10 CFR 626.4 - General acquisition strategy.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false General acquisition strategy. 626.4 Section 626.4 Energy DEPARTMENT OF ENERGY (CONTINUED) SALES REGULATION PROCEDURES FOR ACQUISITION OF PETROLEUM FOR THE STRATEGIC PETROLEUM RESERVE § 626.4 General acquisition strategy. (a) Criteria for commencing acquisition. To reduce...
12 CFR 626.6020 - Nondiscriminatory advertising.
2010-01-01
... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Nondiscriminatory advertising. 626.6020 Section... § 626.6020 Nondiscriminatory advertising. (a) A Farm Credit institution that directly or through third parties engages in any form of advertising shall not use words, phrases, symbols, directions, forms, or...
7 CFR 3560.626 - Affirmative Fair Housing Marketing Plan.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Affirmative Fair Housing Marketing Plan. 3560.626 Section 3560.626 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING... § 3560.626 Affirmative Fair Housing Marketing Plan. On-farm labor housing must meet the requirements of...
47 CFR 73.626 - DTV distributed transmission systems.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false DTV distributed transmission systems. 73.626... RADIO BROADCAST SERVICES Television Broadcast Stations § 73.626 DTV distributed transmission systems. (a... distributed transmission system (DTS). Except as expressly provided in this section, DTV stations operating a...
10 CFR 626.7 - Royalty transfer and exchange.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Royalty transfer and exchange. 626.7 Section 626.7 Energy DEPARTMENT OF ENERGY (CONTINUED) SALES REGULATION PROCEDURES FOR ACQUISITION OF PETROLEUM FOR THE STRATEGIC... pursuant to an agreement between DOE and DOI for the transfer of royalty oil. (b) Acquisition strategy. (1...
12 CFR 626.6025 - Equal housing lender poster.
2010-01-01
... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Equal housing lender poster. 626.6025 Section... § 626.6025 Equal housing lender poster. (a) Each Farm Credit institution that makes loans for the... by a dwelling shall post and maintain an Equal Housing Lender Poster in the lobby of each of its...
10 CFR 626.8 - Deferrals of contractually scheduled deliveries.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Deferrals of contractually scheduled deliveries. 626.8 Section 626.8 Energy DEPARTMENT OF ENERGY (CONTINUED) SALES REGULATION PROCEDURES FOR ACQUISITION OF... estimate the market value of the deferral and establish a strategy for negotiating with suppliers the...
20 CFR 626.2 - Format of the Job Training Partnership Act regulations.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Format of the Job Training Partnership Act regulations. 626.2 Section 626.2 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR INTRODUCTION TO THE REGULATIONS UNDER THE JOB TRAINING PARTNERSHIP ACT § 626.2 Format of the Job...
27 CFR 6.26 - Indirect interest.
2010-04-01
... OF THE TREASURY LIQUORS âTIED-HOUSEâ Unlawful Inducements Interest in Retail License § 6.26 Indirect interest. Industry member interest in retail licenses includes any interest acquired by corporate officials, partners, employees or other representatives of the industry member. Any interest in a retail license...
7 CFR 1280.626 - Certification and voting procedures.
2010-01-01
... 1280.626 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE LAMB... Internet during the voting period. A completed and signed form LS-86 and supporting documentation, such as...
20 CFR 626.3 - Purpose, scope, and applicability of the Job Training Partnership Act regulations.
2010-04-01
... ADMINISTRATION, DEPARTMENT OF LABOR INTRODUCTION TO THE REGULATIONS UNDER THE JOB TRAINING PARTNERSHIP ACT § 626.3 Purpose, scope, and applicability of the Job Training Partnership Act regulations. (a) Parts 626..., part C of the Job Training Partnership Act) establish the Federal programmatic and administrative...
2010-10-01
... VESSEL USE Lifting § 173.010 Definitions. As used in this part— (a) Hook load means the weight of the object lifted by the crane. (b) Crane radius means the distance illustrated in Figure 173.010. EC01MR91...
Spheroidal degeneration in H626R TGFBI variant lattice dystrophy: a multimodality analysis.
Lai, Kevin; Reidy, Jason; Bert, Benjamin; Milman, Tatyana
2014-07-01
The aim of this study was to describe clinical, imaging, molecular genetic, histopathologic, immunohistochemical, and ultrastructural characteristics of coexistent amyloid and spheroidal degeneration-type deposits in a family with histidine-626-arginine transforming growth factor beta-induced (H626R TGFBI) variant lattice dystrophy. This is a retrospective clinical-pathological and genetic analysis of one family with H626R variant lattice dystrophy. Pedigree analysis showed an autosomal dominant inheritance pattern of the disease. Examination of 3 affected family members revealed asymmetric, thick, branching lattice-like deposits associated with corneal haze. Sequencing of the TGFBI gene revealed a high-penetrance disease-causing sequence variation (H626R CAT>CGT heterozygous). Optical coherence tomography demonstrated fusiform, poorly demarcated hyperechoic stromal deposits with focal hypoechoic central regions. Histology of the corneal discs from 2 affected family members showed stromal deposits consistent with TGFBI amyloid. Some amyloid deposits contained a central nidus of spheroidal degeneration-type material that demonstrated autofluorescence, stained with elastic and Masson trichrome stains, did not stain with periodic acid-Schiff or Congo red stains, was nonbirefringent, and did not immunoreact with keratoepithelin antibodies. Transmission electron microscopy confirmed the presence of amyloid fibrils with central, electrodense, homogeneous, discrete, spheroidal degeneration-type deposits. The presence of spheroidal deposits in a subset of affected patients, variability in presentation within an individual and between family members, predominant anterior corneal stromal location and nonimmunoreactivity of deposits for keratoepithelin suggest that these deposits are degenerative in nature. The deposits may arise from ultraviolet light-altered proteins diffused from the limbus, which form a nidus for keratoepithelin deposition.
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false What emission testing must I perform for my application for a certificate of conformity? 59.626 Section 59.626 Protection of Environment... application for a certificate of conformity? This section describes the emission testing you must perform to...
48 CFR 1435.010 - Scientific and technical reports.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Scientific and technical reports. 1435.010 Section 1435.010 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR SPECIAL CATEGORIES OF CONTRACTING RESEARCH AND DEVELOPMENT CONTRACTING 1435.010 Scientific and technical...
48 CFR 935.010 - Scientific and technical reports.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Scientific and technical reports. 935.010 Section 935.010 Federal Acquisition Regulations System DEPARTMENT OF ENERGY SPECIAL CATEGORIES OF CONTRACTING RESEARCH AND DEVELOPMENT CONTRACTING 935.010 Scientific and technical reports. (c...
24 CFR 266.626 - Notice of default and filing an insurance claim.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of default and filing an... AND OTHER AUTHORITIES HOUSING FINANCE AGENCY RISK-SHARING PROGRAM FOR INSURED AFFORDABLE MULTIFAMILY PROJECT LOANS Contract Rights and Obligations Claim Procedures § 266.626 Notice of default and filing an...
48 CFR 35.010 - Scientific and technical reports.
2010-10-01
... reports. (a) R&D contracts shall require contractors to furnish scientific and technical reports... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Scientific and technical reports. 35.010 Section 35.010 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION...
20 CFR 626.1 - Scope and purpose of the Job Training Partnership Act.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Scope and purpose of the Job Training... LABOR INTRODUCTION TO THE REGULATIONS UNDER THE JOB TRAINING PARTNERSHIP ACT § 626.1 Scope and purpose of the Job Training Partnership Act. It is the purpose of the Job Training Partnership Act (JTPA or...
Draft revision of human factors guideline HF-010
International Nuclear Information System (INIS)
Lee, Hyun Chul; Lee, Yong Hee; Oh, In Seok; Lee, Jung Woon; Cha, Woo Chang; Lee, Dhong Ha
2003-05-01
The Application of Human Factors to the design of Man-Machine Interfaces System(MMIS) in the nuclear power plant is essential to the safety and productivity of the nuclear power plants, human factors standards and guidelines as well as human factors analysis methods and experiments are weightily used to the design application. A Korean engineering company has developed a human factors engineering guideline, so-call HF-010, and has used it for human factors design, however the revision of HF-010 is necessary owing to lack of the contents related to the advanced MMI(Man-Machine Interfaces). As the results of the reviews of HF-010, it is found out that the revision of Section 9. Computer Displays of HF-010 is urgent, thus the revision was drafted on the basis of integrated human factors design guidelines for VDT, human factors design guidelines for PMAS SPADES display, human factors design guidelines for PMAS alarm display, and human factors design guidelines for electronic displays developed by the surveillance and operation support project of KOICS. The draft revision of HF-010 Section 9 proposed in this report can be utilized for the human factors design of the advanced MMI, and the high practical usability of the draft can be kept up through the continuous revision according to the advancement of digital technology
46 CFR 160.010-6 - Capacity of buoyant apparatus.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Capacity of buoyant apparatus. 160.010-6 Section 160.010-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND... apparatus is not considered in determining the capacity. (b) [Reserved] ...
Dezwaan, Diane C.; Mequio, Michael J.; Littell, Julia S.; Allen, Jonathan P.; Rossbach, Silvia; Pybus, Vivien
2009-01-01
A bacteriocin produced by a vaginal isolate of Enterococcus faecium strain 62-6, designated enterocin 62-6, was characterized following purification and DNA sequence analysis and compared to previously described bacteriocins. Enterocin 62-6 was isolated from brain heart infusion (BHI) culture supernatants using ammonium sulfate precipitation followed by elution from a Sepharose cation exchange column using a continuous salt gradient (0.1–0.7 M NaCl). SDS-PAGE of an active column fraction resulted in an electrophoretically pure protein, which corresponded to the growth inhibition of the sensitive Lactobacillus indicator strain in the gel overlay assay. Purified enterocin 62-6 was shown to be heat- and pH-stable, and sensitive to the proteolytic enzymes α-chymotrypsin and pepsin. Results from mass spectrometry suggested that it comprised two peptides of 5206 and 5219±1 Da, which was confirmed by DNA sequence analysis. The characteristics of enterocin 62-6 as a small, heat- and pH-stable, cationic, hydrophobic, two-peptide, plasmid-borne bacteriocin, with an inhibitory spectrum against a broad range of Gram-positive but not Gram-negative bacteria, were consistent with its classification as a class IIc bacteriocin. Furthermore, its wide spectrum of growth inhibitory activity against Gram-positive bacteria of vaginal origin including lactobacilli, and stability under the acidic conditions of the vagina, are consistent with our hypothesis that it could have potential significance in disrupting the ecology of the vaginal tract and pave the way for the establishment of the abnormal microbiota associated with the vaginal syndrome bacterial vaginosis. This is the first class IIc bacteriocin produced by a strain of E. faecium of vaginal origin to be characterized. PMID:19578555
46 CFR 159.010-5 - Independent laboratory: Application for acceptance.
2010-10-01
... organization or in a company or corporation that controls the organization. [CGD 93-055, 61 FR 13928, Mar. 28....010-5 Section 159.010-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT... organization or the chief officer's representative, that an official representative of the Coast Guard is...
46 CFR 159.010-7 - Recognized independent laboratory: Memorandum of Understanding.
2010-10-01
... independent laboratory and the Coast Guard; (7) An agreement to conduct comparison testing with other... for conducting comparison tests with other recognized laboratories. (d) Copies of MOUs signed by the... Understanding. 159.010-7 Section 159.010-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED...
46 CFR 159.010-19 - Termination of acceptance or recognition: Procedure.
2010-10-01
... termination is under consideration. The laboratory may submit written comments to the Commandant within 21... of the laboratory and may direct the holder of the certificate of approval to cease claiming that the....010-19 Section 159.010-19 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT...
International Nuclear Information System (INIS)
Körner, Christian; Nattermann, Jacob; Spengler, Ulrich; Nischalke, Hans Dieter; Riesner, Katarina; Krämer, Benjamin; Eisenhardt, Marianne; Glässner, Andreas; Wolter, Franziska; Berg, Thomas; Müller, Tobias; Sauerbruch, Tilman
2012-01-01
Tumour surveillance via induction of TRAIL-mediated apoptosis is a key mechanism, how the immune system prevents malignancy. To determine if gene variants in the TRAIL receptor I (DR4) gene affect the risk of hepatitis C virus (HCV)-induced liver cancer (HCC), we analysed DR4 mutations C626G (rs20575) and A683C (rs20576) in HCV-infected patients with and without HCC. Frequencies of DR4 gene polymorphisms were determined by LightSNiP assays in 159 and 234 HCV-infected patients with HCC and without HCC, respectively. 359 healthy controls served as reference population. Distribution of C626G and A683C genotypes were not significantly different between healthy controls and HCV-positive patients without HCC. DR4 variants 626C and 683A occurred at increased frequencies in patients with HCC. The risk of HCC was linked to carriage of the 626C allele and the homozygous 683AA genotype, and the simultaneous presence of the two risk variants was confirmed as independent HCC risk factor by Cox regression analysis (Odds ratio 1.975, 95% CI 1.205-3.236; p = 0.007). Furthermore HCV viral loads were significantly increased in patients who simultaneously carried both genetic risk factors (2.69 ± 0.36 × 10 6 IU/ml vs. 1.81 ± 0.23 × 10 6 IU/ml, p = 0.049). The increased prevalence of patients with a 626C allele and the homozygous 683AA genotype in HCV-infected patients with HCC suggests that these genetic variants are a risk factor for HCC in chronic hepatitis C
46 CFR 160.010-5 - Buoyant apparatus with plastic foam buoyancy.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Buoyant apparatus with plastic foam buoyancy. 160.010-5... Vessels § 160.010-5 Buoyant apparatus with plastic foam buoyancy. (a) Buoyant apparatus with plastic foam buoyancy must have a plastic foam body with an external protective covering. The body may be reinforced as...
