but not when a promotion focus has been induced. Study 3 shows that stereotype threat facilitates initial math performance under a prevention focus, whereas no effect is found under a promotion focus. Consistent with previous research, however, stereotype threat impaired math performance over time under a prevention focus, but not under a promotion focus. 2012 APA, all rights reserved

A study of leading indicators for occupational health and safety management systems in healthcare.

Science.gov (United States)

Almost, Joan M; VanDenKerkhof, Elizabeth G; Strahlendorf, Peter; Caicco Tett, Louise; Noonan, Joanna; Hayes, Thomas; Van Hulle, Henrietta; Adam, Ryan; Holden, Jeremy; Kent-Hillis, Tracy; McDonald, Mike; Paré, Geneviève C; Lachhar, Karanjit; Silva E Silva, Vanessa

2018-04-23

In Ontario, Canada, approximately $2.5 billion is spent yearly on occupational injuries in the healthcare sector. The healthcare sector has been ranked second highest for lost-time injury rates among 16 Ontario sectors since 2009 with female healthcare workers ranked the highest among all occupations for lost-time claims. There is a great deal of focus in Ontario's occupational health and safety system on compliance and fines, however despite this increased focus, the injury statistics are not significantly improving. One of the keys to changing this trend is the development of a culture of healthy and safe workplaces including the effective utilization of leading indicators within Occupational Health and Safety Management Systems (OHSMSs). In contrast to lagging indicators, which focus on outcomes retrospectively, a leading indicator is associated with proactive activities and consists of selected OHSMSs program elements. Using leading indicators to measure health and safety has been common practice in high-risk industries; however, this shift has not occurred in healthcare. The aim of this project is to conduct a longitudinal study implementing six elements of the Ontario Safety Association for Community and Healthcare (OSACH) system identified as leading indicators and evaluating the effectiveness of this intervention on improving selected health and safety workplace indicators. A quasi-experimental longitudinal research design will be used within two Ontario acute care hospitals. The first phase of the study will focus on assessing current OHSMSs using the leading indicators, determining potential facilitators and barriers to changing current OHSMSs, and identifying the leading indicators that could be added or changed to the existing OHSMS in place. Phase I will conclude with the development of an intervention designed to support optimizing current OHSMSs in participating hospitals based on identified gaps. Phase II will pilot test and evaluate the tailored

Organizational change, patient-focused care: an Australian perspective.

Science.gov (United States)

Braithwaite, J

1995-08-01

Hospitals throughout the world are attempting to improve organizational performance through a variety of means. The focus in this paper is on a leading teaching hospital in Australia for a review of current management strategy. In a time of shrinking resources, management adopted a multi-faceted change management program including restructuring the organization, becoming more patient-focused via a product-line management approach and emphasising efficiency and cost-reduction measures. The next stage in management thinking is to place greater emphasis on patient-focused care. It is concluded this has the propensity to yield substantial further benefits, including improved financial and quality of care outcomes, in the Australian as well as the British and wider Organization for Economic Co-operation and Development (OECD) context. 'Professionally, we have committed ourselves to creating caring environments that promote healing. We cannot meet this goal until we make a commitment to be patient-focused and give up being nurse-focused or facility-focused' (Kerfort and LeClair, 1991). 'In a customer-driven [organization], the distribution of roles is different. The organization is decentralized, with responsibility delegated to those who until now have comprised the order-obeying bottom level of the pyramid. The traditional, hierarchical corporate structure, in other words, is beginning to give way to a flattened, more horizontal structure' (Carlzon, 1987).

European lead fast reactor (ELSY and LEADER projects)

International Nuclear Information System (INIS)

Alemberti, Alessandro; Carlsson, Johan; Malambu, Edouard; Orden, Alfredo; Cinotti, Luciano; Struwe, Dankward; Agostini, Pietro; Monti, Stefano

2010-01-01

The conceptual design of the European Lead Fast Reactor is being developed starting from September 2006, in the frame of the ELSY project. The ELSY reference design is a 600 MWe pool-type reactor cooled by pure lead. The ELSY project demonstrates the possibility of designing a competitive and safe fast critical reactor using simple engineered technical features, whilst fully complying with the Generation IV goal of sustainability and minor actinide (MA) burning capability. Sustainability was a leading criterion for option selection for core design, focusing on the demonstration of the potential to be self sustaining in plutonium and to burn its own generated MAs. To this end, different core configurations have been studied. Economics was a leading criterion for primary system design and plant layout. The use of a compact and simple primary circuit with the additional objective that all internal components be removable, are among the reactor features intended to assure competitive electric energy generation and long-term investment protection. Low capital cost and construction time are pursued through simplicity and compactness of the reactor building (reduced footprint and height). The reduced plant footprint is one of the benefits coming from the elimination of the Intermediate Cooling System, the low reactor building height is the result of the design approach which foresees the adoption of short-height components and two innovative DHR systems. Among the critical issues, the impact of the large mass of lead has been carefully analyzed; it has been demonstrated that the high density of lead can be mitigated by compact solutions and adoption of seismic isolators. Safety has been one of the major focuses all over the ELSY development. In addition to the inherent safety advantages of lead coolant (high boiling point and no exothermic reactions with air or water) a high safety grade of the overall system has been reached. In fact the overall primary system has been

In vivo x-ray fluorescence of bone lead in the study of human lead metabolism: Serum lead, whole blood lead, bone lead, and cumulative exposure

International Nuclear Information System (INIS)

Cake, K.M.; Chettle, D.R.; Webber, C.E.; Gordon, C.L.

1995-01-01

Traditionally, clinical studies of lead's effect on health have relied on blood lead levels to indicate lead exposure. However, this is unsatisfactory because blood lead levels have a half-life of approximately 5 weeks, and thus reflect recent exposure. Over 90% of the lead body burden is in bone, and it is thought to have a long residence time, thus implying that measurements of bone lead reflect cumulative exposure. So, measurements of bone lead are useful in understanding the long-term health effects of lead. Ahlgren reported the first noninvasive measurements of bone lead in humans, where γ-rays from 57 Co were used to excite the K series x-rays of lead. The lead detection system at McMaster University uses a 109 Cd source which is positioned at the center of the detector face (HPGe) and a near backscatter (∼160 degrees) geometry. This arrangement allows great flexibility, since one can sample lead in a range of different bone sites due to a robust normalization technique which eliminates the need to correct for bone geometry, thickness of overlying tissue, and other related factors. The effective radiation dose to an adult during an x-ray fluorescence bone lead measurement is extremely low, being 35 nSv. This paper addresses the issue of how bone, whole blood, and serum lead concentrations can be related in order to understand a person's lead exposure history

The tomato Fni3 lysine-63-specific ubiquitin-conjugating enzyme and suv ubiquitin E2 variant positively regulate plant immunity.

Science.gov (United States)

Mural, Ravi V; Liu, Yao; Rosebrock, Tracy R; Brady, Jennifer J; Hamera, Sadia; Connor, Richard A; Martin, Gregory B; Zeng, Lirong

2013-09-01

The activation of an immune response in tomato (Solanum lycopersicum) against Pseudomonas syringae relies on the recognition of E3 ligase-deficient forms of AvrPtoB by the host protein kinase, Fen. To investigate the mechanisms by which Fen-mediated immunity is regulated, we characterize in this study a Fen-interacting protein, Fni3, and its cofactor, S. lycoperiscum Uev (Suv). Fni3 encodes a homolog of the Ubc13-type ubiquitin-conjugating enzyme that catalyzes exclusively Lys-63-linked ubiquitination, whereas Suv is a ubiquitin-conjugating enzyme variant. The C-terminal region of Fen was necessary for interaction with Fni3, and this interaction was required for cell death triggered by overexpression of Fen in Nicotiana benthamiana leaves. Fni3 was shown to be an active E2 enzyme, but Suv displayed no ubiquitin-conjugating activity; Fni3 and Suv together directed Lys-63-linked ubiquitination. Decreased expression of Fni3, another tomato Ubc13 homolog, Sl-Ubc13-2, or Suv in N. benthamiana leaves diminished cell death associated with Fen-mediated immunity and cell death elicited by several other resistance (R) proteins and their cognate effectors. We also discovered that coexpression of Fen and other R proteins/effectors with a Fni3 mutant that is compromised for ubiquitin-conjugating activity diminished the cell death. These results suggest that Fni3/Sl-Ubc13-2 and Suv regulate the immune response mediated by Fen and other R proteins through Lys-63-linked ubiquitination.

Locking plate and fibular strut-graft augmentation in the reconstruction of unicameral bone cyst of proximal femur in the paediatric population.

Science.gov (United States)

Jamshidi, Khodamorad; Mirkazemi, Masoud; Izanloo, Azra; Mirzaei, Alireza

2018-01-01

Several therapeutic strategies have been used for managing unicameral bone cyst (UBC) of the proximal femur. However, there is insufficient evidence to support one treatment over another, and the optimal treatment is controversial. This study aims at describing our experience with surgical reconstruction of paediatric UBCs of the proximal femur using a proximal locking plate and fibular strut allograft. In total, 14 consecutive paediatric patients with Dormans types IB (four cases) and IIB (10 cases) UBC were assessed. Mean patient age was 8.6 ± 2.3 years, and mean follow-up period was 41.7 ± 29.8 months. Six patients (42.8%) were referred with a pathologic fracture. Clinical/radiological outcome and complication rates were evaluated at the final follow-up session. No cysts were Capanna's class III (recurrence) or IV (no response). Complete healing (Capanna's class I) was seen in ten cysts, while four other cysts healed with residual radiolucent areas (Capanna's class II). Mean healing period was 14.1 ± 5.1 (9-24 months). One patient had superficial infection, one heterotopic ossification, and one mild coxa vara, and mean Musculoskeletal Tumor Society (MSTS) score was 99.5%. According to our results, locking plate and fibular strut graft in Dormans classification types IB and IIB results in a favorable outcome in managing UBC of the proximal femur in the paediatric population.

DEVELOPMENT OF A VALIDATED MODEL FOR USE IN MINIMIZING NOx EMISSIONS AND MAXIMIZING CARBON UTILIZATION WHEN CO-FIRING BIOMASS WITH COAL

Energy Technology Data Exchange (ETDEWEB)

Larry G. Felix; P. Vann Bush; Stephen Niksa

2003-04-30

In full-scale boilers, the effect of biomass cofiring on NO{sub x} and unburned carbon (UBC) emissions has been found to be site-specific. Few sets of field data are comparable and no consistent database of information exists upon which cofiring fuel choice or injection system design can be based to assure that NOX emissions will be minimized and UBC be reduced. This report presents the results of a comprehensive project that generated an extensive set of pilot-scale test data that were used to validate a new predictive model for the cofiring of biomass and coal. All testing was performed at the 3.6 MMBtu/hr (1.75 MW{sub t}) Southern Company Services/Southern Research Institute Combustion Research Facility where a variety of burner configurations, coals, biomasses, and biomass injection schemes were utilized to generate a database of consistent, scalable, experimental results (422 separate test conditions). This database was then used to validate a new model for predicting NO{sub x} and UBC emissions from the cofiring of biomass and coal. This model is based on an Advanced Post-Processing (APP) technique that generates an equivalent network of idealized reactor elements from a conventional CFD simulation. The APP reactor network is a computational environment that allows for the incorporation of all relevant chemical reaction mechanisms and provides a new tool to quantify NOx and UBC emissions for any cofired combination of coal and biomass.

Steroid receptor coactivator-3 regulates glucose metabolism in bladder cancer cells through coactivation of hypoxia inducible factor 1α.

Science.gov (United States)

Zhao, Wei; Chang, Cunjie; Cui, Yangyan; Zhao, Xiaozhi; Yang, Jun; Shen, Lan; Zhou, Ji; Hou, Zhibo; Zhang, Zhen; Ye, Changxiao; Hasenmayer, Donald; Perkins, Robert; Huang, Xiaojing; Yao, Xin; Yu, Like; Huang, Ruimin; Zhang, Dianzheng; Guo, Hongqian; Yan, Jun

2014-04-18

Cancer cell proliferation is a metabolically demanding process, requiring high glycolysis, which is known as "Warburg effect," to support anabolic growth. Steroid receptor coactivator-3 (SRC-3), a steroid receptor coactivator, is overexpressed and/or amplified in multiple cancer types, including non-steroid targeted cancers, such as urinary bladder cancer (UBC). However, whether SRC-3 regulates the metabolic reprogramming for cancer cell growth is unknown. Here, we reported that overexpression of SRC-3 accelerated UBC cell growth, accompanied by the increased expression of genes involved in glycolysis. Knockdown of SRC-3 reduced the UBC cell glycolytic rate under hypoxia, decreased tumor growth in nude mice, with reduction of proliferating cell nuclear antigen and lactate dehydrogenase expression levels. We further revealed that SRC-3 could interact with hypoxia inducible factor 1α (HIF1α), which is a key transcription factor required for glycolysis, and coactivate its transcriptional activity. SRC-3 was recruited to the promoters of HIF1α-target genes, such as glut1 and pgk1. The positive correlation of expression levels between SRC-3 and Glut1 proteins was demonstrated in human UBC patient samples. Inhibition of glycolysis through targeting HK2 or LDHA decelerated SRC-3 overexpression-induced cell growth. In summary, overexpression of SRC-3 promoted glycolysis in bladder cancer cells through HIF1α to facilitate tumorigenesis, which may be an intriguing drug target for bladder cancer therapy.

Special Edition: Fighting Feminism – Organised Opposition to Women’s Rights; Guest Editors’ Introduction

Directory of Open Access Journals (Sweden)

Molly Dragiewicz

2016-06-01

Full Text Available This special issue presents a series of papers by scholars who participated in a workshop entitled ‘Men's Groups: Challenging Feminism’, which was held at the University of British Columbia (UBC, Canada, 26-27 May 2014. The workshop was organised by Susan B Boyd, Professor of Law and Chair in Feminist Legal Studies at the UBC Faculty of Law, and was sponsored by the Peter Wall Institute for Advanced Studies at UBC, the Peter A Allard School of Law, the Centre for Feminist Legal Studies at UBC, and the Canadian Journal of Women and the Law. The aim of the workshop was to bring together feminist scholars from multiple disciplines and multiple national contexts to explore a source of resistance to feminism that has been largely overlooked in scholarly research: the growing number of nationally situated and globally linked organisations acting in the name of men's rights and interests which contend that men are discriminated against in law, education and government funding, and that feminism is to blame for this. This special edition presents eight papers inspired by the workshop, authored by scholars from Canada, New Zealand, Poland, Sweden and the United States. A second special issue comprised of eight other papers inspired by the workshop was published in the Canadian Journal of Women and the Law as volume 28(1 in 2016.To find out more about this special edition, download the PDF file from this page.

What is a Leading Case in EU law? An empirical analysis

DEFF Research Database (Denmark)

Sadl, Urska; Panagis, Yannis

2015-01-01

Lawyers generally explain legal development by looking at explicit amendments to statutory law and modifications in judicial practice. As far as the latter are concerned, leading cases occupy a special place. This article empirically studies the process in which certain cases become leading cases....... Our analysis focuses on Les Verts, a case of considerable fame in EU law, closely scrutinising whether it contains inherent leading case material. We show how the legal relevance of a case can become “embedded” in a long process of reinterpretation by legal actors, and we demonstrate that the actual...

Low-Voltage Paper Isotachophoresis Device for DNA Focusing

Science.gov (United States)

Li, Xiang; Luo, Long; Crooks, Richard M.

2015-01-01

We present a new paper-based isotachophoresis (ITP) device design for focusing DNA samples having lengths ranging from 23 to at least 1517 bp. DNA is concentrated by more than two orders of magnitude within 4 min. The key component of this device is a 2 mm-long, 2 mm-wide circular paper channel formed by concertina folding a paper strip and aligning the circular paper zones on each layer. Due to the short channel length, a high electric field of ~16 kV/m is easily generated in the paper channel using two 9 V batteries. The multilayer architecture also enables convenient reclamation and analysis of the sample after ITP focusing by simply opening the origami paper and cutting out the desired layers. We profiled the electric field in the origami paper channel during ITP experiments using a nonfocusing fluorescent tracer. The result showed that focusing relies on formation and subsequent movement of a sharp electric field boundary between the leading and trailing electrolyte. PMID:26338530

Sparse Matrix for ECG Identification with Two-Lead Features

Directory of Open Access Journals (Sweden)

Kuo-Kun Tseng

2015-01-01

Full Text Available Electrocardiograph (ECG human identification has the potential to improve biometric security. However, improvements in ECG identification and feature extraction are required. Previous work has focused on single lead ECG signals. Our work proposes a new algorithm for human identification by mapping two-lead ECG signals onto a two-dimensional matrix then employing a sparse matrix method to process the matrix. And that is the first application of sparse matrix techniques for ECG identification. Moreover, the results of our experiments demonstrate the benefits of our approach over existing methods.

Plasma devices for focusing extreme light pulses

International Nuclear Information System (INIS)

Fuchs, J.; Gonoskov, A.A.; Nakatsutsumi, M.; Nazarov, W.; Quere, F.; Sergeev, A.M.; Yan, X.Q.

2014-01-01

Since the inception of the laser, there has been a constant push toward increasing the laser peak intensity, as this has lead to opening the exploration of new territories, and the production of compact sources of particles and radiation with unprecedented characteristics. However, increasing the peak laser intensity is usually performed by enhancing the produced laser properties, either by lowering its duration or increasing its energy, which involves a great level of complexity for the laser chain, or comes at great cost. Focusing tightly is another possibility to increase the laser intensity, but this comes at the risk of damaging the optics with target debris, as it requires their placement in close proximity to the interaction region. Plasma devices are an attractive, compact alternative to tightly focus extreme light pulses and further increase the final laser intensity. (authors)

The Z-pinch as plasma lens for the focusing of heavy ion beams

International Nuclear Information System (INIS)

Elfers, M.

1992-04-01

In the present thesis the influence of a Z-pinch plasma on the shape of heavy-ion beams and the for the understanding of this interaction most important plasma parameters were studied. For this the Z-pinch at the heavy-ion accelerator UNILAC was operated. The magnet field gradients of up to (25 ± 3) T/m occuring in the Z-pinch lead to the plasma-lens effect - the focusing of a charged-particle beam traversing axially the Z-pinch. In this thesis for the first time the focusing of a heavy-ion beam by the azimutal magnetic field of a Z-pinch is described. Different beams with an original diameter of 10 mm were focused. The smallest measured beam diameter amounts to 1 mm half-width. The beam energy amounts to 11.4 MeV/u, which leads at gold as projectile matter to a beam energy of 2.25 GeV. (orig./HSI) [de

Literature in Focus - “At the Leading Edge: the ATLAS and CMS LHC experiments”

CERN Document Server

CERN Library

2010-01-01

edited by Dan Green Too often descriptions of detectors focus on the “what” and not the “why”. This volume aims to elucidate how the requirements of the physics at the Large Hadron Collider (LHC) define the detector environment. In turn, the detector choices are made to adapt to that environment. The goal of LHC physics is to explore the mechanism for electroweak symmetry breaking. Because of the minuscule cross-sections which need to be explored, 0.1 fb, the LHC needs to provide 100 fb-1/yr, or an instantaneous luminosity of 1034 / (cm2 sec). With a bunch crossing interval of 25 nsec, well-matched to detector speeds, there will be 25 events occupying each bunch crossing. Thus the physics requires fast, finely segmented, low noise and radiation-resistant detectors which provide redundant measurements of the rarely produced electrons and muons. To achieve those goals, new ground was broken in constructing the A Toroidal LHC ApparatuS (ATLAS) and Compact Muon Soleno...

Hold Me Tight: An Emotionally-Focused Psychoeducational Group for Unmarried Couples

Directory of Open Access Journals (Sweden)

Sung-Hsien Sun

2015-12-01

Full Text Available The research study adapted the “Hold Me Tight” Couple Intervention Program for Taiwanese dating couples to repair and strengthen their relationships by targeting emotions and facilitating secure attachment in group settings. This program is based on Emotionally Focused Therapy (ETF. The program was lead by two lead facilitators, who have received international certification of Emotionally Focused Therapy, and by four co-facilitators. The intervention program consisted of five 1.5 elaboration-hour units. Each unit included three parts: elaboration of key concepts of EFT, dyadic exercises to help create emotional connections between partners, and group discussion to consolidate the change. This study conducted quantitative evaluations at five time points, including pre-, post-, one-month, three-month, and six-month follow-up assessment after the completion of the intervention program. Evaluations included the adult attachment scale, relationship satisfaction, and social awareness between the couple. Focus group interviews were also held two weeks after the group program ended. In total, 20 couples (total of 40 individuals participated in the program; among them, 12 females and 11 males completed the quantitative evaluation and 29 participants participated in the focus group interviews. The result showed that participants improved their attachment security, increased the awareness of partners’ interpersonal behaviors, and facilitated sharing and the acceptance of each other’s vulnerabilities. In the focus group interviews, participants reported positive feedback in reducing vicious cycles and established a sense of security with their partners. Limitations of the study and clinical implications specific to this population were discussed for future cultural adaptation intervention practice and research.

Successful treatment of unicameral bone cyst by single percutaneous injection of alpha-BSM.

Science.gov (United States)

Thawrani, Dinesh; Thai, Chia Che; Welch, Robert D; Copley, Lawson; Johnston, Charles E

2009-01-01

Unicameral bone cyst (UBC) is a benign bone lesion, recognized for its high rate of recurrence and need for repeat procedures to achieve healing. We hypothesized that the osteoconductive material apatitic calcium phosphate (alpha-BSM) could be effective in filling and stimulating resolution of UBC. The purpose of this study was to evaluate clinical and radiographic outcomes of UBC treated by a single injection of alpha-BSM. Thirteen patients (6 male, 7 female) with a mean age of 10.5 years, underwent single percutaneous injection of alpha-BSM for presumed UBC. The aspiration of the cysts was followed by vigorous saline lavage using 2 wide bore needles to disrupt the cyst walls. alpha-BSM "paste" was then injected under fluoroscopic guidance. Radiographs were digitized to measure cystic area (millimeter squares) on 2 orthogonal views. Healing was rated according to a modified Neer outcome grading system. Nine of the 13 patients had had pathologic fractures in the past. Eleven of the 13 patients had had past unsuccessful treatment: multiple steroid injections in 6, curettage and bone grafting in 3, and bone marrow and demineralized bone matrix (Grafton) injection in 2. Five cysts were grade 1 (healed 100%), 6 grade 2 (healed >50%), 2 grade 3 (healed <50% with increased cortical thickness), and none grade 4 (recurrence/enlargement). The average resolution of cystic area in 11/13 cysts was 85.7% at final follow-up of 35.8 months (P=0.0001) with 2.8 mm of average gain in cortical thickness (P=0.0018). None of the 13 lesions required an additional procedure or repeat injection. All patients were clinically asymptomatic at latest follow-up. This is the first study quantifying cyst resolution objectively according to actual decrease in area (millimeter squares). A single injection of alpha-BSM is a safe, minimally invasive and efficacious method to treat UBC in the pediatric population.

Effects of attentional focus on walking stability in elderly.

Science.gov (United States)

de Melker Worms, Jonathan L A; Stins, John F; van Wegen, Erwin E H; Verschueren, Sabine M P; Beek, Peter J; Loram, Ian D

2017-06-01

Balance performance in the elderly is related to psychological factors such as attentional focus. We investigated the effects of internal vs. external focus of attention and fall history on walking stability in healthy older adults. Walking stability of twenty-eight healthy older adults was assessed by applying random unilateral decelerations on a split-belt treadmill and analysing the resulting balance recovery movements. The internal focus instruction was: concentrate on the movement of your legs, whereas the external focus instruction was: concentrate on the movement of the treadmill. In both conditions participants were asked to look ahead at a screen. Outcome measures were coefficient of variation of step length and step width, and characteristics of the centre of mass velocity time-series as analysed using statistical parametric mapping. Fall history was assessed using a questionnaire. After each perturbation participants required two to three strides to regain a normal gait pattern, as determined by the centre of mass velocity response. No effects were found of internal and external focus of attention instructions and fall history on any of the outcome measures. We conclude that, compared to an internal focus of attention instruction, external focus to the walking surface does not lead to improved balance recovery responses to gait perturbations in the elderly. Copyright © 2017 Elsevier B.V. All rights reserved.

Inadequate environment, resources and values lead to missed nursing care: A focused ethnographic study on the surgical ward using the Fundamentals of Care framework.

Science.gov (United States)

Jangland, Eva; Teodorsson, Therese; Molander, Karin; Muntlin Athlin, Åsa

2018-06-01

To explore the delivery of care from the perspective of patients with acute abdominal pain focusing on the contextual factors at system level using the Fundamentals of Care framework. The Fundamentals of Care framework describes several contextual and systemic factors that can impact the delivery of care. To deliver high-quality, person-centred care, it is important to understand how these factors affect patients' experiences and care needs. A focused ethnographic approach. A total of 20 observations were performed on two surgical wards at a Swedish university hospital. Data were collected using participant observation and informal interviews and analysed using deductive content analysis. The findings, presented in four categories, reflect the value patients place on the caring relationship and a friendly atmosphere on the ward. Patients had concerns about the environment, particularly the high-tempo culture on the ward and its impact on their integrity, rest and sleep, access to information and planning, and need for support in addressing their existential thoughts. The observers also noted that missed nursing care had serious consequences for patient safety. Patients with acute abdominal pain were cared for in the high-tempo culture of a surgical ward with limited resources, unclear leadership and challenges to patients' safety. The findings highlight the crucial importance of prioritising and valuing the patients' fundamental care needs for recovery. Nursing leaders and nurses need to take the lead to reconceptualise the value of fundamental care in the acute care setting. To improve clinical practice, the value of fundamentals of care must be addressed regardless of patient's clinical condition. Providing a caring relationship is paramount to ensure a positive impact on patient's well-being and recovery. © 2017 John Wiley & Sons Ltd.

Leading and lagging indicators of occupational health and safety: The moderating role of safety leadership.

Science.gov (United States)

Sheehan, Cathy; Donohue, Ross; Shea, Tracey; Cooper, Brian; Cieri, Helen De

2016-07-01

In response to the call for empirical evidence of a connection between leading and lagging indicators of occupational health and safety (OHS), the first aim of the current research is to consider the association between leading and lagging indicators of OHS. Our second aim is to investigate the moderating effect of safety leadership on the association between leading and lagging indicators. Data were collected from 3578 employees nested within 66 workplaces. Multi-level modelling was used to test the two hypotheses. The results confirm an association between leading and lagging indicators of OHS as well as the moderating impact of middle management safety leadership on the direct association. The association between leading and lagging indicators provides OHS practitioners with useful information to substantiate efforts within organisations to move away from a traditional focus on lagging indicators towards a preventative focus on leading indicators. The research also highlights the important role played by middle managers and the value of OHS leadership development and investment at the middle management level. Copyright © 2016 Elsevier Ltd. All rights reserved.

Influence of focus of attention, reinvestment and fall history on elderly gait stability.

Science.gov (United States)

de Melker Worms, Jonathan L A; Stins, John F; van Wegen, Erwin E H; Loram, Ian D; Beek, Peter J

2017-01-01

Falls represent a substantial risk in the elderly. Previous studies have found that a focus on the outcome or effect of the movement (external focus of attention) leads to improved balance performance, whereas a focus on the movement execution itself (internal focus of attention) impairs balance performance in elderly. A shift toward more conscious, explicit forms of motor control occurs when existing declarative knowledge is recruited in motor control, a phenomenon called reinvestment. We investigated the effects of attentional focus and reinvestment on gait stability in elderly fallers and nonfallers. Full body kinematics was collected from twenty-eight healthy older adults walking on a treadmill, while focus of attention was manipulated through instruction. Participants also filled out the Movement Specific Reinvestment Scale (MSRS) and the Falls Efficacy Scale International (FES-I), and provided details about their fall history. Coefficients of Variation (CV) of spatiotemporal gait parameters and Local Divergence Exponents (LDE) were calculated as measures of gait variability and gait stability, respectively. Larger stance time CV and LDE (decreased gait stability) were found for fallers compared to nonfallers. No significant effect of attentional focus was found for the gait parameters, and no significant relation between MSRS score (reinvestment) and fall history was found. We conclude that external attention to the walking surface does not lead to improved gait stability in elderly. Potential benefits of an external focus of attention might not apply to gait, because walking movements are not geared toward achieving a distinct environmental effect. © 2017 The Authors. Physiological Reports published by Wiley Periodicals, Inc. on behalf of The Physiological Society and the American Physiological Society.

Total contribution of airborne lead to blood lead.

OpenAIRE

Manton, W I

1985-01-01

A nine year study of blood lead concentrations and isotope ratios carried out on a married couple shows that pulmonary deposition cannot account for all the airborne lead in blood; that lead from bone may comprise 70% of blood lead; and that during pregnancy blood lead may double due to mobilisation of lead from bone.

Fingerprinting for discriminating tea germplasm using inter-simple sequence repeat (ISSR) markers

International Nuclear Information System (INIS)

Liu, B.Y.; Li, Y.Y.; Wang, P.S.; Wang, L.Y.; Wang, P.S.

2012-01-01

For the discrimination of tea germplasm at the inter-specific level, 134 tea varieties preserved in the China National Germplasm Tea Repositories (CNGTR) were analyzed using inter simple sequence repeat (ISSR) markers. Eighteen primers were chosen from 60 screened for ISSR amplification, generating 99.4% polymorphic bands. The mean Nei's gene diversity (H) and the overall mean Shannon's Information index (I) were 0.396 and 0.578, respectively, indicating a wide gene pool. Using the presence, sometimes absence of unique ISSR markers, it was possible to discriminate 32 of the genotypes tested. No single primer could discriminate all the 134 genotypes. However, UBC811 provided rich band patterns and it can discriminate 35 genotypes. The combination of two and three primers could discriminate 99 and 121 genotypes, respectively. Furthermore, the combination of band patterns or the DNA fingerprinting based on specific ISSR markers generated by UBC811, UBC835, ISSR2 and ISSR3 could discriminate all 134 genotypes tested. ISSR markers also provide a powerful tool to discriminate tea germplasm at the inter-specific level. (author)

Total contribution of airborne lead to blood lead.

Science.gov (United States)

Manton, W I

1985-01-01

A nine year study of blood lead concentrations and isotope ratios carried out on a married couple shows that pulmonary deposition cannot account for all the airborne lead in blood; that lead from bone may comprise 70% of blood lead; and that during pregnancy blood lead may double due to mobilisation of lead from bone. PMID:3970881

Lead- or Lead-bismuth-cooled fast reactors

International Nuclear Information System (INIS)

Bouchter, J.C.; Courouau, J.L.; Dufour, P.; Guidez, J.; Latge, C.; Martinelli, L.; Renault, C.; Rimpault, G.

2014-01-01

Lead-cooled fast reactors are one of the 6 concepts retained for the 4. generation of nuclear reactors. So far no lead-cooled reactors have existed in the world except lead-bismuth-cooled reactors in soviet submarines. Some problems linked to the use of the lead-bismuth eutectic appeared but were satisfactorily solved by a more rigorous monitoring of the chemistry of the lead-bismuth coolant. Lead presents various advantages as a coolant: no reactivity with water and the air,a high boiling temperature and low contamination when irradiated. The main asset of the lead-bismuth alloy is the drop of the fusion temperature from 327 C degrees to 125 C degrees. The main drawback of using lead (or lead-bismuth) is its high corrosiveness with metals like iron, chromium and nickel. The high corrosiveness of the coolant implies low flow velocities which means a bigger core and consequently a bigger reactor containment. Different research programs in the world (in Europe, Russia and the USA) are reviewed in the article but it appears that the development of this type of reactor requires technological breakthroughs concerning materials and the resistance to corrosion. Furthermore the concept of lead-cooled reactors seems to be associated to a range of low output power because of the compromise between the size of the reactor and its resistance to earthquakes. (A.C.)

Lead in teeth from lead-dosed goats: Microdistribution and relationship to the cumulative lead dose

International Nuclear Information System (INIS)

Bellis, David J.; Hetter, Katherine M.; Jones, Joseph; Amarasiriwardena, Dula; Parsons, Patrick J.

2008-01-01

Teeth are commonly used as a biomarker of long-term lead exposure. There appear to be few data, however, on the content or distribution of lead in teeth where data on specific lead intake (dose) are also available. This study describes the analysis of a convenience sample of teeth from animals that were dosed with lead for other purposes, i.e., a proficiency testing program for blood lead. Lead concentration of whole teeth obtained from 23 animals, as determined by atomic absorption spectrometry, varied from 0.6 to 80 μg g -1 . Linear regression of whole tooth lead (μg g -1 ) on the cumulative lead dose received by the animal (g) yielded a slope of 1.2, with r 2 =0.647 (p -1 , were found in circumpulpal dentine. Linear regression of circumpulpal lead (μg g -1 ) on cumulative lead dose (g) yielded a slope of 23 with r 2 =0.961 (p=0.0001). The data indicated that whole tooth lead, and especially circumpulpal lead, of dosed goats increased linearly with cumulative lead exposure. These data suggest that circumpulpal dentine is a better biomarker of cumulative lead exposure than is whole tooth lead, at least for lead-dosed goats

A cost-saving statistically based screening technique for focused sampling of a lead-contaminated site

International Nuclear Information System (INIS)

Moscati, A.F. Jr.; Hediger, E.M.; Rupp, M.J.

1986-01-01

High concentrations of lead in soils along an abandoned railroad line prompted a remedial investigation to characterize the extent of contamination across a 7-acre site. Contamination was thought to be spotty across the site reflecting its past use in battery recycling operations at discrete locations. A screening technique was employed to delineate the more highly contaminated areas by testing a statistically determined minimum number of random samples from each of seven discrete site areas. The approach not only quickly identified those site areas which would require more extensive grid sampling, but also provided a statistically defensible basis for excluding other site areas from further consideration, thus saving the cost of additional sample collection and analysis. The reduction in the number of samples collected in ''clean'' areas of the site ranged from 45 to 60%

Navigating Rough Waters: A Synthesis of the Countervailing Pressures against Leading for Social Justice

Science.gov (United States)

Theoharis, George

2007-01-01

This article presents a synthesis of countervailing pressures against leading for social justice as described in the literature. This synthesis focuses on the present-day countervailing pressures that school leaders face as detailed in the literature on leading for social justice. These countervailing pressures include a deficit-thinking status…

Examining Career Success of Minority and Women Emergency Medical Technicians (EMTs): A LEADS Project

Science.gov (United States)

Russ-Eft, Darlene F.; Dickison, Philip D.; Levine, Roger

2008-01-01

Emergency medical technicians (EMTs) are a critical segment in prehospital medical care. This study examined EMT-paramedic career success focused on minorities and women, as part of the Longitudinal Emergency Medical Technician Attributes and Demographics Study (LEADS). The LEADS data come from a representative sampling of EMTs throughout the…

Self-focusing and Raman scattering of laser pulses in tenuous plasmas

International Nuclear Information System (INIS)

Antonsen, T.M. Jr.; Mora, P.

1993-01-01

The propagation and self-focusing of short, intense laser pulses in a tenuous plasma is studied both analytically and numerically. Specifically, pulses of length of the order of a few plasma wavelengths and of intensity, which is large enough for relativistic self-focusing to occur, are considered. Such pulses are of interest in various laser plasma acceleration schemes. It is found that these pulses are likely to be strongly affected by Raman instabilities. Two different regimes of instability, corresponding to large and small scattering angles, are found to be important. Small-angle scattering is perhaps the most severe since it couples strongly with relativistic self-focusing, leading the pulses to acquire significant axial and transverse structure in a time of the order of the self-focusing time. Thus it will be difficult to propagate smooth self-focused pulses through tenuous plasmas for distances longer than the Rayleigh length, except for pulse duration of the order of the plasma period

Proteasome, but not autophagy, disruption results in severe eye and wing dysmorphia: a subunit- and regulator-dependent process in Drosophila.

Science.gov (United States)

Velentzas, Panagiotis D; Velentzas, Athanassios D; Pantazi, Asimina D; Mpakou, Vassiliki E; Zervas, Christos G; Papassideri, Issidora S; Stravopodis, Dimitrios J

2013-01-01

Proteasome-dependent and autophagy-mediated degradation of eukaryotic cellular proteins represent the two major proteostatic mechanisms that are critically implicated in a number of signaling pathways and cellular processes. Deregulation of functions engaged in protein elimination frequently leads to development of morbid states and diseases. In this context, and through the utilization of GAL4/UAS genetic tool, we herein examined the in vivo contribution of proteasome and autophagy systems in Drosophila eye and wing morphogenesis. By exploiting the ability of GAL4-ninaE. GMR and P{GawB}Bx(MS1096) genetic drivers to be strongly and preferentially expressed in the eye and wing discs, respectively, we proved that proteasomal integrity and ubiquitination proficiency essentially control fly's eye and wing development. Indeed, subunit- and regulator-specific patterns of severe organ dysmorphia were obtained after the RNAi-induced downregulation of critical proteasome components (Rpn1, Rpn2, α5, β5 and β6) or distinct protein-ubiquitin conjugators (UbcD6, but not UbcD1 and UbcD4). Proteasome deficient eyes presented with either rough phenotypes or strongly dysmorphic shapes, while transgenic mutant wings were severely folded and carried blistered structures together with loss of vein differentiation. Moreover, transgenic fly eyes overexpressing the UBP2-yeast deubiquitinase enzyme were characterized by an eyeless-like phenotype. Therefore, the proteasome/ubiquitin proteolytic activities are undoubtedly required for the normal course of eye and wing development. In contrast, the RNAi-mediated downregulation of critical Atg (1, 4, 7, 9 and 18) autophagic proteins revealed their non-essential, or redundant, functional roles in Drosophila eye and wing formation under physiological growth conditions, since their reduced expression levels could only marginally disturb wing's, but not eye's, morphogenetic organization and architecture. However, Atg9 proved indispensable for

Proteasome, but not autophagy, disruption results in severe eye and wing dysmorphia: a subunit- and regulator-dependent process in Drosophila.