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How will OWCP coordinate compensation payable... Benefits with State Workers' Compensation Benefits § 30.626 How will OWCP coordinate compensation payable under Part E of EEOICPA with benefits from state workers' compensation programs? (a) OWCP will reduce...
48 CFR 435.010 - Scientific and technical reports.
2010-10-01
... CATEGORIES OF CONTRACTING RESEARCH AND DEVELOPMENT CONTRACTING 435.010 Scientific and technical reports... all scientific and technical reports to the National Technical Information Service at the address... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Scientific and technical...
48 CFR 235.010 - Scientific and technical reports.
2010-10-01
....010 Scientific and technical reports. (b) For DoD, the Defense Technical Information Center is responsible for collecting all scientific and technical reports. For access to these reports, follow the... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Scientific and technical...
Risk assessment in gas activities according to legislative decree No. 626/94
International Nuclear Information System (INIS)
Del Gaudio, P.; Andreani, A.; Brindani, A.; Capizzi, F.; Cervi, G.; Gandausio, C.; Savio, S.; Rossi, G.P.; Viola, M.
1998-01-01
Among the latest measures on health and safety (H and S) at work, Legislative Decree 626/94 is the most important step ever taken until now. Following the implementation of a long series of European Directives, the Decree gives the guidelines to be followed in order to safeguard the workers' H and S. Since gas distribution companies are deeply involved in these activities, the Italian Technical Gas Association (ATIG) has issued a paper on D and S focused on the activities of construction, maintenance and management of gas distribution networks. In a series of tables, the article summarizes a long list of the possible actions to be taken during various interventions, detects the sources of potential risks and suggests the main operational precautions. Besides, criteria for risk assessment, a scale of occurrence probabilities and a scale for damage evaluation are given [it
Ospina, C A; Terra, J; Ramirez, A J; Farina, M; Ellis, D E; Rossi, A M
2012-01-01
High-resolution transmission electron microscopy (HRTEM) and ab initio quantum-mechanical calculations of electronic structure were combined to investigate the structure of the hydroxyapatite (HA) (010) surface, which plays an important role in HA interactions with biological media. HA was synthesized by in vitro precipitation at 37°C. HRTEM images revealed thin elongated rod nanoparticles with preferential growth along the [001] direction and terminations parallel to the (010) plane. The focal series reconstruction (FSR) technique was applied to develop an atomic-scale structural model of the high-resolution images. The HRTEM simulations identified the coexistence of two structurally distinct terminations for (010) surfaces: a rather flat Ca(II)-terminated surface and a zig-zag structure with open OH channels. Density functional theory (DFT) was applied in a periodic slab plane-wave pseudopotential approach to refine details of atomic coordination and bond lengths of Ca(I) and Ca(II) sites in hydrated HA (010) surfaces, starting from the HRTEM model. Copyright © 2011 Elsevier B.V. All rights reserved.
Anabolic-Androgenic Steroid Use Among 1,010 College Men.
Pope, Harrison G., Jr.; And Others
1988-01-01
Two percent of 1,010 male college students responding to a questionnaire about anabolic-androgenic steroid use reported using steroids; most of the users were competitive athletes, although some used steroids to improve their physical appearance. Users were not distinguished from non-users in terms of academic achievement or use of other illicit…
Loading Intensity Prediction by Velocity and the OMNI-RES 0-10 Scale in Bench Press.
Naclerio, Fernando; Larumbe-Zabala, Eneko
2017-02-01
Naclerio, F and Larumbe-Zabala, E. Loading intensity prediction by velocity and the OMNI-RES 0-10 scale in bench press. J Strength Cond Res 32(1): 323-329, 2017-This study examined the possibility of using movement velocity and the perceived exertion as indicators of relative load in the bench press (BP) exercise. A total of 308 young, healthy, resistance trained athletes (242 men and 66 women) performed a progressive strength test up to the one repetition maximum for the individual determination of the full load-velocity and load-exertion relationships. Longitudinal regression models were used to predict the relative load from the average velocity (AV) and the OMNI-Resistance Exercise Scales (OMNI-RES 0-10 scale), considering sets as the time-related variable. Load associated with the AV and the OMNI-RES 0-10 scale value expressed after performing a set of 1-3 repetitions were used to construct 2 adjusted predictive equations: Relative load = 107.75 - 62.97 × average velocity; and Relative load = 29.03 + 7.26 × OMNI-RES 0-10 scale value. The 2 models were capable of estimating the relative load with an accuracy of 84 and 93%, respectively. These findings confirm the ability of the 2 calculated regression models, using load-velocity and load-exertion from the OMNI-RES 0-10 scale, to accurately predict strength performance in BP.
Directory of Open Access Journals (Sweden)
N. Cayetano-Castro
2015-01-01
Full Text Available The Ostwald ripening process was studied in Fe0.75Ni0.10Al0.15 and Fe0.74Ni0.10Al0.15Cr0.01 alloys after aging at 750, 850, and 950°C for different times. The microstructural evolution shows a rounded cube morphology (Fe, NiAl β′ precipitates aligned in the ferrite matrix, which changes to elongated plates after prolonged aging. The variation of the equivalent radii of precipitates with time follows the modified Lifshitz-Slyozov-Wagner theory for diffusion-controlled coarsening. Thermo-Calc analysis shows that the chromium content is richer in the matrix than in the precipitates which causes higher hardness and coarsening resistance in the aged Fe0.74Ni0.10Al0.15Cr0.01 alloy.
46 CFR 159.010-11 - Changes in the laboratory's qualifications.
2010-10-01
... Section 159.010-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT... Commandant in writing of each change within 30 days after the change has occurred. (b) If any change in the... laboratory shall notify the Commandant in writing within 30 days after the change occurs. The Commandant may...
75 FR 11988 - Aviation Proceedings, Agreements Filed the Week Ending February 27, 2010
2010-03-12
... Air Transport Association. Subject: Mail Vote 625--Resolution 010p, TC3 Japan, Korea-South East Asia...: Members of the International Air Transport Association. Subject: PTC COMP Mail Vote 620, Resolution 024d... International Air Transport Association. Subject: PTC COMP Mail Vote 626, Resolution 011a, Mileage Manual Non TC...
Miura, Tsutomu; Chiba, Koichi; Kuroiwa, Takayoshi; Narukawa, Tomohiro; Hioki, Akiharu; Matsue, Hideaki
2010-09-15
Neutron activation analysis (NAA) coupled with an internal standard method was applied for the determination of As in the certified reference material (CRM) of arsenobetaine (AB) standard solutions to verify their certified values. Gold was used as an internal standard to compensate for the difference of the neutron exposure in an irradiation capsule and to improve the sample-to-sample repeatability. Application of the internal standard method significantly improved linearity of the calibration curve up to 1 microg of As, too. The analytical reliability of the proposed method was evaluated by k(0)-standardization NAA. The analytical results of As in AB standard solutions of BCR-626 and NMIJ CRM 7901-a were (499+/-55)mgkg(-1) (k=2) and (10.16+/-0.15)mgkg(-1) (k=2), respectively. These values were found to be 15-20% higher than the certified values. The between-bottle variation of BCR-626 was much larger than the expanded uncertainty of the certified value, although that of NMIJ CRM 7901-a was almost negligible. Copyright (c) 2010 Elsevier B.V. All rights reserved.
Magnetotransport study of topological superconductor Cu0.10Bi2Se3 single crystal
Li, M. T.; Fang, Y. F.; Zhang, J. C.; Yi, H. M.; Zhou, X. J.; Lin, C. T.
2018-03-01
We report a magnetotransport study of vortex-pinning in Cu0.10Bi2Se3 single crystal. The sample is demonstrated to be in clean limit and absent of Pauli spin-limiting effect. Interestingly, the resistivity versus magnetic field shows an anomalously pronounced increase when approaching the superconducting-normal state boundary for both {{B}app}\\parallel ab and {{B}app}\\parallel c configurations. We have investigated the flux-flowing behavior under various magnetic fields and temperatures, enabling us to establish its anisotropic vortex phase diagram. Our results suggest the Cu0.10Bi2Se3 can be served as one unique material for exploring exotic surface vortex states in topological superconductors.
International Nuclear Information System (INIS)
Qiu, X.Y.; Huang, H.W.; Gao, Y.D.
2016-01-01
Graphical abstract: - Highlights: • The (010) plane is the easiest one to be seen in wolframite, followed by (001) plane and (100) plane. • (010) and (001) are the primary planes for the absorption of anion collector ions. • W atom can be the absorption site in (001) plane but not in (010) plane. • The proportion of platy particles as well as their perfect cleavage planes increases with the decrease of particle size. • Cleavages occupied by W atom can lead to a low recovery when using BHA alone as the collector of wolframite. - Abstract: The atom distribution and electronic properties of (010), (001) and (100) planes of MnWO 4 and FeWO 4 were studied based on a DFT calculation. The surface stabilities of the three planes were compared according to their surface energies. The most stable one is (010) plane, followed by (001) and (100). (010) and (001) are the main planes for absorption of anion collector ions, which is supported by their bonding relationship and charge density distribution of surface atoms and finally proved by the results of flotation test and stereomicroscope analysis. In addition, the tungsten atoms can be viewed as the absorption site for collectors in (001) plane but not in (010) plane, which can explain the phenomenon in flotation test that the recovery of wolframite can hardly be further boosted even with a high dosage of BHA.
28 CFR 0.10 - Attorney General's Advisory Committee of U.S. Attorneys.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Attorney General's Advisory Committee of... DEPARTMENT OF JUSTICE Office of the Attorney General § 0.10 Attorney General's Advisory Committee of U.S. Attorneys. (a) The Attorney General's Advisory Committee of United States Attorneys shall consist of an...
Wasan, Kishor M; Sivak, Olena; Bartlett, Karen; Wasan, Ellen K; Gershkovich, Pavel
2015-01-01
To evaluate the antifungal activity of amphotericin B (AmB) in a mouse model of systemic candidiasis following administration of a novel oral AmB formulation (iCo-010) that has been pre-exposed to tropical temperatures. Amphotericin B (AmB) was prepared as a 5 mg/mL dispersion in a mixture of Peceol, Gelucire 44/14 and VitE-TPGS 2,3 (iCo-010). The formulation was protected from light and incubated in a sealed container at 43 °C for 60 days. Mice infected with Candida albicans were treated with either iCo-010 formulation pre-incubated at 43 °C for 60 days or freshly prepared iCo-010 formulation at doses of 5, 10 and 20 mg/kg once daily for five consecutive days. Single intravenous 5 mg/kg dose of AmBisome® was used as a positive control group. Seven days following the last dose, the kidney, liver, spleen, lung, heart and brain were removed and the number of colony forming units (CFUs) was determined as a measure of tissue fungal load. In addition, the concentration of AmB within each tissue was determined using high performance liquid chromatography (HPLC). There were no significant differences in the reduction of CFUs and the concentration of AmB recovered in all organs at all iCo-010 doses tested between the freshly prepared iCo-010 formulation compared to the formulation that was incubated at 43 °C for 60 days. A novel oral AmB formulation, iCo-010, incubated at 43 °C for 60 days to simulate the exposure of the formulation to tropical temperatures remained highly effective against murine systemic candidiasis.
Directory of Open Access Journals (Sweden)
Tadaharu Ueda
2015-07-01
Full Text Available The formation processes of V(V-substituted polyoxometalates with the Wells–Dawson-type structure were studied by cyclic voltammetry and by 31P NMR and Raman spectroscopy. Generally, the vanadium-substituted heteropolytungstates, [P2VW17O62]7− and [As2VW17O62]7−, were prepared by mixing equimolar amounts of the corresponding lacunary species—[P2W17O61]10− and [As2W17O61]10−—and vanadate. According to the results of various measurements in the present study, the tungsten site in the framework of [P2W18O62]6− and [As2W18O62]6− without defect sites could be substituted with V(V to form the [P2VW17O62]7− and [As2VW17O62]7−, respectively. The order in which the reagents were mixed was observed to be the key factor for the formation of Dawson-type V(V-substituted polyoxometalates. Even when the concentration of each reagent was identical, the final products differed depending on the order of their addition to the reaction mixture. Unlike Wells–Dawson-type heteropolytungstates, the molybdenum sites in the framework of [P2Mo18O62]6− and [As2Mo18O62]6− were substituted with V(V, but formed Keggin-type [PVMo11O40]4− and [AsVMo11O40]4− instead of [P2VMo17O62]7− and [As2VMo17O62]7−, respectively, even though a variety of reaction conditions were used. The formation constant of the [PVMo11O40]4− and [AsVMo11O40]4− was hypothesized to be substantially greater than that of the [P2VMo17O62]7− and [As2VMo17O62]7−.