Directory of Open Access Journals (Sweden)

Panagiotis D Velentzas

Full Text Available Proteasome-dependent and autophagy-mediated degradation of eukaryotic cellular proteins represent the two major proteostatic mechanisms that are critically implicated in a number of signaling pathways and cellular processes. Deregulation of functions engaged in protein elimination frequently leads to development of morbid states and diseases. In this context, and through the utilization of GAL4/UAS genetic tool, we herein examined the in vivo contribution of proteasome and autophagy systems in Drosophila eye and wing morphogenesis. By exploiting the ability of GAL4-ninaE. GMR and P{GawB}Bx(MS1096 genetic drivers to be strongly and preferentially expressed in the eye and wing discs, respectively, we proved that proteasomal integrity and ubiquitination proficiency essentially control fly's eye and wing development. Indeed, subunit- and regulator-specific patterns of severe organ dysmorphia were obtained after the RNAi-induced downregulation of critical proteasome components (Rpn1, Rpn2, α5, β5 and β6 or distinct protein-ubiquitin conjugators (UbcD6, but not UbcD1 and UbcD4. Proteasome deficient eyes presented with either rough phenotypes or strongly dysmorphic shapes, while transgenic mutant wings were severely folded and carried blistered structures together with loss of vein differentiation. Moreover, transgenic fly eyes overexpressing the UBP2-yeast deubiquitinase enzyme were characterized by an eyeless-like phenotype. Therefore, the proteasome/ubiquitin proteolytic activities are undoubtedly required for the normal course of eye and wing development. In contrast, the RNAi-mediated downregulation of critical Atg (1, 4, 7, 9 and 18 autophagic proteins revealed their non-essential, or redundant, functional roles in Drosophila eye and wing formation under physiological growth conditions, since their reduced expression levels could only marginally disturb wing's, but not eye's, morphogenetic organization and architecture. However, Atg9 proved

The Tomato Fni3 Lysine-63–Specific Ubiquitin-Conjugating Enzyme and Suv Ubiquitin E2 Variant Positively Regulate Plant Immunity[C][W

Science.gov (United States)

Mural, Ravi V.; Liu, Yao; Rosebrock, Tracy R.; Brady, Jennifer J.; Hamera, Sadia; Connor, Richard A.; Martin, Gregory B.; Zeng, Lirong

2013-01-01

The activation of an immune response in tomato (Solanum lycopersicum) against Pseudomonas syringae relies on the recognition of E3 ligase–deficient forms of AvrPtoB by the host protein kinase, Fen. To investigate the mechanisms by which Fen-mediated immunity is regulated, we characterize in this study a Fen-interacting protein, Fni3, and its cofactor, S. lycoperiscum Uev (Suv). Fni3 encodes a homolog of the Ubc13-type ubiquitin-conjugating enzyme that catalyzes exclusively Lys-63–linked ubiquitination, whereas Suv is a ubiquitin-conjugating enzyme variant. The C-terminal region of Fen was necessary for interaction with Fni3, and this interaction was required for cell death triggered by overexpression of Fen in Nicotiana benthamiana leaves. Fni3 was shown to be an active E2 enzyme, but Suv displayed no ubiquitin-conjugating activity; Fni3 and Suv together directed Lys-63–linked ubiquitination. Decreased expression of Fni3, another tomato Ubc13 homolog, Sl-Ubc13-2, or Suv in N. benthamiana leaves diminished cell death associated with Fen-mediated immunity and cell death elicited by several other resistance (R) proteins and their cognate effectors. We also discovered that coexpression of Fen and other R proteins/effectors with a Fni3 mutant that is compromised for ubiquitin-conjugating activity diminished the cell death. These results suggest that Fni3/Sl-Ubc13-2 and Suv regulate the immune response mediated by Fen and other R proteins through Lys-63–linked ubiquitination. PMID:24076975

Comprehensive gene expression profiling reveals synergistic functional networks in cerebral vessels after hypertension or hypercholesterolemia.

Directory of Open Access Journals (Sweden)

Wei-Yi Ong

Full Text Available Atherosclerotic stenosis of cerebral arteries or intracranial large artery disease (ICLAD is a major cause of stroke especially in Asians, Hispanics and Africans, but relatively little is known about gene expression changes in vessels at risk. This study compares comprehensive gene expression profiles in the middle cerebral artery (MCA of New Zealand White rabbits exposed to two stroke risk factors i.e. hypertension and/or hypercholesterolemia, by the 2-Kidney-1-Clip method, or dietary supplementation with cholesterol. Microarray and Ingenuity Pathway Analyses of the MCA of the hypertensive rabbits showed up-regulated genes in networks containing the node molecules: UBC (ubiquitin, P38 MAPK, ERK, NFkB, SERPINB2, MMP1 and APP (amyloid precursor protein; and down-regulated genes related to MAPK, ERK 1/2, Akt, 26 s proteasome, histone H3 and UBC. The MCA of hypercholesterolemic rabbits showed differentially expressed genes that are surprisingly, linked to almost the same node molecules as the hypertensive rabbits, despite a relatively low percentage of 'common genes' (21 and 7% between the two conditions. Up-regulated common genes were related to: UBC, SERPINB2, TNF, HNF4A (hepatocyte nuclear factor 4A and APP, and down-regulated genes, related to UBC. Increased HNF4A message and protein were verified in the aorta. Together, these findings reveal similar nodal molecules and gene pathways in cerebral vessels affected by hypertension or hypercholesterolemia, which could be a basis for synergistic action of risk factors in the pathogenesis of ICLAD.

Bone cysts: unicameral and aneurysmal bone cyst.

Science.gov (United States)

Mascard, E; Gomez-Brouchet, A; Lambot, K

2015-02-01

Simple and aneurysmal bone cysts are benign lytic bone lesions, usually encountered in children and adolescents. Simple bone cyst is a cystic, fluid-filled lesion, which may be unicameral (UBC) or partially separated. UBC can involve all bones, but usually the long bone metaphysis and otherwise primarily the proximal humerus and proximal femur. The classic aneurysmal bone cyst (ABC) is an expansive and hemorrhagic tumor, usually showing characteristic translocation. About 30% of ABCs are secondary, without translocation; they occur in reaction to another, usually benign, bone lesion. ABCs are metaphyseal, excentric, bulging, fluid-filled and multicameral, and may develop in all bones of the skeleton. On MRI, the fluid level is evocative. It is mandatory to distinguish ABC from UBC, as prognosis and treatment are different. UBCs resolve spontaneously between adolescence and adulthood; the main concern is the risk of pathologic fracture. Treatment in non-threatening forms consists in intracystic injection of methylprednisolone. When there is a risk of fracture, especially of the femoral neck, surgery with curettage, filling with bone substitute or graft and osteosynthesis may be required. ABCs are potentially more aggressive, with a risk of bone destruction. Diagnosis must systematically be confirmed by biopsy, identifying soft-tissue parts, as telangiectatic sarcoma can mimic ABC. Intra-lesional sclerotherapy with alcohol is an effective treatment. In spinal ABC and in aggressive lesions with a risk of fracture, surgical treatment should be preferred, possibly after preoperative embolization. The risk of malignant transformation is very low, except in case of radiation therapy. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

Comprehensive Gene Expression Profiling Reveals Synergistic Functional Networks in Cerebral Vessels after Hypertension or Hypercholesterolemia

Science.gov (United States)

Ong, Wei-Yi; Ng, Mary Pei-Ern; Loke, Sau-Yeen; Jin, Shalai; Wu, Ya-Jun; Tanaka, Kazuhiro; Wong, Peter Tsun-Hon

2013-01-01

Atherosclerotic stenosis of cerebral arteries or intracranial large artery disease (ICLAD) is a major cause of stroke especially in Asians, Hispanics and Africans, but relatively little is known about gene expression changes in vessels at risk. This study compares comprehensive gene expression profiles in the middle cerebral artery (MCA) of New Zealand White rabbits exposed to two stroke risk factors i.e. hypertension and/or hypercholesterolemia, by the 2-Kidney-1-Clip method, or dietary supplementation with cholesterol. Microarray and Ingenuity Pathway Analyses of the MCA of the hypertensive rabbits showed up-regulated genes in networks containing the node molecules: UBC (ubiquitin), P38 MAPK, ERK, NFkB, SERPINB2, MMP1 and APP (amyloid precursor protein); and down-regulated genes related to MAPK, ERK 1/2, Akt, 26 s proteasome, histone H3 and UBC. The MCA of hypercholesterolemic rabbits showed differentially expressed genes that are surprisingly, linked to almost the same node molecules as the hypertensive rabbits, despite a relatively low percentage of ‘common genes’ (21 and 7%) between the two conditions. Up-regulated common genes were related to: UBC, SERPINB2, TNF, HNF4A (hepatocyte nuclear factor 4A) and APP, and down-regulated genes, related to UBC. Increased HNF4A message and protein were verified in the aorta. Together, these findings reveal similar nodal molecules and gene pathways in cerebral vessels affected by hypertension or hypercholesterolemia, which could be a basis for synergistic action of risk factors in the pathogenesis of ICLAD. PMID:23874591

Assessment of range of uric and serum biomarkers in determination of bladder cancer severity

Directory of Open Access Journals (Sweden)

Popkov V.M.

2013-12-01

Full Text Available Purpose: to establish efficiency of a range of uric and serum biomarkers of bladder cancer for diagnostics and the prognosis of risk of development of disease recurrence. Material and methods: TPA and TPS, VEGF level research in blood serum, UBC in urine in 176 people, among which 135 patients with bladder cancer (RMP have been conducted. Group of comparison has included16 patients (patients with cystitis. The control group has been made of 25 almost healthy men. 75 patients had non-muscle invasive RMP (Ta-1N0M0. Results. It has been statistically determined that reliable growth of of TPA, TPS in blood serum and UBC in urine in patients with non-muscle invasive RMP in comparison with patients in groups of control and comparison has been established. The increase of UBC in urine of patients of this group with recurrence of tumoral growth within a year has been noted. In comparison with cytological research of urine sedimentation, molecular markers of RMP (the uric UBC and serum TPA, TPS possess diagnostic sensitivity, allow to confirm the presence of disease, to carry out diagnostics of stages of organ and extra invasion. RMP is possible to consider as an additional prognostic serum marker increase in the VEGF level in blood serum. Conclusion. Inclusion in diagnostic process in the clinical research of biomarkers showed that identification of NMIRMP increased from 18,1% in 2006 to 55,6% in 2011. The chosen volume of complex treatment allowed to reduce recurrence and lethality in the first two years from 32 to 15,5%.

CD147 and MCT1-potential partners in bladder cancer aggressiveness and cisplatin resistance.

Science.gov (United States)

Afonso, Julieta; Santos, Lúcio L; Miranda-Gonçalves, Vera; Morais, António; Amaro, Teresina; Longatto-Filho, Adhemar; Baltazar, Fátima

2015-11-01

The relapsing and progressive nature of bladder tumors, and the heterogeneity in the response to cisplatin-containing regimens, are the major concerns in the care of urothelial bladder carcinoma (UBC) patients. The metabolic adaptations that alter the tumor microenvironment and thus contribute to chemoresistance have been poorly explored in UBC setting. We found significant associations between the immunoexpressions of the microenvironment-related molecules CD147, monocarboxylate transporters (MCTs) 1 and 4, CD44 and CAIX in tumor tissue sections from 114 UBC patients. The presence of MCT1 and/or MCT4 expressions was significantly associated with unfavorable clinicopathological parameters. The incidence of CD147 positive staining significantly increased with advancing stage, grade and type of lesion, and occurrence of lymphovascular invasion. Similar associations were observed when considering the concurrent expression of CD147 and MCT1. This expression profile lowered significantly the 5-year disease-free and overall survival rates. Moreover, when selecting patients who received platinum-based chemotherapy, the prognosis was significantly worse for those with MCT1 and CD147 positive tumors. CD147 specific silencing by small interfering RNAs (siRNAs) in UBC cells was accompanied by a decrease in MCT1 and MCT4 expressions and, importantly, an increase in chemosensitivity to cisplatin. Our results provide novel insights for the involvement of CD147 and MCTs in bladder cancer progression and resistance to cisplatin-based chemotherapy. We consider that the possible cooperative role of CD147 and MCT1 in determining cisplatin resistance should be further explored as a potential theranostics biomarker. © 2014 Wiley Periodicals, Inc.

A complex regulatory network coordinating cell cycles during C. elegans development is revealed by a genome-wide RNAi screen.

Science.gov (United States)

Roy, Sarah H; Tobin, David V; Memar, Nadin; Beltz, Eleanor; Holmen, Jenna; Clayton, Joseph E; Chiu, Daniel J; Young, Laura D; Green, Travis H; Lubin, Isabella; Liu, Yuying; Conradt, Barbara; Saito, R Mako

2014-02-28

The development and homeostasis of multicellular animals requires precise coordination of cell division and differentiation. We performed a genome-wide RNA interference screen in Caenorhabditis elegans to reveal the components of a regulatory network that promotes developmentally programmed cell-cycle quiescence. The 107 identified genes are predicted to constitute regulatory networks that are conserved among higher animals because almost half of the genes are represented by clear human orthologs. Using a series of mutant backgrounds to assess their genetic activities, the RNA interference clones displaying similar properties were clustered to establish potential regulatory relationships within the network. This approach uncovered four distinct genetic pathways controlling cell-cycle entry during intestinal organogenesis. The enhanced phenotypes observed for animals carrying compound mutations attest to the collaboration between distinct mechanisms to ensure strict developmental regulation of cell cycles. Moreover, we characterized ubc-25, a gene encoding an E2 ubiquitin-conjugating enzyme whose human ortholog, UBE2Q2, is deregulated in several cancers. Our genetic analyses suggested that ubc-25 acts in a linear pathway with cul-1/Cul1, in parallel to pathways employing cki-1/p27 and lin-35/pRb to promote cell-cycle quiescence. Further investigation of the potential regulatory mechanism demonstrated that ubc-25 activity negatively regulates CYE-1/cyclin E protein abundance in vivo. Together, our results show that the ubc-25-mediated pathway acts within a complex network that integrates the actions of multiple molecular mechanisms to control cell cycles during development. Copyright © 2014 Roy et al.

Brief Report: Effect of a Focused Imitation Intervention on Social Functioning in Children with Autism

Science.gov (United States)

Ingersoll, Brooke

2012-01-01

Imitation is an early skill thought to play a role in social development, leading some to suggest that teaching imitation to children with autism should lead to improvements in social functioning. This study used a randomized controlled trial to evaluate the effect of a focused imitation intervention on initiation of joint attention and…

The optimum lead thickness for lead-activation detectors

International Nuclear Information System (INIS)

Si Fenni; Hu Qingyuan

2009-01-01

The optimum lead thickness for lead-activation detectors has been studied in this paper. First existence of the optimum lead thickness is explained theoretically. Then the optimum lead thickness is obtained by two methods, MCNP5 calculation and mathematical estimation. At last factors which affect the optimum lead thickness are discussed. It turns out that the optimum lead thickness is irrelevant to incident neutron energies. It is recommended 2.5 cm generally.

Determination of the Regional Economy Leading Sectors in Indonesia

Directory of Open Access Journals (Sweden)

Fitri Amalia

2015-03-01

Full Text Available Economic growth and its process are the main condition for the sustainability of the regional economic development. Because of the continuing population growth means economic needs also increase so that additional revenue required each year. This can be obtained by the increase in aggregate output (goods and services or the Gross Regional Domestic Product (GRDP each year. To carry out development with limited resources as a consequence should be focused to develop the sectors that provide great multiplier effect on other sectors or the whole economy. This research is focused to determine the regional leading sector of Bone Bolango as the information and considerations in planning economic development. Location Quotient (LQ and Shift Share are tools of analysis. Location Quotient analysis indicates agriculture, manufacture, finance, leasing and corporate services are base sectors in the Bone Bolango district. Shift Share analysis indicates that the competitive sectors are finance, leasing and corporate services. The results of the analysis based on three analysis tools indicate that the leading sector with the criteria developed, base, and competitive is finance and services sector.

Leading change: 1--identifying the issue.

Science.gov (United States)

Kerridge, Joanna

To enable sustainable change, nurses need to take the lead in managing it. Recent national initiatives have emphasised the importance of frontline staff in service improvement. The ability to influence and manage change has been identified as an essential skill for delivering new models of care. This article is the first in a three-part series designed to help nurses at all levels develop the knowledge and skills they will need to initiate and manage change. This article focuses on identifying what needs to be changed and why.

Exploring the thoughts and attentional focus of music students under pressure

NARCIS (Netherlands)

Oudejans, Raôul R.D.; Spitse, Anne; Kralt, Elmer; Bakker, Frank C.

2017-01-01

Musicians often play under circumstances in which pressure may lead to anxiety and performance deterioration. Theories suggest that a drop in performance is due to a shift in focus of attention towards task-irrelevant information. In this study, we asked music students to report what they think and

Histone H1 couples initiation and amplification of ubiquitin signalling after DNA damage

DEFF Research Database (Denmark)

Thorslund, Tina; Ripplinger, Anita; Hoffmann, Saskia

2015-01-01

DNA double-strand breaks (DSBs) are highly cytotoxic DNA lesions that trigger non-proteolytic ubiquitylation of adjacent chromatin areas to generate binding sites for DNA repair factors. This depends on the sequential actions of the E3 ubiquitin ligases RNF8 and RNF168 (refs 1-6), and UBC13 (also...... known as UBE2N), an E2 ubiquitin-conjugating enzyme that specifically generates K63-linked ubiquitin chains. Whereas RNF168 is known to catalyse ubiquitylation of H2A-type histones, leading to the recruitment of repair factors such as 53BP1 (refs 8-10), the critical substrates of RNF8 and K63-linked...

Leading Change: How Boards and Presidents Build Exceptional Academic Institutions

Science.gov (United States)

MacTaggart, Terrence

2011-01-01

In a time of transformation in higher education, "Leading Change: How Boards and Presidents Build Exceptional Institutions" fills a significant void in leadership literature and focuses on the changing level of board engagement. This book examines 18 institutions, across the spectrum of higher education, at which the board played a…

Current topics in DNA double-strand break repair

International Nuclear Information System (INIS)

Kobayashi, Junya; Takata, Minoru; Iwabuchi, Kuniyoshi; Miyagawa, Kiyoshi; Sonoda, Eiichiro; Suzuki, Keiji; Tauchi, Hiroshi

2008-01-01

DNA double strand break (DSB) is one of the most critical types of damage which is induced by ionizing radiation. In this review, we summarize current progress in investigations on the function of DSB repair-related proteins. We focused on recent findings in the analysis of the function of proteins such as 53BP1, histone H2AX, Mus81-Eme1, Fanc complex, and UBC13, which are found to be related to homologous recombination repair or to non-homologous end joining. In addition to the function of these proteins in DSB repair, the biological function of nuclear foci formation following DSB induction is discussed. (author)

Lead poisoning

Energy Technology Data Exchange (ETDEWEB)

Beijers, J A

1952-01-01

Three cases of acute lead poisoning of cattle herds via ingestion are reported, and reference is made to several other incidents of lead in both humans and animals. The quantity of lead which was found in the livers of the dead cows varied from 6.5 to 19 mg/kg, while 1160 mg/kg of lead in the liver was found for a young cow which was poisoned experimentally with 5 gms of lead acetate per day; hence, there appears to be great variability in the amounts deposited that can lead to intoxication and death. No evidence was found for a lead seam around the teeth, prophyrinuria, or basophil granules in the erythrocytes during acute or chronic lead poisoning of cattle or horses examined. Reference is made to attempts of finding the boundary line between increased lead absorption and lead intoxication in humans, and an examination of 60 laborers in an offset-printing office containing a great deal of inhalable lead (0.16 to 1.9 mg/cu m air) is reviewed. Physical deviation, basophylic granulation of erythrocytes, increased lead content of the urine, and porphyrinuria only indicate an increased absorption of lead; the use of the term intoxication is justified if, in addition, there are complaints of lack of appetite, constipation, fatigue, abdominal pain, and emaciation.

Dual identities: organizational negotiation in STEM-focused Catholic schools

Science.gov (United States)

Kloser, Matthew; Wilsey, Matthew; Hopkins, Dawn W.; Dallavis, Julie W.; Lavin, Erin; Comuniello, Michael

2017-06-01

In the last decade, STEM-focused schools have opened their doors nationally in the hope of meeting students' contemporary educational needs. Despite the growth of these STEM-focused institutions, minimal research exists that follows how schools make a transition toward a STEM focus and what organizational structures are most conducive to a successful transition. The adoption of a STEM focus has clear implications for a school's organizational identity. For Catholic schools, the negotiation of a new STEM focus is especially complex, as Catholic schools have been shown to generally possess a distinct religious and cultural organizational identity. The adoption of a second, STEM-focused identity raises questions about whether and how these identities can coexist. Framed by perspectives on organizational identity and existing conceptualizations of the cultural and religious hallmarks of Catholic schools, this study utilizes a multiple-case study design to explore the organizational transition of four Catholic K-8 institutions to Catholic STEM-focused schools. These cases demonstrate the particular challenges of negotiating multiple organizational identities. While variation existed in how the four schools accommodated these identities, the most promising environments for successful transition drew upon an aggregative model of identity negotiation, that is, when schools attended to both identities, but ensured that the original Catholic identity of the school remained foundational to all decisions. The least successful identity negotiations occurred when there was a lack of common understanding about what comprised a STEM-focused school, leading to minimal buy-in from stakeholders or when a school sought to make the transition for recruitment or marketing rather than mission-driven reasons. Discussion of the more successful identity aggregation provides a framework for schools within and beyond the religious sector that desire to adopt an additional STEM-focused

Continuous particle focusing in a waved microchannel using negative dc dielectrophoresis

KAUST Repository

Li, Ming

2012-07-26

We present a waved microchannel for continuous focusing of microparticles and cells using negative direct current (dc) dielectrophoresis. The waved channel is composed of consecutive s-shaped curved channels in series to generate an electric field gradient required for the dielectrophoretic effect. When particles move electrokinetically through the channel, the experienced negative dielectrophoretic forces alternate directions within two adjacent semicircular microchannels, leading to a focused continuous-flow stream along the channel centerline. Both the experimentally observed and numerically simulated results of the focusing performance are reported, which coincide acceptably in proportion to the specified dimensions (i.e. inlet and outlet of the waved channel). How the applied electric field, particle size and medium concentration affect the performance was studied by focusing polystyrene microparticles of varying sizes. As an application in the field of biology, the focusing of yeast cells in the waved mcirochannel was tested. This waved microchannel shows a great potential for microflow cytometry applications and is expected to be widely used before different processing steps in lab-on-A-chip devices with integrated functions. © 2012 IOP Publishing Ltd.

Screening children for elevated blood lead - Learnings from the literature

International Nuclear Information System (INIS)

Boreland, Frances; Lyle, David

2008-01-01

Introduction: Although it is important that children at risk of developing elevated blood lead receive regular screening, attendance at screening programs is variable. A literature review was undertaken to better understand the factors that affect carers' decisions about whether or not to take their children for blood lead screening. Method: Electronic databases (Medline, EMBASE, CINAHL, Psychinfo) were searched to identify relevant publications, supported by reviewing reference lists of identified articles and searching with internet-based search engines. Results: Thirty-four published studies dealing with blood lead screening rates were identified, of which only seven papers focused specifically on parent's attitudes to blood lead screening. The barriers to and enablers of screening for elevated blood lead levels appear to be similar to those identified for other screening programs. Discussion: It is recommended that attendance at screening be routinely monitored, and that where participation is suboptimal further research be undertaken, in close co-operation with affected communities or sub-groups, to determine how best to encourage screening and to protect children from lead. It is important to minimize stigma and to ensure, as far as possible, that practical barriers such as lack of transport do not restrict access to screening programs

Leading a Recovery-oriented Social Enterprise.

Science.gov (United States)

Raeburn, Toby; Hungerford, Catherine; Sayers, Jan; Escott, Phil; Lopez, Violeta; Cleary, Michelle

2015-05-01

Recovery-oriented mental health services promote the principles of recovery, such as hope and optimism, and are characterized by a personalized approach to developing consumer self-determination. Nurse leaders are increasingly developing such services as social enterprises, but there is limited research on the leadership of these programs. Leading a recovery-oriented mental health nurse social enterprise requires visionary leadership, collaboration with consumers and local health providers, financial viability, and commitment to recovery-focused practice. This article describes the framework of an Australian mental health nursing social enterprise, including the service attributes and leadership lessons that have been learned from developing program sustainability.

Biosorption of lead phosphates by lead-tolerant bacteria as a mechanism for lead immobilization.

Science.gov (United States)

Rodríguez-Sánchez, Viridiana; Guzmán-Moreno, Jesús; Rodríguez-González, Vicente; Flores-de la Torre, Juan Armando; Ramírez-Santoyo, Rosa María; Vidales-Rodríguez, Luz Elena

2017-08-01

The study of metal-tolerant bacteria is important for bioremediation of contaminated environments and development of green technologies for material synthesis due to their potential to transform toxic metal ions into less toxic compounds by mechanisms such as reduction, oxidation and/or sequestration. In this study, we report the isolation of seven lead-tolerant bacteria from a metal-contaminated site at Zacatecas, México. The bacteria were identified as members of the Staphylococcus and Bacillus genera by microscopic, biochemical and 16S rDNA analyses. Minimal inhibitory concentration of these isolates was established between 4.5 and 7.0 mM of Pb(NO 3 ) 2 in solid and 1.0-4.0 mM of Pb(NO 3 ) 2 in liquid media. A quantitative analysis of the lead associated to bacterial biomass in growing cultures, revealed that the percentage of lead associated to biomass was between 1 and 37% in the PbT isolates. A mechanism of complexation/biosorption of lead ions as inorganic phosphates (lead hydroxyapatite and pyromorphite) in bacterial biomass, was determined by Fourier transform infrared spectroscopy and X-ray diffraction analyses. Thus, the ability of the lead-tolerant isolates to transform lead ions into stable and highly insoluble lead minerals make them potentially useful for immobilization of lead in mining waste.

Lead and Cadmium: Priorities for action from UNEP’s perspective for addressing risks posed by these two heavy metals

Directory of Open Access Journals (Sweden)

Piper D.

2013-04-01

Full Text Available The United Nations Environment Programme (UNEP has been focusing on actions with regard to lead and cadmium since 2001 when the work of the Partnership for Clean Fuels and Vehicles (PCFV was initiated. The development and finalization of the reviews of scientific information on lead and cadmium facilitated discussions among Governments in relation to the need for global action with regard to these heavy metals. UNEP continues to address priority areas for focusing to reduce risks posed by lead and cadmium. The Global Alliance to Eliminate Lead Paint (GAELP is a clear example for addressing those risks; however more work is expected to be done in relation to these key issues.

Human geography of New Orleans' high-lead geochemical setting.

Science.gov (United States)

Campanella, Richard; Mielke, Howard W

2008-12-01

Previous soil lead studies in New Orleans focused on the geochemical footprint and its health impacts. This study examines the human geography of race, income, and age in pre-Katrina metropolitan New Orleans within the context of lead accumulation in soils. Sample points of soil lead data (n = 5,467) collected in 1998-2000 were mapped in a geographic information system (GIS), binned into 9 ranges, and queried by (1) 2000 Census racial demographic data, (2) 1999 median household income, and (3) 2000 age data. The absolute population generally declines as lead levels increase except at lead levels from 200-400 to 400-1,000 mg/kg when population increases; the African-American population comprises a disproportionate share of this cohort. The high-lead areas occur in the inner city, home to the largest populations of African-Americans in New Orleans. The mean household income curve indicates that lower economic groups are at risk to higher levels of lead. A total of 44,701 children under the age of 5 years, plus 123,579 children aged 5-17, lived in census block groups containing at least one sample point with over 100 mg/kg lead, and these include 23,124 and 64,064 young people, respectively, who live near at least one point over 400 mg/kg. Lead exposure affects a panoply of outcomes that influence the health and welfare of the community. Unless corrected, children are likely to return to the same or, because of lack of lead-safe practices during renovation, even higher exposure risks than before the flooding of New Orleans.

Advancement on Lead-Free Organic-Inorganic Halide Perovskite Solar Cells: A Review.

Science.gov (United States)

Sani, Faruk; Shafie, Suhaidi; Lim, Hong Ngee; Musa, Abubakar Ohinoyi

2018-06-14

Remarkable attention has been committed to the recently discovered cost effective and solution processable lead-free organic-inorganic halide perovskite solar cells. Recent studies have reported that, within five years, the reported efficiency has reached 9.0%, which makes them an extremely promising and fast developing candidate to compete with conventional lead-based perovskite solar cells. The major challenge associated with the conventional perovskite solar cells is the toxic nature of lead (Pb) used in the active layer of perovskite material. If lead continues to be used in fabricating solar cells, negative health impacts will result in the environment due to the toxicity of lead. Alternatively, lead free perovskite solar cells could give a safe way by substituting low-cost, abundant and non toxic material. This review focuses on formability of lead-free organic-inorganic halide perovskite, alternative metal cations candidates to replace lead (Pb), and possible substitutions of organic cations, as well as halide anions in the lead-free organic-inorganic halide perovskite architecture. Furthermore, the review gives highlights on the impact of organic cations, metal cations and inorganic anions on stability and the overall performance of lead free perovskite solar cells.

Clarifying beliefs underlying hunter intentions to support a ban on lead shot

Science.gov (United States)

Schroeder, Susan A.; Fulton, David C.; Doncarlos, Kathy

2016-01-01

Shot from hunting adds toxic lead to environments worldwide. Existing lead shot regulations have been instituted with little understanding of hunter beliefs and attitudes. This study applied the Theory of Reasoned Action, using a multilevel, multivariate approach, to clarify how positive and negative beliefs relate to attitudes about a ban on lead shot. Structure coefficients and commonality analysis were employed to further examine relationships between beliefs and attitudes. Results suggest that while both positive and negative outcomes influence attitudes, positive outcomes were more influential for supporters and negative beliefs for opposers. Management may need to focus on the results from hunters who indicated that they would be unlikely to support a ban, as these hunters include those who may actively oppose additional efforts to regulate lead.

The role of osteoblast cells in the pathogenesis of unicameral bone cysts.

Science.gov (United States)

Aarvold, Alexander; Smith, James O; Tayton, Edward R; Edwards, Caroline J; Fowler, Darren J; Gent, Edward D; Oreffo, Richard O C

2012-08-01

The pathogenesis of unicameral bone cysts (UBCs) remains largely unknown. Osteoclasts have been implicated, but the role of osteoblastic cells has, to date, not been explored. This study investigated the pathophysiology of UBCs by examining the interactions between the cyst fluid and human bone marrow stromal cells (hBMSCs) and the effect of the fluid on osteogenesis. Fluid was aspirated from two UBCs and analysed for protein, electrolyte and cytokine levels. Graded concentrations of the fluid were used as culture media for hBMSCs to determine the effects of the fluid on hBMSC proliferation and osteogenic differentiation. The fibrocellular lining was analysed histologically and by electron microscopy. Alkaline phosphatase (ALP) staining of hBMSCs that were cultured in cyst fluid demonstrated increased cell proliferation and osteogenic differentiation compared to basal media controls. Biochemical analysis of these hBMSCs compared to basal controls confirmed a marked increase in DNA content (as a marker of proliferation) and ALP activity (as a marker of osteogenic differentiation) which was highly significant (p < 0.001). Osteoclasts were demonstrated in abundance in the cyst lining. The cyst fluid cytokine profile revealed levels of the pro-osteoclast cytokines IL-6, MIP-1α and MCP-1 that were 19×, 31× and 35× greater than those in reference serum. Cyst fluid promoted osteoblastic growth and differentiation. Despite appearing paradoxical that the cyst fluid promoted osteogenesis, osteoblastic cells are required for osteoclastogenesis through RANKL signalling. Three key cytokines in this pathway (IL-6, MIP-1α, MCP-1) were highly elevated in cyst fluid. These findings may hold the key to the pathogenesis of UBCs, with implications for treatment methods.

Immobilization of Cu2 + and Cd2 + by earthworm manure derived biochar in acidic circumstance

Institute of Scientific and Technical Information of China (English)

Zhanghong Wang; Fei Shen; Dekui Shen; Yahui Jiang; Rui Xiao

2017-01-01

Earthworm manure,the by-product obtained from the disposing of biowastes by earthworm breeding,is largely produced and employed as a feedstock for biochar preparation through pyrolysis.For repairing acidic soil or acidic electroplating effluent,biochar physicochemical properties would suffer from some changes like an acidic washing process,which hence affected its application functions.Pristine biochar (UBC)from pyrolysis of earthworm manure at 700℃ and biochar treated by HCl (WBC) were comparatively investigated regarding their physicochemical properties,adsorption capability and adsorption mechanism of Cu2+ and Cd2+ from aqueous solution to explore the immobilization characteristics ofbiochar in acidic environment.After HCl treatment,the soluble ash content and phenolic-OH in the WBC sample was notably decreased against the increase of the carboxyl C==O,aromatic C=C and Si-O-Si,compared to that of UBC.All adsorption processes can be well described by Langmuir isotherm model.The calculated maximum adsorption capacity of Cu2+ and Cd2+ adsorption on UBC were 36.56and 29.31 mg/g,respectively,which were higher than that of WBC (8.64 and 12.81 mg/g,respectively),indicating that HCl treatment significantly decreased biochar adsorption ability.Mechanism analysis revealed that alkali and alkaline earth metallic,salts (carbonates,phosphates and silicates),and surface functional groups were responsible for UBC adsorption,corresponding to ion exchange,precipitation and complexation,respectively.However,ion exchange made little contributions to WBC adsorption due to the great loss of soluble ash content.WBC adsorption was mainly attributed to the abundant exposure of silicates and surface functional groups (carboxyl C==O and aromatic C=C).

Reference gene selection for molecular studies of dormancy in wild oat (Avena fatua L. caryopses by RT-qPCR method.

Directory of Open Access Journals (Sweden)

Izabela Ruduś

Full Text Available Molecular studies of primary and secondary dormancy in Avena fatua L., a serious weed of cereal and other crops, are intended to reveal the species-specific details of underlying molecular mechanisms which in turn may be useable in weed management. Among others, quantitative real-time PCR (RT-qPCR data of comparative gene expression analysis may give some insight into the involvement of particular wild oat genes in dormancy release, maintenance or induction by unfavorable conditions. To assure obtaining biologically significant results using this method, the expression stability of selected candidate reference genes in different data subsets was evaluated using four statistical algorithms i.e. geNorm, NormFinder, Best Keeper and ΔCt method. Although some discrepancies in their ranking outputs were noticed, evidently two ubiquitin-conjugating enzyme homologs, AfUBC1 and AfUBC2, as well as one homolog of glyceraldehyde 3-phosphate dehydrogenase AfGAPDH1 and TATA-binding protein AfTBP2 appeared as more stably expressed than AfEF1a (translation elongation factor 1α, AfGAPDH2 or the least stable α-tubulin homolog AfTUA1 in caryopses and seedlings of A. fatua. Gene expression analysis of a dormancy-related wild oat transcription factor VIVIPAROUS1 (AfVP1 allowed for a validation of candidate reference genes performance. Based on the obtained results it can be recommended that the normalization factor calculated as a geometric mean of Cq values of AfUBC1, AfUBC2 and AfGAPDH1 would be optimal for RT-qPCR results normalization in the experiments comprising A. fatua caryopses of different dormancy status.

Reference gene selection for molecular studies of dormancy in wild oat (Avena fatua L.) caryopses by RT-qPCR method.

Science.gov (United States)

Ruduś, Izabela; Kępczyński, Jan

2018-01-01

Molecular studies of primary and secondary dormancy in Avena fatua L., a serious weed of cereal and other crops, are intended to reveal the species-specific details of underlying molecular mechanisms which in turn may be useable in weed management. Among others, quantitative real-time PCR (RT-qPCR) data of comparative gene expression analysis may give some insight into the involvement of particular wild oat genes in dormancy release, maintenance or induction by unfavorable conditions. To assure obtaining biologically significant results using this method, the expression stability of selected candidate reference genes in different data subsets was evaluated using four statistical algorithms i.e. geNorm, NormFinder, Best Keeper and ΔCt method. Although some discrepancies in their ranking outputs were noticed, evidently two ubiquitin-conjugating enzyme homologs, AfUBC1 and AfUBC2, as well as one homolog of glyceraldehyde 3-phosphate dehydrogenase AfGAPDH1 and TATA-binding protein AfTBP2 appeared as more stably expressed than AfEF1a (translation elongation factor 1α), AfGAPDH2 or the least stable α-tubulin homolog AfTUA1 in caryopses and seedlings of A. fatua. Gene expression analysis of a dormancy-related wild oat transcription factor VIVIPAROUS1 (AfVP1) allowed for a validation of candidate reference genes performance. Based on the obtained results it can be recommended that the normalization factor calculated as a geometric mean of Cq values of AfUBC1, AfUBC2 and AfGAPDH1 would be optimal for RT-qPCR results normalization in the experiments comprising A. fatua caryopses of different dormancy status.

Study on de-coating used beverage cans with thick sulfuric acid for recycle

International Nuclear Information System (INIS)

Wang, Minghua; Woo, Kee-Do; Kim, Dong-Keon; Ma, Lirong

2007-01-01

More than 1800 hundreds of millions of beverage cans are manufactured yearly over the world, which will pollute the globe environment without recycle. The recycle and regeneration estates of used beverage cans are highly profitable enterprises. Vacuum technologies are mature on a large scale today, and therefore, the re-melting process of used beverage cans (UBCs) does not have to use flux. Furthermore, the coating on UBCs becomes the key factor causing poor product quality. The present paper concerns removing the coating of UBCs and compares two different kinds of methods to remove the coating: a thermal method and a chemical reagent method. A new kind of reagent, thick sulfuric acid, was employed in the chemical reagent de-coating process. The de-coating ratio in the thermal method reached 93% at most, but the de-coating ratio reached 100% within 30 min in the chemical reagent method by using thick sulfuric acid. Recycling the used thick sulfuric acid was also supplied. A titanium yellow product can be simultaneously obtained. The experiments show that the chemical reagent method is more available than the thermal method, which will enhance the purity of the regeneration product enormously

Unicameral bone cysts: comparison of percutaneous curettage, steroid, and autologous bone marrow injections.

Science.gov (United States)

Canavese, Federico; Wright, James G; Cole, William G; Hopyan, Sevan

2011-01-01

The purpose of this study was to compare the outcome of percutaneous curettage with intralesional injection of methylprednisolone and bone marrow for unicameral bone cysts (UBCs). This was a retrospective review of 46 children and adolescents with UBC treated with autologous bone marrow injection, methylprednisolone acetate injection or percutaneous curettage alone. Inclusion criteria were a radiological diagnosis of UBC and at least 24 months follow-up from the last procedure. Healing was determined using Neer/Cole 4-grades rating scale. The 3 treatment groups were comparable with regard to age, sex, location of the cyst, and the number of procedures undertaken. At 2 years follow-up, the proportion of patients with satisfactory healing (Neer/Cole grades I and II) was greatest among those who underwent percutaneous curettage (70%) compared with bone marrow injection (21%) and methylprednisolone acetate injection (41%) (P = 0.03). We found no association between healing and age (P = 0.80) nor between healing and sex (P = 0.61). These results suggest that mechanical disruption of the cyst membrane may be helpful in healing of cysts and that this technique may be preferred to simple intralesional injections. Level III.

Main: 2AAK [RPSD[Archive

Lifescience Database Archive (English)

Full Text Available Molecule: Ubiquitin Conjugating Enzyme; Chain: Null; Synonym: Ubc1; Engineered: Yes Ubiquitin Conjugation 6....TPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD arabi_2AAK.jpg ...

Focusing ethnography

DEFF Research Database (Denmark)

Woermann, Niklas

2018-01-01

underpinnings of focusing ethnographic research by comparing different schools of thought and suggesting a practice theory-based approach. It argues that many research projects are focused but do not reflect on the process of focusing, describes how to identify focal settings or practices, and introduces......Building theory with ethnography and filmic research increasingly requires focussing on key practices or settings, instead of painting a broad panorama of a culture. But few authors discuss why and how to focus. This article provides a systematic discussion of the theoretical and methodological...

NRC/UBC fuelling station with intelligent compression

International Nuclear Information System (INIS)

Dada, A.; Boyd, B.; Law, L.; Semczyszyn, D.

2004-01-01

BOC Canada Ltd. will design, integrate and construct the second fueling station on the Hydrogen Highway. This station will be located at the National Research Council's Institute for Fuel Cell Innovation on the campus of the University of British Columbia. BOC's design will bring together an existing alkaline electrolyser, new compression, storage and dispensing. The station will be designed to serve fuel cell passenger vehicles using 350-bar storage. However, the flexible design concept will allow for many other user needs including the potential for servicing larger vehicles, as well as filling portable storage systems for use at satellite stations. The novel station design also offers the potential to fuel from multiple hydrogen sources. Together with NRC, this fueling station will be used to increase public, consumer and investor awareness of hydrogen technologies. Design and construction of this facility will assist in the development of industry codes and standards and familiarize authorities having jurisdiction with hydrogen fueling. The system concept offers the utmost attention to safety, novelty and flexibility. (author)

Purification of SUMO conjugating enzymes and kinetic analysis of substrate conjugation

Science.gov (United States)

Yunus, Ali A.; Lima, Christopher D.

2009-01-01

SUMO conjugation to protein substrates requires the concerted action of a dedicated E2 ubiquitin conjugation enzyme (Ubc9) and associated E3 ligases. Although Ubc9 can directly recognize and modify substrate lysine residues that occur within a consensus site for SUMO modification, E3 ligases can redirect specificity and enhance conjugation rates during SUMO conjugation in vitro and in vivo. In this chapter, we will describe methods utilized to purify SUMO conjugating enzymes and model substrates which can be used for analysis of SUMO conjugation in vitro. We will also describe methods to extract kinetic parameters during E3-dependent or E3-independent substrate conjugation. PMID:19107417

Adolescent asthmatics' needs and preferences regarding medication counseling: results from online focus groups.

NARCIS (Netherlands)

Koster, E.S.; Philbert, D.; Dijk, L. van; Vries, T.W. de; Bouvy, M.L.

2014-01-01

Background: In adolescents, non-adherence is a major problem and leads to uncontrolled disease. Objectives: To assess adolescents needs and preferences regarding counseling and support with focus on use of new media. Methods: Asthmatic adolescents needs and preferences were examined by means of

Adolescent asthmatics' needs and preferences regarding medication counseling: Results from online focus groups

NARCIS (Netherlands)

Koster, Ellen S.; Philbert, Daphne; Van Dijk, Liset L.; De Vries, Tjalling W.; Bouvy, Marcel L.

2014-01-01

Background: In adolescents, non-adherence is a major problem and leads to uncontrolled disease. Objectives: To assess adolescents needs and preferences regarding counseling and support with focus on use of new media. Methods: Asthmatic adolescents needs and preferences were examined by means of

Focused Ethnography

Directory of Open Access Journals (Sweden)

Hubert Knoblauch

2005-09-01

Full Text Available In this paper I focus on a distinctive kind of sociological ethnography which is particularly, though not exclusively, adopted in applied research. It has been proposed that this branch of ethno­graphy be referred to as focused ethnography. Focused ethnography shall be delineated within the context of other common conceptions of what may be called conventional ethnography. However, rather than being opposed to it, focused ethno­graphy is rather complementary to conventional ethnography, particularly in fields that are charac­teristic of socially and functionally differentiated contemporary society. The paper outlines the back­ground as well as the major methodological features of focused ethnography, such as short-term field visits, data intensity and time intensity, so as to provide a background for future studies in this area. URN: urn:nbn:de:0114-fqs0503440

Leading Change: Jesuit Higher Education in the Twenty-First Century

Science.gov (United States)

Lowdon, Melissa

2010-01-01

This study explored perceptions of possible future scenarios for Jesuit higher education in the United States by the year 2030. This study focused on two questions, (a) How do leaders perceive the future of Jesuit higher education? and (b) What key factors identified by these leaders will lead to the most desirable outcome for Jesuit higher…

Analysis of neighborhood behavior in lead optimization and array design.

Science.gov (United States)

Papadatos, George; Cooper, Anthony W J; Kadirkamanathan, Visakan; Macdonald, Simon J F; McLay, Iain M; Pickett, Stephen D; Pritchard, John M; Willett, Peter; Gillet, Valerie J

2009-02-01

Neighborhood behavior describes the extent to which small structural changes defined by a molecular descriptor are likely to lead to small property changes. This study evaluates two methods for the quantification of neighborhood behavior: the optimal diagonal method of Patterson et al. and the optimality criterion method of Horvath and Jeandenans. The methods are evaluated using twelve different types of fingerprint (both 2D and 3D) with screening data derived from several lead optimization projects at GlaxoSmithKline. The principal focus of the work is the design of chemical arrays during lead optimization, and the study hence considers not only biological activity but also important drug properties such as metabolic stability, permeability, and lipophilicity. Evidence is provided to suggest that the optimality criterion method may provide a better quantitative description of neighborhood behavior than the optimal diagonal method.

Screening children for elevated blood lead - Learnings from the literature

Energy Technology Data Exchange (ETDEWEB)

Boreland, Frances [Broken Hill Centre for Remote Health Research, Broken Hill University Department of Rural Health, University of Sydney, Corrindah Court, PO Box 457, Broken Hill, NSW 2880 (Australia)], E-mail: fboreland@gwahs.health.nsw.gov.au; Lyle, David [Broken Hill Centre for Remote Health Research, Broken Hill University Department of Rural Health, University of Sydney, Corrindah Court, PO Box 457, Broken Hill, NSW 2880 (Australia)], E-mail: dlyle@gwahs.health.nsw.gov.au

2008-02-01

Introduction: Although it is important that children at risk of developing elevated blood lead receive regular screening, attendance at screening programs is variable. A literature review was undertaken to better understand the factors that affect carers' decisions about whether or not to take their children for blood lead screening. Method: Electronic databases (Medline, EMBASE, CINAHL, Psychinfo) were searched to identify relevant publications, supported by reviewing reference lists of identified articles and searching with internet-based search engines. Results: Thirty-four published studies dealing with blood lead screening rates were identified, of which only seven papers focused specifically on parent's attitudes to blood lead screening. The barriers to and enablers of screening for elevated blood lead levels appear to be similar to those identified for other screening programs. Discussion: It is recommended that attendance at screening be routinely monitored, and that where participation is suboptimal further research be undertaken, in close co-operation with affected communities or sub-groups, to determine how best to encourage screening and to protect children from lead. It is important to minimize stigma and to ensure, as far as possible, that practical barriers such as lack of transport do not restrict access to screening programs.

2009 Community College Futures Assembly Focus: Leading Change--Leading in an Uncertain Environment

Science.gov (United States)

Campbell, Dale F.; Morris, Phillip A.

2009-01-01

The Community College Futures Assembly has served as a national, independent policy thinktank since 1995. Its purpose is to articulate the critical issues facing American community colleges and recognize innovative programs. Convening annually in January in Orlando, Florida, the Assembly offers a learning environment where tough questions are…

MR-guided focused ultrasound: a potentially disruptive technology.

Science.gov (United States)

Bradley, William G

2009-07-01

A disruptive technology is a technological innovation that overturns the existing dominant technologies in a market. Magnetic resonance (MR)-guided focused ultrasound (MRgFUS) is a noninvasive procedure based on the combination of real-time MR anatomic guidance, MR thermometry, and high-intensity focused ultrasound. Several hundred transducer elements become convergent at a point under MR guidance, leading to heating and coagulation necrosis. Outside the focal point, there is no significant heating. There is no need to break the skin for procedures in the body or to perform a craniotomy for procedures in the brain. This lack of invasiveness is what makes MRgFUS so disruptive compared with surgery. At present, MRgFUS has been used for the ablation of uterine fibroids, breast tumors, painful bony metastases, and liver tumors. In the brain, it has been used for the ablation of glioblastomas and for functional neurosurgery. Phantom and animal studies suggest future applications for prostate cancer and acute stroke treatment.

Lead Polluted Hotspot: Environmental Implication of Unplanned Industrial Development

Directory of Open Access Journals (Sweden)

Rikta Sharmin Yousuf

2016-06-01

Full Text Available In Rayer Bazaar, different industries like tannery, plastic, textile, battery recycling industry etc. are increasing rapidly without considering the environmental issues and deterioration. Since chromium (Cr pollution of this area has been widely investigated due to the presence of tannery industries, this study was focused on examining other environmental factors. Field visits and analytical results of semi-quantitative and quantitative analysis as well as three dimensional excitation emission matrix spectroscopy (3DEEM of water, soil and vegetative tissues indicated that, the area is highly polluted in term of different environmental parameters and metal content. The extremely high lead (Pb content of the soil (1171.7 mg/kg in summer, 2157.1 mg/kg in winter and blackish materials of vegetative tissues (6585.6 mg/kg in summer, 1974.1 mg/kg in winter indicates excessive lead deposition of this area that makes it a lead polluted hotspot. One of the possible sources of the extremely high lead concentration is adjacent battery recycling industry and/or other industries surrounding this area. So it is urgent to take necessary steps to find out immediate options for possible mitigation.

How to conduct focus groups: researching group priorities through discussion.

Science.gov (United States)

1992-01-01

Focus groups serve to uncover priorities and beliefs of a target group, but health project designers do not always take the time to seek this information beforehand. Focus groups also allow various local subgroups to communicate their concerns before the project starts. Focus groups can also breed ideas and dialogue that individual interviews cannot and they provide baseline information so managers can determine if attitudes or priorities have resulted from the project. Diverse people have different beliefs, e.g., women who have young children view oral rehydration therapy differently from women with no children. Project designers can use these basic differences to arrive at some conclusions about general attitudes. Focus group facilitators should have a discussion outline to help keep the group on the topic of concern. They should limit sessions to 60-90 minutes. Each focus groups should include 8-10 people. It is important to have members of various community subgroups in each group. Yet group designers should be careful not to include within the same group, those who may intimidate other people in the group, e.g., in situations where farmers depend on middlemen, farmers may not be open if middlemen are also in the focus group. Facilitators should launch each session with an attempt to encourage the members to be open and to feel comfortable. For example, in Malawi, a facilitator leads her focus group discussions with songs. Stories are another icebreaker. It is important that all focus groups centering around a certain project discuss the same topics. Facilitators need to stress to the group that all discussions are to be kept confidential. The designers should also carefully word the questions so that facilitators will not impart their bias. Facilitators should not direct the group to certain conclusions, but instead keep the discussions focused.

Particle size distributions of lead measured in battery manufacturing and secondary smelter facilities and implications in setting workplace lead exposure limits.

Science.gov (United States)

Petito Boyce, Catherine; Sax, Sonja N; Cohen, Joel M

2017-08-01

Inhalation plays an important role in exposures to lead in airborne particulate matter in occupational settings, and particle size determines where and how much of airborne lead is deposited in the respiratory tract and how much is subsequently absorbed into the body. Although some occupational airborne lead particle size data have been published, limited information is available reflecting current workplace conditions in the U.S. To address this data gap, the Battery Council International (BCI) conducted workplace monitoring studies at nine lead acid battery manufacturing facilities (BMFs) and five secondary smelter facilities (SSFs) across the U.S. This article presents the results of the BCI studies focusing on the particle size distributions calculated from Personal Marple Impactor sampling data and particle deposition estimates in each of the three major respiratory tract regions derived using the Multiple-Path Particle Dosimetry model. The BCI data showed the presence of predominantly larger-sized particles in the work environments evaluated, with average mass median aerodynamic diameters (MMADs) ranging from 21-32 µm for the three BMF job categories and from 15-25 µm for the five SSF job categories tested. The BCI data also indicated that the percentage of lead mass measured at the sampled facilities in the submicron range (i.e., lead) was generally small. The estimated average percentages of lead mass in the submicron range for the tested job categories ranged from 0.8-3.3% at the BMFs and from 0.44-6.1% at the SSFs. Variability was observed in the particle size distributions across job categories and facilities, and sensitivity analyses were conducted to explore this variability. The BCI results were compared with results reported in the scientific literature. Screening-level analyses were also conducted to explore the overall degree of lead absorption potentially associated with the observed particle size distributions and to identify key issues

E-Waste Informal Recycling: An Emerging Source of Lead Exposure in South America.

Science.gov (United States)

Pascale, Antonio; Sosa, Adriana; Bares, Cristina; Battocletti, Alejandra; Moll, María José; Pose, Darío; Laborde, Amalia; González, Hugo; Feola, Gabriella

2016-01-01

Primitive electronic waste (e-waste) recycling creates exposures to several hazardous substances including lead. In Uruguay, primitive recycling procedures are a significant source of lead exposure. The aim of this study was to examine lead exposure in blood lead levels (BLLs) in low-income children exposed to lead through burning cables. A sample of children and adolescents exposed to lead through burning cable activities were assessed at the Department of Toxicology in Montevideo, Uruguay, between 2010 and 2014. Soil lead levels of residences were taken shortly after their assessment. The final sample included 69 children and adolescents (mean age 7.89 years). More than 66% of participants had an additional source of lead exposure-manual gathering of metals-and based paint (r = 0.23; P source of lead exposure was the manual gathering of metals. The average BLL among children and adolescents in this study is higher than the BLLs currently suggested in medical intervention. Future research should focus on exploring effective interventions to reduce lead exposure among this vulnerable group. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

The optics of the Final Focus Test Beam

International Nuclear Information System (INIS)

Irwin, J.; Brown, K.; Bulos, F.; Burke, D.; Helm, R.; Roy, G.; Ruth, R.; Yamamoto, N.; Oide, K.

1991-05-01

The Final Focus Test Beam (FFTB), currently under construction at the end of the SLAC Linac, is being built by an international collaboration as a test bed for ideas and methods required in the design and construction of final focus systems for next generation e + e - linear colliders. The FFTB lattice is based on the previously developed principle of using sextupole pairs in a dispersive region to compensate chromaticity. The linear lattice was optimized for length, and implementation of diagnostic procedures. The transformations between sextupole pairs (CCX and CCY) are exactly -I, the matrix for the intermediate transformer (BX) is exactly diagonal, and the dispersion function has zero slope at the sextupoles and is thus zero at the minimum of the β x function in the intermediate transformer. The introduction of sextupoles in final focus systems leads to the presence of additional optical aberrations, and synchrotron radiation in the dipoles also enlarges the final spot size. The important fourth-order optical aberrations which determine the main features of the design have been identified. Additional lower order aberrations arise in the implementation of these designs, since the real system is not the ideal design. We concentrate on these aberrations and describe strategies for their diagnosis and correction

Lead and lead-based alloys as waste matrix materials

International Nuclear Information System (INIS)

Arustamov, A.E.; Ojovan, M.I.; Kachalov, M.B.

1999-01-01

Metals and alloys with relatively low melting temperatures such as lead and lead-based alloys are considered in Russia as prospective matrices for encapsulation of spent nuclear fuel in containers in preparation for final disposal in underground repositories. Now lead and lead-based alloys are being used for conditioning spent sealed radioactive sources at radioactive waste disposal facilities

The neurobiology of focus and distraction: The case for incorporating mindfulness into leadership.

Science.gov (United States)

Mohapel, Paul

2018-05-01

Increasingly health leaders are experiencing greater demands and pressures, which require the need for better focus while limiting unwarranted distractions. This article offers a neurobiological explanation of how the brain focuses and becomes distracted, in order to help health leaders gain insight into their own effectiveness. Two main neural circuits are contrasted: the mind-wandering default mode circuit and the attentional central executive system. These two systems act in an antagonistic pairing, where the degree of toggling between systems is associated with the degree a person can sustain focus and filter out unwarranted distractions. Excessive multitasking appears to compromise the neural switch of these two systems, thereby diminishing our focus and concentration. In contrast, mindfulness practice is shown to have the opposite effect by enhancing the neural switch, thereby enhancing leadership focus that can lead to greater flexibility, foresight, regulation, and creativity. To conclude, leaders who are excessively distracted, such as with multitasking, may be compromising cognitive brain functioning, while engaging in mindfulness may replenish the brain and thereby enhance leaders' ability to sustain focus and tap into higher cognitive functioning.

Lead poisoning

Science.gov (United States)

... drinking water in homes containing pipes that were connected with lead solder . Although new building codes require ... lead in their bodies when they put lead objects in their mouths, especially if they swallow those ...

Basic physical phenomena, neutron production and scaling of the dense plasma focus

International Nuclear Information System (INIS)

Kaeppeler, H.J.

This paper presents an attempt at establishing a model theory for the dense plasma focus in order to present a consistent interpretation of the basic physical phenomena leading to neutron production from both acceleration and thermal processes. To achieve this, the temporal history of the focus is divided into the compression of the plasma sheath, a qiescent and very dense phase with ensuing expansion, and an instable phase where the focus plasma is disrupted by instabilities. Finally, the decay of density, velocity and thermal fields is considered. Under the assumption that Io 2 /sigmaoRo 2 = const and to/Tc = const, scaling laws for plasma focus devices are derived. It is shown that while generally the neutron yield scales with the fourth power of maximum current, neutron production from thermal processes becomes increasingly important for large devices, while in the small devices neutron production from acceleration processes is by far predominant. (orig.) [de

Lead exposure affects health indices in free-ranging ducks in Argentina.

Science.gov (United States)

Ferreyra, Hebe; Beldomenico, Pablo M; Marchese, Krysten; Romano, Marcelo; Caselli, Andrea; Correa, Ana I; Uhart, Marcela

2015-05-01

Numerous experiments under controlled conditions and extensive investigation of waterfowl die-offs have demonstrated that exposure to lead from spent gunshot is highly detrimental to the health of waterfowl. However, few studies have focused on examining the more subtle sub-lethal effects of lead toxicity on ducks in non-experimental settings. In our study, the health of ducks exposed to varying amounts of lead under natural conditions was assessed by correlating individual lead exposure with relevant indices of health. Based on hunter-killed wild ducks in Argentina, we measured spleen mass, body condition, examined bone marrow smears, and determined Ca and P in bone tissue. In free-ranging live-trapped ducks we determined basic hematology and aminolevulinic acid dehydratase activity. Using multivariate analyses, we found that, when controlling for the potential confounding effect of site type, year, duck species, body mass and age, lead levels in the liver were negatively associated with body condition and spleen mass. Spleen mass was also lower in ducks with higher lead levels in their bones. In live ducks, high blood lead levels were associated with low packed cell volume and red cell morphologic abnormalities. These findings suggest that, despite the lack of recorded lead-induced mortality in the region, lead exposure results in less conspicuous but still significant impacts on the health of ducks, which could have serious implications for their conservation. Moreover, this evidence further supports the need for urgently banning lead shot in the region.

Focus Groups Help To Focus the Marketing Strategy.

Science.gov (United States)

Ashar, Hanna; Lane, Maureen

1996-01-01

A university-based degree completion program for adults conducted focus group research to refine market positioning and promotion. Focus groups averaged five current students and recent graduates who reflected, demographically, the current student population. Results gave insight into reasons for selecting the university, aspects of the program…

Theoretical investigations on a class of double-focus planar lens on the anisotropic material

Science.gov (United States)

Bozorgi, Mahdieh; Atlasbaf, Zahra

2017-05-01

We study a double-focus lens constituted of V-shaped plasmonic nano-antennas (VSPNAs) on the anisotropic TiO2 thin film. The phase and amplitude variations of cross-polarized scattered wave from a unit cell are computed by the developed fast Method of Moments (MoM) in which the dyadic Green's function is evaluated with the transmission line model in the spectral domain. Using the calculated phase and amplitude diagrams, a double-focus lens on the anisotropic thin film is designed in 2 μm. To validate the numerical results, the designed lens is analysed using a full-wave EM-solver. The obtained results show a tunable asymmetric behavior in the focusing intensity of the focal spots for different incident polarizations. It is shown that changing the thickness of anisotropic thin film leads to the changing in such an asymmetric behavior and also the intensity ratio of two focal spots. In addition, the lens performance is examined in the broadband wavelength range from 1.76 to 2.86 μm. It is achieved that the increasing the wavelength leads to decreasing the focal distances of the designed lens and increasing its numerical aperture (NA).

Treatment of unicameral bone cysts in pediatric patients with an injectable regenerative graft: a preliminary report.

Science.gov (United States)

Gentile, John V; Weinert, Carl R; Schlechter, John A

2013-01-01

Multiple treatment modalities exist for unicameral bone cysts (UBC), including steroid injection, autologous bone marrow injection, mechanical decompression, intramedullary fixation, curettage, and bone grafting. All have their own potential limitations such as high recurrence rates, cyst persistence, need for multiple procedures, and prolonged immobilization. A minimally invasive regimen consisting of curettage, decompression, and injection of a calcium sulfate-calcium phosphate (CaSO4-CaPO4) composite has been utilized at our institution in an attempt to obtain optimal results for the treatment of UBCs in the pediatric population. We retrospectively evaluated 16 patients with pathologically confirmed UBC who were treated with curettage, decompression, and injection of a calcium sulfate-calcium phosphate composite between April 2006 and August 2010 at a single institution. The average age of the patients at time of surgical intervention was 9.4 years of age (range, 3 to 16 y). Average follow-up was 16 months (range, 6 to 36 mo). Radiographic healing, clinical outcomes, and complications were evaluated. Final follow-up radiographs demonstrated healing in 93.7% (15 of 16) of patients after a single procedure. Complete healing was observed in 14 of 16 patients and partially healed with a defect in 1 of 16 patients. One patient had a persistent cyst but did not wish to receive further treatment. All patients returned to full activities including sports on average at 3.1 months (range, 1 to 6 mo) and were asymptomatic on most recent follow-up. No postoperative complications, including refracture, were observed. Curettage, decompression, and injection of a calcium sulfate-calcium phosphate composite for UBC in the pediatric population demonstrates encouraging results with low recurrence rates and complications compared with conventional methods. Case series, Level of Evidence IV.

Investigating a potential biological treatment to prevent pathological fractures caused by unicameral bone cysts in children under 8 years.

Science.gov (United States)

Ramos-Pascua, Luis R; Sánchez-Herraéz, Sergio; Casas-Ramos, Paula; Molnar Fuentes, Sebastián; Santos Sánchez, José Ángel

2014-10-01

There is no consensus on when and how to treat unicameral bone cysts (UBCs), partly because of a lack of knowledge of the aetiology. To review the different treatment techniques for UBCs and to describe our results with a single injection of autogenous bone marrow (BM) mixed with demineralised bone matrix (DBM) in very young children. We reviewed five patients under the age of 8 years with UBCs treated by percutaneous aspiration and a single injection of BM associated with DBM. The cyst was located in the proximal humerus in four patients and in the proximal femur in one patient. Assessment of the need for surgery was based on the clinical and radiographic suspicion of new pathological fractures. The administration of a second injection, when necessary, was based on the surgeon's judgement regarding the risk of fracture. The mean follow-up after first injection was 41 months. There were no complications related to the procedure, except a non-displaced fracture, which healed without problems. All patients were pain free and progressively resumed their activities without restriction until a new fracture occurred in two cases. According to Capanna's classification, only one case healed completely (grade 1), one lesion was classified as grade 2, and there were three recurrences at 11, 12 and 27 months after initial treatment (grade 3). The final outcome was treatment failure for three out of the five patients. Two patients were treated with a second injection and one patient is waiting for surgery. A single injection of aspirated autogenous BM mixed with DBM in very young children with active UBCs at risk of fracture is very simple, comfortable and safe. Nevertheless, the results seem to be unpredictable and are probably more dependent on the natural evolution of the cyst than on the treatment. Further comparative studies with larger sample numbers are needed.

Percutaneous intramedullary decompression, curettage, and grafting with medical-grade calcium sulfate pellets for unicameral bone cysts in children: a new minimally invasive technique.

Science.gov (United States)

Dormans, John P; Sankar, Wudbhav N; Moroz, Leslie; Erol, Bülent

2005-01-01

Several treatment options exist for unicameral bone cysts (UBCs), including observation, steroid injection, bone marrow injection, and curettage and bone grafting. These are all associated with high recurrence rates, persistence, and occasional complications. Newer techniques have been described, most with variable success and only short follow-up reported. Because of these factors, a new minimally invasive percutaneous technique was developed for the treatment of UBCs in children. Twenty-eight children with UBCs who underwent percutaneous intramedullary decompression, curettage, and grafting with medical-grade calcium sulfate (MGCS) pellets by the senior author (J.P.D.) between April 2000 and April 2003 were analyzed as part of a pediatric musculoskeletal tumor registry at a large tertiary children's hospital. Four patients were lost to follow-up, and the remaining 24 patients had an average follow-up of 21.9 months (range 4-48 months). Twelve patients were followed for at least 24 months. Six of the 24 children had received previous treatment of their UBC, most often at an outside institution. Follow-up was performed through clinical evaluation and radiographic review. Postoperative radiographs at most recent follow-up showed complete healing, defined as more than 95% opacification, in 22 of 24 patients (91.7%). One patient (4.2%) demonstrated partial healing, defined as 80% to 95% opacification. One patient had less than 80% radiographic healing (4.2%). All 24 patients returned to full activities and were asymptomatic at most recent follow-up. The only complication noted was a superficial suture abscess that occurred in one patient; this resolved with local treatment measures. The new minimally invasive technique of percutaneous intramedullary decompression, curettage, and grafting with MGCS pellets demonstrates favorable results with low complication and recurrence rates compared with conventional techniques. The role of intramedullary decompression as a part

Lead Poisoning

Science.gov (United States)

Lead is a metal that occurs naturally in the earth's crust. Lead can be found in all parts of our ... from human activities such as mining and manufacturing. Lead used to be in paint; older houses may ...

Time-dependent beam focusing at the DARHT-II injector diode

International Nuclear Information System (INIS)

Eylon, S.; Henestroza, E.; Fawley, W.; Yu, S.

1999-01-01

The injector for the second axis of the Dual-Axis Radiographic Hydrotest Facility (DARHT) is being designed and constructed at LBNL. The injector consists of a single gap diode extracting 2(micro)s, 2kA, 3.2 MeV electron beam from a 6.5 inches diameter thermionic dispenser cathode. The injector is powered through a ceramic column by a Marx generator. We also investigated the possibility of extracting a beam current of 4 kA. The focusing system for the electron beam consists of a Pierce electrostatic focusing electrode at the cathode and three solenoidal focusing magnets positioned between the anode and induction accelerator input. The off-energy components (beam-head) during the 400 ns energy rise time are overfocused, leading to beam envelope mismatch and growth resulting in the possibility of beam hitting the accelerator tube walls. The anode focusing magnets can be tuned to avoid the beam spill in the 2kA case. To allow beam-head control for the 4kA case we are considering the introduction of time-varying magnetic focusing field along the accelerator axis generated by a single-loop solenoid magnet positioned in the anode beam tube. We will present the beam-head dynamics calculations as well as the solenoid design and preliminary feasibility test results

Efficacy of breast conservation therapy in early stage bilateral breast cancer

International Nuclear Information System (INIS)

Lee, Misa M.; Chen, Luci M.; Heimann, Ruth; Powers, Claire; Weichselbaum, Ralph R.

1996-01-01

-up was 50 months for synchronous patients, 45 months for metachronous patients, and 52 months for unilateral patients. Local control and survival were analyzed in patients with (1) synchronous bilateral breast cancer (SBBC), (2) metachronous breast cancer (MBBC), (3) unilateral breast cancer (UBC). The interval to development of local recurrence and survival were calculated from the time of development of the second breast lesion in patients with metachronous breast cancer. RESULTS: There were no differences in survival and failure free survival in patients with SBBC, MBBC, or UBC. Five year overall survival by lifetable analysis was 76% for SBBC, 78% for MBBC, and 87% for UBC patients; the p-value was 0.32 by logrank analysis. The five year failure-free survival was 79% for SBBC, 73% for MBBC, and 85% for UBC patients; the p-value was 0.28 by logrank analysis. There were no significant differences in median age, tumor size, pathologic node status, tamoxifen use, chemotherapy use, or median total dose of radiation therapy for SBBC, MBBC, or UBC patients. A significant difference was found in the incidence of family history of breast cancer in patients with unilateral (28%) versus bilateral breast cancer (40%) (p=0.0028 by chi-square analysis). However, there was no difference seen in outcome of patients by family history of breast cancer. The local control was identical in both bilateral and UBC patients with a crude failure rate of 3%. CONCLUSION: In our patients, no differences were observed in both local control and overall survival. Therefore, breast conservation therapy in local-regional, early stage breast cancer is a rational treatment modality for patients with SBBC and MBBC as well as UBC

A UV prime focus spectrograph for the CFHT

International Nuclear Information System (INIS)

Boulade, O.; Vigroux, L.

1986-03-01

The UV prime spectrograph at the Canada-France-Hawaii Telescope is the first instrument to be designed with an aspherized diffraction grating. This technique leads to all reflective Schmidt designs with a very small amount of optical surface on fast aperture ratio. A thin backside illuminated RCA CCD is now used as the detector. Since the detector is at the focus of an f/1 mounting, within the optical path, a minicryostat (5 cm x 5 cm x 3 cm) was designed to minimize the central obscuration. This paper describes this new instrument and its performances

Lead Test

Science.gov (United States)

... to do renovation and repair projects using lead-safe work practices to avoid creating more lead dust or ... in a dangerous area? Yes. If you are working in a potentially harmful environment with exposure to lead dust or fumes: Wash ...

Bulk diffusion and solubility of silver and nickel in lead, lead-silver and lead-nickel solid solutions

International Nuclear Information System (INIS)

Amenzou-Badrour, H.; Moya, G.; Bernardini, J.

1988-01-01

The results of a study of solubility and bulk diffusion of /sup 110/Ag and /sup 63/Ni in lead, lead-silver and lead-nickel solid solutions in the temperature range 220 to 88 0 C are reported. Owing to the low solubility of silver and nickel in lead, Fick's solution corresponding to the boundary condition of a constant concentration of solute at the surface has been used. Depth profile concentration analysis suggests a fundamental difference between the diffusion mechanisms of silver and nickel. Since silver penetration profiles in pure lead give diffusion coefficients independent of the penetration depth and silver concentration, it is suggested that slight decreases of silver diffusivity in lead-silver solid solutions have no significance. This implies that the interstitial silver atoms do not associate significantly with each other to form Ag-Ag dimers. In contrast, different behaviors of /sup 63/Ni depth profile concentration in pure lead and saturated PbNi solid solutions agree with a Ni-Ni interaction leading to the formation of less mobile dimers near the surface in pure lead

Suitable Reference Genes for Accurate Gene Expression Analysis in Parsley (Petroselinum crispum) for Abiotic Stresses and Hormone Stimuli.

Science.gov (United States)

Li, Meng-Yao; Song, Xiong; Wang, Feng; Xiong, Ai-Sheng

2016-01-01

Parsley, one of the most important vegetables in the Apiaceae family, is widely used in the food, medicinal, and cosmetic industries. Recent studies on parsley mainly focus on its chemical composition, and further research involving the analysis of the plant's gene functions and expressions is required. qPCR is a powerful method for detecting very low quantities of target transcript levels and is widely used to study gene expression. To ensure the accuracy of results, a suitable reference gene is necessary for expression normalization. In this study, four software, namely geNorm, NormFinder, BestKeeper, and RefFinder were used to evaluate the expression stabilities of eight candidate reference genes of parsley ( GAPDH, ACTIN, eIF-4 α, SAND, UBC, TIP41, EF-1 α, and TUB ) under various conditions, including abiotic stresses (heat, cold, salt, and drought) and hormone stimuli treatments (GA, SA, MeJA, and ABA). Results showed that EF-1 α and TUB were the most stable genes for abiotic stresses, whereas EF-1 α, GAPDH , and TUB were the top three choices for hormone stimuli treatments. Moreover, EF-1 α and TUB were the most stable reference genes among all tested samples, and UBC was the least stable one. Expression analysis of PcDREB1 and PcDREB2 further verified that the selected stable reference genes were suitable for gene expression normalization. This study can guide the selection of suitable reference genes in gene expression in parsley.

Suitable reference genes for accurate gene expression analysis in parsley (Petroselinum crispum for abiotic stresses and hormone stimuli

Directory of Open Access Journals (Sweden)

Meng-Yao Li

2016-09-01

Full Text Available Parsley is one of the most important vegetable in Apiaceae family and widely used in food industry, medicinal and cosmetic. The recent studies in parsley are mainly focus on chemical composition, further research involving the analysis of the gene functions and expressions will be required. qPCR is a powerful method for detecting very low quantities of target transcript levels and widely used for gene expression studies. To ensure the accuracy of results, a suitable reference gene is necessary for expression normalization. In this study, three software geNorm, NormFinder, and BestKeeper were used to evaluate the expression stabilities of eight candidate reference genes (GAPDH, ACTIN, eIF-4α, SAND, UBC, TIP41, EF-1α, and TUB under various conditions including abiotic stresses (heat, cold, salt, and drought and hormone stimuli treatments (GA, SA, MeJA, and ABA. The results showed that EF-1α and TUB were identified as the most stable genes for abiotic stresses, while EF-1α, GAPDH, and TUB were the top three choices for hormone stimuli treatments. Moreover, EF-1α and TUB were the most stable reference genes across all the tested samples, while UBC was the least stable one. The expression analysis of PcDREB1 and PcDREB2 further verified that the selected stable reference genes were suitable for gene expression normalization. This study provides a guideline for selection the suitable reference genes in gene expression in parsley.

Tanks focus area. Annual report 1997

International Nuclear Information System (INIS)

Frey, J.

1997-01-01

The U.S. Department of Energy Office of Environmental Management is tasked with a major remediation project to treat and dispose of radioactive waste in hundreds of underground storage tanks. These tanks contain about 90,000,000 gallons of high-level and transuranic wastes. We have 68 known or assumed leaking tanks, that have allowed waste to migrate into the soil surrounding the tank. In some cases, the tank contents have reacted to form flammable gases, introducing additional safety risks. These tanks must be maintained in the safest possible condition until their eventual remediation to reduce the risk of waste migration and exposure to workers, the public, and the environment. Science and technology development for safer, more efficient, and cost-effective waste treatment methods will speed up progress toward the final remediation of these tanks. The DOE Office of Environmental Management established the Tanks Focus Area to serve as the DOE-EM's technology development program for radioactive waste tank remediation in partnership with the Offices of Waste Management and Environmental Restoration. The Tanks Focus Area is responsible for leading, coordinating, and facilitating science and technology development to support remediation at DOE's four major tank sites: the Hanford Site in Washington State, Idaho National Engineering and Environmental Laboratory in Idaho, Oak Ridge Reservation in Tennessee, and the Savannah River Site in South Carolina. The technical scope covers the major functions that comprise a complete tank remediation system: waste retrieval, waste pretreatment, waste immobilization, tank closure, and characterization of both the waste and tank. Safety is integrated across all the functions and is a key component of the Tanks Focus Area program

Electrical properties of a novel lead alkoxide precursor: Lead glycolate

International Nuclear Information System (INIS)

Tangboriboon, Nuchnapa; Pakdeewanishsukho, Kittikhun; Jamieson, Alexander; Sirivat, Anuvat; Wongkasemjit, Sujitra

2006-01-01

The reaction of lead acetate trihydrate Pb(CH 3 COO) 2 .3H 2 O and ethylene glycol, using triethylenetetramine (TETA) as a catalyst, provides in one step access to a polymer-like precursor of lead glycolate [-PbOCH 2 CH 2 O-]. On the basis of high-resolution mass spectroscopy, chemical analysis composition, FTIR, 13 C-solid state NMR and TGA, the lead glycolate precursor can be identified as a trimer structure. The FTIR spectrum demonstrates the characteristics of lead glycolate; the peaks at 1086 and 1042 cm -1 can be assigned to the C-O-Pb stretchings. The 13 C-solid state NMR spectrum gives notably only one peak at 68.639 ppm belonging to the ethylene glycol ligand. The phase transformations of lead glycolate and lead acetate trihydrate to lead oxide, their microstructures, and electrical properties were found to vary with increasing temperature. The lead glycolate precursor has superior electrical properties relative to those of lead acetate trihydrate, suggesting that the lead glycolate precursor can possibly be used as a starting material for producing electrical and semiconducting ceramics, viz. ferroelectric, anti-ferroelectric, and piezoelectric materials

Possible Lead Free Nanocomposite Dielectrics for High Energy Storage Applications

Directory of Open Access Journals (Sweden)

Srinivas Kurpati

2017-03-01

Full Text Available There is an increasing demand to improve the energy density of dielectric capacitors for satisfying the next generation material systems. One effective approach is to embed high dielectric constant inclusions such as lead zirconia titanate in polymer matrix. However, with the increasing concerns on environmental safety and biocompatibility, the need to expel lead (Pb from modern electronics has been receiving more attention. Using high aspect ratio dielectric inclusions such as nanowires could lead to further enhancement of energy density. Therefore, the present brief review work focuses on the feasibility of development of a lead-free nanowire reinforced polymer matrix capacitor for energy storage application. It is expected that Lead-free sodium Niobate nanowires (NaNbO3 and Boron nitride will be a future candidate to be synthesized using simple hydrothermal method, followed by mixing them with polyvinylidene fluoride (PVDF/ divinyl tetramethyl disiloxanebis (benzocyclobutene matrix using a solution-casting method for Nanocomposites fabrication. The energy density of NaNbO3 and BN based composites are also be compared with that of lead-containing (PbTiO3/PVDF Nano composites to show the feasibility of replacing lead-containing materials from high-energy density dielectric capacitors. Further, this paper explores the feasibility of these materials for space applications because of high energy storage capacity, more flexibility and high operating temperatures. This paper is very much useful researchers who would like to work on polymer nanocomposites for high energy storage applications.