Li, Guixia; Zhao, Lianming; Zhu, Houyu; Liu, Xiuping; Ma, Huifang; Yu, Yanchen; Guo, Wenyue
2017-07-05
The hydrodesulfurization (HDS) of thiophene on clean and S-modified MoP(010) is investigated to understand the HDS mechanism as well as the surface sulfur (S) atom effect using periodic density functional theory (DFT). The results show that thiophene prefers strongly flat adsorption on both the clean and S-modified surfaces, in either the molecular state or the dissociative state breaking simultaneously one C-S bond, and the adsorption of thiophene can be slightly weakened by the surface S atom. Thermodynamic and kinetic analysis indicates that the HDS of thiophene in both the molecular and dissociative adsorption states prefers to take place along the direct desulfurization (DDS) pathway rather than hydrogenation on both the clean and S-modified MoP(010) surfaces. Surface S shows a promotion effect on the HDS catalytic activity of MoP(010), because the energy barrier/rate constant of the rate-determining step on the DDS pathway is decreased/enlarged under the S modification. Compared with the situation of MoP(001), MoP(010) should have relatively low HDS activity, since a higher energy barrier as well as weaker exothermicity is involved in the reaction on the latter surface.
Opoku, Francis; Govender, Krishna Kuben; Sittert, Cornelia Gertina Catharina Elizabeth van; Govender, Penny Poomani
2018-01-01
Graphite-like carbon nitride (g-C3N4)-based heterostructures have received much attention due to their prominent photocatalytic activity. The g-C3N4/Bi2WO6 and g-C3N4/Bi2MoO6 heterostructures, which follow a typical hetero-junction charge transfer mechanisms show a weak potential for hydrogen evolution and reactive radical generation under visible light irradiation. A mediator-free Z-scheme g-C3N4/Bi2MoO6(010) and g-C3N4/Bi2WO6(010) heterostructures photocatalyst are designed for the first time using first-principles studies. Moreover, theoretical understanding of the underlying mechanism, the effects of interfacial composition and the role the interface play in the overall photoactivity is still unexplained. The calculated band gap of the heterostructures is reduced compared to the bulk Bi2WO6 and Bi2MoO6. In this study, we systematically calculated energy band structure, optical properties and charge transfer of the g-C3N4/Bi2MoO6(010) and g-C3N4/Bi2WO6(010) heterostructures using the hybrid density functional theory approach. The results show that the charge transfer at the interface of the heterostructures induces a built-in potential, which benefits the separation of photogenerated charge carriers. The g-C3N4/Bi2MoO6(010) heterostructure with more negative adhesion energy (-1.10 eVA-2) is predicted to have a better adsorptive ability and can form more easily compared to the g-C3N4/Bi2WO6(010) interface (-1.16 eVA-2). Therefore, our results show that the g-C3N4 interaction with Bi2MoO6 is stronger than Bi2WO6, which is also verified by the smaller vertical separation (3.25 Å) between Bi2MoO6 and g-C3N4 compared to the g-C3N4/Bi2WO6(010) interface (3.36 Å). The optical absorption verifies that these proposed Z-scheme heterostructures are excellent visible light harvesting semiconductor photocatalyst materials. This enhancement is ascribed to the role of g-C3N4 monolayer as an electron acceptor and the direct Z-scheme charge carrier transfer at the interface of
Directory of Open Access Journals (Sweden)
Suharso Suharso
2010-06-01
Full Text Available The surface topology of borax crystals grown at a relative supersaturation of 0.21 has been investigated using ex situ atomic force microscopy (AFM. It was found that the cleavage of borax crystals along the (010 face planes has features of the cleavage of layered compounds, exhibiting cleavage steps of low heights. The step heights of the cleavage of the (010 face of borax crystal are from one unit cell to three unit cells of this face. Keywords: AFM, cleavage, borax.
Energy Technology Data Exchange (ETDEWEB)
Qiu, X.Y. [School of Minerals Processing and Bioengineering, Central South University, Changsha 410083, Hunan (China); Guangzhou Research Institute of Non-Ferrous Metals, Guangzhou 510651, Guangdong (China); Huang, H.W., E-mail: hhwknight@163.com [School of Minerals Processing and Bioengineering, Central South University, Changsha 410083, Hunan (China); Guangzhou Research Institute of Non-Ferrous Metals, Guangzhou 510651, Guangdong (China); Gao, Y.D. [Guangzhou Research Institute of Non-Ferrous Metals, Guangzhou 510651, Guangdong (China)
2016-03-30
Graphical abstract: - Highlights: • The (010) plane is the easiest one to be seen in wolframite, followed by (001) plane and (100) plane. • (010) and (001) are the primary planes for the absorption of anion collector ions. • W atom can be the absorption site in (001) plane but not in (010) plane. • The proportion of platy particles as well as their perfect cleavage planes increases with the decrease of particle size. • Cleavages occupied by W atom can lead to a low recovery when using BHA alone as the collector of wolframite. - Abstract: The atom distribution and electronic properties of (010), (001) and (100) planes of MnWO{sub 4} and FeWO{sub 4} were studied based on a DFT calculation. The surface stabilities of the three planes were compared according to their surface energies. The most stable one is (010) plane, followed by (001) and (100). (010) and (001) are the main planes for absorption of anion collector ions, which is supported by their bonding relationship and charge density distribution of surface atoms and finally proved by the results of flotation test and stereomicroscope analysis. In addition, the tungsten atoms can be viewed as the absorption site for collectors in (001) plane but not in (010) plane, which can explain the phenomenon in flotation test that the recovery of wolframite can hardly be further boosted even with a high dosage of BHA.
LPCVD homoepitaxy of Si doped β-Ga2O3 thin films on (010) and (001) substrates
Rafique, Subrina; Karim, Md Rezaul; Johnson, Jared M.; Hwang, Jinwoo; Zhao, Hongping
2018-01-01
This paper presents the homoepitaxy of Si-doped β-Ga2O3 thin films on semi-insulating (010) and (001) Ga2O3 substrates via low pressure chemical vapor deposition with a growth rate of ≥1 μm/h. Both high resolution scanning transmission electron microscopy and X-ray diffraction measurements demonstrated high crystalline quality homoepitaxial growth of these thin films. Atomic resolution STEM images of the as-grown β-Ga2O3 thin films on (010) and (001) substrates show high quality material without extended defects or dislocations. The charge carrier transport properties of the as-grown Si-doped β-Ga2O3 thin films were characterized by the temperature dependent Hall measurement using van der Pauw patterns. The room temperature carrier concentrations achieved for the (010) and (001) homoepitaxial thin films were ˜1.2 × 1018 cm-3 and ˜9.5 × 1017 cm-3 with mobilities of ˜72 cm2/V s and ˜42 cm2/V s, respectively.
CRED Gridded Bathymetry of Southeast Maro Reef (100-010) in the Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-010b is a 60-m ASCII grid of depth data collected near SE Maro Reef in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as part...
Al atom on MoO3(010) surface: adsorption and penetration using density functional theory.
Wu, Hong-Zhang; Bandaru, Sateesh; Wang, Da; Liu, Jin; Lau, Woon Ming; Wang, Zhenling; Li, Li-Li
2016-03-14
Interfacial issues, such as the interfacial structure and the interdiffusion of atoms at the interface, are fundamental to the understanding of the ignition and reaction mechanisms of nanothermites. This study employs first-principle density functional theory to model Al/MoO3 by placing an Al adatom onto a unit cell of a MoO3(010) slab, and to probe the initiation of interfacial interactions of Al/MoO3 nanothermite by tracking the adsorption and subsurface-penetration of the Al adatom. The calculations show that the Al adatom can spontaneously go through the topmost atomic plane (TAP) of MoO3(010) and reach the 4-fold hollow adsorption-site located below the TAP, with this subsurface adsorption configuration being the most preferred one among all plausible adsorption configurations. Two other plausible configurations place the Al adatom at two bridge sites located above the TAP of MoO3(010) but the Al adatom can easily penetrate below this TAP to a relatively more stable adsorption configuration, with a small energy barrier of merely 0.2 eV. The evidence of subsurface penetration of Al implies that Al/MoO3 likely has an interface with intermixing of Al, Mo and O atoms. These results provide new insights on the interfacial interactions of Al/MoO3 and the ignition/combustion mechanisms of Al/MoO3 nanothermites.
46 CFR 159.010-17 - Termination of acceptance or recognition of an independent laboratory.
2010-10-01
... (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF EQUIPMENT AND... comply with § 159.010-11; (g) Contracts or transfers the performance or supervision of required..., or in the opinion of the Commandant is unable to, carry out its responsibilities under an MOU...
Atomic-Scale Observations of (010) LiFePO4 Surfaces Before and After Chemical Delithiation.
Kobayashi, Shunsuke; Fisher, Craig A J; Kato, Takeharu; Ukyo, Yoshio; Hirayama, Tsukasa; Ikuhara, Yuichi
2016-09-14
The ability to view directly the surface structures of battery materials with atomic resolution promises to dramatically improve our understanding of lithium (de)intercalation and related processes. Here we report the use of state-of-the-art scanning transmission electron microscopy techniques to probe the (010) surface of commercially important material LiFePO4 and compare the results with theoretical models. The surface structure is noticeably different depending on whether Li ions are present in the topmost surface layer or not. Li ions are also found to migrate back to surface regions from within the crystal relatively quickly after partial delithiation, demonstrating the facile nature of Li transport in the [010] direction. The results are consistent with phase transformation models involving metastable phase formation and relaxation, providing atomic-level insights into these fundamental processes.
Magneto-transport studies on Bi2Te2+xSe1–x (x = 0.05 and 0.10 topological insulators
Directory of Open Access Journals (Sweden)
Bushra Irfan
2016-09-01
Full Text Available Bi2Te2Se is one of the most promising three dimensional topological insulators, for the study of surface states. In this work, we report the results of transport and magneto-transport behavior of Bi2Te2+xSe1–x (x=0.05 and 0.10 single crystals grown using modified Bridgeman technique. Resistance versus temperature measurements show semiconducting behavior for x = 0.05 and 0.10 crystals. Linear magnetoresistance is observed for Bi2Te2.05Se0.95 (i.e. x=0.05 whereas, Bi2Te2.10Se0.90 (x=0.10 single crystal shows a conductance fluctuations at low magnetic field.