Radiologically contaminated lead shot reuse at the Idaho National Engineering Laboratory (INEL)

International Nuclear Information System (INIS)

Heileson, W.M.; Grant, R.P.

1995-01-01

This project involved the utilization of radioactively contaminated lead shot located at the Radioactive Waste Management Complex (RWMC) for radiation shielding on a radioactive liquid process tank located at Argonne National Laboratory-West (ANL-W). The use of previously contaminated shot precludes the radioactive contamination of clean shot. With limited treatment and disposal options for contaminated lead shot, the reuse of lead for shielding is significant due to the inherent characteristic of becoming a mixed waste when radiologically contaminated. The INEL conducted a lead cleanup campaign in 1990. This was designed to ensure control of potential Resource Conservation and Recovery Act (RCRA) regulated waste. Contaminated lead from throughout the INEL, was containerized per the lead Waste Acceptance Criteria at the generator sites. Limited areas at the INEL are designated for mixed waste storage. As a result, some of the lead was stored at the RWMC in the air support weather shield (ASWS). This lead was contaminated with small amounts of fission product contamination. The lead was in the form of shot, brick, sheet, casks, and other various sized pieces. In 1993, ANL-W identified a need for lead shot to be used as shielding in a radioactive liquid waste storage and processing tank at the Fuel Cycle Facility (FCF). The contaminated lead used on this project had been in storage as mixed waste at the RWMC. This paper will focus on the processes and problems encountered to utilize the contaminated lead shot

A systems approach to risk management through leading safety indicators

International Nuclear Information System (INIS)

Leveson, Nancy

2015-01-01

The goal of leading indicators for safety is to identify the potential for an accident before it occurs. Past efforts have focused on identifying general leading indicators, such as maintenance backlog, that apply widely in an industry or even across industries. Other recommendations produce more system-specific leading indicators, but start from system hazard analysis and thus are limited by the causes considered by the traditional hazard analysis techniques. Most rely on quantitative metrics, often based on probabilistic risk assessments. This paper describes a new and different approach to identifying system-specific leading indicators and provides guidance in designing a risk management structure to generate, monitor and use the results. The approach is based on the STAMP (System-Theoretic Accident Model and Processes) model of accident causation and tools that have been designed to build on that model. STAMP extends current accident causality to include more complex causes than simply component failures and chains of failure events or deviations from operational expectations. It incorporates basic principles of systems thinking and is based on systems theory rather than traditional reliability theory. - Highlights: • Much effort has gone into developing leading indicators with only limited success. • A systems-theoretic, assumption-based approach may be more successful. • Leading indicators are warning signals of an assumption’s changing vulnerability. • Heuristic biases can be controlled by using plausibility rather than likelihood

Relational Leading

DEFF Research Database (Denmark)

Larsen, Mette Vinther; Rasmussen, Jørgen Gulddahl

2015-01-01

This first chapter presents the exploratory and curious approach to leading as relational processes – an approach that pervades the entire book. We explore leading from a perspective that emphasises the unpredictable challenges and triviality of everyday life, which we consider an interesting......, relevant and realistic way to examine leading. The chapter brings up a number of concepts and contexts as formulated by researchers within the field, and in this way seeks to construct a first understanding of relational leading....

Development of a Focused Library of Triazole-Linked Privileged-Structure-Based Conjugates Leading to the Discovery of Novel Phenotypic Hits against Protozoan Parasitic Infections.

Science.gov (United States)

Uliassi, Elisa; Piazzi, Lorna; Belluti, Federica; Mazzanti, Andrea; Kaiser, Marcel; Brun, Reto; Moraes, Carolina B; Freitas-Junior, Lucio H; Gul, Sheraz; Kuzikov, Maria; Ellinger, Bernhard; Borsari, Chiara; Costi, Maria Paola; Bolognesi, Maria Laura

2018-04-06

Protozoan infections caused by Plasmodium, Leishmania, and Trypanosoma spp. contribute significantly to the burden of infectious diseases worldwide, causing severe morbidity and mortality. The inadequacy of available treatments calls for cost- and time-effective drug discovery endeavors. To this end, we envisaged the triazole linkage of privileged structures as an effective drug design strategy to generate a focused library of high-quality compounds. The versatility of this approach was combined with the feasibility of a phenotypic assay, integrated with early ADME-tox profiling. Thus, an 18-membered library was efficiently assembled via Huisgen cycloaddition of phenothiazine, biphenyl, and phenylpiperazine scaffolds. The resulting 18 compounds were then tested against seven parasite strains, and counter-screened for selectivity against two mammalian cell lines. In parallel, hERG and cytochrome P450 (CYP) inhibition, and mitochondrial toxicity were assessed. Remarkably, 10-((1-(3-([1,1'-biphenyl]-3-yloxy)propyl)-1H-1,2,3-triazol-5-yl)methyl)-10H-phenothiazine (7) and 10-(3-(1-(3-([1,1'-biphenyl]-3-yloxy)propyl)-1H-1,2,3-triazol-4-yl)propyl)-10H-phenothiazine (12) showed respective IC 50 values of 1.8 and 1.9 μg mL -1 against T. cruzi, together with optimal selectivity. In particular, compound 7 showed a promising ADME-tox profile. Thus, hit 7 might be progressed as an antichagasic lead. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Self-focusing of electromagnetic waves as a result of relativistic electron-mass variation

International Nuclear Information System (INIS)

Spatschek, K.H.

1977-01-01

Relativistic electron-mass variations due to the presence of intense electromagnetic radiation in the plasma cause a nonlinear refractive index. Using a variational principle the latter is obtained up to fourth order in the electric field amplitude and it is shown that nonlinear effects of the second order lead to self-focusing of a beam of radiation. By nonlinear optics considerations, the self-focusing length of an axially symmetric beam is obtained. Including higher-order dispersive effects it is shown that within the thin-beam approximation the complex electric field envelope obeys a cubic nonlinear Schroedinger equation with an attractive self-consistent potential. The cylindrically symmetric nonlinear Schroedinger equation predicts collapse of the radiation at the self-focusing distance. The nature of the self-focusing singularity is analysed and it is shown that higher-order nonlinearities saturate the amplitude. Then oscillations of the beam radius along the axial direction occur. (author)

Injection of Unicameral Bone Cysts with Bone Marrow Aspirate and Demineralized Bone Matrix Avoids Open Curettage and Bone Grafting in a Retrospective Cohort.

Science.gov (United States)

Gundle, Kenneth R; Bhatt, Etasha M; Punt, Stephanie E; Bompadre, Viviana; Conrad, Ernest U

2017-01-01

Many treatment options exist for unicameral bone cysts (UBC), without clear evidence of superiority. Meta-analyses have been limited by small numbers of patients in specific anatomic and treatment subgroups. The purpose of this study was to report the outcomes of injecting bone marrow aspirate and demineralized bone matrix (BMA/DBM) for the treatment of proximal humerus UBC. Fifty-one patients with proximal humerus lesions treated by BMA/DBM injection were retrospectively reviewed from a single academic medical center. The mean number of injections performed per patient was 2.14 (range 1-5). Eleven patients underwent only one injection (22%), an additional 19 patients completed treatment after two injections (37%), four patients healed after three injections (8%), and one patient healed after four injections (2%). The cumulative success rate of serial BMA/DBM injections was 22% (11/51), 58% (30/51), 67% (34/51), and 69% (35/51). Eleven patients (22%) ultimately underwent open curettage and bone grafting, and five patients (10%) were treated with injection of calcium phosphate bone substitute. A BMA/DBM injection strategy avoided an open procedure in 78% of patients with a proximal humerus UBC. The majority of patients underwent at least 2 injection treatments. Level IV retrospective cohort study.

Background Checks for all Gun Buyers and Gun Violence Restraining Orders: State Efforts to Keep Guns from High-Risk Persons.

Science.gov (United States)

Vernick, Jon S; Alcorn, Ted; Horwitz, Joshua

2017-03-01

There were more than 36,000 firearm-related deaths in the U.S. in 2015. Under federal law, a background check is required only for gun purchases from licensed dealers. Research suggests that some persons prohibited from owning a gun turn to private sellers, including those identified online, to attempt to obtain a firearm. State-level approaches to make it more difficult for high-risk persons to purchase or possess firearms include universal background check (UBC) and gun violence restraining order (GVRO) laws. UBC laws, on the books in 18 states as of the end of 2016, can reduce both homicide and suicide rates. After Colorado adopted a UBC law in 2013, the number of background checks conducted by private sellers for sales occurring at places other than gun shows steadily increased. GVRO laws give law enforcement and families the authority to petition a court to temporarily remove firearms from an individual who presents a danger to himself or others during times of crisis, regardless of whether that person has been diagnosed with a mental illness. California enacted a GVRO law in 2014. Data are emerging to suggest the effectiveness of GVRO-type laws at averting suicides and providing an entryway to services.

Assessment of DNA damage and telomerase activity in exfoliated urinary cells as sensitive and noninvasive biomarkers for early diagnosis of bladder cancer in ex-workers of a rubber tyres industry.

Science.gov (United States)

Cavallo, Delia; Casadio, Valentina; Bravaccini, Sara; Iavicoli, Sergio; Pira, Enrico; Romano, Canzio; Fresegna, Anna Maria; Maiello, Raffaele; Ciervo, Aureliano; Buresti, Giuliana; Zoli, Wainer; Calistri, Daniele

2014-01-01

The aim of the present study was to identify sensitive and noninvasive biomarkers of early carcinogenic effect at target organ to use in biomonitoring studies of workers at risk for previous occupational exposure to potential carcinogens. Standard urine cytology (Papanicolaou staining test), comet assay, and quantitative telomerase repeat amplification protocol (TRAP) assay were performed in 159 ex-rubber workers employed in tyres production and 97 unexposed subjects. In TRAP positive cases, a second level analysis using FISH (Urovysion) was done. Cystoscopy results were available for 11 individuals whose 6 FISH/TRAP/comet positive showed in 3 cases a dysplastic condition confirmed by biopsy, 1 comet positive resulted in infiltrating UBC to the biopsy and with hyperplasia and slight dysplasia to the urinary cytology, 1 comet positive resulted in papillary superficial UBC to the biopsy, 1 FISH/TRAP positive showed a normal condition, and 2 TRAP positive showed in one case a phlogosis condition. The results evidenced good concordance of TRAP, comet, and FISH assays as early biomarkers of procarcinogenic effect confirmed by the dysplastic condition and UBC found by cystoscopy-biopsy analysis. The analysis of these markers in urine cells could be potentially more accurate than conventional cytology in monitoring workers exposed to mixture of bladder potential carcinogens.

Assessment of DNA Damage and Telomerase Activity in Exfoliated Urinary Cells as Sensitive and Noninvasive Biomarkers for Early Diagnosis of Bladder Cancer in Ex-Workers of a Rubber Tyres Industry

Directory of Open Access Journals (Sweden)

Delia Cavallo

2014-01-01

Full Text Available The aim of the present study was to identify sensitive and noninvasive biomarkers of early carcinogenic effect at target organ to use in biomonitoring studies of workers at risk for previous occupational exposure to potential carcinogens. Standard urine cytology (Papanicolaou staining test, comet assay, and quantitative telomerase repeat amplification protocol (TRAP assay were performed in 159 ex-rubber workers employed in tyres production and 97 unexposed subjects. In TRAP positive cases, a second level analysis using FISH (Urovysion was done. Cystoscopy results were available for 11 individuals whose 6 FISH/TRAP/comet positive showed in 3 cases a dysplastic condition confirmed by biopsy, 1 comet positive resulted in infiltrating UBC to the biopsy and with hyperplasia and slight dysplasia to the urinary cytology, 1 comet positive resulted in papillary superficial UBC to the biopsy, 1 FISH/TRAP positive showed a normal condition, and 2 TRAP positive showed in one case a phlogosis condition. The results evidenced good concordance of TRAP, comet, and FISH assays as early biomarkers of procarcinogenic effect confirmed by the dysplastic condition and UBC found by cystoscopy-biopsy analysis. The analysis of these markers in urine cells could be potentially more accurate than conventional cytology in monitoring workers exposed to mixture of bladder potential carcinogens.

Molecular basis of APC/C regulation by the spindle assembly checkpoint

Science.gov (United States)

Zhang, Ziguo; Yang, Jing; Maslen, Sarah; Skehel, Mark; Barford, David

2016-01-01

In the dividing eukaryotic cell the spindle assembly checkpoint (SAC) ensures each daughter cell inherits an identical set of chromosomes. The SAC coordinates the correct attachment of sister chromatid kinetochores to the mitotic spindle with activation of the anaphase-promoting complex/cyclosome (APC/C), the E3 ubiquitin ligase that initiates chromosome separation. In response to unattached kinetochores, the SAC generates the mitotic checkpoint complex (MCC), a multimeric assembly that inhibits the APC/C, delaying chromosome segregation. Here, using cryo-electron microscopy we determined the near-atomic resolution structure of an APC/C-MCC complex (APC/CMCC). We reveal how degron-like sequences of the MCC subunit BubR1 block degron recognition sites on Cdc20, the APC/C coactivator subunit (Cdc20APC/C) responsible for substrate interactions. BubR1 also obstructs binding of UbcH10 (APC/C’s initiating E2) to repress APC/C ubiquitination activity. Conformational variability of the complex allows for UbcH10 association, and we show from a structure of APC/CMCC in complex with UbcH10 how the Cdc20 subunit intrinsic to the MCC (Cdc20MCC) is ubiquitinated, a process that results in APC/C reactivation when the SAC is silenced. PMID:27509861

Correlation between some parameters of lead absorption and lead intoxication

Science.gov (United States)

Waldron, H. A.

1971-01-01

Waldron, H. A. (1971).Brit. J. industr. Med.,28, 195-199. Correlation between some parameters of lead absorption and lead intoxication. Use has been made of data collected over a number of years from workers exposed to a lead hazard in a motor-car factory. The correlations between various parameters of lead absorption and lead intoxication were computed, including blood and urine lead concentrations, urinary coproporphyrin, ALA and PBG concentrations, and haemoglobin concentration. In all, 15 correlation coefficients were calculated, of which only six showed a statistically significant result (i.e., Plead and urine lead (r = 0·38, Plead and coproporphyrin (r = 0·42, Plead and ALA (r = 0·43, Plead and PBG (r = 0·19, P<0·05). PMID:5572689

Angular Spectrum Method for the Focused Acoustic Field of a Linear Transducer

Science.gov (United States)

Belgroune, D.; de Belleval, J. F.; Djelouah, H.

Applications involving non-destructive testing or acoustical imaging are more and more sophisticated. In this context, a model based on the angular spectrum approach is tackled in view to calculate the focused impulse field radiated by a linear transducer through a plane fluid-solid interface. It is well known that electronic focusing, based on a cylindrical delay law, like for the classical cases (lenses, curved transducer), leads to an inaccurate focusing in the solid due to geometric aberrations errors affecting refraction. Generally, there is a significant difference between the acoustic focal distance and the geometrical focal due to refraction. In our work, an optimized delay law, based on the Fermat's principle is established, particularly at an oblique incidence where the geometrical considerations, relatively simple in normal incidence, become quickly laborious. Numerical simulations of impulse field are judiciously carried out. Subsequently, the input parameters are optimally selected in order to achieve good computation accuracy and a high focusing. The overall results, involving compression and shear waves, have highlighted the focusing improvement in the solid when compared to the currently available approaches. Indeed, the acoustic focal distance is very close to geometrical focal distance and then, allows better control of the refracted angular beam profile (refraction angle, focusing depth and focal size).

Disruptive Technologies: A Credible Threat to Leading Programs in Continuing Medical Education?

Science.gov (United States)

Christensen, Clayton M.; Armstrong, Elizabeth G.

1998-01-01

Disruptive technologies are simple convenient innovations that have triggered failures of some well-managed companies. They may threaten continuing medical-education programs so focused on leading-edge technology they lose sight of the very different educational needs of growing numbers of health care providers, who are turning to consultants, the…

Magnetic electron focusing and tuning of the electron current with a pn-junction

Energy Technology Data Exchange (ETDEWEB)

Milovanović, S. P., E-mail: slavisa.milovanovic@uantwerpen.be; Ramezani Masir, M., E-mail: mrmphys@gmail.com; Peeters, F. M., E-mail: francois.peeters@uantwerpen.be [Departement Fysica, Universiteit Antwerpen, Groenenborgerlaan 171, B-2020 Antwerpen (Belgium)

2014-01-28

Transverse magnetic focusing properties of graphene using a ballistic four terminal structure are investigated. The electric response is obtained using the semiclassical billiard model. The transmission exhibits pronounced peaks as a consequence of skipping orbits at the edge of the structure. When we add a pn-junction between the two probes, snake states along the pn-interface appear. Injected electrons are guided by the pn-interface to one of the leads depending on the value of the applied magnetic field. Oscillations in the resistance are found depending on the amount of particles that end up in each lead.

Without 'Focus'

Directory of Open Access Journals (Sweden)

Aldo Sevi

2010-12-01

Full Text Available It is widely accepted that a notion of 'focus', more or less as conceived of in Jackendoff (1972, must be incorporated into our theory of grammar, as a means of accounting for certain observed correlations between prosodic facts and semantic/pragmatic facts. In this paper, we put forth the somewhat radical idea that the time has come to give up this customary view, and eliminate 'focus' from our theory of grammar. We argue that such a move is both economical and fruitful.Research over the years has revealed that the correlations between prosody, 'focus', and the alleged semantic/pragmatic effects of focus are much less clear and systematic than we may have initially hoped. First we argue that this state of affairs detracts significantly from the utility of our notion of 'focus', to the point of calling into question the very motivation for including it in the grammar. Then we look at some of the central data, and show how they might be analyzed without recourse to a notion of 'focus'. We concentrate on (i the effect of pitch accent placement on discourse congruence, and (ii the choice of 'associate' for the so-called 'focus sensitive' adverb only. We argue that our focus-free approach to the data improves empirical coverage, and begins to reveal patterns that have previously been obscured by preconceptions about 'focus'.ReferencesBeaver, D. & Clark, B. 2008. Sense and Sensitivity: How Focus Determines Meaning. Blackwell.Beaver, D., Clark, B., Flemming, E., Jaeger, T. F. & Wolters, M. 2007. ‘When semantics meets phonetics: Acoustical studies of second occurrence focus’. Language 83.2: 245–76.http://dx.doi.org/10.1353/lan.2007.0053Beckman, M. & Hirschberg, J. 1994. ‘The ToBI Annotation Conventions’. Ms.,http://www.cs.columbia.edu/~julia/files/conv.pdf.Bolinger, D. 1972. ‘Accent is predictable (if you are a mind-reader’. Language 48.3: 633–44.http://dx.doi.org/10.2307/412039Büring, D. 2006. ‘Focus projection and default

Focus on focusing

International Nuclear Information System (INIS)

Anon.

1985-01-01

The discovery and impact of the principle of strong focusing was celebrated at a history Symposium at Stanford on 25 July in the course of the 1985 US Summer School on Particle Accelerators. Burt Richter, Stanford Linac Director, who introduced all the speakers with well chosen reminders about their various contributions related to the theme of the symposium, remarked that it was an appropriate time to be lauding the great contributions of accelerator physicists following the Nobel Prize award to Simon van der Meer for outstanding achievements in accelerator physics

Focus on focusing

Energy Technology Data Exchange (ETDEWEB)

Anon.

1985-10-15

The discovery and impact of the principle of strong focusing was celebrated at a history Symposium at Stanford on 25 July in the course of the 1985 US Summer School on Particle Accelerators. Burt Richter, Stanford Linac Director, who introduced all the speakers with well chosen reminders about their various contributions related to the theme of the symposium, remarked that it was an appropriate time to be lauding the great contributions of accelerator physicists following the Nobel Prize award to Simon van der Meer for outstanding achievements in accelerator physics.

Developing the Competence to Lead in Everyday Situations

DEFF Research Database (Denmark)

Thomassen, Anja Overgaard; Rasmussen, Jørgen Gulddahl

2015-01-01

This chapter discusses how leaders help one another develop their ability to lead in everyday situations through collaborative work in learning groups, focusing on the interaction between theory and practice. The theme is how the understanding of course assignments and approaches changes during...... leaders’ participation in a module on personal leadership development, which is part of a master’s degree in public governance. The analytic framework concentrates on the work in learning groups as an integrated part of this module, and particularly on the development of learning relationships by viewing...

Collective Focusing of Intense Ion Beam Pulses for High-energy Density Physics Applications

International Nuclear Information System (INIS)

Dorf, Mikhail A.; Kaganovich, Igor D.; Startsev, Edward A.; Davidson, Ronald C.

2011-01-01

The collective focusing concept in which a weak magnetic lens provides strong focusing of an intense ion beam pulse carrying a neutralizing electron background is investigated by making use of advanced particle-in-cell simulations and reduced analytical models. The original analysis by Robertson Phys. Rev. Lett. 48, 149 (1982) is extended to the parameter regimes of particular importance for several high-energy density physics applications. The present paper investigates (1) the effects of non-neutral collective focusing in a moderately strong magnetic field; (2) the diamagnetic effects leading to suppression of the applied magnetic field due to the presence of the beam pulse; and (3) the influence of a finite-radius conducting wall surrounding the beam cross-section on beam neutralization. In addition, it is demonstrated that the use of the collective focusing lens can significantly simplify the technical realization of the final focusing of ion beam pulses in the Neutralized Drift Compression Experiment-I (NDCX-I), and the conceptual designs of possible experiments on NDCX-I are investigated by making use of advanced numerical simulations.

The identification of lead ammunition as a source of lead exposure in First Nations: The use of lead isotope ratios

International Nuclear Information System (INIS)

Tsuji, Leonard J.S.; Wainman, Bruce C.; Martin, Ian D.; Sutherland, Celine; Weber, Jean-Philippe; Dumas, Pierre; Nieboer, Evert

2008-01-01

The use of lead shotshell to hunt water birds has been associated with lead-contamination in game meat. However, evidence illustrating that lead shotshell is a source of lead exposure in subsistence hunting groups cannot be deemed definitive. This study seeks to determine whether lead shotshell constitutes a source of lead exposure using lead isotope ratios. We examined stable lead isotope ratios for lichens, lead shotshell and bullets, and blood from residents of Fort Albany and Kashechewan First Nations, and the City of Hamilton, Ontario, Canada. Data were analyzed using ANOVA and regression analyses. ANOVA of isotope ratios for blood revealed significant differences with respect to location, but not sex. Hamilton differed from both Kashechewan and Fort Albany; however, the First Nations did not differ from each other. ANOVA of the isotope ratios for lead ammunition and lichens revealed no significant differences between lichen groups (north and south) and for the lead ammunition sources (pellets and bullets). A plot of 206 Pb/ 204 Pb and 206 Pb/ 207 Pb values illustrated that lichens and lead ammunition were distinct groupings and only the 95% confidence ellipse of the First Nations group overlapped that of lead ammunition. In addition, partial correlations between blood-lead levels (adjusted for age) and isotope ratios revealed significant (p 206 Pb/ 204 Pb and 206 Pb/ 207 Pb, and a significant negative correlation for 208 Pb/ 206 Pb, as predicted if leaded ammunition were the source of lead exposure. In conclusion, lead ammunition was identified as a source of lead exposure for First Nations people; however, the isotope ratios for lead shotshell pellets and bullets were indistinguishable. Thus, lead-contaminated meat from game harvested with lead bullets may also be contributing to the lead body burden

Lack of observed movement response to lead exposure of California condors

Science.gov (United States)

Poessel, Sharon; Brandt, Joseph; Uyeda, Linda; Astell, Molly; Katzner, Todd E.

2018-01-01

Lead poisoning is an important conservation concern for wildlife, and scavenging birds are especially at risk from consumption of carcasses of animals killed with lead ammunition. Because current methods to identify lead exposure require animal capture and blood collection, management would benefit from the development of a less costly and noninvasive behavioral test for illness in wild animals. We attempted to design such a test to identify lead exposure in California condors (Gymnogyps californianus) that we tracked with global positioning system (GPS) telemetry in southern California, USA, 2013–2016. We measured blood-lead concentrations in tracked birds and expected that flight behavior would be influenced by lead exposure; thus, we measured the effect of blood-lead concentrations on 2 different types of movement rates and on the proportion of time condors spent in flight. We found no effect of lead exposure on any of these 3 behavioral metrics. Our work suggests that the measurements we took of flight behaviors were not a useful tool in predicting lead exposure in the mildly to moderately exposed birds we studied. Wild birds are effective at hiding illness, especially condors who have a strong social hierarchy in which showing weakness is a disadvantage. However, focusing on behaviors other than flight, expanding the sample studied to include birds with a wider range of lead concentration values, or analyzing tissues such as feathers (rather than, or in addition to, blood) may be more useful for identification of lead exposure and other diseases that may limit wildlife populations. © 2017 This article is a U.S. Government work and is in the public domain in the USA.

Effect on blood lead of airborne lead particles characterized by size.

Science.gov (United States)

Park, Dong-Uk; Paik, Nam-Won

2002-03-01

Worker exposure to airborne lead particles was evaluated for a total of 117 workers in 12 work-places of four different industrial types in Korea. The particle sizes were measured using 8-stage cascade impactors worn by the workers. Mass median aerodynamic diameters (MMAD) were determined by type of industry and percentage of lead particles as a fraction of airborne lead (PbA) concentration was determined by particle size. Blood lead (PbB) levels of workers who matched airborne lead samples were also examined. A Scheffé's pairwise comparison test showed that MMAD and the fractions of each of respirable particles and lead particles lead particles lead particles (r = 0.82) than that between concentrations of small particles and PbA (r = 0.61). A simple linear regression indicated that PbB correlated better with respirable lead concentration (r2 = 0.35, P = 0.0001) than with PbA concentration and had a higher slope coefficient. Controlling for respirable lead concentration reduced the partial correlation coefficient between PbA concentration and PbB level from 0.56 to 0.20 (P = 0.053). The results indicate that the contribution of respirable lead particles to lead absorption would be greater than that of PbA. This study concludes that the measurement of PbA only may not properly reflect a worker's exposure to lead particles with diverse characteristics. For the evaluation of a worker's exposure to various types of lead particles, it is recommended that respirable lead particles as well as PbA be measured.

Common ECG Lead Placement Errors. Part I: Limb Lead Reversals

Directory of Open Access Journals (Sweden)

Allison V. Rosen

2015-10-01

Full Text Available Background: Electrocardiography (ECG is a very useful diagnostic tool. However, errors in placement of ECG leads can create artifacts, mimic pathologies, and hinder proper ECG interpretation. It is important for members of the health care team to be able to recognize the common patterns resulting from lead placement errors. Methods: 12-lead ECGs were recorded in a single male healthy subject in his mid 20s. Six different limb lead reversals were compared to ECG recordings from correct lead placement. Results: Classic ECG patterns were observed when leads were reversed. Methods of discriminating these ECG patterns from true pathologic findings were described. Conclusion: Correct recording and interpretation of ECGs is key to providing optimal patient care. It is therefore crucial to be able to recognize common ECG patterns that are indicative of lead reversals.

LEADING WITH LEADING INDICATORS

International Nuclear Information System (INIS)

PREVETTE, S.S.

2005-01-01

This paper documents Fluor Hanford's use of Leading Indicators, management leadership, and statistical methodology in order to improve safe performance of work. By applying these methods, Fluor Hanford achieved a significant reduction in injury rates in 2003 and 2004, and the improvement continues today. The integration of data, leadership, and teamwork pays off with improved safety performance and credibility with the customer. The use of Statistical Process Control, Pareto Charts, and Systems Thinking and their effect on management decisions and employee involvement are discussed. Included are practical examples of choosing leading indicators. A statistically based color coded dashboard presentation system methodology is provided. These tools, management theories and methods, coupled with involved leadership and employee efforts, directly led to significant improvements in worker safety and health, and environmental protection and restoration at one of the nation's largest nuclear cleanup sites

Lifetime and shelf life of sealed tritium-filled plasma focus chambers with gas generator

Directory of Open Access Journals (Sweden)

B.D. Lemeshko

2017-11-01

Full Text Available The paper describes the operation features of plasma focus chambers using deuterium–tritium mixture. Handling tritium requires the use of sealed, vacuum-tight plasma focus chambers. In these chambers, there is an accumulation of the impurity gases released from the inside surfaces of the electrodes and the insulator while moving plasma current sheath inside chambers interacting with β-electrons generated due to the decay of tritium. Decay of tritium is also accompanied by the accumulation of helium. Impurities lead to a decreased yield of neutron emission from plasma focus chambers, especially for long term operation. The paper presents an option of absorption type gas generator in the chamber based on porous titanium, which allows to significantly increase the lifetime and shelf life of tritium chambers. It also shows the results of experiments on the comparison of the operation of sealed plasma focus chambers with and without the gas generator. Keywords: Plasma focus, Neutron yield, Tritium-filled plasma focus chambers, PACS Codes: 29.25.-v, 52.58.Lq

Focusing on customer service.

Science.gov (United States)

1996-01-01

This booklet is devoted to a consideration of how good customer service in family planning programs can generate demand for products and services, bring customers back, and reduce costs. Customer service is defined as increasing client satisfaction through continuous concern for client preferences, staff accountability to clients, and respect for the rights of clients. Issues discussed include the introduction of a customer service approach and gaining staff commitment. The experience of PROSALUD in Bolivia in recruiting appropriate staff, supervising staff, soliciting client feedback, and marketing services is offered as an example of a successful customer service approach. The key customer service functions are described as 1) establishing a welcoming atmosphere, 2) streamlining client flow, 3) personalizing client services, and 4) organizing and providing clear information to clients. The role of the manager in developing procedures is explored, and the COPE (Client-Oriented Provider-Efficient) process is presented as a good way to begin to make improvements. Techniques in staff training in customer service include brainstorming, role playing, using case studies (examples of which are provided), and engaging in practice sessions. Training also leads to the development of effective customer service attitudes, and the differences between these and organizational/staff-focused attitudes are illustrated in a chart. The use of communication skills (asking open-ended questions, helping clients express their concerns, engaging in active listening, and handling difficult situations) is considered. Good recovery skills are important when things go wrong. Gathering and using client feedback is the next topic considered. This involves identifying, recording, and discussing customer service issues as well as taking action on these issues and evaluating the results. The booklet ends by providing a sample of customer service indicators, considering the maintenance of a

Medication errors in home care: a qualitative focus group study.

Science.gov (United States)

Berland, Astrid; Bentsen, Signe Berit

2017-11-01

To explore registered nurses' experiences of medication errors and patient safety in home care. The focus of care for older patients has shifted from institutional care towards a model of home care. Medication errors are common in this situation and can result in patient morbidity and mortality. An exploratory qualitative design with focus group interviews was used. Four focus group interviews were conducted with 20 registered nurses in home care. The data were analysed using content analysis. Five categories were identified as follows: lack of information, lack of competence, reporting medication errors, trade name products vs. generic name products, and improving routines. Medication errors occur frequently in home care and can threaten the safety of patients. Insufficient exchange of information and poor communication between the specialist and home-care health services, and between general practitioners and healthcare workers can lead to medication errors. A lack of competence in healthcare workers can also lead to medication errors. To prevent these, it is important that there should be up-to-date information and communication between healthcare workers during the transfer of patients from specialist to home care. Ensuring competence among healthcare workers with regard to medication is also important. In addition, there should be openness and accurate reporting of medication errors, as well as in setting routines for the preparation, alteration and administration of medicines. To prevent medication errors in home care, up-to-date information and communication between healthcare workers is important when patients are transferred from specialist to home care. It is also important to ensure adequate competence with regard to medication, and that there should be openness when medication errors occur, as well as in setting routines for the preparation, alteration and administration of medications. © 2017 John Wiley & Sons Ltd.

Dreaming of a Better Life: Utopia as a Focus for Thematic, Interdisciplinary Instruction

Science.gov (United States)

Resor, Cynthia; Gandy, S. Kay

2014-01-01

Throughout history humans have dreamed of a better life. This concept of utopia can be used as a central focus for thematic and interdisciplinary instruction. This approach has three key advantages. First, students recognize that certain themes are consistent across time and place and that realization can lead students to explore their own dreams…

Non-linear optics for the final focus of the single-pass-collider

International Nuclear Information System (INIS)

Brown, K.L.; Spencer, J.E.

1981-02-01

The purpose of the final focus system (FFS) is to demagnify the beam envelope in the Collider arc lattice to a size suitable for beam collisions at the interaction region. The final spot size is determined by the beam emittance, the beta function β* at the IR, the momentum spread in the beam, and the quality of the FFS optics. In particular, if the focusing system is not chromatically corrected, the momentum dispersion in the beam can lead to a substantial degradation in the quality of the final focus. The objective is to design a FFS for 50 GeV/c within approx. 100 meters having an IR spot size sigma/sub xy/ of approximately 2 μm for a beam emittance of epsilon = 3 x 10 -10 m-rad and a momentum spread of delta = +-0.5%. This requires a β/sub x,y/ equal to or less than 1 cm. This report considers the problems encountered in the design of a final focus system that will reliably provide the desired beam size for collisions

Secondary lead production

Energy Technology Data Exchange (ETDEWEB)

Hollis, R.G.

1990-10-16

This invention is concerned with the efficient recovery of soft lead from the paste component of used automobile lead-acid storage batteries. According to the invention, a scrap which contains lead oxide, lead sulfate, and antimony in an oxidized state is processed in the following steps to recover lead. A refractory lined reaction vessel is continuously charged with the scrap, along with a reductant effective for reducing lead oxide. The charged material is melted and agitated by means of a submerged lance at 900-1150{degree}C whereby some of the lead oxide of the scrap is reduced to form molten lead. A slag layer is then formed above the molten lead, and an amount of lead oxide is maintained in the slag layer. The molten lead, now containing under 0.5 wt % of antimony, is removed, and the antimony oxide in the scrap is concentrated as oxide in the slag layer. Preferred embodiments of the invention result in the production, in a single step, of a soft lead substantially free of antimony. The slag may be subsequently treated to reduce the antimony oxide and produce a valuable antimony-lead product. Further advantages of the process are that a wet battery paste may be used as the feed without prior drying, and the process can be conducted at a temperature 100-150{degree}C lower than in previously known methods. In addition, a smaller reactor can be employed which reduces both capital cost and fuel costs. The process of the invention is illustrated by descriptions of pilot plant tests. 1 fig.

Trapping, focusing, and sorting of microparticles through bubble streaming

Science.gov (United States)

Wang, Cheng; Jalikop, Shreyas; Hilgenfeldt, Sascha

2010-11-01

Ultrasound-driven oscillating microbubbles can set up vigorous steady streaming flows around the bubbles. In contrast to previous work, we make use of the interaction between the bubble streaming and the streaming induced around mobile particles close to the bubble. Our experiment superimposes a unidirectional Poiseuille flow containing a well-mixed suspension of neutrally buoyant particles with the bubble streaming. The particle-size dependence of the particle-bubble interaction selects which particles are transported and which particles are trapped near the bubbles. The sizes selected for can be far smaller than any scale imposed by the device geometry, and the selection mechanism is purely passive. Changing the amplitude and frequency of ultrasound driving, we can further control focusing and sorting of the trapped particles, leading to the emergence of sharply defined monodisperse particle streams within a much wider channel. Optimizing parameters for focusing and sorting are presented. The technique is applicable in important fields like cell sorting and drug delivery.

Integrated single grating compressor for variable pulse front tilt in simultaneously spatially and temporally focused systems.

Science.gov (United States)

Block, Erica; Thomas, Jens; Durfee, Charles; Squier, Jeff

2014-12-15

A Ti:Al(3)O(2) multipass chirped pulse amplification system is outfitted with a single-grating, simultaneous spatial and temporal focusing (SSTF) compressor platform. For the first time, this novel design has the ability to easily vary the beam aspect ratio of an SSTF beam, and thus the degree of pulse-front tilt at focus, while maintaining a net zero-dispersion system. Accessible variation of pulse front tilt gives full spatiotemporal control over the intensity distribution at the focus and could lead to better understanding of effects such as nonreciprocal writing and SSTF-material interactions.

Influence of dispersion stretching of ultrashort UV laser pulse on the critical power for self-focusing

Science.gov (United States)

Ionin, A. A.; Mokrousova, D. V.; Piterimov, D. A.; Seleznev, L. V.; Sinitsyn, D. V.; Sunchugasheva, E. S.

2018-04-01

The critical power for self-focusing in air for ultrashort ultraviolet laser pulses, stretched due to dispersion from 90 to 730 fs, was experimentally measured. It was shown that the pulse duration enhancement due to its propagation in condensed media leads to an almost linear decrease in the critical power for self-focusing. It was also observed that when the pulse peak power exceeds the critical one, the maximum of linear plasma distribution along the ultraviolet laser filament does not shift in the direction opposite to the laser pulse propagation, as observed for infrared laser filaments, but remains at the geometrical focus.

Kinetics of oil saponification by lead salts in ancient preparations of pharmaceutical lead plasters and painting lead mediums.

Science.gov (United States)

Cotte, M; Checroun, E; Susini, J; Dumas, P; Tchoreloff, P; Besnard, M; Walter, Ph

2006-12-15

Lead soaps can be found in archaeological cosmetics as well as in oil paintings, as product of interactions of lead salts with oil. In this context, a better understanding of the formation of lead soaps allows a follow-up of the historical evolution of preparation recipes and provides new insights into conservation conditions. First, ancient recipes of both pharmaceutical lead plasters and painting lead mediums, mixtures of oil and lead salts, were reconstructed. The ester saponification by lead salts is determined by the preparation parameters which were quantified by FT-IR spectrometry. In particular, ATR/FT-IR spectrometer was calibrated by the standard addition method to quantitatively follow the kinetics of this reaction. The influence of different parameters such as temperature, presence of water and choice of lead salts was assessed: the saponification is clearly accelerated by water and heating. This analysis provides chemical explanations to the historical evolution of cosmetic and painting preparation recipes.

Lead levels - blood

Science.gov (United States)

Blood lead levels ... is used to screen people at risk for lead poisoning. This may include industrial workers and children ... also used to measure how well treatment for lead poisoning is working. Lead is common in the ...