Adsorption of ethanol on V2O5 (010) surface for gas-sensing applications: Ab initio investigation
International Nuclear Information System (INIS)
Qin, Yuxiang; Cui, Mengyang; Ye, Zhenhua
2016-01-01
Highlights: • Ethanol adsorbed on V 2 O 5 (010) surface was investigated by ab initio calculations. • Ethanol prefers to adsorb on “Hill”-like surface, rather than“Valley”-like region. • Surface O 1(H) site plays a key role to dominate the ethanol adsorption process. • Sensing mechanism is related with electronic structure and electron redistribution. • Gas sensitivity is reflected by quantitative electron population analysis. - Abstract: The adsorption of ethanol on V 2 O 5 (010) surface was investigated by means of density functional theory (DFT) with a combined generalized gradient approximation (GGA) plus Hubbard U approach to exploit the potential sensing applications. The adsorption configurations were first constructed by considering different orientations of ethanol molecule to V and O sites on the “Hill”- and “Valley”-like regions of corrugated (010) surface. It is found that ethanol molecule can adsorb on whole surface in multiple stable configurations. Nevertheless the molecular adsorption on the “Hill”-like surface is calculated to occur preferentially, and the single coordinated oxygen on “Hill”-like surface (O 1(H) ) acting as the most energetically favorable adsorption site shows the strongest adsorption ability to ethanol molecule. Surface adsorption of ethanol tunes the electronic structure of V 2 O 5 and cause an n-doping effect. As a consequence, the Fermi levels shift toward the conductive bond increasing the charge carrier concentration of electrons in adsorbed V 2 O 5 . The sensitive electronic structure and the multiple stable configurations to ethanol adsorption highlight the high adsorption activity and then the potential of V 2 O 5 (010) surface applied to high sensitive sensor for ethanol vapor detection. Further Mulliken population and Natural bond orbital (NBO) calculations quantify the electron transfer from the adsorbed ethanol to the surface, and correlates the adsorption ability of surface sites
The adsorption and dissociation of water molecule on goethite (010) surface: A DFT approach
Energy Technology Data Exchange (ETDEWEB)
Zhou, Long, E-mail: shuweixia@ouc.edu.cn [Key Laboratory of Marine Chemistry Theory and Technology, Ministry of Education, Ocean University of China, College of Chemistry and Chemical Engineering (China); Xiu, Fangyuan [Key Laboratory of Marine Chemistry Theory and Technology, Ministry of Education, Ocean University of China, College of Chemistry and Chemical Engineering (China); Qiu, Meng [Qingdao Institute of Bioenergy and Bioprocess Technology (China); Xia, Shuwei; Yu, Liangmin [Key Laboratory of Marine Chemistry Theory and Technology, Ministry of Education, Ocean University of China, College of Chemistry and Chemical Engineering (China)
2017-01-15
Graphical abstract: The optimized structure of hydrated goethite (010) surface with medium water coverage (water density about 6.7 H{sub 2}O/nm{sup 2}). - Highlights: • Stable adsorption and dissociation structure of H{sub 2}O on goethite (010) surface was investigated by DFT. • Reasonable path for water dissociation was proposed by transitional state analysis. • The mechanism of water adsorption on goethite and binding nature were revealed by PDOS. - Abstract: Using density functional theory (DFT) calculation, we investigate the configuration, stability and electronic properties of fresh cleaved (010) goethite surface (Pnma) and this surface exposed to water monolayer at low, medium and high coverage. Water is predicted to be chemisorbed to the surface, together with the surface reconstruction. The interaction energy of the most stable configuration of both low and medium coverage per water molecule is almost the same (−1.17 eV), while that of high coverage is much lower (less than 1.03 eV). It indicates that highly hydrated surface is less stable. PDOS analysis reveals the adsorption of H{sub 2}O is due to the formation of Fe−O bond, caused by overlapping of Fe's 3d and O's 2p orbitals. Dissociation processes at low and medium water coverage are non-spontaneous; while at high coverage, it can undertake spontaneously both thermodynamically and dynamically. The dissociation paths of all three water coverage are the similar. The proton from one adsorbed water is likely to dissociate to bind to the vicinal surface μ{sub 3}−O as an intermediate product; the proton belonged to μ{sub 3}−O transferred to the neighbor surface μ{sub 2}−O as the dissociative configuration.
National Oceanic and Atmospheric Administration, Department of Commerce — The Global Forecast System (GFS) forecast 0-10cm soil-moisture data at 37.5km resolution is created at the NOAA Climate Prediction Center for the purpose of near...
2010-01-05
... 1974; United States Citizenship and Immigration Services--010 Asylum Information and Pre-Screening... system of records to the Department of Homeland Security's inventory, entitled Unites States Citizenship... Citizenship and Immigration Services (202-272-1663), 20 Massachusetts Avenue, NW., 3rd Floor, Washington, DC...
Energy Technology Data Exchange (ETDEWEB)
Li, Junqi, E-mail: sfmlab@163.com; Zhou, Jian; Hao, Hongjuan; Li, Weijie
2017-03-31
Highlights: • Z-scheme system and n-n heterogeneous were constructed on the (010) and (110) facet. • The n-n-Z system realizes the wide absorption range, high charge-separation and strong redox ability. • The PEC performance of the Fe{sub 2}O{sub 3} modified Ag-BiVO{sub 4} was enhanced than that of the pure BiVO{sub 4}. - Abstract: Crystal facet dependence is an important approach for optimizing the performance of photocatalyst. In consideration that there is a close correlation between the photoelectric conversion efficiencies and crystal facet, the monoclinic bismuth vanadate (m-BiVO{sub 4}) with (010) and (110) crystal facets has drawn attention. We designed the Ag nanoparticles modified the (010) facet of the BiVO{sub 4} (Ag-{sub 010}BiVO{sub 4}) and then the Ag-{sub 010}BiVO{sub 4} heterogeneous nanostructure was modified by the Fe{sub 2}O{sub 3} nanoparticles. In the Fe{sub 2}O{sub 3} modified Ag-{sub 010}BiVO{sub 4}, the (110) facet of the BiVO{sub 4} was only modified by the Fe{sub 2}O{sub 3} nano-particles to construct the n-n heterojunction structure. Simultaneously, the Z-scheme system was fabricated on the (010) facet of the BiVO{sub 4}, where was modified by the Ag and Fe{sub 2}O{sub 3} nano-particles. We investigated its photoelectrochemical (PEC) and photocatalytic activities by the measurement of the electrochemical performance and degradation of methyl orange (MO). The Ag species in the system is only treated as the solid state electron mediator. As was expected, the Fe{sub 2}O{sub 3} modified Ag-{sub 010}BiVO{sub 4} heterojunction structure exhibited the highest photocurrent density and the smallest impedance. Besides, the Fe{sub 2}O{sub 3} modified Ag-{sub 010}BiVO{sub 4} heterojunction structure exhibited excellent redox ability and the MO could be degraded 92% after 150 min. It is worth noting that the outstanding performance should be attributed to the synergistic effect of n-n and Z-scheme system in the different facets, which
Study I: effects of 0.06% and 0.10% blood alcohol concentration on human postural control.
Modig, F; Patel, M; Magnusson, M; Fransson, P A
2012-03-01
Alcohol intoxication causes many accidental falls presented at emergency departments, with the injury severity often related to level of blood alcohol concentration (BAC). One way to evaluate the decline in postural control and the fall risk is to assess standing stability when challenged. The study objective was to comprehensively investigate alcohol-related impairments on postural control and adaptive motor learning at specific BAC levels. Effects of alcohol intoxication at 0.06% and 0.10% BAC were examined with posturography when unperturbed or perturbed by calf vibration. Twenty-five participants (mean age 25.1 years) were investigated standing with either eyes open or closed. Our results revealed several significant findings: (1) stability declined much faster from alcohol intoxication between 0.06% and 0.10% BAC (60-140%) compared with between 0.0% and 0.06% BAC (30%); (2) sustained exposure to repeated balance perturbations augmented the alcohol-related destabilization; (3) there were stronger effects of alcohol intoxication on stability in lateral direction than in anteroposterior direction; and (4) there was a gradual degradation of postural control particularly in lateral direction when the balance perturbations were repeated at 0.06% and 0.10% BAC, indicating adaptation deficits when intoxicated. To summarize, alcohol has profound deteriorating effects on human postural control, which are dose dependent, time dependent and direction specific. The maximal effects of alcohol intoxication on physiological performance might not be evident initially, but may be revealed first when under sustained sensory-motor challenges. Copyright © 2011 Elsevier B.V. All rights reserved.
GROWTH RATE DISPERSION (GRD OF THE (010 FACE OF BORAX CRYSTALS IN FLOWING SOLUTION
Directory of Open Access Journals (Sweden)
Suharso Suharso
2010-06-01
Full Text Available The growth rates of borax crystals from aqueous solutions in the (010 direction at various flow rates were measured. The observed variations of the growth rate can be represented by a normal distribution. It was found that there is no correlation between growth rate distribution and solution flow under these experimental conditions. Keywords: Growth rate dispersion (GRD, borax, flow rate
Derivation of the human embryonic stem cell line RCe010-A (RC-6
Directory of Open Access Journals (Sweden)
P.A. De Sousa
2016-03-01
Full Text Available The human embryonic stem cell line RCe010-A (RC-6 was derived from a frozen and thawed blastocyst voluntarily donated as unsuitable and surplus to fertility requirements following ethics committee approved informed consent under licence from the UK Human Fertilisation and Embryology Authority. The cell line shows normal pluripotency marker expression and differentiation to the three germ layers in vitro. It has a normal 46XY male karyotype and microsatellite PCR identity, HLA and blood group typing data are available.
Tabbers, Merit M.; Chmielewska, Ania; Roseboom, Maaike G.; Crastes, Nolwenn; Perrin, Catherine; Reitsma, Johannes B.; Norbruis, Obbe; Szajewska, Hania; Benninga, Marc A.
2011-01-01
BACKGROUND: Constipation is a frustrating symptom affecting 3% of children worldwide. A fermented dairy product containing Bifidobacterium lactis strain DN-173 010 was effective in increasing stool frequency in constipated women. Our aim was to assess the effects of this product in constipated
700 TWh dry gas for NOK 0,10 per kWh
International Nuclear Information System (INIS)
2003-01-01
In 2002, Norway exported natural gas corresponding to a heat value of 700 TWh. The article looks at what energy price the big gas customers on the continent and in Great Britain really paid for the Norwegian gas. The average price to the wholesale dealer was NOK 0,10/kWh. However, the wholesale dealers quadruple the price out to the end-users. It is also found that if the gas was made available on the home market, then the Norwegian gas distributors would be able to compete on price with the foreign distributors. This fact along with the extreme price on electricity in the winter 2003 gives an impetus to the debate that goes on in Norway on whether or not to build gas power plants
DEFF Research Database (Denmark)
Schou, Morten; Torp-Pedersen, Christian; Gustafsson, Finn
2008-01-01
screening registers (N=18,010) including patients admitted with HF or MI. Ten years follow-up was recorded and formal testing for interactions between eGFR and LVEF with respect to outcome was done. RESULTS: Twelve-thousand-and-ninety patients died. A significant interaction (P=0.010) was found and each...
Tang, Fan; Zhou, Xinhua; Wang, Liang; Shan, Luchen; Li, Chuwen; Zhou, Hefeng; Lee, Simon Ming-Yuen; Hoi, Maggie Pui-Man
2018-02-05
Doxorubicin (Dox) is an effective anti-cancer agent but limited by its cardiotoxicity, thus the search for pharmacological agents for enhancing anti-cancer activities and protecting against cardiotoxicity has been a subject of great interest. We have previously reported the synergistic anti-cancer effects of a novel compound DT-010. In the present study, we further investigated the cardioprotective effects of DT-010 in zebrafish embryos in vivo and the molecular underlying mechanisms in H9c2 cardiomyocytes in vitro. We showed that DT-010 prevented the Dox-induced morphological distortions in the zebrafish heart and the associated cardiac impairments, and especially improved ventricular functions. By using H9c2 cells model, we showed that DT-010 directly inhibited the generation of reactive oxygen species by Dox and protected cell death and cellular damage. We further observed that DT-010 protected against Dox-induced myocardiopathy via inhibiting downstream molecular pathways in response to oxidative stress, including reactive oxygen species-mediated MAPK signaling pathways ERK and JNK, and apoptotic pathways involving the activation of caspase 3, caspase 7, and PARP signaling. Recent studies also suggest the importance of alterations in cardiac autophagy in Dox cardiotoxicity. We further showed that DT-010 could inhibit the induction of autophagosomes formation by Dox via regulating the upstream Akt/AMPK/mTOR signaling. Since Dox-induced cardiotoxicity is multifactorial, our results suggest that multi-functional agent such as DT-010 might be an effective therapeutic agent for combating cardiotoxicity associated with chemotherapeutic agents such as Dox. Copyright © 2017 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Qin, Yuxiang, E-mail: qinyuxiang@tju.edu.cn [School of Electronics and Information Engineering, Tianjin University, Tianjin 300072 (China); Key Laboratory for Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Cui, Mengyang; Ye, Zhenhua [School of Electronics and Information Engineering, Tianjin University, Tianjin 300072 (China)
2016-08-30
Highlights: • Ethanol adsorbed on V{sub 2}O{sub 5} (010) surface was investigated by ab initio calculations. • Ethanol prefers to adsorb on “Hill”-like surface, rather than“Valley”-like region. • Surface O{sub 1(H)} site plays a key role to dominate the ethanol adsorption process. • Sensing mechanism is related with electronic structure and electron redistribution. • Gas sensitivity is reflected by quantitative electron population analysis. - Abstract: The adsorption of ethanol on V{sub 2}O{sub 5} (010) surface was investigated by means of density functional theory (DFT) with a combined generalized gradient approximation (GGA) plus Hubbard U approach to exploit the potential sensing applications. The adsorption configurations were first constructed by considering different orientations of ethanol molecule to V and O sites on the “Hill”- and “Valley”-like regions of corrugated (010) surface. It is found that ethanol molecule can adsorb on whole surface in multiple stable configurations. Nevertheless the molecular adsorption on the “Hill”-like surface is calculated to occur preferentially, and the single coordinated oxygen on “Hill”-like surface (O{sub 1(H)}) acting as the most energetically favorable adsorption site shows the strongest adsorption ability to ethanol molecule. Surface adsorption of ethanol tunes the electronic structure of V{sub 2}O{sub 5} and cause an n-doping effect. As a consequence, the Fermi levels shift toward the conductive bond increasing the charge carrier concentration of electrons in adsorbed V{sub 2}O{sub 5}. The sensitive electronic structure and the multiple stable configurations to ethanol adsorption highlight the high adsorption activity and then the potential of V{sub 2}O{sub 5} (010) surface applied to high sensitive sensor for ethanol vapor detection. Further Mulliken population and Natural bond orbital (NBO) calculations quantify the electron transfer from the adsorbed ethanol to the surface, and
Genome-wide Analysis of Insomnia (N=1,331,010) Identifies Novel Loci and Functional Pathways
De Leeuw, Chrstiaan; Bryois, Julien; Skene, Nathan; Stringer, Sven; Watanabe, Kyoko; Jansen, Philip; Nagel, Mats; Savage, Jeanne; Tiemeier, Henning; White, Tonya; Tung, Joyce; Hinds, David; Vacic, Vladimir; Sullivan, Patrick; Van Der Sluis, Sophie
2018-01-01
Insomnia is the second-most prevalent mental disorder, with no sufficient treatment available. Despite a substantial role of genetic factors, only a handful of genes have been implicated and insight into the associated neurobiological pathways remains limited. Here, we use an unprecedented large genetic association sample (N=1,331,010) to allow detection of a substantial number of genetic variants and gain insight into biological functions, cell types and tissues involved in insomnia. We iden...
About thermal properties of TIIn1-xNdxS2 (0≤X≤0.10) solid solutions
International Nuclear Information System (INIS)
Zarbaliev, M.M.; Agaeva, U.M.; Sardarova, N.S.
2013-01-01
This report is devoted to investigation of thermal expansion and thermal conductivity of TIIn 1 -xNd x S 2 (0≤X≤0.10) solid solutions, depending on the concentration and temperature at 80-450 K. The measurements were carried out on the thermal expansion of polycrystalline, and the thermal conductivity of single-crystal samples
International Nuclear Information System (INIS)
Xiao-Zhi, Wu; Shao-Feng, Wang; Rui-Ping, Liu
2009-01-01
Dislocations are thought to be the principal mechanism of high ductility of the novel B2 structure intermetallic compounds YAg and YCu. In this paper, the edge dislocation core structures of two primary slip systems {010} and {011-bar 1} for YAg and YCu are presented theoretically within the lattice theory of dislocation. The governing dislocation equation is a nonlinear integro-differential equation and the variational method is applied to solve the equation. Peierls stresses for {010} and {011-bar 1} slip systems are calculated taking into consideration the contribution of the elastic strain energy. The core width and Peierls stress of a typical transition-metal aluminide NiAl is also reported for the purpose of verification and comparison. The Peierls stress of NiAl obtained here is in agreement with numerical results, which verifies the correctness of the results obtained for YAg and YCu. Peierls stresses of the {011-bar 1} slip system are smaller than those of {010} for the same intermetallic compounds originating from the smaller unstable stacking fault energy. The obvious high unstable stacking fault energy of NiAl results in a larger Peierls stress than those of YAg and YCu although they have the same B2 structure. The results show that the core structure and Peierls stress depend monotonically on the unstable stacking fault energy. (condensed matter: structure, thermal and mechanical properties)
Chen, Lai; Su, Yuefeng; Chen, Shi; Li, Ning; Bao, Liying; Li, Weikang; Wang, Zhao; Wang, Meng; Wu, Feng
2014-10-22
Hierarchical Li1.2 Ni0.2 Mn0.6 O2 nanoplates with exposed {010} planes are designed and synthesized. In combination with the advantages from the hierarchical archi-tecture and the exposed electrochemically active {010} planes of layered materials, this material satisfies both efficient ion and electron transport and thus shows superior rate capability and excellent cycling stability. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Directory of Open Access Journals (Sweden)
N. Kenters
2017-06-01
Full Text Available Abstract Background In healthcare facilities, Clostridium difficile infections spread by transmission of bacterial spores. Appropriate sporicidal disinfectants are needed to prevent development of clusters and outbreaks. In this study different cleaning/disinfecting wipes and sprays were tested for their efficacy against spores of distinctive C. difficile PCR ribotypes. Methods Four different products were tested; 1 hydrogen peroxide 1.5%; 2 glucoprotamin 1.5%; 3 a mixture of ethanol, propane and N-alkyl amino propyl glycine; and 4 a mixture of didecyldimonium chloride, benzalkonium chloride, polyaminopropyl, biguanide and dimenthicone as active ingredients. Tiles were contaminated with a test solution containing a concentration of 5x106CFU/ml spores of C. difficile strains belonging to PCR ribotypes 010, 014 or 027. The tiles were left to dry for an hour and then wiped or sprayed with one of the sprays or wipes as intended by the manufacturers. When products neutralized after 5 min, microbiological cultures and ATP measures were performed. Results Irrespective of the disinfection method, the microbial count log10 reduction of C. difficile PCR ribotype 010 was highest, followed by the reduction of C. difficile 014 and C. difficile 027. Overall, the wipes performed better than the sprays with the same active ingredient. On average, although not significantly, a difference in relative light units (RLU reduction between the wipes and sprays was found. The wipes had a higher RLU log10 reduction, but no significant difference for RLU reduction was observed between the different C. difficile strains (p = 0.16. Conclusion C. difficile spores of PCR ribotypes 014 and 027 strains are more difficult to eradicate than non-toxigenic PCR ribotype 010. In general, impregnated cleaning/disinfection wipes performed better than ready-to-use sprays. Wipes with hydrogen peroxide (1.5% showed the highest bactericidal activity.
2017-12-04
Depths (e.g., surface, subsurface - minimal coverage, buried). (4) Road Types: (a) Primary roads - all weather, hard surface highways (e.g...asphalt, etc.) (b) Secondary roads - all weather, loose surface highways (e.g., compacted gravel, compacted dirt, etc.) TOP 04-1-010 4...adequate maintenance support for the MRS and PMs, or have the SUT Field Service Representative(s) on site to perform any needed maintenance actions
Energy Technology Data Exchange (ETDEWEB)
Zhang, Jin Na [College of Chemistry and Materials Science, Liaoning University of Petroleum and Chemical Technology, Fushun 113001 (China); State Key Laboratory of Catalysis, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian 116023 (China); Lu, Hui, E-mail: huilu@dicp.ac.cn [Greenhouse Gas Research Center, Climate Change Technology Research Division, Korea Institute of Energy Research, Daejeon 305-343 (Korea, Republic of); State Key Laboratory of Catalysis, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian 116023 (China); Gui, Jian Zhou [College of Chemistry and Materials Science, Liaoning University of Petroleum and Chemical Technology, Fushun 113001 (China); Kim, Jong Pyo; Son, Sou Hwan [Greenhouse Gas Research Center, Climate Change Technology Research Division, Korea Institute of Energy Research, Daejeon 305-343 (Korea, Republic of); Park, Jung Hoon, E-mail: pjhoon@kier.re.kr [Greenhouse Gas Research Center, Climate Change Technology Research Division, Korea Institute of Energy Research, Daejeon 305-343 (Korea, Republic of)
2013-04-20
Highlights: ► The novel Fe/Nb co-substituted SrCo{sub 1−2x}(Fe,Nb){sub x}O{sub 3−δ} (x = 0.05, 0.10) oxides were characterized by the XRD, DSC, TG and SEM–EDS. ► The high structural stability of the co-substituted SrCo{sub 1−2x}(Fe,Nb){sub x}O{sub 3−δ} (x = 0.05, 0.10) oxides. ► The excellent oxygen permeation performance of the co-substituted SrCo{sub 1−2x}(Fe,Nb){sub x}O{sub 3−δ} (x = 0.10) membrane. -- Abstract: The novel Fe/Nb co-substituted SrCo{sub 1−2x}(Fe,Nb){sub x}O{sub 3−δ} (x = 0.05, 0.10) oxides have been synthesized and characterized by X-ray diffraction (XRD), differential scanning calorimetry (DSC), thermogravimetry (TG), and scanning electron microscopy (SEM). The XRD and DSC results demonstrate that the structural stability of the Fe/Nb co-substituted samples x = 0.05, 0.10 is improved greatly compared to the sample x = 0.00. The Fe/Nb co-doping in the SrCoO{sub 3−δ} oxide results in the improved structural stability of the SrCo{sub 1−2x}(Fe,Nb){sub x}O{sub 3−δ} (x = 0.05, 0.10) oxides. The nonstoichiometric and sintering properties were investigated by TG and SEM, and the oxygen permeation fluxes were measured at 800–950 °C for the sample x = 0.10. The improved oxygen permeability of the ceramic SrCo{sub 1−2x}(Fe,Nb){sub x}O{sub 3−δ} (x = 0.10) membrane compared to the (Ba{sub 0.5}Sr{sub 0.5})(Co{sub 0.8}Fe{sub 0.2})O{sub 3−δ} and SrCo{sub 0.8}Fe{sub 0.2}O{sub 3–δ} membranes, was observed under an air/He oxygen partial pressure gradient at 800–950 °C.
Ibrahim, Fady; Sivak, Olena; Wasan, Ellen K; Bartlett, Karen; Wasan, Kishor M
2013-10-29
An oral lipid based formulation that exhibits tropical stability (iCo-010) was developed to enhance the absorption of orally administered amphotericin B (AmB). iCo-010 has previously shown high efficacy in an acute model of systemic candidiasis in rats, directing the focus of this study to be its efficacy in a chronic model of systemic candidiasis in mice. Mice were infected with 0.6 to 1×108 CFUs of Candida albicans ATCC 18804 strain by tail vein injection and were left for three days to develop the infection after which time treatment was initiated. The infected animals were assigned to the following treatment groups: no treatment (control) or iCo-010 at 5, 10 and 20 mg/kg administered by oral gavage once daily (QD) for 5 consecutive days. The animals were sacrificed 7 days after the last dose and the concentration of AmB and the fungal burden were assessed within the liver, kidneys, heart, lungs, spleen and brain. Although the infection was relatively low (~ 60-100 CFUs/ 1 ml tissue homogenate) in the liver, lungs and heart, the infection level was very high (70 000 CFUs / 1 ml tissue homogenate) in the kidney tissues for the control group. The highest concentrations of AmB were recovered in the kidneys and the spleen. The fungal burden in the tissues was lowered by 69-96% in the treatment groups when compared to the control group. Oral iCo-010 is an effective treatment of systemic candidiasis in the mouse model.
Broadening of the magnetic entropy change in La0.75Ca0.15Sr0.10MnO3
DEFF Research Database (Denmark)
Krishnan Venkatesh, Radha; Kuhn, Luise Theil; Pryds, Nini
2012-01-01
A broad table-like entropy change (ΔS) at room temperature has been observed in the ferromagnetic compound La0.75Ca0.15Sr0.10MnO3, which is analyzed in the concept of Landau theory and with critical exponent analysis obtained from the magnetization measurements. The change in entropy in La0.75Ca0...
Adsorption and dehydrogenation of ammonia at the V{sub 2}O{sub 5}(010) surface: DFT cluster studies
Energy Technology Data Exchange (ETDEWEB)
Gruber, Mathis; Hermann, Klaus [Fritz-Haber-Institut der MPG, Berlin (Germany)
2008-07-01
Transition metal oxide catalysts are widely used for selective oxidation reactions. However, in many cases details of the catalytic reaction mechanisms are still under discussion. One prominent example is the ammoxidation of propylene to acrylonitrile at transition metal oxide surfaces (SOHIO process). This catalytic reaction includes, amongst other steps, the adsorption and dehydrogenation of NH{sub x}, x<4, at the catalyst surface. We have performed theoretical studies on these reaction steps where the catalyst is simulated by a finite section of the V{sub 2}O{sub 5}(010) surface. The calculations use density-functional theory combined with clusters modeling the surface and adsorbate system. Calculations for the clean V{sub 2}O{sub 5}(010) surface show that binding energies of the H atom are always significantly larger than of the NH{sub x} species. Further, the substrate is found to lower corresponding dehydrogenation energies compared with values for the gas phase reaction. However, the lowering is too small to make dehydrogenation likely to happen under ammoxidation reaction conditions. This suggests that surface defects such as oxygen vacancies become important for the reaction. Therefore, the role of oxygen vacancies for the dehydrogenation of NH{sub x} is discussed in detail.
Li, Jili; Yao, Ruimin; Cao, Chuanbao
2014-04-09
As we know, Li(+)-ion transport in layered LiNi1/3Co1/3Mn1/3O2 (NCM) is through two-dimensional channels parallel to the Li(+)-ion layers that are indexed as {010} active planes. In this paper, NCM nanoplates with exposed {010} active facets are synthesized in a polyol medium (ethylene glycol) and characterized by XRD, XPS, SEM, and HR-TEM. In addition, the effects of reaction conditions on the morphologies, structures and electrochemical performances are also evaluated. The results show that more {010} facets can be exposed with the thickness of NCM nanoplates increasing which can lead to more channels for Li(+)-ion migration. However, when the annealing temperatures exceed 900 °C, many new crystal planes grow along the thickness direction covering the {010} facets. In all of the NCM nanoplates obtained at different conditions, the NCM nanoplates calcined at 850 °C for 12 h (NCM-850-12H) display a high initial discharge capacity of 207.6 mAh g(-1) at 0.1 C (1 C = 200 mA g(-1)) between 2.5 and 4.5 V higher than most of NCM materials as cathodes for lithium ion batteries. The discharge capacities of NCM-850-12H are 169.8, 160.5, and 149.3 mAh g(-1) at 2, 5, and 7 C, respectively, illustrating the excellent rate capability. The superior electrochemical performance of NCM-850-12H cathode can be attributed to more {010} active planes exposure.