Electric motors in the focus; Elektroantrieb im Focus

Energy Technology Data Exchange (ETDEWEB)

Wilms, Jan

2013-05-15

In August 2013, the first electric series production model of Ford comes to the market: the Focus Electric. A 23-kWh lithium-ion battery supplies the 107 kilowatts (145 hp) electric motor of the Focus Electric with energy. This battery enables a range of 162 kilometers and a limited top speed of 136 kilometers per hour. However, with 40,000 Euro this electric-powered vehicles is too expensive.

A pharmacy course on leadership and leading change.

Science.gov (United States)

Sorensen, Todd D; Traynor, Andrew P; Janke, Kristin K

2009-04-07

To develop and implement a course that develops pharmacy students' leadership skills and encourages them to become leaders within the profession. A leadership course series was offered to pharmacy students on 2 campuses. The series incorporated didactic, experiential, and self-directed learning activities, and focused on developing core leadership skills, self-awareness, and awareness of the process for leading change. Students reported increased knowledge and confidence in their ability to initiate and lead efforts for change. The learning activities students' valued most were the StrengthsFinder assessment (67% of students rated "very useful") and a Leadership Networking Partners (LNP) program (83% of students rated "very useful"). Teaching leadership skills poses a significant challenge in curriculum development and requires multifaceted course design elements that resonate with students and engage the practice community. Addressing these requirements results in a high level of student engagement and a desire to continue the development of leadership skills.

A Pharmacy Course on Leadership and Leading Change

Science.gov (United States)

Traynor, Andrew P.; Janke, Kristin K.

2009-01-01

Objective To develop and implement a course that develops pharmacy students' leadership skills and encourages them to become leaders within the profession. Design A leadership course series was offered to pharmacy students on 2 campuses. The series incorporated didactic, experiential, and self-directed learning activities, and focused on developing core leadership skills, self-awareness, and awareness of the process for leading change. Assessment Students reported increased knowledge and confidence in their ability to initiate and lead efforts for change. The learning activities students' valued most were the StrengthsFinder assessment (67% of students rated “very useful”) and a Leadership Networking Partners (LNP) program (83% of students rated “very useful”). Conclusion Teaching leadership skills poses a significant challenge in curriculum development and requires multifaceted course design elements that resonate with students and engage the practice community. Addressing these requirements results in a high level of student engagement and a desire to continue the development of leadership skills. PMID:19513161

Lead and osteoporosis: Mobilization of lead from bone in postmenopausal women

Energy Technology Data Exchange (ETDEWEB)

Silbergeld, E.K. (Environmental Defense Fund, WA (USA)); Schwartz, J. (Environmental Protection Agency, Washington, DC (USA)); Mahaffey, K. (National Institute of Environmental Health Sciences, Research Triangle Park, NC (USA))

1988-10-01

Although it has been known that humans accumulate lead in bone, mineralized tissue has been considered primarily as a sequestering compartment and not as a site of toxic action for lead. However, experimental data indicate that bone lead can be released during conditions of demineralization, such as pregnancy and lactation. We have examined lead status in women, before and after menopause, using the NHANES II dataset compiled between 1976 and 1980. In 2981 black and white women there was a highly significant increase in both whole blood and calculated plasma lead concentrations after menopause. The results indicate that bone lead is not an inert storage site for absorbed lead. Moreover, lead may interact with other factors in the course of postmenopausal osteoporosis, to aggravate the course of the disease, since lead is known to inhibit activation of vitamin D, uptake of dietary calcium, and several regulatory aspects of bone cell function. The consequences of this mobilization may also be of importance in assessing the risks of maternal lead exposure to fetal and infant health.

Focus is key: Panic-focused interpretations are associated with symptomatic improvement in panic-focused psychodynamic psychotherapy.

Science.gov (United States)

Keefe, John R; Solomonov, Nili; Derubeis, Robert J; Phillips, Alexander C; Busch, Fredric N; Barber, Jacques P; Chambless, Dianne L; Milrod, Barbara L

2018-04-18

This study examines whether, in panic-focused psychodynamic psychotherapy (PFPP), interpretations of conflicts that underlie anxiety (panic-focused or PF-interpretations) are specifically associated with subsequent panic disorder (PD) symptom improvement, over and above the provision of non-symptom-focused interpretations. Technique use in Sessions 2 and 10 of a 24-session PFPP protocol was assessed for the 65 patients with complete outcome data randomized to PFPP in a two-site trial of psychotherapies for PD. Sessions were rated in 15-min segments for therapists' use of PF-interpretations, non-PF-interpretations, and PF-clarifications. Robust regressions were conducted to examine the relationship between these interventions and symptom change subsequent to the sampled session. Interpersonal problems were examined as a moderator of the relationship of PF-interpretations to symptom change. At Session 10, but not at Session 2, patients who received a higher degree of PF-interpretations experienced greater subsequent improvement in panic symptoms. Non-PF-interpretations were not predictive. Patients with more interpersonal distress benefitted particularly from the use of PF-interpretations at Session 10. By the middle phase of PFPP, panic-focused interpretations may drive subsequent improvements in panic symptoms, especially among patients with higher interpersonal distress. Interpretations of conflict absent a panic focus may not be especially helpful.

Safe leads and lead changes in competitive team sports

Science.gov (United States)

Clauset, A.; Kogan, M.; Redner, S.

2015-06-01

We investigate the time evolution of lead changes within individual games of competitive team sports. Exploiting ideas from the theory of random walks, the number of lead changes within a single game follows a Gaussian distribution. We show that the probability that the last lead change and the time of the largest lead size are governed by the same arcsine law, a bimodal distribution that diverges at the start and at the end of the game. We also determine the probability that a given lead is "safe" as a function of its size L and game time t . Our predictions generally agree with comprehensive data on more than 1.25 million scoring events in roughly 40 000 games across four professional or semiprofessional team sports, and are more accurate than popular heuristics currently used in sports analytics.

Bringing the frame into focus: the influence of regulatory fit on processing fluency and persuasion.

Science.gov (United States)

Lee, Angela Y; Aaker, Jennifer L

2004-02-01

This research demonstrates that people's goals associated with regulatory focus moderate the effect of message framing on persuasion. The results of 6 experiments show that appeals presented in gain frames are more persuasive when the message is promotion focused, whereas loss-framed appeals are more persuasive when the message is prevention focused. These regulatory focus effects suggesting heightened vigilance against negative outcomes and heightened eagerness toward positive outcomes are replicated when perceived risk is manipulated. Enhanced processing fluency leading to more favorable evaluations in conditions of compatibility appears to underlie these effects. The findings underscore the regulatory fit principle that accounts for the persuasiveness of message framing effects and highlight how processing fluency may contribute to the "feeling right" experience when the strategy of goal pursuit matches one's goal.

Library design practices for success in lead generation with small molecule libraries.

Science.gov (United States)

Goodnow, R A; Guba, W; Haap, W

2003-11-01

The generation of novel structures amenable to rapid and efficient lead optimization comprises an emerging strategy for success in modern drug discovery. Small molecule libraries of sufficient size and diversity to increase the chances of discovery of novel structures make the high throughput synthesis approach the method of choice for lead generation. Despite an industry trend for smaller, more focused libraries, the need to generate novel lead structures makes larger libraries a necessary strategy. For libraries of a several thousand or more members, solid phase synthesis approaches are the most suitable. While the technology and chemistry necessary for small molecule library synthesis continue to advance, success in lead generation requires rigorous consideration in the library design process to ensure the synthesis of molecules possessing the proper characteristics for subsequent lead optimization. Without proper selection of library templates and building blocks, solid phase synthesis methods often generate molecules which are too heavy, too lipophilic and too complex to be useful for lead optimization. The appropriate filtering of virtual library designs with multiple computational tools allows the generation of information-rich libraries within a drug-like molecular property space. An understanding of the hit-to-lead process provides a practical guide to molecular design characteristics. Examples of leads generated from library approaches also provide a benchmarking of successes as well as aspects for continued development of library design practices.

On the Self-Focusing of Whistler Waves in a Radial Inhomogeneous Plasma

DEFF Research Database (Denmark)

Balmashnov, A. A.

1980-01-01

The process of whistler wave self-focusing is experimentally investigated. It was found that a whistler wave propagating along the plasma column with a density crest excites a longitudinal wave of the same frequency propagating across the external magnetic field. The amplitude modulation of the l......The process of whistler wave self-focusing is experimentally investigated. It was found that a whistler wave propagating along the plasma column with a density crest excites a longitudinal wave of the same frequency propagating across the external magnetic field. The amplitude modulation...... of the latter wave is accompanied by a density modification, which leads to trapping of the whistler wave in a density trough in the center of the plasma column....

[Leadership Experience of Clinical Nurses: Applying Focus Group Interviews].

Science.gov (United States)

Lee, Byoung Sook; Eo, Yong Sook; Lee, Mi Aie

2015-10-01

The purpose of this study was to understand and describe the leadership experience of clinical nurses. During 2014, data were collected using focus group interviews. Three focus group interviews were held with a total of 20 clinical nurses participating. All interviews were recorded as they were spoken and transcribed and data were analyzed using qualitative content analysis. Fifteen categories emerged from the five main themes. 1) Thoughts on the leadership category: to lead others, to cope with problem situations adequately and to serve as a shield against difficulties. 2) Situations requiring leadership: situation that requires correct judgement, coping and situations that need coordination and cooperation. 3-1) Leadership behaviors: other-oriented approach and self-oriented approach. 3-2) Leadership behavior consequences: relevant compensation and unfair termination. 4-1) Facilitators of leadership: confidence and passion for nursing and external support and resources. 4-2) Barriers to leadership: non-supportive organization culture and deficiency in own leadership competencies. 5) Strategies of leadership development: strengthen leadership through self-development and organizational leadership development. In conclusion, the results indicate that it is necessary to enhance clinical nurses' leadership role in healthcare. Enhancement can be achieved through leadership programs focused on enlarging leadership experience, constant self-development, leadership training, and development of leadership competencies suited to the nursing environment.

Rochester’s Lead Law: Evaluation of a Local Environmental Health Policy Innovation

Science.gov (United States)

Ayoob, Maria; Morley, Rebecca

2011-01-01

Background: Significant progress has been made in reducing the incidence of childhood lead poisoning in the United States in the past three decades. However, the prevalence of elevated blood lead in children (≥ 10 μg/dL) remains high in some communities, particularly those with high proportions of pre-1978 housing in poor condition. Increasingly, municipalities are using local policy tools to reduce lead poisoning in high-risk areas, but little is known about the effectiveness of such policies. Objectives: In this article, we evaluated the effectiveness of a comprehensive rental housing–based lead law adopted in Rochester, New York, in 2005. Methods: This policy evaluation integrates analyses of city inspections data, a survey of landlords, landlord focus groups, and health department data on children’s blood lead levels from the first 4 years of implementation of the 2005 law. Results: Implementation has proceeded consistent with projected numbers of inspections with nearly all target units inspected in the first 4 years. Higher than expected inspection passage rates suggest that landlords have reduced lead hazards in rental housing affected by the law. Implementation of the lead law does not appear to have had a significant impact on the housing market. Conclusions: Although many uncertainties remain, our analysis suggests that the lead law has had a positive impact on children’s health. Strong enforcement, support for community-based lead programs, and ongoing intergovernmental coordination will be necessary to maintain lead-safe housing in Rochester. Lessons learned from the Rochester experience may inform future local lead poisoning prevention policies in other communities. PMID:22001644

Focusators for laser-branding

Science.gov (United States)

Doskolovich, L. L.; Kazanskiy, N. L.; Kharitonov, S. I.; Uspleniev, G. V.

A new method is investigated for synthesis of computer-generated optical elements: focusators that are able to focus the radial-symmetrical laser beam into complex focal contours, in particular into alphanumeric symbols. The method is based on decomposition of the focal contour into segments of straight lines and semi-circles, following corresponding spacing out of the focusator on elementary segments (concentric rings or sectors) and solution of the inverse task of focusing from focusator segments into corresponding elements of the focal contour. The results of numerical computing of the field from synthesized focusators into the letters are presented. The theoretical efficiency of the focusators discussed is no less than 85%. The amplitude masks and the results of operational studies of synthesized focusators are presented.

An examination of knowledge, attitudes and practices related to lead exposure in South Western Nigeria

Directory of Open Access Journals (Sweden)

Sridhar Mynepalli KC

2006-03-01

Full Text Available Abstract Background Lead is a highly toxic and pervasive metal. Chronic exposure to low levels is responsible for significant health effects, particularly in children. Prevention remains the best option for reducing childhood lead exposure, however the knowledge, attitudes and practices to lead exposure in many developing countries is not known. Methods: We conducted four focus group discussions (FGD to evaluate knowledge attitudes and practices to lead exposure in Nigeria. An FGD guide was developed from the literature and preliminary discussion with members of the public. Participants in the FGD were randomly selected from adults living in Ibadan, South Western Nigeria in 2004. Results We found that there was limited awareness of the sources of lead exposure in the domestic environment and participants had little knowledge of the health effects of chronic low-dose lead exposure. Conclusion We conclude that the findings of this study should be used, in conjunction with others, to develop appropriate health education intervention for lead exposure in the domestic environment.

[Environmental lead poisoning from lead-glazed earthenware used for storing drinks].

Science.gov (United States)

Sabouraud, S; Coppéré, B; Rousseau, C; Testud, F; Pulce, C; Tholly, F; Blanc, M; Culoma, F; Facchin, A; Ninet, J; Chambon, P; Medina, B; Descotes, J

2009-12-01

Current unusual environmental sources of lead exposure mainly include traditional medicines, either ayurvedic remedies or others, traditional cosmetics (kohl, surma), and the use of traditional earthenware, for storage or cooking. We report two cases of lead poisoning in adults initially identified by paroxysmal abdominal pain or anemia. In both cases, the environmental investigation evidenced one main source of lead exposure, namely a lead-glazed earthenware jug in which a drink was stored, "kefir" in the first case, and "kombucha" tea in the second one. It is recommended to search for lead intoxication in patients with unexplained anemia. Environmental sources of lead can be multiple. Their relative importance has to be ranked during the environmental investigation and among these, lead-glazed earthenware must be considered as a source of high lead exposure when drinks are stored inside and thus can soak.

A Dynamically Focusing Cochlear Implant Strategy Can Improve Vowel Identification in Noise.

Science.gov (United States)

Arenberg, Julie G; Parkinson, Wendy S; Litvak, Leonid; Chen, Chen; Kreft, Heather A; Oxenham, Andrew J

2018-03-09

The standard, monopolar (MP) electrode configuration used in commercially available cochlear implants (CI) creates a broad electrical field, which can lead to unwanted channel interactions. Use of more focused configurations, such as tripolar and phased array, has led to mixed results for improving speech understanding. The purpose of the present study was to assess the efficacy of a physiologically inspired configuration called dynamic focusing, using focused tripolar stimulation at low levels and less focused stimulation at high levels. Dynamic focusing may better mimic cochlear excitation patterns in normal acoustic hearing, while reducing the current levels necessary to achieve sufficient loudness at high levels. Twenty postlingually deafened adult CI users participated in the study. Speech perception was assessed in quiet and in a four-talker babble background noise. Speech stimuli were closed-set spondees in noise, and medial vowels at 50 and 60 dB SPL in quiet and in noise. The signal to noise ratio was adjusted individually such that performance was between 40 and 60% correct with the MP strategy. Subjects were fitted with three experimental strategies matched for pulse duration, pulse rate, filter settings, and loudness on a channel-by-channel basis. The strategies included 14 channels programmed in MP, fixed partial tripolar (σ = 0.8), and dynamic partial tripolar (σ at 0.8 at threshold and 0.5 at the most comfortable level). Fifteen minutes of listening experience was provided with each strategy before testing. Sound quality ratings were also obtained. Speech perception performance for vowel identification in quiet at 50 and 60 dB SPL and for spondees in noise was similar for the three tested strategies. However, performance on vowel identification in noise was significantly better for listeners using the dynamic focusing strategy. Sound quality ratings were similar for the three strategies. Some subjects obtained more benefit than others, with some

Lead pollution: lead content in milk from cows fed on contaminated forages

Energy Technology Data Exchange (ETDEWEB)

Sapetti, C; Arduino, E; Durio, P

1973-01-01

Lead toxicity is reviewed, and the history of the lead poisoning is described. Much of the lead pollution in soil is due to automobile exhaust. Two milk cows were fed forage with added lead acetate. The 20 kg of lead corresponded to 50 ppm, a level that is often found in hays near major highways. The cows milk was then analyzed for lead content. During the first and second phase of administration of lead salts, the milk cows did not show any evident symptoms of intoxication. The lead in the milk did have a marked correlation with the administered lead. The lead doses did not last long enough for chronic symptoms to begin. The dosage of lead in milk, due to the facility of drawing samples and the relevant levels of response, could represent a valid method for diagnosing incipient chronic intoxications.

Effect measure modification of blood lead-air lead slope factors.

Science.gov (United States)

Richmond-Bryant, Jennifer; Meng, Qingyu; Cohen, Jonathan; Davis, J Allen; Svendsgaard, David; Brown, James S; Tuttle, Lauren; Hubbard, Heidi; Rice, Joann; Kirrane, Ellen; Vinikoor-Imler, Lisa; Kotchmar, Dennis; Hines, Erin; Ross, Mary

2015-01-01

There is abundant literature finding that susceptibility factors, including race and ethnicity, age, and housing, directly influence blood lead levels. No study has explored how susceptibility factors influence the blood lead-air lead relationship nationally. The objective is to evaluate whether susceptibility factors act as effect measure modifiers on the blood lead-air lead relationship. Participant level blood lead data from the 1999 to 2008 National Health and Nutrition Examination Survey were merged with air lead data from the US Environmental Protection Agency. Linear mixed effects models were run with and without an air lead interaction term for age group, sex, housing age, or race/ethnicity to determine whether these factors are effect measure modifiers for all ages combined and for five age brackets. Age group and race/ethnicity were determined to be effect measure modifiers in the all-age model and for some age groups. Being a child (1-5, 6-11, and 12-19 years) or of Mexican-American ethnicity increased the effect estimate. Living in older housing (built before 1950) decreased the effect estimate for all models except for the 1-5-year group, where older housing was an effect measure modifier. These results are consistent with the peer-reviewed literature of time-activity patterns, ventilation, and toxicokinetics.

Task-focused behavior mediates the associations between supportive interpersonal environments and students' academic performance.

Science.gov (United States)

Kiuru, Noona; Pakarinen, Eija; Vasalampi, Kati; Silinskas, Gintautas; Aunola, Kaisa; Poikkeus, Anna-Maija; Metsäpelto, Riitta-Leena; Lerkkanen, Marja-Kristiina; Nurmi, Jari-Erik

2014-04-01

In the longitudinal study presented here, we tested the theoretical assumption that children's task-focused behavior in learning situations mediates the associations between supportive interpersonal environments and academic performance. The sample consisted of 2,137 Finnish-speaking children. Data on supportive interpersonal environments (characterized by authoritative parenting, positive teacher affect toward the child, and peer acceptance) were gathered in Grade 1. The children's task-focused behavior was measured in Grades 2 and 3, and academic performance was measured in Grades 1 and 4. The results supported our assumption by showing that all three supportive environments were positively associated with children's subsequent academic performance via increased task-focused behavior in learning situations. These findings suggest that students' academic performance can be promoted by increasing the support they receive from peers, parents, and teachers because such increased support leads to better task focus in learning tasks.

Lead - nutritional considerations

Science.gov (United States)

... billion people had toxic (poisonous) blood lead levels. Food Sources Lead can be found in canned goods if there is lead solder in the ... to bottled water for drinking and cooking. Avoid canned goods from foreign ... cans goes into effect. If imported wine containers have a lead foil ...

Design of voice coil motor dynamic focusing unit for a laser scanner

Energy Technology Data Exchange (ETDEWEB)

Lee, Moon G.; Kim, Gaeun; Lee, Chan-Woo; Lee, Soo-Hun; Jeon, Yongho, E-mail: princaps@ajou.ac.kr [Department of Mechanical Engineering, Ajou University, San 5, Woncheon-dong, Yeongtong-gu, Suwon-si, Gyeonggi-do 443-749 (Korea, Republic of)

2014-04-15

Laser scanning systems have been used for material processing tasks such as welding, cutting, marking, and drilling. However, applications have been limited by the small range of motion and slow speed of the focusing unit, which carries the focusing optics. To overcome these limitations, a dynamic focusing system with a long travel range and high speed is needed. In this study, a dynamic focusing unit for a laser scanning system with a voice coil motor (VCM) mechanism is proposed to enable fast speed and a wide focusing range. The VCM has finer precision and higher speed than conventional step motors and a longer travel range than earlier lead zirconium titanate actuators. The system has a hollow configuration to provide a laser beam path. This also makes it compact and transmission-free and gives it low inertia. The VCM's magnetics are modeled using a permeance model. Its design parameters are determined by optimization using the Broyden–Fletcher–Goldfarb–Shanno method and a sequential quadratic programming algorithm. After the VCM is designed, the dynamic focusing unit is fabricated and assembled. The permeance model is verified by a magnetic finite element method simulation tool, Maxwell 2D and 3D, and by measurement data from a gauss meter. The performance is verified experimentally. The results show a resolution of 0.2 μm and travel range of 16 mm. These are better than those of conventional focusing systems; therefore, this focusing unit can be applied to laser scanning systems for good machining capability.

Extraction of uranium and lead from mixed waste debris using a variety of metal/ligand complexes

International Nuclear Information System (INIS)

Needham, D.A.; Duran, B.L.; Ehler, D.S.; Sauer, N.N.

1997-01-01

To ensure the safety of our Nation's nuclear stockpile, Los Alamos National Laboratory is in the process of constructing the DARHT (Dual Axis Radiographic Hydrodynamic Test) facility. DARHT will examine the effects of aging and the stability of our stockpile. Contained testing will be phased in to reduce the impact of these tests, which contain depleted uranium, on our environment. The main focus of this research is to develop a treatment scheme for the recovery of depleted uranium and lead from shot debris that will result from these tests. The goals of this research are to optimize the conditions on a bench scale using a commercially available water soluble polymer to bind the lead and a variety of metal/ligand complexes such as 4,5-dihydroxy-1,3-benzene-disulfonic acid, dithionite, sodium carbonate/bicarbonate, and sodium hypochlorite to bind the uranium. Studies were conducted on a mixture of debris, such as wood, cable, paper towels, and tubing that contained both uranium and lead ranging in concentration from 10-1000's of ppm of contaminants. Experiments were done varying combinations and successions of extractant solutions as well as a number of sequential extractions. Studies show that a mixture of sodium hypochlorite and carbonate removed 90+% of both uranium and lead. We then focused on a separation scheme for the lead and uranium

The effect of lead-based paint hazard remediation on blood lead levels of lead poisoned children in New York City.

Science.gov (United States)

Leighton, Jessica; Klitzman, Susan; Sedlar, Slavenka; Matte, Thomas; Cohen, Neal L

2003-07-01

Despite the widespread use of lead paint hazard control for children with lead poisoning, few controlled studies that estimate the effect of such control on children's blood lead levels have been published. This retrospective follow-up study examined the effects of lead hazard remediation and its timing on the blood lead levels of lead-poisoned children. From the New York City child blood lead registry, 221 children were selected who had an initial blood lead level of 20-44 micro g/dL between 1 July 1994 and 31 December 1996; were 6 months to 6 years of age; had a report of a follow-up blood lead test between 10 and 14 months after the initial test; had a lead-based paint hazard identified in the primary dwelling unit prior to the 10- to 14-month follow-up blood lead test; had resided or spent time at only one address with an identified lead-based paint hazard; and were not chelated. The decline in geometric mean blood lead levels from baseline to 10-14 months later was compared for children whose homes were remediated and whose homes were not remediated during the follow-up period. Regardless of remediation, geometric mean blood lead levels declined significantly from 24.3 micro g/dL at the initial diagnosis to 12.3 micro g/dL at the 10- to 14-month follow-up blood lead test (Premediated the geometric mean blood lead levels declined 53% compared to 41% among the 75 children whose homes were not remediated by the follow-up blood lead test, a remediation effect of approximately 20% (Premediation effect was 11%, although it was no longer significant. Race was the only factor that appeared to confound the relationship: Black children had higher follow-up blood lead levels even after controlling for other factors, including the natural logarithm of the initial blood lead level. The effect of remediation appeared to be stronger for younger (10 to remediation (within less than 3 months) appeared to have greater declines in blood lead levels at the follow-up test than

Study on neutron beam probe. Study on the focused neutron beam

Energy Technology Data Exchange (ETDEWEB)

Kotajima, Kyuya; Suzuki, K.; Fujisawa, M.; Takahashi, T.; Sakamoto, I. [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Wakabayashi, T.

1998-03-01

A monoenergetic focused neutron beam has been produced by utilizing the endoenergetic heavy ion reactions on hydrogen. To realize this, the projectile heavy ion energy should be taken slightly above the threshold energy, so that the excess energy converted to the neutron energy should be very small. In order to improve the capability of the focused neutron beam, some hydrogen stored metal targets have also been tested. Separating the secondary heavy ions (associated particles) from the primary ions (accelerated particles) by using a dipole magnet, a rf separator, and a particle identification system, we could directly count the produced neutrons. This will leads us to the possibility of realizing the standard neutron field which had been the empty dream of many neutron-related researchers in the world. (author)

Ontario School Principals and Diversity: Are They Prepared to Lead for Equity?

Science.gov (United States)

Tuters, Stephanie; Portelli, John

2017-01-01

Purpose: Ontario is the most ethnically diverse province in Canada. School educators cannot disregard the reality of diversity in all its senses. The question that directs the focus of this paper is: to what extent are leaders in Ontario formally prepared to lead schools that support the students of today? The paper aims to discuss this issue.…

Process research on Emotionally Focused Therapy (EFT) for couples: linking theory to practice.

Science.gov (United States)

Greenman, Paul S; Johnson, Susan M

2013-03-01

The focus of this article is on the link among theory, process, and outcome in the practice of Emotionally Focused Therapy (EFT) for couples. We describe the EFT model of change and the EFT perspective on adult love as the reflection of underlying attachment processes. We outline the manner in which theory and research inform EFT interventions. This leads into a detailed review of the literature on the processes of change in EFT. We highlight the client responses and therapist operations that have emerged from process research and their relation to treatment outcomes. We discuss the implications of this body of research for clinical practice and training. © FPI, Inc.

Plasma focus breeder

International Nuclear Information System (INIS)

Ikuta, Kazunari.

1981-09-01

Instead of using linear accelerators, it is possible to breed fissile fuels with the help of high current plasma focus device. A mechanism of accelerating proton beam in plasma focus device to high energy would be a change of inductance in plasma column because of rapid growth of plasma instability. A possible scheme of plasma focus breeder is also proposed. (author)

Melatonin reduces lead levels in blood, brain and bone and increases lead excretion in rats subjected to subacute lead treatment.

Science.gov (United States)

Hernández-Plata, Everardo; Quiroz-Compeán, Fátima; Ramírez-Garcia, Gonzalo; Barrientos, Eunice Yáñez; Rodríguez-Morales, Nadia M; Flores, Alberto; Wrobel, Katarzina; Wrobel, Kazimierz; Méndez, Isabel; Díaz-Muñoz, Mauricio; Robles, Juvencio; Martínez-Alfaro, Minerva

2015-03-04

Melatonin, a hormone known for its effects on free radical scavenging and antioxidant activity, can reduce lead toxicity in vivo and in vitro.We examined the effects of melatonin on lead bio-distribution. Rats were intraperitoneally injected with lead acetate (10, 15 or 20mg/kg/day) with or without melatonin (10mg/kg/day) daily for 10 days. In rats intoxicated with the highest lead doses, those treated with melatonin had lower lead levels in blood and higher levels in urine and feces than those treated with lead alone, suggesting that melatonin increases lead excretion. To explore the mechanism underlying this effect, we first assessed whether lead/melatonin complexes were formed directly. Electronic density functional (DFT) calculations showed that a lead/melatonin complex is energetically feasible; however, UV spectroscopy and NMR analysis showed no evidence of such complexes. Next, we examined the liver mRNA levels of metallothioneins (MT) 1 and 2. Melatonin cotreatment increased the MT2 mRNA expression in the liver of rats that received the highest doses of lead. The potential effects of MTs on the tissue distribution and excretion of lead are not well understood. This is the first report to suggest that melatonin directly affects lead levels in organisms exposed to subacute lead intoxication. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

[Effects of lead exposure on the human body and health implications].

Science.gov (United States)

Moreira, Fátima Ramos; Moreira, Josino Costa

2004-02-01

To review the literature concerning the risks associated with exposure to lead and lead compounds, especially in children and in populations that are occupationally exposed. Using "chumbo" [lead] and "efeitos" [effects] as search terms, two large databases, namely PubMed (United States National Library of Medicine) and LILACS (Literatura Latino-Americana e do Caribe em Ciências da Saúde [Latin American and Caribbean Literature in the Health Sciences]), were searched for studies on lead toxicity from 1988 to 2002. Other sources used to conduct the search include the web page of the United States Agency for Toxic Substances and Disease Registry, in Atlanta, Georgia, and the library of the Toxicology Laboratory of the Center for Workers' Health and Human Ecology at the National School of Public Health [Centro de Estudos da Saúde de Trabalhador e Ecologia Humana, Escola Nacional de Saúde Pública], Fundação Oswaldo Cruz, Rio de Janeiro, Brazil. The toxic effects of lead and lead compounds have been extensively studied for over a century. In recent years, epidemiologic studies have focused primarily on the neurotoxic effects of lead on children, particularly in terms of impaired intellectual ability and behavioral problems. However, there is still insufficient information on the mechanisms of action that account for such toxicity. More in-depth studies are also needed on the effects of lead exposure on bone, the central nervous system, the cardiovascular system, the kidneys, the liver, the male and female reproductive systems, and the endocrine system. The potential teratogenicity and carcinogenicity of lead, as well as its effect on pregnancy outcomes and neonatal growth and development, also require further study.

Plutonium focus area

International Nuclear Information System (INIS)

1996-08-01

To ensure research and development programs focus on the most pressing environmental restoration and waste management problems at the U.S. Department of Energy (DOE), the Assistant Secretary for the Office of Environmental Management (EM) established a working group in August 1993 to implement a new approach to research and technology development. As part of this new approach, EM developed a management structure and principles that led to the creation of specific Focus Areas. These organizations were designed to focus the scientific and technical talent throughout DOE and the national scientific community on the major environmental restoration and waste management problems facing DOE. The Focus Area approach provides the framework for intersite cooperation and leveraging of resources on common problems. After the original establishment of five major Focus Areas within the Office of Technology Development (EM-50, now called the Office of Science and Technology), the Nuclear Materials Stabilization Task Group (EM-66) followed the structure already in place in EM-50 and chartered the Plutonium Focus Area (PFA). The following information outlines the scope and mission of the EM, EM-60, and EM-66 organizations as related to the PFA organizational structure

Leading Causes of Death among Asian American Subgroups (2003-2011.

Directory of Open Access Journals (Sweden)

Katherine G Hastings

Full Text Available Our current understanding of Asian American mortality patterns has been distorted by the historical aggregation of diverse Asian subgroups on death certificates, masking important differences in the leading causes of death across subgroups. In this analysis, we aim to fill an important knowledge gap in Asian American health by reporting leading causes of mortality by disaggregated Asian American subgroups.We examined national mortality records for the six largest Asian subgroups (Asian Indian, Chinese, Filipino, Japanese, Korean, Vietnamese and non-Hispanic Whites (NHWs from 2003-2011, and ranked the leading causes of death. We calculated all-cause and cause-specific age-adjusted rates, temporal trends with annual percent changes, and rate ratios by race/ethnicity and sex. Rankings revealed that as an aggregated group, cancer was the leading cause of death for Asian Americans. When disaggregated, there was notable heterogeneity. Among women, cancer was the leading cause of death for every group except Asian Indians. In men, cancer was the leading cause of death among Chinese, Korean, and Vietnamese men, while heart disease was the leading cause of death among Asian Indians, Filipino and Japanese men. The proportion of death due to heart disease for Asian Indian males was nearly double that of cancer (31% vs. 18%. Temporal trends showed increased mortality of cancer and diabetes in Asian Indians and Vietnamese; increased stroke mortality in Asian Indians; increased suicide mortality in Koreans; and increased mortality from Alzheimer's disease for all racial/ethnic groups from 2003-2011. All-cause rate ratios revealed that overall mortality is lower in Asian Americans compared to NHWs.Our findings show heterogeneity in the leading causes of death among Asian American subgroups. Additional research should focus on culturally competent and cost-effective approaches to prevent and treat specific diseases among these growing diverse populations.

Leading Causes of Death among Asian American Subgroups (2003-2011).

Science.gov (United States)

Hastings, Katherine G; Jose, Powell O; Kapphahn, Kristopher I; Frank, Ariel T H; Goldstein, Benjamin A; Thompson, Caroline A; Eggleston, Karen; Cullen, Mark R; Palaniappan, Latha P

2015-01-01

Our current understanding of Asian American mortality patterns has been distorted by the historical aggregation of diverse Asian subgroups on death certificates, masking important differences in the leading causes of death across subgroups. In this analysis, we aim to fill an important knowledge gap in Asian American health by reporting leading causes of mortality by disaggregated Asian American subgroups. We examined national mortality records for the six largest Asian subgroups (Asian Indian, Chinese, Filipino, Japanese, Korean, Vietnamese) and non-Hispanic Whites (NHWs) from 2003-2011, and ranked the leading causes of death. We calculated all-cause and cause-specific age-adjusted rates, temporal trends with annual percent changes, and rate ratios by race/ethnicity and sex. Rankings revealed that as an aggregated group, cancer was the leading cause of death for Asian Americans. When disaggregated, there was notable heterogeneity. Among women, cancer was the leading cause of death for every group except Asian Indians. In men, cancer was the leading cause of death among Chinese, Korean, and Vietnamese men, while heart disease was the leading cause of death among Asian Indians, Filipino and Japanese men. The proportion of death due to heart disease for Asian Indian males was nearly double that of cancer (31% vs. 18%). Temporal trends showed increased mortality of cancer and diabetes in Asian Indians and Vietnamese; increased stroke mortality in Asian Indians; increased suicide mortality in Koreans; and increased mortality from Alzheimer's disease for all racial/ethnic groups from 2003-2011. All-cause rate ratios revealed that overall mortality is lower in Asian Americans compared to NHWs. Our findings show heterogeneity in the leading causes of death among Asian American subgroups. Additional research should focus on culturally competent and cost-effective approaches to prevent and treat specific diseases among these growing diverse populations.

Lead elimination by ICRF 158 in rats after chronic lead exposure

Energy Technology Data Exchange (ETDEWEB)

Witting, U; Hultsch, E

1981-02-01

Lead elimination by ICRF 158, a lipophilic derivative of ethylene-diaminetetra-acetate (EDTA), was investigated in rats after chronic lead exposure. The animals had received a lead concentration of 550 ppm in their drinking water for 140 days. Subsequent treatment with ICRF 158 for 30 days led to increased mobilization and elimination of incorporated lead, and the lead-induced inhibition of hemosynthesis was removed. ICR 158 produced no renal damage in excess to lead-induced tubular nephrosis. Separate toxicity tests in mice demonstrated that is less toxic than CaNa/sub 2/EDTA. ICRF 158 does not form stable complexes with lead ions in vitro. The mechanism of action of this lipophilic EDTA derivative is compared to that of its hydrophilic correspondent, the chelating agent CaNa/sub 2/EDTA.

Cryogenic current leads

Energy Technology Data Exchange (ETDEWEB)

Zizek, F.

1982-01-01

Theoretical, technical and design questions are examined of cryogenic current leads for SP of magnetic systems. Simplified mathematical models are presented for the current leads. To illustrate modeling, the calculation is made of the real current leads for 500 A and three variants of current leads for 1500 A for the enterprise ''Shkoda.''

The effect of lead-based paint hazard remediation on blood lead levels of lead poisoned children in New York City

International Nuclear Information System (INIS)

Leighton, Jessica; Klitzman, Susan; Sedlar, Slavenka; Matte, Thomas; Cohen, Neal L.

2003-01-01

Despite the widespread use of lead paint hazard control for children with lead poisoning, few controlled studies that estimate the effect of such control on children's blood lead levels have been published. This retrospective follow-up study examined the effects of lead hazard remediation and its timing on the blood lead levels of lead-poisoned children. From the New York City child blood lead registry, 221 children were selected who had an initial blood lead level of 20-44 μg/dL between 1 July 1994 and 31 December 1996; were 6 months to 6 years of age; had a report of a follow-up blood lead test between 10 and 14 months after the initial test; had a lead-based paint hazard identified in the primary dwelling unit prior to the 10- to 14-month follow-up blood lead test; had resided or spent time at only one address with an identified lead-based paint hazard; and were not chelated. The decline in geometric mean blood lead levels from baseline to 10-14 months later was compared for children whose homes were remediated and whose homes were not remediated during the follow-up period. Regardless of remediation, geometric mean blood lead levels declined significantly from 24.3 μg/dL at the initial diagnosis to 12.3 μg/dL at the 10- to 14-month follow-up blood lead test (P<0.01). Among the 146 children whose homes were remediated the geometric mean blood lead levels declined 53% compared to 41% among the 75 children whose homes were not remediated by the follow-up blood lead test, a remediation effect of approximately 20% (P<0.01). After adjusting for potential confounders, the remediation effect was 11%, although it was no longer significant. Race was the only factor that appeared to confound the relationship: Black children had higher follow-up blood lead levels even after controlling for other factors, including the natural logarithm of the initial blood lead level. The effect of remediation appeared to be stronger for younger (10 to <36 months old) than for older (36

Three-dimensional investigations of the threading regime in a microfluidic flow-focusing channel

Science.gov (United States)

Gowda, Krishne; Brouzet, Christophe; Lefranc, Thibault; Soderberg, L. Daniel; Lundell, Fredrik

2017-11-01

We study the flow dynamics of the threading regime in a microfluidic flow-focusing channel through 3D numerical simulations and experiments. Making strong filaments from cellulose nano-fibrils (CNF) could potentially steer to new high-performance bio-based composites competing with conventional glass fibre composites. CNF filaments can be obtained through hydrodynamic alignment of dispersed CNF by using the concept of flow-focusing. The aligned structure is locked by diffusion of ions resulting in a dispersion-gel transition. Flow-focusing typically refers to a microfluidic channel system where the core fluid is focused by the two sheath fluids, thereby creating an extensional flow at the intersection. In this study, threading regime corresponds to an extensional flow field generated by the water sheath fluid stretching the dispersed CNF core fluid and leading to formation of long threads. The experimental measurements are performed using optical coherence tomography (OCT) and 3D numerical simulations with OpenFOAM. The prime focus is laid on the 3D characteristics of thread formation such as wetting length of core fluid, shape, aspect ratio of the thread and velocity flow-field in the microfluidic channel.

Work function of oxygen exposed lead and lead/indium alloy films

International Nuclear Information System (INIS)

Gundlach, K.H.; Hellemann, H.P.; Hoelzl, J.

1982-01-01

The effect of indium in superconducting tunnel junctions with lead/indium alloy base electrodes is investigated by measuring the vacuum work function of lead, indium, and lead/indium alloy films. It is found that the anomalous decrease of the work function of lead upon exposure to oxygen, explained by the penetration of oxygen into the inner surface of the lead film, is reversed into a slight increase in work function when some indium is added to the lead. This result indicates that the addition of indium provides a protection by suppressing the penetration of oxygen (and probably other gases) into the interior of the thin film

MOST RECENT FINDINGS IN EARNINGS MANAGEMENT AREA: INTERESTING INSIGHTS FROM TRADITIONALLY TOP 5 LEADING ACCOUNTING JOURNALS

OpenAIRE

Dan Dacian Cuzdriorean

2013-01-01

A meta-analysis was conducted over the last 5 years comprising traditionally top 5leading accounting research. The paper overviews emerging research and identify both frameworkpapers that attracted significant attention and leading scholars in the field. The earningsmanagement area exhibits considerable momentum, found largely driven by North Americanscholars focused research groups. The main goal of the paper was to offer a thoroughlyunderstanding of what literature has achieved so far and t...

Temperature-based on-column solute focusing in capillary liquid chromatography reduces peak broadening from precolumn dispersion and volume overload when used alone or with solvent-based focusing

Science.gov (United States)

Groskreutz, Stephen R.; Horner, Anthony R.; Weber, Stephen G.

2015-01-01

On-column focusing is essential for satisfactory performance using capillary scale columns. On-column focusing results from generating transient conditions at the head of the column that lead to high solute retention. Solvent-based on-column focusing is a well-known approach to achieve this. Temperature-assisted on-column focusing (TASF) can also be effective. TASF improves focusing by cooling a short segment of the column inlet to a temperature that is lower than the column temperature during the injection and then rapidly heating the focusing segment to the match the column temperature. A troublesome feature of an earlier implementation of TASF was the need to leave the capillary column unpacked in that portion of the column inside the fitting connecting it to the injection valve. We have overcome that problem in this work by packing the head of the column with solid silica spheres. In addition, technical improvements to the TASF instrumentation include: selection of a more powerful thermo-electric cooler to create faster temperature changes and electronic control for easy incorporation into conventional capillary instruments. Used in conjunction with solvent-based focusing and with isocratic elution, volumes of paraben samples (esters of p-hydroxybenzoic acid) up to 4.5-times the column liquid volume can be injected without significant bandspreading due to volume overload. Interestingly, the shapes of the peaks from the lowest volume injections that we can make, 30 nL, are improved when using TASF. TASF is very effective at reducing the detrimental effects of precolumn dispersion using isocratic elution. Finally, we show that TASF can be used to focus the neuropeptide galanin in a sample solvent with elution strength stronger than the mobile phase. Here, the stronger solvent is necessitated by the need to prevent peptide adsorption prior to and during analysis. PMID:26091787

Blood lead and lead-210 origins in residents of Toulouse

International Nuclear Information System (INIS)

Servant, J.; Delapart, M.

1981-01-01

Blood lead and lead-210 analyses were performed on blood samples from non-smoking residents of Toulouse (city of 400,000 inhabitants). Simultaneous surface soil lead content determinations were carried out by the same procedure on rural zone samples of southwestern France. The observed isotopic ratios were compared in order to evaluate food chain contamination. For an average of 19.7 +- 5.8 μg 100 cc -1 of lead in blood, atmospheric contamination amounts to 20%, estimated as follows: 6% from direct inhalation and 14% from dry deposits on vegetation absorbed as food. The natural levels carried over by the food chain reach 14.9 μg 100 cc -1 and have a 210 Pb/Pb concentration ratio of 0.055 dpmμg -1 . These results lead to a maximum value of 15 μg 100 cc -1 for natural lead in human blood according to the ICRP model. (author)

(Wormwood capillary) by random amplified polymorphic DNA (RAPD)

African Journals Online (AJOL)

STORAGESEVER

2009-05-04

May 4, 2009 ... Faculty of Agrotechnology and Food Science, Universiti Malaysia Terengganu, .... Operon and UBC (University of British Columbia, Canada) 10mers .... a visual representation of the relationship of difference population of.

Leading Wave Amplitude of a Tsunami

Science.gov (United States)

Kanoglu, U.

2015-12-01

Okal and Synolakis (EGU General Assembly 2015, Geophysical Research Abstracts-Vol. 17-7622) recently discussed that why the maximum amplitude of a tsunami might not occur for the first wave. Okal and Synolakis list observations from 2011 Japan tsunami, which reached to Papeete, Tahiti with a fourth wave being largest and 72 min later after the first wave; 1960 Chilean tsunami reached Hilo, Hawaii with a maximum wave arriving 1 hour later with a height of 5m, first wave being only 1.2m. Largest later waves is a problem not only for local authorities both in terms of warning to the public and rescue efforts but also mislead the public thinking that it is safe to return shoreline or evacuated site after arrival of the first wave. Okal and Synolakis considered Hammack's (1972, Ph.D. Dissertation, Calif. Inst. Tech., 261 pp., Pasadena) linear dispersive analytical solution with a tsunami generation through an uplifting of a circular plug on the ocean floor. They performed parametric study for the radius of the plug and the depth of the ocean since these are the independent scaling lengths in the problem. They identified transition distance, as the second wave being larger, regarding the parameters of the problem. Here, we extend their analysis to an initial wave field with a finite crest length and, in addition, to a most common tsunami initial wave form of N-wave as presented by Tadepalli and Synolakis (1994, Proc. R. Soc. A: Math. Phys. Eng. Sci., 445, 99-112). We compare our results with non-dispersive linear shallow water wave results as presented by Kanoglu et al. (2013, Proc. R. Soc. A: Math. Phys. Eng. Sci., 469, 20130015), investigating focusing feature. We discuss the results both in terms of leading wave amplitude and tsunami focusing. Acknowledgment: The research leading to these results has received funding from the European Union's Seventh Framework Programme (FP7/2007-2013) under grant agreement no 603839 (Project ASTARTE - Assessment, Strategy and Risk

Lead-oriented synthesis: Investigation of organolithium-mediated routes to 3-D scaffolds and 3-D shape analysis of a virtual lead-like library.

Science.gov (United States)

Lüthy, Monique; Wheldon, Mary C; Haji-Cheteh, Chehasnah; Atobe, Masakazu; Bond, Paul S; O'Brien, Peter; Hubbard, Roderick E; Fairlamb, Ian J S

2015-06-01

Synthetic routes to six 3-D scaffolds containing piperazine, pyrrolidine and piperidine cores have been developed. The synthetic methodology focused on the use of N-Boc α-lithiation-trapping chemistry. Notably, suitably protected and/or functionalised medicinal chemistry building blocks were synthesised via concise, connective methodology. This represents a rare example of lead-oriented synthesis. A virtual library of 190 compounds was then enumerated from the six scaffolds. Of these, 92 compounds (48%) fit the lead-like criteria of: (i) -1⩽AlogP⩽3; (ii) 14⩽number of heavy atoms⩽26; (iii) total polar surface area⩾50Å(2). The 3-D shapes of the 190 compounds were analysed using a triangular plot of normalised principal moments of inertia (PMI). From this, 46 compounds were identified which had lead-like properties and possessed 3-D shapes in under-represented areas of pharmaceutical space. Thus, the PMI analysis of the 190 member virtual library showed that whilst scaffolds which may appear on paper to be 3-D in shape, only 24% of the compounds actually had 3-D structures in the more interesting areas of 3-D drug space. Copyright © 2015 Elsevier Ltd. All rights reserved.

Lead-Free Piezoelectrics

CERN Document Server

Nahm, Sahn

2012-01-01

Ecological restrictions in many parts of the world are demanding the elimination of Pb from all consumer items. At this moment in the piezoelectric ceramics industry, there is no issue of more importance than the transition to lead-free materials. The goal of Lead-Free Piezoelectrics is to provide a comprehensive overview of the fundamentals and developments in the field of lead-free materials and products to leading researchers in the world. The text presents chapters on demonstrated applications of the lead-free materials, which will allow readers to conceptualize the present possibilities and will be useful for both students and professionals conducting research on ferroelectrics, piezoelectrics, smart materials, lead-free materials, and a variety of applications including sensors, actuators, ultrasonic transducers and energy harvesters.

The detrimental effects of lead on human and animal health

Directory of Open Access Journals (Sweden)

Mohammed Abdulrazzaq Assi

2016-06-01

Full Text Available Lead, a chemical element in the carbon group with symbol Pb (from Latin: Plumbum, meaning “the liquid silver” and has an atomic number 82 in the periodic table. It was the first element that was characterized by its kind of toxicity. In animal systems, lead (Pb has been incriminated in a wide spectrum of toxic effects and it is considered one of the persistent ubiquitous heavy metals. Being exposed to this metal could lead to the change of testicular functions in human beings as well as in the wildlife. The lead poising is a real threat to the public health, especially in the developing countries. Accordingly, great efforts on the part of the occupational and public health have been taken to curb the dangers of this metal. Hematopoietic, renal, reproductive, and central nervous system are among the parts of the human body and systems that are vulnerable toward the dangers following exposure to high level of Pb. In this review, we discussed the massive harmful impact that leads acetate toxicity has on the animals and the worrying fact that this harmful toxicant can be found quite easily in the environment and abundance. Highlighting its (Pb effects on various organs in the biological systems, its economic, as well as scientific importance, with the view to educate the public/professionals who work in this area. In this study, we focus on the current studies and research related to lead toxicity in animals and also to a certain extent toward human as well.

The combination of electrospray and flow focusing

Science.gov (United States)

Gañán-Calvo, Alfonso M.; López-Herrera, José M.; Riesco-Chueca, Pascual

2006-11-01

An ultra-fine liquid atomization procedure combining the advantages of electrospray and flow focusing is presented. Both techniques are known to produce strikingly small and steady liquid micro-jets issuing from menisci held by capillary forces. Such menisci take the form of a cusp-like drop attached to the feeding tube (flow focusing: FF) or a Taylor cone (electrospray: ES). The issuing micro-jets are forced or ‘sucked’ from the parent meniscus either by pressure or electrohydrodynamic forces. Subsequent capillary breakup of the jet leads to fine sprays of remarkable quality. Here we describe the joint effect of pressurization and electrification in a flow focusing device, and the subsequent coupling of both ES and FF phenomena. For any given liquid and flow rate, the combined procedure gives rise to significantly smaller droplet sizes than observed in any of the source techniques. The co-flowing gas stream removes space charges; in addition, the perforated plate facing the feed tube provides an electric barrier, shielding the jet-meniscus or ‘production’ area from the spray or ‘product’ area. As a result, space charges and electrified droplets are removed from the production area, thus avoiding the ambient electric saturation which becomes a limiting factor in ES-spraying: a significantly enhanced spraying stability ensues, with a much wider operation range than FF or ES. Other unexpected outcomes from the combination are also shown. A theoretical model is developed to predict the emitted droplet size: a first integral of the momentum equation yielding a generalized Bernoulli equation, and an explicit approximation for the jet diameter and droplet size, accurate within a broad parametrical band.

Lead Toxicity

Science.gov (United States)

... o Do not use glazed ceramics, home remedies, cosmetics, or leaded-crystal glassware unless you know that they are lead safe. o If you live near an industry, mine, or waste site that may have contaminated ...

Aspects of Hydrological Modelling In The Punjab Himalayan and Karakoram Ranges, Pakistan

Science.gov (United States)

Loukas, A.; Khan, M. I.; Quick, M. C.

Various aspects of hydrologic modelling of high mountainous basins in the Punjab Hi- malayan and Karakoram ranges of Northern Pakistan were studied. The runoff from three basins in this region was simulated using the U.B.C. watershed model, which re- quires limited meteorological data of minimum and maximum daily temperature and precipitation. The structure of the model is based on the concept that the hydrolog- ical behavior is a function of elevation and thus, a watershed is conceptualized as a number of elevational zones. A simplified energy budget approach, which is based on daily maximum and minimum temperature and can account for forested and open areas, and aspect and latitude, is used in the U.B.C. model for the estimation of the snowmelt and glacier melt. The studied basins have different hydrological responses and limited data. The runoff from the first basin, the Astore basin, is mainly gener- ated by snowmelt. In the second basin, the Kunhar basin, the runoff is generated by snowmelt but significant redistribution of snow, caused by snow avalanches, affect the runoff generation. The third basin, the Hunza basin, is a highly glacierized basin and its runoff is mainly generated by glacier melt. The application of the U.B.C. watershed model to these three basins showed that the model could estimate reasonably well the runoff generated by the different components.

High Intensity Focused Ultrasound for Cancer Therapy--harnessing its non-linearity

International Nuclear Information System (INIS)

Haar, Gail ter

2008-01-01

In medicine in general, and for cancer treatments in particular, there is a drive to find effective non-invasive therapies. High Intensity Focused Ultrasound (HIFU) represents one such technique. In principle, it is simple--a high energy ultrasound beam is brought to a tight focus within a target which may lie several centimetres below the skin surface (for example, in a tumour of the liver), and is used to destroy a selected tissue volume. The main mechanism for cell killing in a HIFU beam is heat. Ultrasound energy absorption is frequency dependent, the higher frequencies being absorbed most strongly. Significant thermal advantage may therefore be gained from non-linear propagation, which generates higher harmonics, in tissue. Acoustic cavitation and thermal exsolution of gas (boiling) also contribute to tissue damage. This activity leads to the local mechanical disruption of cells. In addition, the non-linear oscillation of these bubbles leads to enhanced energy deposition. The acoustic emissions from such bubbles are characteristic of their behaviour and may be correlated to some extent with the appearance of the disruption produced. The more widespread clinical acceptance of HIFU is awaiting faster, and more efficient, energy delivery and treatment monitoring. A better understanding of the nonlinear aspects of HIFU propagation in tissue is thus important if this technique is to benefit more patients

Methylxanthines and drug dependence: a focus on interactions with substances of abuse.

Science.gov (United States)

Morelli, Micaela; Simola, Nicola

2011-01-01

This chapter examines the psychostimulant actions of methylxanthines, with a focus on the consequences of their excessive use. Consumption of methylxanthines is pervasive and their use is often associated with that of substances known to produce dependence and to have abuse potential. Therefore, the consequences of this combined use are taken into consideration in order to evaluate whether, and to what extent, methylxanthines could influence dependence on or abuse of other centrally active substances, leading to either amplification or attenuation of their effects. Since the methylxanthine that mostly influences mental processes and readily induces psychostimulation is caffeine, this review mainly focuses on caffeine as a prototype of methylxanthine-produced dependence, examining, at the same time, the risks related to caffeine use.

Experimental Study of the Phenomenology of Spallation Neutrons in a Large Lead Block

CERN Multimedia

Galvez Altamirano, J; Lopez, C; Perlado, J M; Perez-Navarro, A

2002-01-01

%PS211 %title \\\\ \\\\The purpose of PS211 is to determine how neutrons, produced by spallation inside a large Lead volume are slowed down by undergoing a very large number of scatterings, losing each time a small fraction ($\\sim$ 1\\%) of their kinetic energy. The focus is in determining the probability for a spallation neutron produced at an energy of several MeV or more, to survive capture on Lead resonances and to reach resonance energies of materials to be transmuted, such as 5.6 eV for $^{99}$Tc. This process, of Adiabatic Resonance Crossing, involves a subtle interplay between the capture resonances of the Lead medium and of selected impurities. This phenomenology of spallation neutrons in a large Lead volume, is the physics foundation of the Fast Energy Amplifier proposed by C. Rubbia, and could open up new possibilities in the incineration of long-lived nuclear waste such as Actinides or Fission Fragments (e.g. $^{99}$Tc, $^{129}$I, etc.).\\\\ \\\\334 tons of high purity Lead, installed in t7, are exposed to...

Stabilization of Reversed Replication Forks by Telomerase Drives Telomere Catastrophe.

Science.gov (United States)

Margalef, Pol; Kotsantis, Panagiotis; Borel, Valerie; Bellelli, Roberto; Panier, Stephanie; Boulton, Simon J

2018-01-25

Telomere maintenance critically depends on the distinct activities of telomerase, which adds telomeric repeats to solve the end replication problem, and RTEL1, which dismantles DNA secondary structures at telomeres to facilitate replisome progression. Here, we establish that reversed replication forks are a pathological substrate for telomerase and the source of telomere catastrophe in Rtel1 -/- cells. Inhibiting telomerase recruitment to telomeres, but not its activity, or blocking replication fork reversal through PARP1 inhibition or depleting UBC13 or ZRANB3 prevents the rapid accumulation of dysfunctional telomeres in RTEL1-deficient cells. In this context, we establish that telomerase binding to reversed replication forks inhibits telomere replication, which can be mimicked by preventing replication fork restart through depletion of RECQ1 or PARG. Our results lead us to propose that telomerase inappropriately binds to and inhibits restart of reversed replication forks within telomeres, which compromises replication and leads to critically short telomeres. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

The lead and lead-acid battery industries during 2002 and 2007 in China

Energy Technology Data Exchange (ETDEWEB)

Chen, H.Y.; Li, A.J.; Finlow, D.E. [Key Lab of Electrochemical Technology on Energy Storage and Power Generation in Guangdong Universities, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China)

2009-06-01

In the past 15 years, the center of the international lead market has shifted to China. China has become the largest producer of raw and refined lead, plus the largest consumer. This paper reviews the status of the lead and lead-acid battery industries in China, including lead mining, lead refining, secondary lead production, the lead-acid battery industry, new opportunities for lead-acid batteries, and the environmental problems associated with lead and lead-acid batteries. The output of raw and refined lead has increased annually in China, and now accounts for more than 30% of the world total. As a result of a change in the Chinese government's policy regarding the export of lead, plus an increase in the price of lead, the profits of Chinese lead manufacturers were significantly reduced, the trade deficit of the Chinese lead industry increased, the operating rates of lead smelter enterprises greatly reduced, and some small enterprises were forced to shut down. At the present time, an increasing number of enterprises have begun to produce secondary lead, and the scale of production has expanded from tens of tons to tens of thousands of tons. In 2006, the output of secondary lead in China reached 700,000 tons, but outdated technology and equipment limited development of the secondary lead industry. Because of serious pollution problems, raw material shortages, and fierce price competition in the battery market, changes in the development of the lead-acid battery industry have been dramatic; approximately one thousand medium-sized and small lead-acid battery producers have been closed in the past 3 years. The output of large lead-acid battery enterprises has not been reduced, however, as a result of their manufacturing technology and equipment being comparable to those in other advanced industrial countries. In China, the flourishing development of electric bicycles, electric tricycles, and photovoltaic energy systems should provide ongoing opportunities for

The lead and lead-acid battery industries during 2002 and 2007 in China

International Nuclear Information System (INIS)

Chen, H.Y.; Li, A.J.; Finlow, D.E.

2009-01-01

In the past 15 years, the center of the international lead market has shifted to China. China has become the largest producer of raw and refined lead, plus the largest consumer. This paper reviews the status of the lead and lead-acid battery industries in China, including lead mining, lead refining, secondary lead production, the lead-acid battery industry, new opportunities for lead-acid batteries, and the environmental problems associated with lead and lead-acid batteries. The output of raw and refined lead has increased annually in China, and now accounts for more than 30% of the world total. As a result of a change in the Chinese government's policy regarding the export of lead, plus an increase in the price of lead, the profits of Chinese lead manufacturers were significantly reduced, the trade deficit of the Chinese lead industry increased, the operating rates of lead smelter enterprises greatly reduced, and some small enterprises were forced to shut down. At the present time, an increasing number of enterprises have begun to produce secondary lead, and the scale of production has expanded from tens of tons to tens of thousands of tons. In 2006, the output of secondary lead in China reached 700,000 tons, but outdated technology and equipment limited development of the secondary lead industry. Because of serious pollution problems, raw material shortages, and fierce price competition in the battery market, changes in the development of the lead-acid battery industry have been dramatic; approximately one thousand medium-sized and small lead-acid battery producers have been closed in the past 3 years. The output of large lead-acid battery enterprises has not been reduced, however, as a result of their manufacturing technology and equipment being comparable to those in other advanced industrial countries. In China, the flourishing development of electric bicycles, electric tricycles, and photovoltaic energy systems should provide ongoing opportunities for the

Narcissistic personality and risk perception among Chinese aviators: The mediating role of promotion focus.

Science.gov (United States)

Ju, Chengting; Ji, Ming; Lan, Jijun; You, Xuqun

2017-12-01

Optimism bias is a crucial feature of risk perception that leads to increased risk-taking behaviour, which is a particularly salient issue among pilots in aviation settings due to the high-stakes nature of flight. The current study sought to address the roles of narcissism and promotion focus on optimism bias in risk perception in aviation context. Participants were 239 male flight cadets from the Civil Aviation Flight University of China who completed the Narcissistic Personality Inventory-13, the Work Regulatory Focus Scale, and an indirect measure of unrealistic optimism in risk perception, which measured risk perception for the individual and the risk assumed by other individuals performing the same task. Higher narcissism increased the likelihood of underestimating personal risks, an effect that was mediated by high promotion focus motivation, such that high narcissism led to high promotion focus motivation. The findings have important implications for improving the accuracy of risk perception in aviation risks among aviators. © 2016 International Union of Psychological Science.

A green lead hydrometallurgical process based on a hydrogen-lead oxide fuel cell.

Science.gov (United States)

Pan, Junqing; Sun, Yanzhi; Li, Wei; Knight, James; Manthiram, Arumugam

2013-01-01

The automobile industry consumed 9 million metric tons of lead in 2012 for lead-acid batteries. Recycling lead from spent lead-acid batteries is not only related to the sustainable development of the lead industry, but also to the reduction of lead pollution in the environment. The existing lead pyrometallurgical processes have two main issues, toxic lead emission into the environment and high energy consumption; the developing hydrometallurgical processes have the disadvantages of high electricity consumption, use of toxic chemicals and severe corrosion of metallic components. Here we demonstrate a new green hydrometallurgical process to recover lead based on a hydrogen-lead oxide fuel cell. High-purity lead, along with electricity, is produced with only water as the by-product. It has a >99.5% lead yield, which is higher than that of the existing pyrometallurgical processes (95-97%). This greatly reduces lead pollution to the environment.

Exploring valid reference genes for quantitative real - time rt - pce studies of hydrogenperoxide signaling in arabidopsis

International Nuclear Information System (INIS)

Zhou, H.; Han, B.; Xie, Y.; Zhang, J.; Shen, W.

2015-01-01

Hydrogen peroxide (H/sub 2/O/sub 2/ ) acts as a signaling molecule modulating the expression of various genes in plants. However, the reference gene(s) used for gene expression analysis of H/sub 2/O/sub 2/ signaling is still arbitrary. A reliable result obtained by quantitative real-time RT-PCR (RT-qPCR) highly depends on accurate transcript normalization using stably expressed reference genes, whereas the inaccurate normalization could easily lead to the false conclusions. In this report, by using geNorm and NormFinder algorithms, 12 candidate reference genes were evaluated and compared in root and shoot tissues of Arabidopsis upon different doses of H/sub 2/O/sub 2/. The results revealed that, in our experimental conditions, three novel reference genes (TIP41-like, UKN, and UBC21) were identified and validated as suitable reference genes for RT-qPCR normalization in both root and shoot tissues under oxidative stress. This conclusion was further confirmed by publicly available microarray data of methyl viologen and drought stress. In comparison with a single reference gene (EF-1a), the expression pattern of ZAT12 modulated by H/sub 2/O/sub 2/, when using TIP41-like, UKN, and UBC21 as multiple reference gene(s), was similar with the previous reports by using northern blotting. Thus, we proposed that these three reference genes might be good candidates for other researchers to include in their reference gene validation in gene expression studies under H/sub 2/O/sub 2/ related oxidative stress. (author)

Lead Contamination and Microbial Lead Tolerance in Soils at Major ...

African Journals Online (AJOL)

Devika

ABSTRACT: Lead pollution and lead tolerance levels of microbes in soil at major road junctions in Benin. City were investigated. Results revealed that distance from the road junctions affected the concentrations of lead in soil, as well as the microbial population density and types of microbes present in the soil. The highest ...

Lead Contamination and Microbial Lead Tolerance in Soils at Major ...

African Journals Online (AJOL)

Lead pollution and lead tolerance levels of microbes in soil at major road junctions in Benin City were investigated. Results revealed that distance from the road junctions affected the concentrations of lead in soil, as well as the microbial population density and types of microbes present in the soil. The highest concentrations ...

Packaging and transportation of radioactively contaminated lead

International Nuclear Information System (INIS)

Gleason, Eugene; Holden, Gerard

2007-01-01

Under the management of the Nuclear Decommissioning Authority (NDA) the government of the United Kingdom has launched an ambitious program to remediate the nation's nuclear waste legacy. Over a twenty-five year period NDA plans to decommission several first generation nuclear power plants and other radioactive facilities. The use innovative, safe 'fit for purpose' technologies will be a major part of this complex program. This paper will present a case study of a recently completed project undertaken in support of the nuclear decommissioning activities at the Sellafield site in the United Kingdom. The focus is on an innovative application of new packaging technology developed for the safe transportation of radioactively contaminated lead objects. Several companies collaborated on the project and contributed to its safe and successful conclusion. These companies include British Nuclear Group, Gravatom Engineering, W. F. Bowker Transport, Atlantic Container Lines, MHF Logistical Solutions and Energy Solutions. New containers and a new innovative inter-modal packaging system to transport the radioactive lead were developed and demonstrated during the project. The project also demonstrated the potential contribution of international nuclear recycling activities as a safe, economic and feasible technical option for nuclear decommissioning in the United Kingdom. (authors)

The effects of thiamin on lead metabolism: organ distribution of lead 203.

Science.gov (United States)

Kim, J S; Hamilton, D L; Blakley, B R; Rousseaux, C G

1992-01-01

The effect of thiamin on the organ distribution of lead was evaluated in CD-1 mice exposed intragastrically or intraperitoneally to a single dose of lead acetate (100 micrograms) containing 100 microCi lead 203. They were treated with either thiamin (25 or 50 mg/kg body weight), calcium ethylenediaminetetraacetic acid (CaEDTA) (50 mg/kg body weight), or combinations of thiamin and CaEDTA. The whole body retention and the organ distribution of lead 203 varied depending upon the route of lead administration, dose of thiamin and the specific treatment combination. Thiamin (25 or 50 mg/kg) treatment increased the whole body retention of both intragastric and intraperitoneal lead by approximately 10% in each instance. Calcium ethylenediaminetetraacetic acid, either alone or in combination with thiamin (50 mg/kg) reduced the whole body retention of lead by as much as 14% regardless of route of lead exposure. The relative retention of lead by the liver, kidney and spleen was greater in mice exposed to lead by the intragastric route. Regardless of route, CaEDTA in the combined treatment reduced the relative retention of lead in both the liver and kidney, whereas thiamin alone only reduced the retention of lead in the kidney. The results of this study indicate that thiamin in combination with CaEDTA alters the distribution and retention of lead in a manner which may have therapeutic application as it relates to chelation therapy. PMID:1423063

Towards a more adaptive co - management of natural resources ...

African Journals Online (AJOL)

2014-06-01

Jun 1, 2014 ... being channelled into Madagascar's environmental sector since the mid-1980s, the ...... firmly embedded in Malagasy environmental legislation, there is little potential to ..... UBC Press, British Colombia. Norris, S. 2006.

Leading for success unleash your leadership potential to achieve extraordinary results

CERN Document Server

Cook, Sarah

2009-01-01

Leading for Success is intended to provide IT managers with practical advice and tips on how to become an effective leader. Whatever the environment in which you work, providing effective leadership fosters a climate where team members want to give of their best and where organisational goals are more likely to be reached. Furthermore, there is a strong focus on leadership and the creation of stakeholder value for an organisation.

The effects of attentional focus in the preparation and execution of a standing long jump.

Science.gov (United States)

Becker, Kevin A; Fairbrother, Jeffrey T; Couvillion, Kaylee F

2018-04-03

Attentional focus research suggests an external focus leads to improved motor performance compared to an internal focus (Wulf in Int Rev Sport Exerc Psychol 6:77-104, 2013), but skilled athletes often report using an internal focus (Fairbrother et al., Front Psychol 7:1028, 2016) and sometimes shifting between different foci in the preparation and execution phases of performance (Bernier et al. in J Appl Sport Psychol 23:326-341, 2011; Bernier et al. in Sport Psychol 30:256-266, 2016). To date, focus shifts have been unexplored in experimental research, thus the purpose of this study was to determine the effect of shifting focus between the preparation and execution phases of a standing long jump. Participants (N = 29) completed two jumps in a control condition (CON), followed by two jumps in four experimental conditions presented in a counterbalanced order. Conditions included using an external focus (EF) and internal focus (IF) in both preparation and execution of the skill, as well as shifting from an internal focus in preparation to an external focus in execution (ITE), and an external focus in preparation to an internal focus in execution (ETI). Jump distance was analyzed with a repeated measures ANOVA. The main effect of condition was significant, p ITE also generated farther jumps than IF and CON (p's ITE conditions suggests that the focus employed in execution has the strongest impact on performance. Additionally, if an internal focus must be used in preparation, the performance decrement can be ameliorated by shifting to an external focus during execution.

Lead shot from hunting as a source of lead in human blood

International Nuclear Information System (INIS)

Johansen, Poul; Pedersen, Henning Sloth; Asmund, Gert; Riget, Frank

2006-01-01

This study investigates the relationship between the intake of birds hunted with lead shot and the lead concentration in human blood. Fifty adult men from Nuuk, Greenland took part in the study. From September 2003 to June 2004 they regularly gave blood samples and recorded how many birds they ate. We found a clear relationship between the number of bird meals and blood lead and also a clear seasonal variation. The concentration was highest in mid-winter when bird consumption is at its highest. Blood lead was low (15 μg/L, mean concentration) among the participants reporting not eating birds. Among those reporting to eat birds regularly, blood lead was significantly higher, up to 128 μg/L (mean concentration). Concentrations depended on the frequency of bird meals: the more the bird meals, the higher the resulting blood lead. This clear relationship points to lead shot as the dominating lead source to people in Greenland. - Birds hunted with lead shot and consumed are a source of lead in human blood

Lead shot from hunting as a source of lead in human blood

Energy Technology Data Exchange (ETDEWEB)

Johansen, Poul [National Environmental Research Institute, Frederiksborgvej 399, DK-4000 Roskilde (Denmark)]. E-mail: poj@dmu.dk; Pedersen, Henning Sloth [Primary Health Care Center, DK-3900 Nuuk (Greenland); Asmund, Gert [National Environmental Research Institute, Frederiksborgvej 399, DK-4000 Roskilde (Denmark); Riget, Frank [National Environmental Research Institute, Frederiksborgvej 399, DK-4000 Roskilde (Denmark)

2006-07-15

This study investigates the relationship between the intake of birds hunted with lead shot and the lead concentration in human blood. Fifty adult men from Nuuk, Greenland took part in the study. From September 2003 to June 2004 they regularly gave blood samples and recorded how many birds they ate. We found a clear relationship between the number of bird meals and blood lead and also a clear seasonal variation. The concentration was highest in mid-winter when bird consumption is at its highest. Blood lead was low (15 {mu}g/L, mean concentration) among the participants reporting not eating birds. Among those reporting to eat birds regularly, blood lead was significantly higher, up to 128 {mu}g/L (mean concentration). Concentrations depended on the frequency of bird meals: the more the bird meals, the higher the resulting blood lead. This clear relationship points to lead shot as the dominating lead source to people in Greenland. - Birds hunted with lead shot and consumed are a source of lead in human blood.

The leaching of lead from lead-based paint in landfill environments.

Science.gov (United States)

Wadanambi, Lakmini; Dubey, Brajesh; Townsend, Timothy

2008-08-30

Lead leaching from lead-based paint (LBP) was examined using standardized laboratory protocols and tests with leachate from actual and simulated landfill environments. Two different LBP samples were tested; leaching solutions included leachates from three municipal solid waste (MSW) landfills and three construction and demolition (C&D) debris landfills. The toxicity characteristic leaching procedure (TCLP) and the synthetic precipitation leaching procedure (SPLP) were also performed. Lead concentrations were many times higher using the TCLP compared to the SPLP and the landfill leachates. No significant difference (alpha=0.05) was observed in leached lead concentrations from the MSW landfill and C&D debris landfill leachates. The impact of other building materials present in LBP debris on lead leaching was examined by testing mixtures of LBP (2%) and different building materials (98%; steel, wood, drywall, concrete). The type of substrate present impacted lead leaching results, with concrete demonstrating the most dramatic impact; the lowest lead concentrations were measured in the presence of concrete under both TCLP and SPLP extractions.

Relationship between soil lead and airborne lead concentrations at Springfield, Missouri, USA

Energy Technology Data Exchange (ETDEWEB)

Sheets, R W; Kyger, J R; Biagioni, R N; Probst, S [Department of Chemistry, Southwest Missouri State University, 65804 Springfield, MO (United States); Boyer, R; Barke, K [Greene County Health Department, 65802 Springfield, MO (United States)

2001-04-23

This study tests whether lead deposited to soil from automobiles during past years in a medium-sized US city (population 150000) may present a current health risk. It examines the relationship between current soil lead concentrations at nine locations within the city of Springfield, Missouri, and airborne lead levels measured at the same locations during years (1975-1981) when lead emissions from automobiles were much greater than at present. A strong, significant correlation is found between soil and airborne lead levels at eight of the sites (r=0.91, P<0.005 for soil lead vs. 1979 airborne lead), in low-traffic areas as well as in areas adjacent to heavy traffic flow. Residual lead concentrations in these soils are relatively low, even for the high-traffic sites, as expected for a medium sized city.

Corrosion by liquid lead and lead-bismuth: experimental results review and analysis

Energy Technology Data Exchange (ETDEWEB)

Zhang, Jinsuo [Los Alamos National Laboratory

2008-01-01

Liquid metal technologies for liquid lead and lead-bismuth alloy are under wide investigation and development for advanced nuclear energy systems and waste transmutation systems. Material corrosion is one of the main issues studied a lot recently in the development of the liquid metal technology. This study reviews corrosion by liquid lead and lead bismuth, including the corrosion mechanisms, corrosion inhibitor and the formation of the protective oxide layer. The available experimental data are analyzed by using a corrosion model in which the oxidation and scale removal are coupled. Based on the model, long-term behaviors of steels in liquid lead and lead-bismuth are predictable. This report provides information for the selection of structural materials for typical nuclear reactor coolant systems when selecting liquid lead or lead bismuth as heat transfer media.

Relationship between soil lead and airborne lead concentrations at Springfield, Missouri, USA.

Science.gov (United States)

Sheets, R W; Kyger, J R; Biagioni, R N; Probst, S; Boyer, R; Barke, K

2001-04-23

This study tests whether lead deposited to soil from automobiles during past years in a medium-sized US city (population 150,000) may present a current health risk. It examines the relationship between current soil lead concentrations at nine locations within the city of Springfield, Missouri, and airborne lead levels measured at the same locations during years (1975-1981) when lead emissions from automobiles were much greater than at present. A strong, significant correlation is found between soil and airborne lead levels at eight of the sites (r = 0.91, P lead vs. 1979 airborne lead), in low-traffic areas as well as in areas adjacent to heavy traffic flow. Residual lead concentrations in these soils are relatively low, even for the high-traffic sites, as expected for a medium sized city.

Biochemical function of typical and variant Arabidopsis thaliana U-box E3 ubiquitin-protein ligases.

Science.gov (United States)

Wiborg, Jakob; O'Shea, Charlotte; Skriver, Karen

2008-08-01

The variance of the U-box domain in 64 Arabidopsis thaliana (thale cress) E3s (ubiquitin-protein ligases) was used to examine the interactions between E3s and E2s (ubiquitin-conjugating enzymes). E2s and E3s are components of the ubiquitin protein degradation pathway. Seven U-box proteins were analysed for their ability to ubiquitinate proteins in vitro in co-operation with different E2s. All U-box domains exhibited ubiquitination activity and interacted productively with UBC4/5-type E2s. Three and four of the U-box domains mediated ubiquitin addition in the presence of UBC13 and UBC7 E2s respectively, but no productive interaction was observed with the UBC15 E2 tested. The activity of AtPUB54 [Arabidopsis thaliana (thale cress) plant U-box 54 protein] was dependent on Trp(266) in the E2-binding cleft, and the E2 selectivity was changed by substitution of this position. The function of the distant U-box protein, AtPUB49, representing a large family of eukaryotic proteins containing a U-box linked to a cyclophilin-like peptidyl-prolyl cis-trans isomerase domain, was characterized biochemically. AtPUB49 functioned both as a prolyl isomerase and a chaperone by catalysing cis-trans isomerization of peptidyl-prolyl bonds and dissolving protein aggregates. In conclusion, both typical and atypical Arabidopsis U-box proteins were active E3s. The overlap in the E3/E2 selectivity suggests that in vivo specificity is not determined only by the E3-E2 interactions, but also by other parameters, e.g. co-existence or interactions with additional domains. The biochemical functions of AtPUB49 suggest that the protein can be involved in folding or degradation of protein substrates. Similar functions can also be retained within a protein complex with separate chaperone and U-box proteins.

Uranium-lead systematics

International Nuclear Information System (INIS)

Wickman, F.E.

1983-01-01

The method of Levchenkov and Shukolyukov for calculating age and time disturbance of minerals without correction for original lead is generalized to include the cases when (1) original lead and radiogenic lead leach differently, and (2) the crystals studied consist of a core and a mantle. It is also shown that a straight line obtained from the solution of the equations is the locus of the isotopic composition of original lead. (Auth.)

[Pre-verbality in focusing and the need for self check. An attempt at "focusing check"].