International Nuclear Information System (INIS)
Kubik, Peter W.; Ivy-Ochs, Susan
2004-01-01
The sea level, high latitude 10 Be production rate for exposure dating obtained from the giant 9.8 ka landslide of Koefels (Austria) has been calculated based on a re-assessment of the contribution of the muonic cosmic ray component. The 0-10 ka production rate value is 5.44 ± 0.19 10 Be atoms/y g quartz
W.H. Oldenmenger (Wendy); P.J. de Raaf (Pleun); C. de Klerk (Cora); C.C.D. van der Rijt (Carin)
2013-01-01
textabstractContext: To improve the management of cancer-related symptoms, systematic screening is necessary, often performed by using 0-10 numeric rating scales. Cut points are used to determine if scores represent clinically relevant burden. Objectives: The aim of this systematic review was to
Origin of 6-fold coordinated aluminum at (010-type pyrophyllite edges
Directory of Open Access Journals (Sweden)
M. Okumura
2017-05-01
Full Text Available To better understand the aqueous chemical reactivity of clay mineral edges we explored the relationships between hydration and the structure of (010-type edges of pyrophyllite. In particular, we used density functional theory and the quantum theory of atoms in molecules to evaluate the stability of 6-fold coordinated hydrated aluminum at the edge in terms of the electron density distribution. Geometrical optimization revealed an intra-edge hydrogen bond network between aluminol hydroxyls and water ligands completing the aluminum coordination shell. From the electron density isosurfaces one water ligand is not covalently bonded to aluminum. Bader charge analysis revealed that OH2 ligands have small negative charge. In addition, it is also found that the charge of the 6-fold coordinated aluminum is larger than one of the 5-fold aluminum. From these results, the charging of the OH2 ligands is interpreted as charge transfer originated from the formation of the hydrogen bond network and not from Al-OH2 interaction per se. This suggests that the weakly bound water ligand in question, and more generally 6-fold hydrated edge Al coordination, is stabilized primarily by the hydrogen bond network which in turn leads to weak ionic attraction to the aluminum center itself. The finding highlights the importance of cooperative effects between solvent structure and the coordination of metal cations exposed at clay mineral edges.
Effect of Ca2+ Ions on Electrical Properties of Ba1-x Ca x Ti0.90Sn0.10O3-0.05Y2O3 Ceramics
Chen, Zhi-hui; Li, Zhi-wei; Ding, Jian-ning; Zhao, Tian-xiang; Qiu, Jian-hua; Zhu, Ke-qian; Xu, Jiu-jun; Zhang, Bing
2018-03-01
Ba1-x Ca x Ti0.90Sn0.10O3-0.05Y2O3 (BCTSY) lead-free piezoceramics with x = 0.02 to 0.10 have been fabricated by solid-state sintering method at 1420°C. The effects of Ca2+ ions on the microstructure and electrical properties of the samples were studied. X-ray diffraction analysis showed that all samples possessed pure perovskite structure with Ca2+ ions diffused into the matrix lattice. The rhombohedral phase and tetragonal phase coexisted in the composition range of 0.02 ceramic became more homogeneous with addition of Ca2+ ions, and the average grain size of the samples decreased from 97 μm (x = 0.02) to 18 μm (x = 0.10). Addition of Ca2+ remarkably improved the piezoelectric properties, enhanced the dielectric frequency dispersion, and increased the Curie temperature of the ceramics. The piezoelectric properties of the ceramics were optimized at x = 0.04 with d 33 and K p values of 579 pC/N and 52.7%, respectively.
Rovibrational bound states of SO2 isotopologues. I: Total angular momentum J = 0-10
Kumar, Praveen; Ellis, Joseph; Poirier, Bill
2015-04-01
Isotopic variation of the rovibrational bound states of SO2 for the four stable sulfur isotopes 32-34,36S is investigated in comprehensive detail. In a two-part series, we compute the low-lying energy levels for all values of total angular momentum in the range J = 0-20. All rovibrational levels are computed, to an extremely high level of numerical convergence. The calculations have been carried out using the ScalIT suite of parallel codes. The present study (Paper I) examines the J = 0-10 rovibrational levels, providing unambiguous symmetry and rovibrational label assignments for each computed state. The calculated vibrational energy levels exhibit very good agreement with previously reported experimental and theoretical data. Rovibrational energy levels, calculated without any Coriolis approximations, are reported here for the first time. Among other potential ramifications, this data will facilitate understanding of the origin of mass-independent fractionation of sulfur isotopes in the Archean rock record-of great relevance for understanding the "oxygen revolution".
Energy Technology Data Exchange (ETDEWEB)
Mamor, M; Sellai, A; Bouziane, K; Harthi, S H Al; Busaidi, M Al; Gard, F S [Physics Department, Sultan Qaboos University, PO Box 36 Muscat 123, Sultanate of (Oman)
2007-03-07
Current-voltage (I-V) and capacitance-voltage (C-V) characteristics of He-ion irradiated Pd/n-Si{sub 09}Ge{sub 0.10} Schottky contacts have been measured in the temperature range from 100 to 300 K. Schottky barrier properties such as the Schottky barrier height ({phi}{sub bn}) and ideality factor (n) have been studied as a function of temperature. The degree to which their characteristics deviated from the ideal case increased as the temperature decreased. A decrease in {phi}{sub bn} and an increase in n with decreasing temperature are observed. Additionally, linear dependence between the so-called temperature factor T{sub 0} and temperature as well as between {phi}{sub bn} and n are shown. This type of strong temperature dependence indicates the presence of a large degree of lateral inhomogeneities of the barrier height, resulting from the He-ion irradiation induced defects and traps which produce a variation in the number of free carriers. The presence of electrically active defects introduced by He-ion irradiation at and below the Si{sub 0.90}Ge{sub 0.10} surface support this interpretation.
Su, Yuefeng; Chen, Gang; Chen, Lai; Li, Weikang; Zhang, Qiyu; Yang, Zhiru; Lu, Yun; Bao, Liying; Tan, Jing; Chen, Renjie; Chen, Shi; Wu, Feng
2018-02-21
A modified Ni-rich Li[Ni 0.8 Co 0.1 Mn 0.1 ]O 2 cathode material with exposed {010} planes is successfully synthesized for lithium-ion batteries. The scanning electron microscopy images have demonstrated that by tuning the ammonia concentration during the synthesis of precursors, the primary nanosheets could be successfully stacked along the [001] crystal axis predominantly, self-assembling like multilayers. According to the high-resolution transmission electron microscopy results, such a morphology benefits the growth of the {010} active planes of final layered cathodes during calcination treatment, resulting in the increased area of the exposed {010} active planes, a well-ordered layer structure, and a lower cation mixing disorder. The Li-ion diffusion coefficient has also been improved after the modification based on the results of potentiostatic intermittent titration technique. As a consequence, the modified Li[Ni 0.8 Co 0.1 Mn 0.1 ]O 2 material exhibits superior initial discharges of 201.6 mA h g -1 at 0.2 C and 185.7 mA h g -1 at 1 C within 2.8-4.3 V (vs Li + /Li), and their capacity retentions after 100 cycles reach 90 and 90.6%, respectively. The capacity at 10 C also increases from 98.3 to 146.5 mA h g -1 after the modification. Our work proposes a novel approach for exposing high-energy {010} active planes of the layered cathode material and again confirms its validity in improving electrochemical properties.
African Journals Online (AJOL)
Worldwide an estimated 8.1 million children die each year before they reach their 5th birthday, and. 99% of these deaths are in the developing world.[1-2]. Malnutrition is associated with more than 50% of these deaths,[3-4] and is therefore an important risk factor for the burden of disease in developing countries.[5]. Hospital ...
International Nuclear Information System (INIS)
Lonkhuyzen, R.A. Van
1995-11-01
The US Department of Energy (DOE) proposes to excavate contaminated soil at Vicinity Property 9 (VP9), a 0.64-ha (1.6-acre) parcel near the Weldon Spring Site in Missouri. A palustrine wetland approximately 0.10 ha (0.25 acre) in size within VP9 would be excavated. Site restoration should allow palustrine wetland to become reestablished. No long-term impacts to floodplains are expected
Proteomic and metabolomic profiles of marine Vibrio sp. 010 in response to an antifoulant challenge
Chandramouli, Kondethimmanahalli; Dash, Swagatika; Zhang, Yu; Ravasi, Timothy; Qian, Peiyuan
2013-01-01
Vibrio spp. have the ability to form biofilms, which may contribute to the subsequent successful colonization by microfouling and macrofouling organisms. The effects of an antifouling compound, poly-ether B, on Vibrio sp. 010 were investigated using flow cytometry, proteomics, and metabolomics. A 2-D gel-based proteomic analysis was used to identify proteins responsive to poly-ether B treatment. The profiles of biofilm metabolites were analyzed by ultra-performance liquid chromatography-mass spectrometry. Poly-ether B caused a significant reduction in viability. The proteins affected by the treatment were related to nucleotide metabolism, the glyoxylate cycle, and stress responses. Metabolites such as tripeptides, fatty acids, and quorum-sensing molecules were regulated differentially. Down-regulation of proteins and metabolites potentially led to a loss in colonisation ability, thereby affecting the structure of the biofilm. These results suggest that the proteins and metabolites identified may serve as target molecules for potent antifouling compounds. © 2013 Copyright Taylor and Francis Group, LLC.
Proteomic and metabolomic profiles of marine Vibrio sp. 010 in response to an antifoulant challenge
Chandramouli, Kondethimmanahalli
2013-08-01
Vibrio spp. have the ability to form biofilms, which may contribute to the subsequent successful colonization by microfouling and macrofouling organisms. The effects of an antifouling compound, poly-ether B, on Vibrio sp. 010 were investigated using flow cytometry, proteomics, and metabolomics. A 2-D gel-based proteomic analysis was used to identify proteins responsive to poly-ether B treatment. The profiles of biofilm metabolites were analyzed by ultra-performance liquid chromatography-mass spectrometry. Poly-ether B caused a significant reduction in viability. The proteins affected by the treatment were related to nucleotide metabolism, the glyoxylate cycle, and stress responses. Metabolites such as tripeptides, fatty acids, and quorum-sensing molecules were regulated differentially. Down-regulation of proteins and metabolites potentially led to a loss in colonisation ability, thereby affecting the structure of the biofilm. These results suggest that the proteins and metabolites identified may serve as target molecules for potent antifouling compounds. © 2013 Copyright Taylor and Francis Group, LLC.
Room temperature ferromagnetism of nanocrystalline Nd1.90Ni0.10O3-δ
Sarkar, B. J.; Mandal, J.; Dalal, M.; Bandyopadhyay, A.; Chakrabarti, P. K.
2018-05-01
Nanocrystalline sample of Ni2+ doped neodymium oxide (Nd1.90Ni0.10O3-δ, NNO) is synthesized by co-precipitation method. Analysis of X-ray diffraction (XRD) pattern by Rietveld refinement method confirms the desired phase of NNO and complete substitution of Ni2+ ions in the Nd2O3 lattice. Analyses of transmission electron microscopy (TEM) and Raman spectroscopy of NNO recorded at room temperature (RT) also substantiate this fact. Besides, no traces of impurities are found in the analyses of XRD, TEM and Raman data. Room temperature hysteresis loop of NNO suggests the presence of weak ferromagnetism (FM) in low field region ( 600 mT), but in high field region paramagnetism of the host is more prominent. Magnetization vs. temperature ( M- T) curve in the entire temperature range (300-5 K) is analyzed successfully by a combined equation generated from three-dimensional (3D) spin wave model and Curie-Weiss law, which suggests the presence of mixed paramagnetic phase together with ferromagnetic phase in the doped sample. The onset of magnetic ordering is analyzed by oxygen vacancy mediated F-center exchange (FCE) coupling mechanism.
Hierarchical LiFePO4 with a controllable growth of the (010) facet for lithium-ion batteries.
Guo, Binbin; Ruan, Hongcheng; Zheng, Cheng; Fei, Hailong; Wei, Mingdeng
2013-09-27
Hierarchically structured LiFePO4 was successfully synthesized by ionic liquid solvothermal method. These hierarchically structured LiFePO4 samples were constructed from nanostructured platelets with their (010) facets mainly exposed. To the best of our knowledge, facet control of a hierarchical LiFePO4 crystal has not been reported yet. Based on a series of experimental results, a tentative mechanism for the formation of these hierarchical structures was proposed. After these hierarchically structured LiFePO4 samples were coated with a thin carbon layer and used as cathode materials for lithium-ion batteries, they exhibited excellent high-rate discharge capability and cycling stability. For instance, a capacity of 95% can be maintained for the LiFePO4 sample at a rate as high as 20 C, even after 1000 cycles.
Tabbers, Merit M; Chmielewska, Ania; Roseboom, Maaike G; Boudet, Claire; Perrin, Catherine; Szajewska, Hania; Benninga, Marc A
2009-03-18
Constipation is a frustrating symptom affecting 3% of children worldwide. Randomised controlled trials show that both polyethylene glycol and lactulose are effective in increasing defecation frequency in children with constipation. However, in 30-50%, these children reported abdominal pain, bloating, flatulence, diarrhoea, nausea and bad taste of the medication. Two recent studies have shown that the fermented dairy product containing Bifidobacterium lactis strain DN-173 010 is effective in increasing stool frequency in constipation-predominant irritable bowel syndrome patients with a defecation frequency fermented dairy product is effective in the treatment of constipated children with a defecation frequency fermented dairy product containing Bifidobacterium lactis DN-173 010 or a control product, twice a day, for 3 weeks. During the study all children are instructed to try to defecate on the toilet for 5-10 minutes after each meal (3 times a day) and daily complete a standardized bowel diary. Primary endpoint is stool frequency. Secondary endpoints are stool consistency, faecal incontinence frequency, pain during defecation, digestive symptoms (abdominal pain, flatulence), adverse effects (nausea, diarrhoea, bad taste) and intake of rescue medication (Bisacodyl). Rate of success and rate of responders are also evaluated, with success defined as > or = 3 bowel movements per week and or = 3 on the last week of product consumption. To demonstrate that the success percentage in the intervention group will be 35% and the success percentage in the control group (acidified milk without ferments, toilet training, bowel diary) will be 15%, with alpha 0.05 and power 80%, a total sample size of 160 patients was calculated. This study is aimed to show that the fermented dairy product containing Bifidobacterium lactis strain DN-173 010 is effective in increasing stool frequency after 3 weeks of product consumption in children with functional constipation and a defecation
A desk evaluation review of project BGD/5/010 food irradiation. Project desk evaluation
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-03-26
To increase the availability of food, the Bangladesh Atomic Energy Commission (BAEC), through its institute of Food and Radiation Biology (IFRB), has for many years pursued research studies in the use of ionizing radiation for food disinfestation and preservation. The Agency has been assisting these research efforts since the late 1970s. Project BGD/5/010, Food Irradiation, as reformulated in 1984, was to take on-going activities ones step further, with the main objective of demonstrating on a semi-commercial scale the efficacy and profitability of food irradiation in reducing the high storage losses of economically important food, such as potatoes, onions, dried fish and other seafood. A further objective was the transfer of food irradiation technology to the relevant industries in Bangladesh. The total budget of the project for the years 1983 through 1992 includes 5.1 man-months of expert services, $1,064,634 for equipment and $29,200 for training. The review was undertaken upon request by the Asia and the Pacific Section, to assess the current status of this ten-year project, which has encountered numerous delays and set-backs and is now nearing completion, and to determine to what extent the experience gained on the project could be useful in the implementation of similar on-going and future projects.
A desk evaluation review of project BGD/5/010 food irradiation. Project desk evaluation
International Nuclear Information System (INIS)
1993-01-01
To increase the availability of food, the Bangladesh Atomic Energy Commission (BAEC), through its institute of Food and Radiation Biology (IFRB), has for many years pursued research studies in the use of ionizing radiation for food disinfestation and preservation. The Agency has been assisting these research efforts since the late 1970s. Project BGD/5/010, Food Irradiation, as reformulated in 1984, was to take on-going activities ones step further, with the main objective of demonstrating on a semi-commercial scale the efficacy and profitability of food irradiation in reducing the high storage losses of economically important food, such as potatoes, onions, dried fish and other seafood. A further objective was the transfer of food irradiation technology to the relevant industries in Bangladesh. The total budget of the project for the years 1983 through 1992 includes 5.1 man-months of expert services, $1,064,634 for equipment and $29,200 for training. The review was undertaken upon request by the Asia and the Pacific Section, to assess the current status of this ten-year project, which has encountered numerous delays and set-backs and is now nearing completion, and to determine to what extent the experience gained on the project could be useful in the implementation of similar on-going and future projects
International Nuclear Information System (INIS)
Ma, Zhipeng; Shao, Guangjie; Wang, Xu; Song, Jianjun; Wang, Guiling; Liu, Tingting
2014-01-01
A facile solvothermal synthesis and esterification reaction combined with a high temperature calcination technique has been developed to prepare the uniform carbon coating LiFePO 4 nanoplates. The carbon coating LiFePO 4 nanoplates are investigated by X-ray diffraction (XRD), Raman spectroscopy, scanning electron microscope (SEM), transmission electron microscope (TEM), galvanostatic intermittent titration technique (GITT) and galvanostatic charge–discharge test. A reasonable growth mechanism of LiFePO 4 nanoplates is proposed on the basis of time dependent experimental results. The results show that each nanoplate is a LiFePO 4 single crystal with the large (010) plane. According to Raman spectroscopy analysis, carbon is uniformly coated on the surface of LiFePO 4 nanoplates. Electrochemical test results also indicate that the carbon coating LiFePO 4 nanoplates exhibit a high reversible specific capacity of 144.8 mAh g −1 at 0.5 C and 116.9 mAh g −1 under lower discharging rate at −20 °C. - Highlights: • LiFePO 4 nanoplates prepared by facile solvothermal synthesis expose large (010) plane. • The polyester network formed by the esterification reaction could entirely wrap LiFePO 4 . • The polyester wrapped on the surface of LiFePO 4 transformed into the uniform carbon layer after calcination. • LiFePO 4 /C nanoplates have good high-rate and low-temperature performance
Deep level defects in Ge-doped (010) β-Ga2O3 layers grown by plasma-assisted molecular beam epitaxy
Farzana, Esmat; Ahmadi, Elaheh; Speck, James S.; Arehart, Aaron R.; Ringel, Steven A.
2018-04-01
Deep level defects were characterized in Ge-doped (010) β-Ga2O3 layers grown by plasma-assisted molecular beam epitaxy (PAMBE) using deep level optical spectroscopy (DLOS) and deep level transient (thermal) spectroscopy (DLTS) applied to Ni/β-Ga2O3:Ge (010) Schottky diodes that displayed Schottky barrier heights of 1.50 eV. DLOS revealed states at EC - 2.00 eV, EC - 3.25 eV, and EC - 4.37 eV with concentrations on the order of 1016 cm-3, and a lower concentration level at EC - 1.27 eV. In contrast to these states within the middle and lower parts of the bandgap probed by DLOS, DLTS measurements revealed much lower concentrations of states within the upper bandgap region at EC - 0.1 - 0.2 eV and EC - 0.98 eV. There was no evidence of the commonly observed trap state at ˜EC - 0.82 eV that has been reported to dominate the DLTS spectrum in substrate materials synthesized by melt-based growth methods such as edge defined film fed growth (EFG) and Czochralski methods [Zhang et al., Appl. Phys. Lett. 108, 052105 (2016) and Irmscher et al., J. Appl. Phys. 110, 063720 (2011)]. This strong sensitivity of defect incorporation on crystal growth method and conditions is unsurprising, which for PAMBE-grown β-Ga2O3:Ge manifests as a relatively "clean" upper part of the bandgap. However, the states at ˜EC - 0.98 eV, EC - 2.00 eV, and EC - 4.37 eV are reminiscent of similar findings from these earlier results on EFG-grown materials, suggesting that possible common sources might also be present irrespective of growth method.
X-ray properties of the Be/X-ray systems 2S0114+650 LSI+65 deg 010
International Nuclear Information System (INIS)
Koenigsberger, G.; Swank, J.H.; Szymkowiak, A.E.
1982-12-01
Results are presented from experiments on the Einstein Observatory, HEAO-1 and OSO-8 on the temporal and spectral properties of 2S0114+650. In a 12 hour Einstein MPC and SSS observation two episodes of flaring occurred by an order of magnitude over about 1 hour. Variability on shorter time scales showed a preferred period of 14.9 minutes, but periodic pulsations were not seen in the HEAO-1 and OSO-8 data. There is some evidence that the spectrum is steeper when the source is quiescent at low luminosity, but no large spectral changes attended the flares. Absorption column densities were consistent with interstellar reddening of the proposed companion, the Be star LSI+65 deg 010. In the minute and hour variability and in the spectral character, 2S0114+650 is similar to other Be star-neutron star binary X-ray sources. Variations over several days in the OSO-8 data suggest orbital effects
Directory of Open Access Journals (Sweden)
Perrin Catherine
2009-03-01
Full Text Available Abstract Background Constipation is a frustrating symptom affecting 3% of children worldwide. Randomised controlled trials show that both polyethylene glycol and lactulose are effective in increasing defecation frequency in children with constipation. However, in 30–50%, these children reported abdominal pain, bloating, flatulence, diarrhoea, nausea and bad taste of the medication. Two recent studies have shown that the fermented dairy product containing Bifidobacterium lactis strain DN-173 010 is effective in increasing stool frequency in constipation-predominant irritable bowel syndrome patients with a defecation frequency Methods/design It is a two nation (The Netherlands and Poland double-blind, placebo-controlled randomised multicentre trial in which 160 constipated children (age 3–16 years with a defecation frequency Bifidobacterium lactis DN-173 010 or a control product, twice a day, for 3 weeks. During the study all children are instructed to try to defecate on the toilet for 5–10 minutes after each meal (3 times a day and daily complete a standardized bowel diary. Primary endpoint is stool frequency. Secondary endpoints are stool consistency, faecal incontinence frequency, pain during defecation, digestive symptoms (abdominal pain, flatulence, adverse effects (nausea, diarrhoea, bad taste and intake of rescue medication (Bisacodyl. Rate of success and rate of responders are also evaluated, with success defined as ≥ 3 bowel movements per week and ≤1 faecal incontinence episode over the last 2 weeks of product consumption and responder defined as a subject reporting a stool frequency ≥ 3 on the last week of product consumption. To demonstrate that the success percentage in the intervention group will be 35% and the success percentage in the control group (acidified milk without ferments, toilet training, bowel diary will be 15%, with alpha 0.05 and power 80%, a total sample size of 160 patients was calculated. Conclusion This
International Nuclear Information System (INIS)
Cicerone, Daniel S.; Sanchez Proano, Paula; Magallanes, Jorge F.; Nader, Gonzalo
2008-01-01
The countries of the Latin American region face the challenge of an adequate management of their water resources in order to satisfy not only quantitatively, but also qualitatively its different uses: irrigation, stock breeding, industrial, rural and municipal supply and recreational. The regional ARCAL project RLA/1/010, according to international recommendations (PAHO and WHO), set out to contribute to the improvement of the management of the water quality of surface water bodies. (author) [es
Order and disorder in Ca2ND0.90H0.10-A structural and thermal study
International Nuclear Information System (INIS)
Verbraeken, Maarten C.; Suard, Emmanuelle; Irvine, John T.S.
2011-01-01
The structure of calcium nitride hydride and its deuterided form has been re-examined at room temperature and studied at high temperature using neutron powder diffraction and thermal analysis. When synthesised at 600 deg. C, a mixture of both ordered and disordered Ca 2 ND 0.90 H 0.10 phases results. The disordered phase is the minor component and has a primitive rocksalt structure (spacegroup Fm3m) with no ordering of D/N on the anion sites and the ordered phase is best described using the rhombohedral spacegroup R-3m with D and N arranged in alternate layers in (111) planes. This mixture of ordered and disordered phases exists up to 580 deg. C, at which the loss of deuterium yields Ca 2 ND 0.85 with the disappearance of the disordered phase. In the new ordered phase there exists a similar content of vacancies on both anion sites; to achieve this balance, a little N transfers onto the D site, whereas there is no indication of D transferring onto the N-sites. These observations are thought to indicate that the D/N ordering is difficult to achieve with fully occupied anion sites. It has previously been reported that Ca 2 ND has an ordered cubic cell with alternating D and N sites in the [100] directions ; however, for the samples studied herein, there were clearly two coexisting phases with apparent broadening/splitting of the primitive peaks but not for the ordered peaks. The rhombohedral phase was in fact metrically cubic; however, all the observed peaks were consistent with the rhombohedral unit cell with no peaks requiring the larger ordered cubic unit cell to be utilised. Furthermore this rhombohedral cell displays the same form of N-D ordering as the Sr and Ba analogues, which are metrically rhombohedral. - Graphical abstract: Ca 2 ND 0.90 H 0.10 forms a mixture of ordered and disordered phases when synthesised at 600 deg. C. The ordered phase disappears at high temperature upon release of structural deuterium/hydrogen, leaving a single, partially disordered
International Nuclear Information System (INIS)
Haro, M.; Marquez, E.; Villares, P.; Jimenez-Garay, R.