Science.gov (United States)

Masui, T; Ikemi, A; Murayama, S

1983-06-01

Though the Focusing process is not entirely non-verbal, in Focusing, careful attention is paid by the Focuser and the Listener to the pre-verbal experiential process. In other words, Focusing involves attending to the felt sense that is not easily expressed in words immediately. Hence, during the process of learning to Focus, the Focusing teacher attempts to communicate the experiences of Focusing to the student which are not easily done by words. Due to such difficulties, the Focusing student may (and quite frequently does) mistake the experiential process in Focusing with other processes. Often, the felt sense can be confused with other phenomena such as "autogenic discharge". Also the Focuser may not stay with the felt sense and drift into "free association" or frequently, certain processes in "meditation" can be confused with Focusing. Therefore, there is a need for a "check" by which the Focusing student can confirm the Focusing experience for himself. For the Focusing student, such a "check" serves not only to confirm the Focusing process, but also an aid to learning Focusing. We will report here a "Focusing Check" which we developed by translating Eugene Gendlin's "Focusing Check" and making several modifications in it so that it will be more understandable to the Japanese. Along with the "Focusing Check" we developed, the authors discuss the need for such a check.

The Differential Effects of Attentional Focus in Children with Moderate and Profound Visual Impairments

Directory of Open Access Journals (Sweden)

Scott W. T. McNamara

2017-10-01

Full Text Available It has been consistently reported that an external focus of attention leads to better motor performance than an internal focus, but no research to date has explored this effect in a population with visual impairments (VI. External focus statements typically reference something in the environment (e.g., target that may be difficult to conceptualize for people with VI since they cannot generate a visual representation of the object of focus. Internal focus statements could be more closely identifiable with proprioception that is not impaired in this population. Recent studies have reported that sighted adults with temporarily obstructed vision are able to receive an external focus benefit when performing discrete tasks (i.e., golf putt and vertical jump, however, it is unclear if those with VI would experience the same benefit. The purpose of this investigation was to compare how an internal focus and external focus impact the balance of children with VI. Eighteen children with VI were grouped into a moderate (n = 11 and a profound VI group (n = 7. Participants completed a familiarization trial, an internal focus trial (i.e., focusing on feet and an external focus trial (i.e., focusing on markers in a counterbalanced order. The moderate VI group had a lower root mean square error while using an external focus (p = 0.04, while the profound VI group did not differ between conditions (p > 0.05. These results suggest that while performing a task reliant on sensory feedback, an external focus benefit may be dependent on the severity of VI. Further research is needed to examine whether external focus statements can be presented in a way that may be more intuitive to those with profound VI. These findings may help to influence how professionals in health-related fields (e.g., physical therapist and physical educators give instructions on motor performance to populations with VI.

Spectrum of reflected light by self-focusing of light in a laser plasma

International Nuclear Information System (INIS)

Gorbunov, L.M.

1983-01-01

The spectrum of the radiation reflected by a laser-produced plasma is considered. In this situation, self-focusing occurs and a region of low density (caviton) is formed. It is shown that the process leads to a considerable broadening of the spectrum on the ''red'' side, and to the appearance of a line structure in the spectrum. The results can explain data for the reflected light spectrum [L. M. Gorbunov et al., FIAN Preprint No. 126 (1979)] as being due to the nonstationary self-focusing of light in a laser-produced plasma that has recently been observed [V. L. Artsimovich et al., FIAN Preprint No. 252 (1981); Sov. Phys. Doklady 27, 618 (1982)

EC FP6 Siberia-focused Enviro-RISKS Project and its Outcomes

Science.gov (United States)

Baklanov, A. A.; Gordov, E. P.

2009-04-01

The FP6 Project "Man-induced Environmental Risks: Monitoring, Management and Remediation of Man-made Changes in Siberia" (Enviro-RISKS) strategic objective is to facilitate elaboration of solid scientific background and understanding of man-made associated environmental risks, their influence on all aspects of regional environment and optimal ways for it remediation by means of coordinated initiatives of a range of relevant RTD projects as well as to achieve their improved integration thus giving the projects additional synergy in current activities and potential for practical applications. List of Partners includes 3 leading European research organizations, 6 leading Russian research organizations (5 - located in Siberia) and 1 organization from Kazakhstan. Additionally several Russian and European research organizations joined to the Project as Associated Partners. Scientific background and foundation for the project performance is formed by a number of different levels RTD projects carried out by Partners and devoted to near all aspects of the theme. The set comprise coordinated/performed by partners EC funded thematic international projects, Russian national projects and other projects performed by NIS partners. Project outcomes include, in particular, development and support of the bilingual Enviro-RISKS web portal (http://risks.scert.ru/) as the major tool for disseminations of environmental information and project results; achieved level of development of Siberia Integrated Regional Study (SIRS, http://sirs.scert.ru/), which is the Siberia-focused NEESPI Environmental Mega-Project ongoing under the auspices of the Siberian Branch of the Russian Academy of Sciences. The main Project outcome are Memorandum on the state of the art of environmental RTD activity in Siberia and Recommendations on future environmental RTD activity in Siberia elaborated by four Working Experts Groups working in most important for Siberia Thematic Focuses. Three Thematic Focuses

Focusing of Acoustic Waves through Acoustic Materials with Subwavelength Structures

KAUST Repository

Xiao, Bingmu

2013-05-01

In this thesis, wave propagation through acoustic materials with subwavelength slits structures is studied. Guided by the findings, acoustic wave focusing is achieved with a specific material design. By using a parameter retrieving method, an effective medium theory for a slab with periodic subwavelength cut-through slits is successfully derived. The theory is based on eigenfunction solutions to the acoustic wave equation. Numerical simulations are implemented by the finite-difference time-domain (FDTD) method for the two-dimensional acoustic wave equation. The theory provides the effective impedance and refractive index functions for the equivalent medium, which can reproduce the transmission and reflection spectral responses of the original structure. I analytically and numerically investigate both the validity and limitations of the theory, and the influences of material and geometry on the effective spectral responses are studied. Results show that large contrasts in impedance and density are conditions that validate the effective medium theory, and this approximation displays a better accuracy for a thick slab with narrow slits in it. Based on the effective medium theory developed, a design of a at slab with a snake shaped" subwavelength structure is proposed as a means of achieving acoustic focusing. The property of focusing is demonstrated by FDTD simulations. Good agreement is observed between the proposed structure and the equivalent lens pre- dicted by the theory, which leads to robust broadband focusing by a thin at slab.

Temperature-based on-column solute focusing in capillary liquid chromatography reduces peak broadening from pre-column dispersion and volume overload when used alone or with solvent-based focusing.

Science.gov (United States)

Groskreutz, Stephen R; Horner, Anthony R; Weber, Stephen G

2015-07-31

On-column focusing is essential for satisfactory performance using capillary scale columns. On-column focusing results from generating transient conditions at the head of the column that lead to high solute retention. Solvent-based on-column focusing is a well-known approach to achieve this. Temperature-assisted on-column focusing (TASF) can also be effective. TASF improves focusing by cooling a short segment of the column inlet to a temperature that is lower than the column temperature during the injection and then rapidly heating the focusing segment to the match the column temperature. A troublesome feature of an earlier implementation of TASF was the need to leave the capillary column unpacked in that portion of the column inside the fitting connecting it to the injection valve. We have overcome that problem in this work by packing the head of the column with solid silica spheres. In addition, technical improvements to the TASF instrumentation include: selection of a more powerful thermo-electric cooler to create faster temperature changes and electronic control for easy incorporation into conventional capillary instruments. Used in conjunction with solvent-based focusing and with isocratic elution, volumes of paraben samples (esters of p-hydroxybenzoic acid) up to 4.5-times the column liquid volume can be injected without significant bandspreading due to volume overload. Interestingly, the shapes of the peaks from the lowest volume injections that we can make, 30nL, are improved when using TASF. TASF is very effective at reducing the detrimental effects of pre-column dispersion using isocratic elution. Finally, we show that TASF can be used to focus the neuropeptide galanin in a sample solvent with elution strength stronger than the mobile phase. Here, the stronger solvent is necessitated by the need to prevent peptide adsorption prior to and during analysis. Copyright © 2015 Elsevier B.V. All rights reserved.

Implementing a least cost and risk focused maintenance process

International Nuclear Information System (INIS)

Darling, S.S.

1996-01-01

The paper will focus on the vital role maintenance, big ''M'' (spares, PM program, planning and scheduling, turning the wrench), has in preserving return of investment, and safety in operation of high risk high value facilities/platforms. The maintenance process of today and for the future must utilize risk assessment and reliability engineering techniques to prioritize plant resources. The new process must provide for high levels of safety assurance yet allow for improved generation and transmission capacity while maintaining adequate system reliability. This approach ultimately leads to continuous and sustained reduction in operating cost, improved production capacity, and a safety culture based upon a risk determent cost-beneficial decision process

Lead dust in Broken Hill homes: effect of remediation on indoor lead levels.

Science.gov (United States)

Boreland, F; Lyle, D M

2006-02-01

This study was undertaken to determine whether home remediation effectively reduced indoor lead levels in Broken Hill, a long-established silver-lead-zinc mining town in outback Australia. A before-after study of the effect of home remediation on indoor lead levels was embedded into a randomized controlled trial of the effectiveness of remediation for reducing elevated blood lead levels in young children. Moist towelettes were used to measure lead loading (microg/m2) on internal windowsills and internal and entry floors of 98 homes; samples were collected before, immediately after, and 2, 4, 6, 8, and 10 months after remediation. Data were log(10) transformed for the analysis. Remediation reduced average indoor lead levels by approximately 50%, and lead levels remained low for the duration of the follow-up period (10 months). The greatest gains were made in homes with the highest initial lead levels; homes with low preremediation lead levels showed little or no benefit. Before remediation, homes located in areas with high soil lead levels or with "poor" dust proofing had higher lead levels than those in areas with lower soil lead levels or with "medium" or "good" dust proofing; these relative differences remained after remediation. There was no evidence that lead loading was reduced by an increased opportunity to become aware of lead issues. We conclude that remediation is an effective strategy for reducing the lead exposure of children living in homes with high indoor lead levels.

High human exposure to lead through consumption of birds hunted with lead shot

International Nuclear Information System (INIS)

Johansen, P.; Asmund, G.; Riget, F.

2004-01-01

Lead shot contaminates the edible parts of birds so that tolerable human lead intake is exceeded. - We assess lead contamination of Greenland seabirds killed with lead shot having studied thick-billed murre and common eider, the two most important species in the diet. The lead concentration is very high in meat of eiders killed with lead shot (mean 6.1 μg/g-wet wt, 95% CL 2.1-12). This level is about 44 times higher than in drowned eiders and eight times higher than in shot murres. Analyzing whole breasts instead of sub-samples reveals about seven times higher lead levels in birds' meat. We conclude that in some cases the lead intake by Greenland bird eaters will largely exceed the FAO/WHO tolerable lead intake guideline and that lead shot is a more important source of lead in the diet than previously estimated

Lead in the environment

Science.gov (United States)

Pattee, Oliver H.; Pain, Deborah J.; Hoffman, David J.; Rattner, Barnett A.; Burton, G. Allen; Cairns, John

2003-01-01

Anthropogenic uses of lead have probably altered its availability and environmental distribution more than any other toxic element. Consequently, lead concentrations in many living organisms may be approaching thresholds of toxicity for the adverse effects of lead. Such thresholds are difficult to define, as they vary with the chemical and physical form of lead, exposure regime, other elements present and also vary both within and between species. The technological capability to accurately quantify low lead concentrations has increased over the last decade, and physiological and behavioral effects have been measured in wildlife with tissue lead concentrations below those previously considered safe for humans.s.236 Consequently. lead criteria for the protection of wildlife and human health are frequently under review, and 'thresholds' of lead toxicity are being reconsidered. Proposed lead criteria for the protection of natural resources have been reviewed by Eisler. Uptake of lead by plants is limited by its generally low availability in soils and sediments, and toxicity may be limited by storage mechanisms and its apparently limited translocation within most plants. Lead does not generally accumulate within the foliar parts of plants, which limits its transfer to higher trophic levels. Although lead may concentrate in plant and animal tissues, no evidence of biomagnification exists. Acid deposition onto surface waters and soils with low buffering capacity may influence the availability of lead for uptake by plants and animals, and this may merit investigation at susceptible sites. The biological significance of chronic low-level lead exposure to wildlife is sometimes difficult to quantify. Animals living in urban environments or near point sources of lead emission are inevitably subject to greater exposure to lead and enhanced risk of lead poisoning. Increasingly strict controls on lead emissions in many countries have reduced exposure to lead from some sources

Anemia risk in relation to lead exposure in lead-related manufacturing

Directory of Open Access Journals (Sweden)

Nan-Hung Hsieh

2017-05-01

Full Text Available Abstract Background Lead-exposed workers may suffer adverse health effects under the currently regulated blood lead (BPb levels. However, a probabilistic assessment about lead exposure-associated anemia risk is lacking. The goal of this study was to examine the association between lead exposure and anemia risk among factory workers in Taiwan. Methods We first collated BPb and indicators of hematopoietic function data via health examination records that included 533 male and 218 female lead-exposed workers between 2012 and 2014. We used benchmark dose (BMD modeling to estimate the critical effect doses for detection of abnormal indicators. A risk-based probabilistic model was used to characterize the potential hazard of lead poisoning for job-specific workers by hazard index (HI. We applied Bayesian decision analysis to determine whether BMD could be implicated as a suitable BPb standard. Results Our results indicated that HI for total lead-exposed workers was 0.78 (95% confidence interval: 0.50–1.26 with risk occurrence probability of 11.1%. The abnormal risk of anemia indicators for male and female workers could be reduced, respectively, by 67–77% and 86–95% by adopting the suggested BPb standards of 25 and 15 μg/dL. Conclusions We conclude that cumulative exposure to lead in the workplace was significantly associated with anemia risk. This study suggests that current BPb standard needs to be better understood for the application of lead-exposed population protection in different scenarios to provide a novel standard for health management. Low-level lead exposure risk is an occupational and public health problem that should be paid more attention.

Safety, Dosimetry, and Tumor Detection Ability of ⁶⁸Ga-NOTA-AE105

DEFF Research Database (Denmark)

Skovgaard Lund, Dorthe; Persson, Morten; Brandt-Larsen, Malene

2017-01-01

The overexpression of urokinase-type plasminogen activator receptors (uPARs) represents an established biomarker for aggressiveness in most common malignant diseases, including breast cancer (BC), prostate cancer (PC), and urinary bladder cancer (UBC), and is therefore an important target for new...... cancer therapeutic and diagnostic strategies. In this study, uPAR PET imaging using a68Ga-labeled version of the uPAR-targeting peptide (AE105) was investigated in a group of patients with BC, PC, and UBC. The aim of this first-in-human, phase I clinical trial was to investigate the safety.......Conclusion:This first-in-human, phase I clinical trial demonstrates the safe use and clinical potential of68Ga-NOTA-AE105 as a new radioligand for uPAR PET imaging in cancer patients....

NONINVASIVE DIAGNOSIS OF URINARY BLADDER CANCER BY CROSS-POLARIZATION OPTICAL COHERENCE TOMOGRAPHY: CLINICAL RESULTS

Directory of Open Access Journals (Sweden)

O. S. Streltsova

2014-07-01

Full Text Available The investigation examined the feasibility of cross-polarization optical cohe-rence tomography (CP OCT to detect early urinary bladder cancer (UBC. Studies were performed in 376 patients; 5290 images were obtained using an OCT 133-U optical coherence tomograph. To acquire and compare intrared-light scattering images in baseline and orthogonal polarizations is the basis of CP OCT; their analysis makes it possible to judge from the state of the epithelium/connective tissue system and to obtain information on changes in tissue depolarizing components, collagen in particular. The authors elaborated criteria as determinants of the nature of CP OCT changes in direct and orthogonal polarizations in health, inflammatory changes, and UBC at its early stage - urothelial dysplasia and carcinoma in situ in flat suspected areas.

Leading-Edge Velocities and Lifted Methane Jet Flame Stability

Directory of Open Access Journals (Sweden)

W. Wang

2010-01-01

Full Text Available Current interest exists in understanding reaction-zone dynamics and mechanisms with respect to how they counterpropagate against incoming reactants. Images of flame position and flow-field morphology are presented from flame chemiluminescence and particle image velocimetry (PIV measurements. In the present study, PIV experiments were carried out to measure the methane jet lifted-flame flow-field velocities in the vicinity of the flame leading edge. Specifically, velocity fields within the high-temperature zone were examined in detail, which complements previous studies, whose prime focus is the flow-field upstream of the high-temperature boundary. PIV data is used not only to determine the velocities, but, along with chemiluminescence images, to also indicate the approximate location of the reaction zone (further supported by/through the leading-edge flame velocity distributions. The velocity results indirectly support the concept that the flame is anchored primarily through the mechanism of partially premixed flame propagation.

Lake sediments record prehistoric lead pollution related to early copper production in North America.

Science.gov (United States)

Pompeani, David P; Abbott, Mark B; Steinman, Byron A; Bain, Daniel J

2013-06-04

The mining and use of copper by prehistoric people on Michigan's Keweenaw Peninsula is one of the oldest examples of metalworking. We analyzed the concentration of lead, titanium, magnesium, iron, and organic matter in sediment cores recovered from three lakes located near mine pits to investigate the timing, location, and magnitude of ancient copper mining pollution. Lead concentrations were normalized to lithogenic metals and organic matter to account for processes that can influence natural (or background) lead delivery. Nearly simultaneous lead enrichments occurred at Lake Manganese and Copper Falls Lake ∼8000 and 7000 years before present (yr BP), indicating that copper extraction occurred concurrently in at least two locations on the peninsula. The poor temporal coherence among the lead enrichments from ∼6300 to 5000 yr BP at each lake suggests that the focus of copper mining and annealing shifted through time. In sediment younger than ∼5000 yr BP, lead concentrations remain at background levels at all three lakes, excluding historic lead increases starting ∼150 yr BP. Our work demonstrates that lead emissions associated with both the historic and Old Copper Complex tradition are detectable and can be used to determine the temporal and geographic pattern of metal pollution.

Lead exposure from lead pellets: age-related accumulation in mute swans

Energy Technology Data Exchange (ETDEWEB)

Eskildsen, J.; Grandjean, P.

1984-05-01

In a cross-sectional study of adult swans and their successfully fledged young in Ringkobing Fjord, West Jutland, Denmark, 128 venous blood samples were taken during the moulting period and analyzed for lead. While the juveniles generally showed blood lead levels below 15 micrograms/100 ml (median, 11 micrograms/100 ml), the values were significantly higher in adults (median, 25 micrograms/100 ml). Adult females showed slightly higher levels than did adult males. None of the birds examined showed signs of acute lead toxicity, and increased blood levels in adults may reflect increased lead body burdens from previous ingestion of lead shot as gizzard stones.

Lead dust in broken hill homes--a potential hazard for young children?

Science.gov (United States)

Boreland, F; Lyle, D M; Wlodarczyk, J; Balding, W A; Reddan, S

2002-01-01

To determine the potential hazard posed by indoor lead dust to young children in Broken Hill, a silver-lead-zinc mining town in outback Australia, and the degree to which lead flux is influenced by factors such as geographical location, house construction type and condition. 116 homes were selected and 93 (80%) studied from 10 localities in Broken Hill during the spring of 1995. Lead flux was measured using 85 mm diameter polystyrene petri dishes. Dishes were placed in four rooms of each house to collect dust over a six-to-eight-week period. Data on the location, condition and construction type of each house were recorded. Multiple linear regression was used to determine predictors of lead flux. Flux data were log transformed for the analysis. Average household lead flux varied nearly seven-fold across districts from a low of 166 (distant from the mines), to a high of 1,104 microg/m2/30-day period (adjacent to the mines). Houses that were 'adequately sealed' had 2.9 times the lead flux, and 'poorly sealed' houses 4.3 times the flux, of 'very well sealed' houses. Construction material did not significantly affect these flux levels, and no statistically significant interactions were found between house condition and location or house type. Many Broken Hill homes have high levels of lead flux that pose a potential risk to young children. Quantification of this hazard provides useful information for the community that can help focus efforts on actions required to minimise lead dust in the home. Household dust is a potential source of lead for young children in at-risk communities. Information on lead flux in homes can assist these communities and public health agencies to better understand and deal more effectively with the problem.

Lead-free piezoceramics.

Science.gov (United States)

Saito, Yasuyoshi; Takao, Hisaaki; Tani, Toshihiko; Nonoyama, Tatsuhiko; Takatori, Kazumasa; Homma, Takahiko; Nagaya, Toshiatsu; Nakamura, Masaya

2004-11-04

Lead has recently been expelled from many commercial applications and materials (for example, from solder, glass and pottery glaze) owing to concerns regarding its toxicity. Lead zirconium titanate (PZT) ceramics are high-performance piezoelectric materials, which are widely used in sensors, actuators and other electronic devices; they contain more than 60 weight per cent lead. Although there has been a concerted effort to develop lead-free piezoelectric ceramics, no effective alternative to PZT has yet been found. Here we report a lead-free piezoelectric ceramic with an electric-field-induced strain comparable to typical actuator-grade PZT. We achieved this through the combination of the discovery of a morphotropic phase boundary in an alkaline niobate-based perovskite solid solution, and the development of a processing route leading to highly textured polycrystals. The ceramic exhibits a piezoelectric constant d33 (the induced charge per unit force applied in the same direction) of above 300 picocoulombs per newton (pC N(-1)), and texturing the material leads to a peak d33 of 416 pC N(-1). The textured material also exhibits temperature-independent field-induced strain characteristics.

Early Childhood Lead Exposure and Academic Achievement: Evidence From Detroit Public Schools, 2008–2010

Science.gov (United States)

Baker, Harolyn W.; Tufts, Margaret; Raymond, Randall E.; Salihu, Hamisu; Elliott, Michael R.

2013-01-01

Objectives. We assessed the long-term effect of early childhood lead exposure on academic achievement in mathematics, science, and reading among elementary and junior high school children. Methods. We linked early childhood blood lead testing surveillance data from the Detroit Department of Health and Wellness Promotion to educational testing data from the Detroit, Michigan, public schools. We used the linked data to investigate the effect of early childhood lead exposure on academic achievement among school-aged children, both marginally and adjusted for grade level, gender, race, language, maternal education, and socioeconomic status. Results. High blood lead levels before age 6 years were strongly associated with poor academic achievement in grades 3, 5, and 8. The odds of scoring less than proficient for those whose blood lead levels were greater than 10 micrograms per deciliter were more than twice the odds for those whose blood lead levels were less than 1 micrograms per deciliter after adjustment for potential confounders. Conclusions. Early childhood lead exposure was negatively associated with academic achievement in elementary and junior high school, after adjusting for key potential confounders. The control of lead poisoning should focus on primary prevention of lead exposure in children and development of special education programs for students with lead poisoning. PMID:23327265

Specificities of reactor coolant pumps units with lead and lead-bismuth coolant

International Nuclear Information System (INIS)

Beznosov, A.V.; Anotonenkov, M.A.; Bokov, P.A.; Baranova, V.S.; Kustov, M.S.

2009-01-01

The analysis results of impact of lead and lead-bismuth coolants specific properties on the coolants flow features in flow channels of the main and auxiliary circulating pumps are presented. Impossibility of cavitation initiation in flow channels of vane pumps pumping lead and lead-bismuth coolants was demonstrated. The experimental research results of discontinuity of heavy liquid metal coolant column were presented and conditions of gas cavitation initiation in coolant flow were discussed. Invalidity of traditional calculation methods of water and sodium coolants circulation pumps calculations for lead and lead-bismuth coolants circulation pumps was substantiated [ru

Demonstration Results for the Phytoextraction of Lead-Contaminated Soil at the Twin Cities Army Ammunition Plant, Arden Hills, Minnesota

Science.gov (United States)

2000-07-01

resulted in corresponding blood lead levels, USEPA has not developed a cancer slope factor and has focused on the non-carcinogenic effects. Lead...threshold value. USEPA’s alternative approach to the use of cancer slope factors and RfDs to evaluate lead exposure is to consider the effect of...the sites, the grass in the 90- x 90-foot farm plots was eradicated with an application of RoundupTM ( glyphosate ) [Figure 4-3]. These activities were

Focus group discussions

CERN Document Server

Hennink, Monique M

2014-01-01

The Understanding Research series focuses on the process of writing up social research. The series is broken down into three categories: Understanding Statistics, Understanding Measurement, and Understanding Qualitative Research. The books provide researchers with guides to understanding, writing, and evaluating social research. Each volume demonstrates how research should be represented, including how to write up the methodology as well as the research findings. Each volume also reviews how to appropriately evaluate published research. Focus Group Discussions addresses the challenges associated with conducting and writing focus group research. It provides detailed guidance on the practical and theoretical considerations in conducting focus group discussions including: designing the discussion guide, recruiting participants, training a field team, moderating techniques and ethical considerations. Monique Hennink describes how a methodology section is read and evaluated by others, such as journal reviewers or ...

Compressing and focusing a short laser pulse by a thin plasma lens

International Nuclear Information System (INIS)

Ren, C.; Duda, B. J.; Hemker, R. G.; Mori, W. B.; Katsouleas, T.; Antonsen, T. M.; Mora, P.

2001-01-01

We consider the possibility of using a thin plasma slab as an optical element to both focus and compress an intense laser pulse. By thin we mean that the focal length is larger than the lens thickness. We derive analytic formulas for the spot size and pulse length evolution of a short laser pulse propagating through a thin uniform plasma lens. The formulas are compared to simulation results from two types of particle-in-cell code. The simulations give a greater final spot size and a shorter focal length than the analytic formulas. The difference arises from spherical aberrations in the lens which lead to the generation of higher-order vacuum Gaussian modes. The simulations also show that Raman side scattering can develop. A thin lens experiment could provide unequivocal evidence of relativistic self-focusing

Identifying drug risk perceptions in Danish youths: Ranking exercises in focus groups

DEFF Research Database (Denmark)

Demant, Jakob; Ravn, Signe

2010-01-01

Abstract: Background: This paper develops an analytical approach for understanding the perceptions of risks associated with drugs among youths in general. These perceptions are central in order to understand how certain drugs become popular, leading to increasing prevalence of use, while others do...... not. As such, this approach can become an efficient policy tool. Methods: Focus groups are used to investigate risk perceptions. We develop a specific methodology that combines a ranking exercise with discourse theory as an analytical approach. This methodology produces detailed information...... and provides a relatively efficient way of investigating normative risk perceptions at a national or subcultural level. The paper develops this methodology in relation to a Danish case with 12 focus group interviews with youths aged from 17 to 22. Results: The analysis identifies five discourses articulated...

Identifying drug risk perceptions in Danish youths: Ranking exercises in focus groups

DEFF Research Database (Denmark)

Demant, Jakob Johan; Ravn, Signe

2010-01-01

not. As such, this approach can become an efficient policy tool. Methods: Focus groups are used to investigate risk perceptions. We develop a specific methodology that combines a ranking exercise with discourse theory as an analytical approach. This methodology produces detailed information......Abstract: Background: This paper develops an analytical approach for understanding the perceptions of risks associated with drugs among youths in general. These perceptions are central in order to understand how certain drugs become popular, leading to increasing prevalence of use, while others do...... and provides a relatively efficient way of investigating normative risk perceptions at a national or subcultural level. The paper develops this methodology in relation to a Danish case with 12 focus group interviews with youths aged from 17 to 22. Results: The analysis identifies five discourses articulated...

Photocatalyzed removal of lead ion from lead-chelator solution

Energy Technology Data Exchange (ETDEWEB)

Cho, Young Hyun; Na, Jung Won; Sung, Ki Woung [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

1994-07-01

The present study was undertaken to examine the influence of such chelating agents on the ease and speed of photocatalyzed metal removal and deposition. With excess EDTA, the free EDTA competes with Pb for oxidation, and at a ten fold excess, no lead oxidation (hence removal) occurs. With insufficient EDTA, the corresponding initial concentration of Pb-EDTA is decreased; after its destruction, the remaining Pb{sup 2+} is removed more slowly, at rates found with lead nitrate solution. The net result is that the maximum rate of lead deposition occurs at the stoichiometric ratio of 1:1 EDTA : Pb{sup 2+}.

Effects of Atwood number on shock focusing in shock-cylinder interaction

Science.gov (United States)

Ou, Junfeng; Ding, Juchun; Luo, Xisheng; Zhai, Zhigang

2018-02-01

The evolution of shock-accelerated heavy-gas cylinder surrounded by the air with different Atwood numbers (A_t=0.28, 0.50, 0.63) is investigated, concentrating on shock focusing and jet formation. Experimentally, a soap film technique is used to generate an ideal two-dimensional discontinuous gas cylinder with a clear surface, which can guarantee the observation of shock wave movements inside the cylinder. Different Atwood numbers are realized by different mixing ratios of SF_6 and air inside the cylinder. A high-speed schlieren system is adopted to capture the shock motions and jet morphology. Numerical simulations are also performed to provide more information. The results indicate that an inward jet is formed for low Atwood numbers, while an outward jet is generated for high Atwood numbers. Different Atwood numbers will lead to the differences in the relative velocities between the incident shock and the refraction shock, which ultimately results in the differences in shock competition near the downstream pole. The morphology and feature of the jet are closely associated with the position and intensity of shock focusing. The pressure and vorticity contours indicate that the jet formation should be attributed to the pressure pulsation caused by shock focusing, and the jet development is ascribed to the vorticity induction. Finally, a time ratio proposed in the previous work for determining the shock-focusing type is verified by experiments.

El diseño curricular desde la perspectiva de la actividad profesional / Curricular design: focus on professional performance

Directory of Open Access Journals (Sweden)

Idielyn Cabrera Marrero

2017-09-01

Full Text Available The analysis of the curricular design theories shows that the concept of performance has not yet been sufficiently studied, this explains actual inconsistencies in the design methodologies that claim to be focused on professional activity. However, in practice they are focusing professional problems instead, or simply copying other universities curricula without considering the particular country stage of development. Taking Chemical engineers as a referent point, the authors devise a methodology of curricular design focused on professional activity leading to the comprehension of this particular engineers ‘performance. The findings result from the application of the functional structural systemic method.

Vector boson and Charmonium production in proton-lead and lead-lead collisions with ATLAS at the LHC

CERN Document Server

AUTHOR|(INSPIRE)INSPIRE-00241320; The ATLAS collaboration

2016-01-01

Electroweak bosons do not interact strongly with the dense and hot medium formed in nuclear collisions, and thus should be sensitive to the nuclear modification of parton distribution functions (nPDFs). The in-medium modification of heavy charmonium states plays an important role in studying the hot and dense medium. The ATLAS detector, optimized to search for new physics in proton-proton collisions, is well equipped to measure Z and W bosons as well as quarkonium in the high occupancy environment produced in heavy ion collisions. Results from the ATLAS experiment on W and Z boson yields as a function of centrality, transverse momentum and rapidity, in lead-lead and proton-lead collisions are presented. Quarkonium results from proton-lead collisions are also presented.

Near-field flat focusing mirrors

Science.gov (United States)

Cheng, Yu-Chieh; Staliunas, Kestutis

2018-03-01

This article reviews recent progress towards the design of near-field flat focusing mirrors, focusing/imaging light patterns in reflection. An important feature of such flat focusing mirrors is their transverse invariance, as they do not possess any optical axis. We start with a review of the physical background to the different focusing mechanisms of near- and far-field focusing. These near-field focusing devices like flat lenses and the reviewed near-field focusing mirrors can implement planar focusing devices without any optical axis. In contrast, various types of far-field planar focusing devices, such as high-contrast gratings and metasurfaces, unavoidably break the transverse invariance due to their radially symmetrical structures. The particular realizations of near-field flat focusing mirrors including Bragg-like dielectric mirrors and dielectric subwavelength gratings are the main subjects of the review. The first flat focusing mirror was demonstrated with a chirped mirror and was shown to manage an angular dispersion for beam focusing, similar to the management of chromatic dispersion for pulse compression. Furthermore, the reviewed optimized chirped mirror demonstrated a long near-field focal length, hardly achieved by a flat lens or a planar hyperlens. Two more different configurations of dielectric subwavelength gratings that focus a light beam at normal or oblique incidence are also reviewed. We also summarize and compare focusing performance, limitations, and future perspectives between the reviewed flat focusing mirrors and other planar focusing devices including a flat lens with a negative-index material, a planar hyperlens, a high-contrast grating, and a metasurface.

Attention has memory: priming for the size of the attentional focus.

Science.gov (United States)

Fuggetta, Giorgio; Lanfranchi, Silvia; Campana, Gianluca

2009-01-01

Repeating the same target's features or spatial position, as well as repeating the same context (e.g. distractor sets) in visual search leads to a decrease of reaction times. This modulation can occur on a trial by trial basis (the previous trial primes the following one), but can also occur across multiple trials (i.e. performance in the current trial can benefit from features, position or context seen several trials earlier), and includes inhibition of different features, position or contexts besides facilitation of the same ones. Here we asked whether a similar implicit memory mechanism exists for the size of the attentional focus. By manipulating the size of the attentional focus with the repetition of search arrays with the same vs. different size, we found both facilitation for the same array size and inhibition for a different array size, as well as a progressive improvement in performance with increasing the number of repetition of search arrays with the same size. These results show that implicit memory for the size of the attentional focus can guide visual search even in the absence of feature or position priming, or distractor's contextual effects.

Lead-elevated activity of xanthine oxidase in lead-exposed workers

Directory of Open Access Journals (Sweden)

Sławomir Kasperczyk

2013-04-01

Full Text Available Background: The aim of the present study was to explore the connection between lead toxicity and the activity of xanthine oxidase (XO. In addition, we indicated the uric acid (UA and creatinine levels and concentration of erythrocyte malondialdehyde (MDA to estimate oxidative stress intensity. Materials and Methods: The examined group consisted of 125 healthy male employees of zinc and lead works. The examined group was divided into tertiles according to blood lead levels. In the collected blood samples, concentrations of lead-exposure indices, UA, creatinine, and MDA as well as activity of XO were measured concomitantly. The control group consisted of 32 healthy male administrative workers who were exposed to lead only environmentally. Results: XO activity and MDA level were significantly elevated in all tertiles compared to the control group. Creatinine level was significantly elevated in the medium and high tertiles. However, the level of UA was significantly elevated in the high tertile, while in the low and medium tertile only a tendency toward higher values was observed. Conclusions: Occupational exposure to lead induces activity of XO. This induction may contribute to the observed simultaneously increased oxidative stress, measured as MDA level, and the increased level of UA. Med Pr 2013;64(2:175–180

BrightFocus Foundation

Science.gov (United States)

... About BrightFocus Foundation Featured Content BrightFocus: Investing in Science to Save Mind and Sight We're here to help. Explore ... recognition is very important. Monday, November 6, 2017 New Diagnosis? Managing a mind and sight disease is a journey. And you’ ...

Role of Airborne Lead in Increased Body Burden of Lead in Hartford Children*

Science.gov (United States)

Lepow, Martha L.; Bruckman, Leonard; Rubino, Robert A.; Markowitz, Steven; Gillette, Marybeth; Kapish, Janet

1974-01-01

The ingestion of airborne lead fallout is the mechanism responsible for increased lead body burdens found in 10 urban Connecticut children. The mean indoor lead levels found in housedust was 11,000 μg/g; highest concentrations occurred on windowsills and in floor dust. The mean lead content of Hartford street dirt was 1,200 μg/g; levels were highest near the street and next to the buildings. The mean lead concentration of hand samples taken from the subject children was 2,400 μg/g; the mean weight of hand samples was 11 mg. The concentration of lead in dirt and househould dust was high enough to theoretically result in excessive lead accumulation in young children who are putting their dusty, dirty hands in their mouths during play. While we believe that lead emitted from automobiles contributes significantly to air, dirt and dust lead levels the environmental impact of reducing or eliminating lead from gasoline is not yet completely understood. PMID:4133903

Physical properties of lead free solders in liquid and solid state

Energy Technology Data Exchange (ETDEWEB)

Mhiaoui, Souad

2007-04-17

The European legislation prohibits the use of lead containing solders in Europe. However, lead free solders have a higher melting point (typical 20%) and their mechanical characteristics are worse. Additional problems are aging and adhesion of the solder on the electronic circuits. Thus, research activities must focus on the optimization of the properties of Sn-Ag-Cu based lead free solders chosen by the industry. Two main objectives are treated in this work. In the center of the first one is the study of curious hysteresis effects of metallic cadmium-antimony alloys after thermal cycles by measuring electronic transport phenomena (thermoelectric power and electrical resistivity). The second objective, within the framework of ''cotutelle'' between the universities of Metz and of Chemnitz and supported by COST531, is to study more specifically lead free solders. A welding must well conduct electricity and well conduct and dissipate heat. In Metz, we determined the electrical conductivity, the thermoelectric power and the thermal conductivity of various lead free solders (Sn-Ag-Cu, Sn-Cu, Sn-Ag, Sn-Sb) as well in the liquid as well in the solid state. The results have been compared to classical lead-tin (Pb-Sn) solders. In Chemnitz we measured the surface tension, the interfacial tension and the density of lead free solders. We also measured the viscosity of these solders without and with additives, in particular nickel. These properties were related to the industrial problems of wettability and spreadability. Lastly, we solidified alloys under various conditions. We observed undercooling. We developed a technique of mixture of nanocrystalline powder with lead free solders ''to sow'' the liquid bath in order to obtain ''different'' solids which were examined using optical and electron microscopy. (orig.)

Reversible surface binding of cadmium and lead by lactic acid and bifidobacteria.

Science.gov (United States)

Teemu, Halttunen; Seppo, Salminen; Jussi, Meriluoto; Raija, Tahvonen; Kalle, Lertola

2008-07-15

Extensive cadmium and lead contamination of water has been reported to occur locally as a result of human activities. Lactic acid bacteria have been reported to remove cadmium and lead from water. The aim of this work was to clarify the mechanisms of cadmium and lead removal from water. In addition, the effect of other metals, reversibility of binding and recyclability of the biomass was assessed. Based on our earlier data, the two most promising lactic acid bacteria, Lactobacillus fermentum ME3 and Bifidobacterium longum 46, were selected for these experiments. The results showed that the presence of other cationic metals and blocking of carboxyl and phosphoryl groups reduced cadmium and lead removal. These results suggest involvement of electrostatic interactions in cadmium and lead removal, and support our earlier findings. Transmission electron micrographs showed large deposits of lead on the bacterial surface suggesting formation of metallic lead precipitates. Both cadmium and lead removal were reversible processes established by full recovery of removed metal after desorption with dilute solutions of EDTA and HNO(3). Resorption capacity of both biomasses tested was reduced after regeneration with 10 mM EDTA and 15 mM HNO(3). Taken together, the results suggest involvement of several reversible mechanisms such as ion exchange and precipitation in cadmium and lead binding by lactic acid bacteria. The results show that specific lactic acid bacteria have the potential for removal of cadmium and lead from water although reduction in resorption capacity after regeneration of the biomass may form a problem. Since the studies so far have mainly focused on removal of single metals from pure water, metal removal in conditions of natural waters should be assessed in further experiments.

Lead Poisoning Prevention Tips

Science.gov (United States)

... or removed safely. How are children exposed to lead? Lead-based paint and lead contaminated dust are ... What can be done to prevent exposure to lead? It is important to determine the construction year ...

The effects of thiamin on lead metabolism: organ distribution of lead 203.

OpenAIRE

Kim, J S; Hamilton, D L; Blakley, B R; Rousseaux, C G

1992-01-01

The effect of thiamin on the organ distribution of lead was evaluated in CD-1 mice exposed intragastrically or intraperitoneally to a single dose of lead acetate (100 micrograms) containing 100 microCi lead 203. They were treated with either thiamin (25 or 50 mg/kg body weight), calcium ethylenediaminetetraacetic acid (CaEDTA) (50 mg/kg body weight), or combinations of thiamin and CaEDTA. The whole body retention and the organ distribution of lead 203 varied depending upon the route of lead a...

Method of handling of scrap lead from lead-acid batteries

Energy Technology Data Exchange (ETDEWEB)

Sytschev, A P; Kim, G V; Larin, V F; Sidorova, G D; Vicharev, I G; Kuur, V P; Achmetov, R S; Moiseev, G L; Maslov, V I; Kabatschek, V G

1979-12-13

Scrap lead and the casings of accumulators are mined and molten together in oxidixing atmosphere at a temperature of 1300 to 1500/sup 0/C. The lead oxide contained in the melt is then reduced to blue lead. Due to the combustion of the accumulator casings consisting of organic substances the fuel consumption in the melting process is reduced in accordance. The oxidizing atmosphere in the melting process is produced by use of air or oxygen.

Lead isotope ratios in artists' lead white: a progress report

Energy Technology Data Exchange (ETDEWEB)

Keisch, B; Callahan, R C [Carnegie-Mellon Univ., Pittsburgh, Pa. (USA)

1976-07-01

The lead isotope ratios in over four hundred samples of lead white have been determined. The samples represent various geographical sources and dates from the thirteenth century to the present. A new method for organizing this large volume of data is described which helps with the visualization of temporal and geographic patterns. A number of interesting relationships between lead isotope ratio and date or source are shown to exist. Some examples of successful applications of this methodology are described.

How Technicians Can Lead Science Improvements in Any School: A Small-Scale Study in England

Science.gov (United States)

Jones, Beth; Quinnell, Simon

2015-01-01

This article describes how seven schools in England improved their science provision by focusing on the professional development of their science technicians. In September 2013, the Gatsby Charitable Foundation funded the National Science Learning Centre to lead a project connecting secondary schools with experienced senior science technicians…

Activity of lead deposited in the tissues in conditions of occupational lead exposure

Energy Technology Data Exchange (ETDEWEB)

1974-01-01

The author measured urinary excretion of delta-aminolevulinic acid (ALA), coproporphyrins and lead, before and after administration of chelating agents (CaEDTA and D-penicillamine) to subjects presenting clinical symptoms of lead poisoning and workers occupationally exposed to lead. He found a great increase in lead following its mobilization in subjects with lead poisoning who had previously shown a high level of haemoglobin precursors and a low urinary lead level. In these subjects ALA excretion was proportional to the duration of exposure. A correlation was found between urinary ALA and coproporphyrins, on the one hand, and lead excretion after provocation, on the other. This suggests that the lead deposited in the tissues, as well as that in circulation, retains all its activity.

Plasma focus matching conditions

International Nuclear Information System (INIS)

Soliman, H.M.; Masoud, M.M.; Elkhalafawy, T.A.

1988-01-01

A snow-plough and slug models have been used to obtain the optimum matching conditions of the plasma in the focus. The dimensions of the plasma focus device are, inner electrode radius = 2 cm, outer electrode radius = 5.5 cm, and its length = 8 cm. It was found that the maximum magnetic energy of 12.26 kJ has to be delivered to plasma focus whose density is 10 19 /cm 3 at focusing time of 2.55 μs and with total external inductance of 24.2 n H. The same method is used to evaluate the optimum matching conditions for the previous coaxial discharge system which had inner electrode radius = 1.6 cm, outer electrode radius = 3.3 cm and its length = 31.5 cm. These conditions are charging voltage = 12 kV, capacity of the condenser bank = 430 μf, plasma focus density = 10 19 /cm 3 focusing time = 8 μs and total external inductance = 60.32 n H.3 fig., 2 tab

Health care of people at work. Workers exposed to lead. I. Inorganic lead

Energy Technology Data Exchange (ETDEWEB)

Waldron, H.A.

1978-01-01

The risks associated with exposure to inorganic lead and the means by which these risks can be minimized are outlined. Lead is used to make a variety of metal products, the grids and oxides in storage batteries, pigments, chemicals, and also for lead plating. In the United States about 70% of the total lead consumption is related to transportation. Uptake of inorganic lead is by ingestion and inhalation. About 90% of the total body burden of lead is contained within the skeletal tissues. Lead is excreted in the kidney, in sweat, and in milk. Toxic effects are directed against the blood, the nervous system, and the kidney. Symptoms of lead poisoning are abdominal pain, constipation, vomiting, asthenia, paresthesia, psychological symptoms, and diarrhea. Physical and biological monitoring can serve to protect workers. Diagnosis of lead poisoning is not easy. Treatment involves removal from exposure and/or treatment with a chelating agent.

Leading Democratically

Science.gov (United States)

Brookfield, Stephen

2010-01-01

Democracy is the most venerated of American ideas, the one for which wars are fought and people die. So most people would probably agree that leaders should be able to lead well in a democratic society. Yet, genuinely democratic leadership is a relative rarity. Leading democratically means viewing leadership as a function or process, rather than…

Who Leads China's Leading Universities?

Science.gov (United States)

Huang, Futao

2017-01-01

This study attempts to identify the major characteristics of two different groups of institutional leaders in China's leading universities. The study begins with a review of relevant literature and theory. Then, there is a brief introduction to the selection of party secretaries, deputy secretaries, presidents and vice presidents in leading…

Remediation of lead contaminated soil

International Nuclear Information System (INIS)

Urban, W.; Krishnamurthy, S.

1992-01-01

Lead contaminated soil in urban area is of major concern because of the potential health risk to children. Many studies have established a direct correlation between lead in soil and elevated blood lead levels in children. In Minneapolis, Minnesota, Mielke et al. (1983) reported that 50% of the Hmong children with lead poisioning were in areas where soil lead levels were between 500 and 1000 micrograms per gram (ug/g), and 40% of the children suffering from lead poisioning lived in areas where soil lead levels exceeded 1000 ug/g. In urban areas, lead pollution in soil has come from many different sources. The sources include lead paint, lead batteries and automobile exhaust. Olson and Skogerbee (1975) found the following lead compounds in soils where the primary source of pollution was from automobiles: lead sulfate, lead oxide, lead dioxide, lead sulfide, and metallic lead. The primary form of lead found was lead sulfate. Lead sulfate, lead tetraoxide, white lead, and other forms of lead have been used in the manufacture of paints for houses. At present, two remediation techniques, solidification and Bureau of Mines fluosilicic acid leaching, are available for lead-contaminated sites. The objective of the present investigation at the Risk Reduction Engineering Laboratory (RREL), Edison, was to try to solubilize the lead species by appropriate reagents and then recover the contaminants by precipitation as lead sulfate, using environmentally acceptable methods. The apparatus used for mixing was a LabMaster mixer, with variable speed and high-shear impeller. Previous work had used nitric acid for dissolving metallic lead. Owing to the environmental concerns, it was decided to use acetic acid in the presence of oxygen. The theoretical justification for this approach is the favorable redox potential for the reaction between metallic lead, acetic acid, and gaseous oxygen

Living With Diabetes in Appalachia: A Focus Group Study.

Science.gov (United States)

Carpenter, Roger; Smith, Mary Jane

This article presents an innovative holistic practice application based on evidence from a focus group study on managing diabetes. The purpose of this study addressed the research question: How do persons with type 2 diabetes describe ways of managing the challenge of living with diabetes? A second purpose was to link the findings on ways to manage diabetes to holistic nursing practice through story theory. Nine adults with type 2 diabetes living in rural West Virginia participated in 3 focus groups. Using content analysis, the study findings integrated themes with core qualities, and are as follows: living life as an evolving process is awakening to the present and doing it your way, being on guard is a vigilant ongoing responsibility, attending to bodily experience is awareness of body and facing life stress, and knowing the consequences is awareness of potential problems and taking charge. Merging the study findings with the concepts of story theory led to the development of an innovative practice application for managing diabetes. Managing diabetes in this practice application goes beyond problem-centeredness to a patient-centered approach, offering attention to individual preferences. Since managing diabetes is a major problem in Appalachia, there a need for innovative approaches. This study adds to the body of knowledge on how persons from Appalachia manage diabetes. In addition, it offers a story practice approach for managing diabetes-replacing a problem focus to a more holistic approach to practice leading to more meaningful and fulfilling outcomes.

Conversion of the random amplified polymorphic DNA (RAPD ...

African Journals Online (AJOL)

Conversion of the random amplified polymorphic DNA (RAPD) marker UBC#116 linked to Fusarium crown and root rot resistance gene (Frl) into a co-dominant sequence characterized amplified region (SCAR) marker for marker-assisted selection of tomato.

Determining lead concentration in the blood of primary school children in Damascus city and suburbs

International Nuclear Information System (INIS)

Al-Merey, R.; Al-Ghali, M.; Mortada, S.

2006-01-01

Due to the fact that lead is a relatively common element in nature and one of the most pollutant elements which man kind is exposed to in densely populated cities that have a large number of vehicles using leaded petrol which has bad effects on human health particularly children, it is found necessary to scan the health situation related to lead exposure in Damascus. The present work focuses on determining the concentration of lead in the blood of primary school children in Damascus city and some schools in the suburbs of Damascus. 546 blood samples were collected from school children in Damascus city and 183 blood samples from school children in the suburbs of Damascus. Parameters such as student's environmental, social and behavioral information were taken into consideration and correlate with lead concentration in students blood samples. Results showed that 76.3% of the samples have more than 10 μg/100 ml of lead in the blood. Which has lead to the following health effects: Decrease in hemoglobin and vitamin-D, Effects on central nervous system, Deterioration in children growth, decreasing in IQ, and kidney failure. (Authors)

Determining lead concentration in the blood of primary school children in Damascus city and suburbs

International Nuclear Information System (INIS)

Al-Merey, R.; Galee, M.; Mortada, S.

2005-05-01

Due to the fact that lead is a relatively common element in nature and one of the most pollutant elements which man kind is exposed to in densely populated cities that have a large number of vehicles using leaded petrol which has bad effects on human health particularly children, it is found necessary to scan the health situation related to lead exposure in Damascus. The present work focuses on determining the concentration of lead in the blood of primary school children in Damascus city and some schools in the suburbs of Damascus. 546 blood samples were collected from school children in Damascus city and 183 blood samples from school children in the suburbs of Damascus. Parameters such as student's environmental, social and behavioral information were taken into consideration and correlate with lead concentration in students blood samples. Results showed that 76.3% of the samples have more than 10 μg/100 ml of lead in the blood. Which has lead to the following health effects: Decrease in hemoglobin and vitamin-D, Effects on central nervous system, Deterioration in children growth, decreasing in IQ, and kidney failure. (Authors)

Lead theft--a study of the "uniqueness" of lead from church roofs.

Science.gov (United States)

Bond, John W; Hainsworth, Sarah V; Lau, Tien L

2013-07-01

In the United Kingdom, theft of lead is common, particularly from churches and other public buildings with lead roofs. To assess the potential to distinguish lead from different sources, 41 samples of lead from 24 church roofs in Northamptonshire, U.K, have been analyzed for relative abundance of trace elements and isotopes of lead using X-ray fluorescence (XRF) and inductively coupled plasma mass spectrometry, respectively. XRF revealed the overall presence of 12 trace elements with the four most abundant, calcium, phosphorus, silicon, and sulfur, showing a large weight percentage standard error of the mean of all samples suggesting variation in the weight percentage of these elements between different church roofs. Multiple samples from the same roofs, but different lead sheets, showed much lower weight percentage standard errors of the mean suggesting similar trace element concentrations. Lead isotope ratios were similar for all samples. Factors likely to affect the occurrence of these trace elements are discussed. © 2013 American Academy of Forensic Sciences.

Lead isotope ratios in artists' lead white: a progress report

International Nuclear Information System (INIS)

Keisch, B.; Callahan, R.C.

1976-01-01

The lead isotope ratios in over four hundred samples of lead white have been determined. The samples represent various geographical sources and dates from the thirteenth century to the present. A new method for organizing this large volume of data is described which helps with the visualization of temporal and geographic patterns. A number of interesting relationships between lead isotope ratio and date or source are shown to exist. Some examples of successful applications of this methodology are described. (author)

Focused ultrasound in ophthalmology

Directory of Open Access Journals (Sweden)

Silverman RH

2016-09-01

Full Text Available Ronald H Silverman1,2 1Department of Ophthalmology, Columbia University Medical Center, 2F.L. Lizzi Center for Biomedical Engineering, Riverside Research, New York, NY, USA Abstract: The use of focused ultrasound to obtain diagnostically significant information about the eye goes back to the 1950s. This review describes the historical and technological development of ophthalmic ultrasound and its clinical application and impact. Ultrasound, like light, can be focused, which is crucial for formation of high-resolution, diagnostically useful images. Focused, single-element, mechanically scanned transducers are most common in ophthalmology. Specially designed transducers have been used to generate focused, high-intensity ultrasound that through thermal effects has been used to treat glaucoma (via cilio-destruction, tumors, and other pathologies. Linear and annular transducer arrays offer synthetic focusing in which precise timing of the excitation of independently addressable array elements allows formation of a converging wavefront to create a focus at one or more programmable depths. Most recently, linear array-based plane-wave ultrasound, in which the array emits an unfocused wavefront and focusing is performed solely on received data, has been demonstrated for imaging ocular anatomy and blood flow. While the history of ophthalmic ultrasound extends back over half-a-century, new and powerful technologic advances continue to be made, offering the prospect of novel diagnostic capabilities. Keywords: ophthalmic ultrasound, ultrasound biomicroscopy (UBM, high-intensity focused ultrasound (HIFU, ultrafast imaging, Doppler imaging 

Quantification of atmospheric lead emissions from 70 years of leaded petrol consumption in Australia

Science.gov (United States)

Kristensen, Louise Jane

2015-06-01

Lead is a persistent pollutant and the subject of many environmental studies, yet, in Australia, the extent of atmospheric lead emissions from the use of leaded petrol is unquantified. This paper details the first comprehensive account of leaded petrol sales and its lead concentrations over the 70 years of use in Australia. The resulting atmospheric lead emissions are calculated to provide the most complete understanding of the volume of lead released to the Australian continent from the consumption of leaded petrol. Atmospheric emissions of lead to the entire Australian continent from leaded petrol are calculated to total 240,510 tonnes over seven decades of use, peaking at 7869 tonnes in 1974. Total emissions for individual states and territories range from 1745 to 67,893 tonnes, with New South Wales responsible for the largest emissions. The effect of regulations on allowable concentrations of tetraethyl-lead additives are observed in the reduction of lead emissions in New South Wales and Victoria. The consequences to human health and the environment of leaded petrol consumption in Australia's populous cities are examined against historical air quality data and blood lead levels.

Plasma focus sources: Supplement to the neutron resonance radiography workshop proceedings

International Nuclear Information System (INIS)

Nardi, V.; Brzosko, J.

1989-01-01

Since their discovery, plasma focus discharges have been recognized as very intense pulsed sources of deuterium-deuterium (D-D) or deuterium-tritium (D-T) fusion-reaction neutrons, with outstanding capabilities. Specifically, the total neutron emission/shot, YN, and the rate of neutron emission, Y/sub n/, of an optimized plasma focus (PF) are higher than the corresponding quantities observed in any other type of pinched discharge at the same level of powering energy W 0 . Recent developments have led to the concept and experimental demonstration of an Advanced Plasma Focus System (APF) that consists of a Mather-geometry plasma focus in which field distortion elements (FDEs) are inserted in the inter-electrode gap for increasing the neutron yield/shot, Y/sub n/. The FDE-induced redistribution of the plasma current increases Y/sub n/ by a factor ≅5-10 above the value obtained without FDEs under otherwise identical conditions of operation of the plasma focus. For example, an APF that is fed by a fast capacitor bank with an energy, W 0 = 6kJ, and voltage, V 0 = 16.5 kV provides Y/sub n/ /congruent/ 4 /times/ 10 9 D-D neutrons/shot (pure D 2 filling) and Y/sub n/ = 4 /times/ 10 11 D-T neutrons/shot (filling is 50% deuterium and 50% tritium). The FDE-induced increase of Y/sub n/ for fixed values of (W 0 , V 0 ), the observed scaling law Y/sub n/ /proportional to/ W 0 2 for optimized plasma focus systems, and our experience with neutron scattering in bulk objects lead us to the conclusion that we can use an APF as a source of high-intensity neutron pulses (10 14 n/pulse) in the field off neutron radiography (surface and bulk) with a nanosecond or millisecond time resolution

Large-capacity current leads

International Nuclear Information System (INIS)

Ballarino, A.

2008-01-01

Feeding superconducting magnets with reliable low-loss devices is a key issue for any cryo-electrical system. Conventional or HTS current leads can be used, and cooling methods, materials, and geometries can be chosen to optimize the thermo-electrical performance of the system. The LHC magnets are powered via more than 3000 current leads transporting altogether about 3 MA of current. With thousands of leads, the LHC lead project represents today the largest project of its kind ever undertaken. Following a review of the LHC lead project, an overview of the choices that can be made for the optimization of large capacity current leads is presented. Examples are given of other leads for large scale magnet systems for which the use of HTS is being envisaged

Damage of reactor buildings occurred at the Fukushima Daiichi accident. Focusing on sequence leading to hydrogen explosions

International Nuclear Information System (INIS)

Naito, Masanori

2011-01-01

Fukushima Daiichi accident discharged enormous radioactive materials confined inside into the environment due to hydrogen explosions occurred at reactor buildings and forced many people to live the refugee life. This article described overview of Great East Japan Earthquake, specifications of Fukushima Daiichi nuclear power plants, sequence of plant status after earthquake occurrence and computerized simulation of plant behavior of Unit 1 leading to core melt and hydrogen explosion. Simulation results with estimated and assumed conditions showed water level decreased to bottom of reactor core after 4 hrs and 15 minutes passed, core melt started after 6 hrs and 49 minutes passed, failure of core support plate after 7 hrs and 18 minutes passed and through failure of penetration at bottom of pressure vessel after 7 hrs and 25 minutes passed. Hydrogen concentration at operating floor of reactor building of Unit 1 would be 15% accumulated and the pressure would amount to about 5 bars after hydrogen explosion if reactor building did not rupture with leak-tight structure. Since reactor building was not pressure-proof structure, walls of operating floor would rupture before 5 bars attained. (T. Tanaka)

Performance of Lead-Free versus Lead-Based Hunting Ammunition in Ballistic Soap

Science.gov (United States)

Gremse, Felix; Krone, Oliver; Thamm, Mirko; Kiessling, Fabian; Tolba, René Hany; Rieger, Siegfried; Gremse, Carl

2014-01-01

Background Lead-free hunting bullets are an alternative to lead-containing bullets which cause health risks for humans and endangered scavenging raptors through lead ingestion. However, doubts concerning the effectiveness of lead-free hunting bullets hinder the wide-spread acceptance in the hunting and wildlife management community. Methods We performed terminal ballistic experiments under standardized conditions with ballistic soap as surrogate for game animal tissue to characterize dimensionally stable, partially fragmenting, and deforming lead-free bullets and one commonly used lead-containing bullet. The permanent cavities created in soap blocks are used as a measure for the potential wound damage. The soap blocks were imaged using computed tomography to assess the volume and shape of the cavity and the number of fragments. Shots were performed at different impact speeds, covering a realistic shooting range. Using 3D image segmentation, cavity volume, metal fragment count, deflection angle, and depth of maximum damage were determined. Shots were repeated to investigate the reproducibility of ballistic soap experiments. Results All bullets showed an increasing cavity volume with increasing deposited energy. The dimensionally stable and fragmenting lead-free bullets achieved a constant conversion ratio while the deforming copper and lead-containing bullets showed a ratio, which increases linearly with the total deposited energy. The lead-containing bullet created hundreds of fragments and significantly more fragments than the lead-free bullets. The deflection angle was significantly higher for the dimensionally stable bullet due to its tumbling behavior and was similarly low for the other bullets. The deforming bullets achieved higher reproducibility than the fragmenting and dimensionally stable bullets. Conclusion The deforming lead-free bullet closely resembled the deforming lead-containing bullet in terms of energy conversion, deflection angle, cavity shape

Performance of lead-free versus lead-based hunting ammunition in ballistic soap.

Directory of Open Access Journals (Sweden)

Felix Gremse

Full Text Available BACKGROUND: Lead-free hunting bullets are an alternative to lead-containing bullets which cause health risks for humans and endangered scavenging raptors through lead ingestion. However, doubts concerning the effectiveness of lead-free hunting bullets hinder the wide-spread acceptance in the hunting and wildlife management community. METHODS: We performed terminal ballistic experiments under standardized conditions with ballistic soap as surrogate for game animal tissue to characterize dimensionally stable, partially fragmenting, and deforming lead-free bullets and one commonly used lead-containing bullet. The permanent cavities created in soap blocks are used as a measure for the potential wound damage. The soap blocks were imaged using computed tomography to assess the volume and shape of the cavity and the number of fragments. Shots were performed at different impact speeds, covering a realistic shooting range. Using 3D image segmentation, cavity volume, metal fragment count, deflection angle, and depth of maximum damage were determined. Shots were repeated to investigate the reproducibility of ballistic soap experiments. RESULTS: All bullets showed an increasing cavity volume with increasing deposited energy. The dimensionally stable and fragmenting lead-free bullets achieved a constant conversion ratio while the deforming copper and lead-containing bullets showed a ratio, which increases linearly with the total deposited energy. The lead-containing bullet created hundreds of fragments and significantly more fragments than the lead-free bullets. The deflection angle was significantly higher for the dimensionally stable bullet due to its tumbling behavior and was similarly low for the other bullets. The deforming bullets achieved higher reproducibility than the fragmenting and dimensionally stable bullets. CONCLUSION: The deforming lead-free bullet closely resembled the deforming lead-containing bullet in terms of energy conversion

Target discovery focused approaches to overcome bottlenecks in the exploitation of antimycobacterial natural products.

Science.gov (United States)

Baptista, Rafael; Bhowmick, Sumana; Nash, Robert J; Baillie, Les; Mur, Luis Aj

2018-04-01

Tuberculosis is a major global health hazard. The search for new antimycobacterials has focused on such as screening combinational chemistry libraries or designing chemicals to target predefined pockets of essential bacterial proteins. The relative ineffectiveness of these has led to a reappraisal of natural products for new antimycobacterial drug leads. However, progress has been limited, we suggest through a failure in many cases to define the drug target and optimize the hits using this information. We highlight methods of target discovery needed to develop a drug into a candidate for clinical trials. We incorporate these into suggested analysis pipelines which could inform the research strategies to accelerate the development of new drug leads from natural products.

Penetration of a magnetic field into superconducting lead and lead-indium alloys

International Nuclear Information System (INIS)

Egloff, C.; Raychaudhuri, A.K.; Rinderer, L.

1983-01-01

The temperature dependence of the magnetic field penetration depth of superconducting lead and lead-indium alloys has been studied over the temperature range between about 2 K and T/sub c/. Data are analyzed in terms of the microscopic theory. The difficulties of a unique analysis of the penetration data are pointed out and a strategy for the analysis is discussed. The penetration depth at T = 0K for pure lead is determined as 522 A. This value, though higher than the previously accepted value for lead, is nevertheless consistent with the strong coupling character of lead

Lead inclusions in aluminium

International Nuclear Information System (INIS)

Johnson, E.; Johansen, A.; Sarholt-Kristensen, L.; Andersen, H.H.; Grabaek, L.; Bohr, J.

1990-01-01

Ion implantation at room temperature of lead into aluminum leads to spontaneous phase separation and formation of lead precipitates growing topotactically with the matrix. Unlike the highly pressurized (∼ 1-5 GPa) solid inclusions formed after noble gas implantations, the pressure in the lead precipitates is found to be less than 0.12 GPa. Recently the authors have observed the result that the lead inclusions in aluminum exhibit both superheating and supercooling. In this paper they review and elaborate on these results. Small implantation-induced lead precipitates embedded in an aluminum matrix were studied by x-ray diffraction

EP toxicity testing of lead to resolve disposition of radioactively contaminated lead

International Nuclear Information System (INIS)

Larsen, M.M.; Boehmer, A.M.

1986-03-01

The Department of Energy (DOE), in its efforts to comply with the requirements of the Resource Conservation and Recovery Act (RCRA) of 1976, is concerned with hazardous waste which is also radioactively contaminated. There are no existing facilities to treat or dispose of these wastes. One such waste is lead, which is extensively used in the nuclear industry as shielding. This paper reports the results of leach testing of lead (both solid lead samples and lead shot) to resolve questions as to whether or not radioactively contaminated waste lead must be treated as a hazardous waste. The results of these tests showed that: some samples passed the leach test. Results of development efforts performed to date to recycle lead and those planned for the future are included in this report

Peeling lead paint turns into poisonous dust. Guess where it ends up? A media campaign to prevent childhood lead poisoning in New York City.

Science.gov (United States)

Greene, Danielle; Tehranifar, Parisa; DeMartini, Diana P; Faciano, Andrew; Nagin, Deborah

2015-06-01

Successful public health media campaigns promote messages, increase awareness, engage the public, and encourage behavior change. Between 2004 and 2006, the Lead Poisoning Prevention Program of the New York City Department of Health and Mental Hygiene conducted a media campaign grounded in social learning theory and the social marketing model to increase parents' awareness of childhood lead poisoning, ways to protect their children, and property owners' legal responsibility to fix peeling lead paint safely, and increase awareness of regulatory changes and encourage enforcement of New York City's Local Law 1 of 2004. Campaign materials were focus group tested and the campaign was refined annually. The campaign ran city-wide and in targeted high-risk neighborhoods. Neighborhoods and media venue (bus, train, kiosk, and store) changed annually, based on population risk factors and venue availability. Exposure to the campaign, campaign-related knowledge, and behavior were assessed using pre- and postcampaign street intercept surveys. Results showed that campaign reached the targeted population, and had an impact on knowledge of lead poisoning prevention measures as evidenced by increased knowledge of lead paint exposures sources in one year and increased knowledge of preventive behaviors in another year; these improvements were observed for both genders and most ethnic, primary language, educational attainment, and age groups in each year. Lessons learned indicate that well-targeted media campaigns, designed with audience participation, can reach parents through various venues, and improve key knowledge areas. Evaluation challenges faced include high levels of knowledge at baseline, competing media messages, and balancing between program needs and evaluation design. © 2015 Society for Public Health Education.

Matrix ageing and vascular impacts: focus on elastin fragmentation.

Science.gov (United States)

Duca, Laurent; Blaise, Sébastien; Romier, Béatrice; Laffargue, Muriel; Gayral, Stéphanie; El Btaouri, Hassan; Kawecki, Charlotte; Guillot, Alexandre; Martiny, Laurent; Debelle, Laurent; Maurice, Pascal

2016-06-01

Cardiovascular diseases (CVDs) are the leading cause of death worldwide and represent a major problem of public health. Over the years, life expectancy has considerably increased throughout the world, and the prevalence of CVD is inevitably rising with the growing ageing of the population. The normal process of ageing is associated with progressive deterioration in structure and function of the vasculature, commonly called vascular ageing. At the vascular level, extracellular matrix (ECM) ageing leads to molecular alterations in long half-life proteins, such as elastin and collagen, and have critical effects on vascular diseases. This review highlights ECM alterations occurring during vascular ageing with a specific focus on elastin fragmentation and also the contribution of elastin-derived peptides (EDP) in age-related vascular complications. Moreover, current and new pharmacological strategies aiming at minimizing elastin degradation, EDP generation, and associated biological effects are discussed. These strategies may be of major relevance for preventing and/or delaying vascular ageing and its complications. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2016. For permissions please email: journals.permissions@oup.com.

Elution of lead from lead zirconate titanate ceramics to acid rain

Science.gov (United States)

Tsurumi, Takaaki; Takezawa, Shuhei; Hoshina, Takuya; Takeda, Hiroaki

2017-10-01

The amount of lead that eluted from lead zirconate titanate (PZT) ceramics to artificial acid rain was evaluated. Four kinds of PZT ceramics, namely, pure PZT at MPB composition, CuO-added PZT, PZT with 10 mol % substitution of Ba for Pb, and CuO-added PZT with 10 mol % substitution of Ba for Pb, were used as samples of the elution test. These PZT ceramics of 8 mm2 and 1.1-1.2 mm thickness were suspended in 300 ml of H2SO4 solution of pH 4.0. The concentration of lead eluted from PZT was in the range from 0.2 to 0.8 ppm. It was found that both liquid phase formation by the addition of CuO and the substitution of Ba for Pb were effective to reduce the amount of lead that eluted. By fitting the leaching out curve with a classical equation, a master curve assuming no sampling effect was obtained. The lead concentration evaluated from the amount of lead that eluted from a commercial PZT plate to H2SO4 solution of pH 5.3 was almost the same as the limit in city water. It is concluded that PZT is not harmful to health and the environment and the amount of lead that eluted from PZT can be controlled by modifying PZT composition.

Production of radioisotopes within a plasma focus device

International Nuclear Information System (INIS)

Angeli, E.; Tartari, A.; Frignani, M.; Molinari, V.; Mostacci, D.; Rocchi, F.; Sumini, M. . E-mail address of corresponding author: domiziano.mostacci@mail.ing.unibo.it

2005-01-01

In recent years, research conducted in the US and in Italy has demonstrated production of radioisotopes in Plasma Focus (PF) devices, and particularly, on what could be termed 'endogenous' production, to wit, production within the plasma itself, as opposed to irradiation of targets. This technique relies on the formation of localized small plasma zones characterized by very high densities and fairly high temperatures. The conditions prevailing in these zones lead to high nuclear reaction rates, as pointed out in previous work by several authors. Further investigation of the cross sections involved has proven necessary to model the phenomena involved. In this paper, the present status of research in this field is reviewed, both with regards to cross section models and to experimental production of radioisotopes. Possible outcomes and further development are discussed. (author)

Selection of Suitable Internal Control Genes for Accurate Normalization of Real-Time Quantitative PCR Data of Buffalo (Bubalus bubalis) Blastocysts Produced by SCNT and IVF.

Science.gov (United States)

Sood, Tanushri Jerath; Lagah, Swati Viviyan; Sharma, Ankita; Singla, Suresh Kumar; Mukesh, Manishi; Chauhan, Manmohan Singh; Manik, Radheysham; Palta, Prabhat

2017-10-01

We evaluated the suitability of 10 candidate internal control genes (ICGs), belonging to different functional classes, namely ACTB, EEF1A1, GAPDH, HPRT1, HMBS, RPS15, RPS18, RPS23, SDHA, and UBC for normalizing the real-time quantitative polymerase chain reaction (qPCR) data of blastocyst-stage buffalo embryos produced by hand-made cloning and in vitro fertilization (IVF). Total RNA was isolated from three pools, each of cloned and IVF blastocysts (n = 50/pool) for cDNA synthesis. Two different statistical algorithms geNorm and NormFinder were used for evaluating the stability of these genes. Based on gene stability measure (M value) and pairwise variation (V value), calculated by geNorm analysis, the most stable ICGs were RPS15, HPRT1, and ACTB for cloned blastocysts, HMBS, UBC, and HPRT1 for IVF blastocysts and RPS15, GAPDH, and HPRT1 for both the embryo types analyzed together. RPS18 was the least stable gene for both cloned and IVF blastocysts. Following NormFinder analysis, the order of stability was RPS15 = HPRT1>GAPDH for cloned blastocysts, HMBS = UBC>RPS23 for IVF blastocysts, and HPRT1>GAPDH>RPS15 for cloned and IVF blastocysts together. These results suggest that despite overlapping of the three most stable ICGs between cloned and IVF blastocysts, the panel of ICGs selected for normalization of qPCR data of cloned and IVF blastocyst-stage embryos should be different.

Bioceramic bone graft substitute for treatment of unicameral bone cysts.

Science.gov (United States)

Fillingham, Y A; Cvetanovich, G L; Haughom, B D; Erickson, B J; Gitelis, S

2016-08-01

To review the outcome of 12 patients who underwent debridement and injection of bioceramic for unicameral bone cyst (UBC). The resorption rate of the bioceramic was estimated by both traditional and novel methods. Records of 10 males and 2 females aged 6 to 34 years who underwent debridement and injection of bioceramic for UBC and were followed up for a mean of 41 (range, 26-57) months were reviewed. Functional outcome was assessed using the selfcompleted Musculoskeletal Tumor Society (MSTS) questionnaire. Radiological outcome was assessed using both original and modified Neer Outcome Rating System. The resorption rate of the bioceramic was estimated using both traditional and novel (ImageJ) methods. The mean MSTS score was 29.7 (range, 28-30) indicating excellent functional outcome. Of the 12 patients, 9 achieved complete healing and 3 had a residual cyst of 1%, 11%, and 52%. The last was considered a local recurrence, and the patient underwent repeat percutaneous injection of the bioceramic 1.5 years later and remained disease-free 4 years later. The mean resorption rate was 29% faster when estimated using the traditional rather than the ImageJ method (0.47 vs. 0.33 cm3/day, p=0.02). In the patient with recurrence, the resorption rate was faster than the average (0.68 vs. 0.33 cm3/day). A single percutaneous injection of the bioceramic for UBC achieved good functional and radiological outcome while avoiding donor-site morbidity.

Study the Output Characteristics of a 90 kJ Filippove-Type Plasma Focus

Science.gov (United States)

Sadat Kiai, S. M.; Talaei, A.; Adlparvar, S.; Zirak, A.; Elahi, M.; Safarian, A.; Farhangi, S.; Alhooie, S.; Dabirzadeh, A. A.; Khalaj, M. M.; Mahlooji, M. S.; Talaei, M.; KaKaei, S.; Sheibani, S.; Kashani, A.; Zahedi, F.

2010-08-01

The output characteristics of a Filippove-Type plasma focus "Dena" (288 μF, 25 kV, 90 kJ) is numerically investigated by considering the voltage, current, current derivative, and maximum current as a function of capacitor bank energy in the constant Argon gas pressure and compared to the experiment. It is shown that increase on the bank energy leads to the increment on the maximum current and decrement on the pinch time.

Long range correlations, leading particle spectrum and correlations with leading particles

International Nuclear Information System (INIS)

Ilgenfritz, E.M.

1976-05-01

The unitary cluster emission model by de Groot and Ruijgrok is discussed as an approach to understand the leading particle behaviour. Consequences of the model concerning co--rrelations between leading particles and produced particles in the central region are considered. No satisfactory agreement was found. Production of leading clusters is argued for being an essential feature of these correlations. (author)

Leading in crisis: lessons for safety leaders.

Science.gov (United States)

George, William W; Denham, Charles R; Burgess, L Hayley; Angood, Peter B; Keohane, Carol

2010-03-01

The National Quality Forum (NQF) Safe Practices are a group of 34 evidence-based Safe Practices that should be universally used to reduce the risk of harm to patients. Four of these practices specifically address leadership. A recently published book, 7 Lessons for Leading in Crisis, offers practical advice on how to lead in crisis. An analysis of how concepts from the 7 lessons could be applied to the Safe Practices was presented nationally by webinar to assess the audience's reaction to the information. The objective of this article was to present the information and the audience's reaction to it. Recommendations for direct actions that health care leaders can take to accelerate adoption of NQF Safe Practices were presented to health care leaders, followed by an immediate direct survey that used Reichheld's "Net Promoter Score" to assess whether the concepts presented were considered applicable and valuable to the audience. In a separate presentation, the challenges and crises facing nursing leaders were addressed by nursing leaders. Six hundred seventy-four hospitals, with an average of 4.5 participants per hospital, participated in the webinar. A total of 272 safety leaders responded to a survey immediately after the webinar. A Net Promoter Score assessment revealed that 58% of those surveyed rated the value of the information at 10, and 91% scored the value of the webinar to be between 8 and 10, where 10 is considered a strong recommendation that those voting would recommend this program to others. The overwhelmingly high score indicated that the principles presented were important and valuable to this national audience of health care leadership. The 2010 environment of uncertainty and shrinking financial resources poses significant risk to patients and new challenges for leaders at all levels. A values-grounded focus on personal accountability for leading in crisis situations strongly resonates with those interested in or leading patient safety initiatives.

Comparative toxicity of tetra ethyl lead and lead oxide to earthworms, Eisenia fetida (Savigny)

International Nuclear Information System (INIS)

Venkateswara Rao, J.; Kavitha, P.; Padmanabha Rao, A.

2003-01-01

Leaded gasoline contains tetra ethyl lead (TEL) as an antiknocking agent, which produces major amounts of lead oxide in automobile exhaust along with traces of TEL. To minimize the lead contamination, methyl tertiary butyl ether (MTBE) is used as a substitute for producing unleaded gasoline. It has become increasingly apparent that young children are highly susceptible to the harmful effects of lead. Hence, a study was carried out to monitor lead toxicity in soil, using adult earthworms (Eisenia fetida, Savigny). Leaded gasoline (TEL) and lead oxide are 383- and 211-fold more toxic than unleaded gasoline (MTBE) in 7 days of exposure and 627- and 290-fold more toxic in 14 days, respectively. Results indicate that the presence of TEL in leaded gasoline and lead oxide has a significant effect on behavior, morphology, and histopathology of earthworms. Absorption of TEL into the tissues is comparatively less than that of lead oxide but toxic effects were severe. Rupture of the cuticle, extrusion of coelomic fluid and inflexible metameric segmentation were observed, causing desensitization of the posterior region leading to fragmentation in earthworms