1987-01-01
Electrical switching phenomenon, as well as the memory effect in the semiconductor chalcogenide glass Ge 0.10 As 0.20 Te 0.70 has been studied. A device with a plano-punctual interelectrode configuration has been designed and built, so that the electrical stimuli may be applied correctly. This device permits adequate positioning of the upper electrode, as well as contact pressure regulation. The I-V characteristics in the OFF-state have been obtained, showing a marked non-linear character. Equally, a relation has been found between the threshold voltage and electrical resistance parameters, indicating that the electrical power giving rise to the phenomenon is constant. Finally, memory effects showing a sudden reduction in electrical resistance, as well as interelectrode filaments, have been observed. (author)
International Nuclear Information System (INIS)
Jurczyk, J.; Capalla, K.; Szeja, K.
1980-01-01
A spectrophotometric method is presented of determining 0,1 to 0,10% niobium content in steel. The dissolution of steel was made by means of a mixture of hydrochloric and nitric acids. Niobium was precipitated by hydrolysis in the presence of tannin, gelatine and ascorbic acid and then was determined in the form of a coloured complex compound at pH 3. The concentration of niobium in the examined solution cannot exceed 1,6 μg/cm 3 . Standard deviation for niobium content 0,017% Nb is 0,0007% and for 0,100% Nb - 0,0025%. (author)
Over 100 Validated and Candidate Planets Orbiting Bright Stars in K2 Campaigns 0-10
Mayo, Andrew; Vanderburg, Andrew; Latham, David; Bieryla, Allyson; Morton, Timothy
2018-01-01
Since 2014, NASA's K2 mission has observed large portions of the ecliptic plane in search of transiting planets and has detected hundreds of planet candidates. With observations planned until at least early 2018, K2 will continue to identify more planet candidates. We present here over 250 planet candidates observed during Campaigns 0-10 of the K2 mission that are orbiting stars brighter than 13th magnitude and for which we have obtained high-resolution spectra. We analyze these candidates using the VESPA package in order to calculate the false positive probability (FPP), and find that more than half are validated with a FPP less than 0.1%. We show that like the population of planets found during the original Kepler mission, large planets discovered by K2 tend to orbit metal-rich stars. We also show tentative evidence of a gap in the planet radius distribution. We compare our sample to the Kepler candidate sample investigated by Fulton and collaborators and conclude that more planets are required to confirm the gap. This work, in addition to increasing the population of validated K2 planets and providing new targets for follow-up observations, will also serve as a framework for validating candidates from upcoming K2 campaigns and the Transiting Exoplanet Survey Satellite (TESS), expected to launch in 2018.
A SOFT X-RAY REVERBERATION LAG IN THE AGN ESO 113–G010
International Nuclear Information System (INIS)
Cackett, E. M.; Fabian, A. C.; Kara, E.; Zogbhi, A.; Reynolds, C.; Uttley, P.
2013-01-01
Reverberation lags have recently been discovered in a handful of nearby, variable active galactic nuclei (AGNs). Here, we analyze a ∼100 ks archival XMM-Newton observation of the highly variable AGN, ESO 113–G010, in order to search for lags between hard, 1.5-4.5 keV, and soft, 0.3-0.9 keV, energy X-ray bands. At the lowest frequencies available in the light curve (∼ –4 Hz), we find hard lags where the power-law-dominated hard band lags the soft band (where the reflection fraction is high). However, at higher frequencies in the range (2-3) × 10 –4 Hz we find a soft lag of –325 ± 89 s. The general evolution from hard to soft lags as the frequency increases is similar to other AGNs where soft lags have been detected. We interpret this soft lag as due to reverberation from the accretion disk, with the reflection component responding to variability from the X-ray corona. For a black hole mass of 7 × 10 6 M ☉ this corresponds to a light-crossing time of ∼9 R g /c; however, dilution effects mean that the intrinsic lag is likely longer than this. Based on recent black hole mass scaling for lag properties, the lag amplitude and frequency are more consistent with a black hole a few times more massive than the best estimates, though flux-dependent effects could easily add scatter this large.
New developed cylindrical TM010 mode EPR cavity for X-band in vivo tooth dosimetry.
Directory of Open Access Journals (Sweden)
Guo Junwang
Full Text Available EPR tooth in vivo dosimetry is an attractive approach for initial triage after unexpected nuclear events. An X-band cylindrical TM010 mode resonant cavity was developed for in vivo tooth dosimetry and used in EPR applications for the first time. The cavity had a trapezoidal measuring aperture at the exact position of the cavity's cylindrical wall where strong microwave magnetic field H1 concentrated and weak microwave electric field E1 distributed. Theoretical calculations and simulations were used to design and optimize the cavity parameters. The cavity features were evaluated by measuring DPPH sample, intact incisor samples embed in a gum model and the rhesus monkey teeth. The results showed that the cavity worked at designed frequency and had the ability to make EPR spectroscopy in relative high sensitivity. Sufficient modulation amplitude and microwave power could be applied into the aperture. Radiation induced EPR signal could be observed remarkably from 1 Gy irradiated intact incisor within only 30 seconds, which was among the best in scan time and detection limit. The in vivo spectroscopy was also realized by acquiring the radiation induced EPR signal from teeth of rhesus monkey whose teeth was irradiated by dose of 2 Gy. The results suggested that the cavity was sensitive to meet the demand to assess doses of significant level in short time. This cavity provided a very potential option for the development of X-band in vivo dosimetry.
Fourie, Josephus; Dumont, Pascal; Halos, Lénaïg; Beugnet, Frederic; Pollmeier, Matthias
2013-01-01
The efficacy of the treatment with Certifect ® (containing fipronil 6.26% w/v, amitraz 7.48% w/v, (S)-methoprene 5.63% w/v) applied topically was assessed in 18 dogs diagnosed with clinical generalized demodicosis. Three treatment regimens were compared over a 3-month period. Starting at Day 0, dogs were treated monthly (group 1) or every two weeks (group 2) with the combination of fipronil, amitraz, and (S)-methoprene or with monthly topical applications of the combination of amitraz and metaflumizone (group 3, reference treatment). Clinical examinations including deep skin scrapings were performed every month in order to evaluate the resolution of clinical signs and the reduction in mite counts. On Day 84, the percentage reduction of mite counts in group 1 was 99.8%, whereas no Demodex canis could be detected in groups 2 and 3 (i.e. 100% parasitological efficacy). As a result of the Demodex mite count reduction, the skin condition of the dogs improved significantly in all groups. This study illustrates, that both monthly and bi-weekly treatments with Certifect were effective in treating dogs with generalized demodicosis over a 3-month period. © J. Fourie et al., published by EDP Sciences, 2013.
Knyazev, Yu. V.; Kazak, N. V.; Bayukov, O. A.; Platunov, M. S.; Velikanov, D. A.; Bezmaternykh, L. N.; Ivanova, N. B.; Ovchinnikov, S. G.
2017-04-01
The investigation of mixed Co-Fe ludwigite single crystals shows that their magnetic properties are close to the magnetic properties of Fe3BO5 despite the predominance of cobalt ions. The magnetic properties of Co3 - x Fe x BO5 single crystals with x = 0.10 are studied in detail. Magnetometric measurements demonstrate a strong magnetic anisotropy with easy magnetization axis b, and the orbital magnetic moment of cobalt is in a frozen state. The detected temperature dependence of the absorption of Mössbauer spectra allowed us to determine the magnetic ordering temperature, which agrees with the results of magnetization measurements ( T C = 84 K).
12 CFR 626.6000 - Definitions.
2010-01-01
... include current, illegal use of or addiction to a controlled substance (as defined in section 102 of the Controlled Substances Act (21 U.S.C. 802)). (e) Residential real estate-related transaction means any of the...) The selling, brokering, or appraising of residential real property. [57 FR 13637, Apr. 17, 1992...
2010-04-01
.... Nontraditional employment, as applied to women, means occupations or fields of work where women comprise less... performance are required, such as annuities, insurance claims, and other benefit payments. Act means the Job... buyers that must include other than JTPA programs. The package must include performance criteria...
Solubility of tritium in Pd1-YAgY alloys (Y = 0.00, 0.10, 0.20, 0.30)
International Nuclear Information System (INIS)
Lasser, R.; Powell, G.L.
1988-01-01
Solubility measurements of tritium (T) in Pd 1-Y Ag Y alloys (Y = 0.00, 0.10, 0.20, 0.30) are reported in the temperature range of 250 K to 733 K, the pressure range below 3 bar, and the concentration range of 0.001 to 0.64 hydrogen to metal atom ratio. To study isotopic effects, the pressure-concentration-temperature relationships of the hydrogen isotopes protium (H) and deuterium (D) have been measured using the same samples and experimental setup and to temperatures as high as 1500 K using a different set up and samples. The experimental data are compared with values for H and D determined by other groups. In the case of T, most of the data presented have not been determined before. From these data the Sieverts' constants were calculated which show a strong temperature and isotope dependence. Analytical expressions, based on models that assume various degrees to which the hydrogen can perceive the alloy composition of individual sites in an alloy, are given for the Sieverts' constants that allow the calculation of the standard Gibbs free energies, enthalpies and entropies of H, D and T in these alloys
Energy Technology Data Exchange (ETDEWEB)
Smylie, M. P.; Claus, H.; Kwok, W. -K.; Louden, E. R.; Eskildsen, M. R.; Sefat, A. S.; Zhong, R. D.; Schneeloch, J.; Gu, G. D.; Bokari, E.; Niraula, P. M.; Kayani, A.; Dewhurst, C. D.; Snezhko, A.; Welp, U.
2018-01-19
The temperature dependence of the London penetration depth Delta lambda(T) in the superconducting doped topological crystalline insulator Sn1-xInxTe was measured down to 450 mK for two different doping levels, x approximate to 0.45 (optimally doped) and x approximate to 0.10 (underdoped), bookending the range of cubic phase in the compound. The results indicate no deviation from fully gapped BCS-like behavior, eliminating several candidate unconventional gap structures. Critical field values below 1 K and other superconducting parameters are also presented. The introduction of disorder by repeated particle irradiation with 5 MeV protons does not enhance T-c, indicating that ferroelectric interactions do not compete with superconductivity.
Energy Technology Data Exchange (ETDEWEB)
Amaral, J.B. [Faculdade Estácio de Sergipe, 49020-530 Aracaju, SE (Brazil); Araujo, R.M. [Coordenação de Química, IPISE/PIC, Faculdade Pio Décimo, 49095-000 Aracaju, SE (Brazil); Pedra, P.P. [CETEC, Universidade Federal do Recôncavo da Bahia, 44380-000 Cruz das Almas, BA (Brazil); Meneses, C.T.; Duque, J.G.S. [Departamento de Física, Universidade Federal de Sergipe, Campus Prof. Alberto Carvalho, 49500-000 Itabaiana, SE (Brazil); Rezende, M.V. dos S, E-mail: mvsrezende@gmail.com [Departamento de Física, Universidade Federal de Sergipe, Campus Prof. Alberto Carvalho, 49500-000 Itabaiana, SE (Brazil)
2016-09-15
In this work, the effect of insertion of transition metal, TM (=Ni, Zn, Al and Fe), ions in Cu{sub 1−x}TM{sub x}O samples (0
Esparza, V.; Thornton, D. E.
1976-01-01
Results are presented of a 0.10 scale orbiter forebody test with left and right mounted air data probes (ADP) as well as a flight test probe (nose boom). Left and right ADP data were obtained at Mach numbers of .3, .4, .5, .6, .7, .8, .85, .9, .95, .98, 1.05 and 1.1 through a Reynolds number range of 1.3 to 4.4 million. Nose boom data were obtained at Mach numbers of .3, .4, .5, .6, .7, .9 and .98.
pH-Dependent Surface Chemistry from First Principles: Application to the BiVO4(010)-Water Interface.
Ambrosio, Francesco; Wiktor, Julia; Pasquarello, Alfredo
2018-03-28
We present a theoretical formulation for studying the pH-dependent interfacial coverage of semiconductor-water interfaces through ab initio electronic structure calculations, molecular dynamics simulations, and the thermodynamic integration method. This general methodology allows one to calculate the acidity of the individual adsorption sites on the surface and consequently the pH at the point of zero charge, pH PZC , and the preferential adsorption mode of water molecules, either molecular or dissociative, at the semiconductor-water interface. The proposed method is applied to study the BiVO 4 (010)-water interface, yields a pH PZC in excellent agreement with the experimental characterization. Furthermore, from the calculated p K a values of the individual adsorption sites, we construct an ab initio concentration diagram of all adsorbed species at the interface as a function of the pH of the aqueous solution. The diagram clearly illustrates the pH-dependent coverage of the surface and indicates that protons are found to be significantly adsorbed (∼1% of available sites) only in highly acidic conditions. The surface is found to be mostly covered by molecularly adsorbed water molecules in a wide interval of pH values ranging from 2 to 8. Hydroxyl ions are identified as the dominant adsorbed species at pH larger than 8.2.
Zhou, Min; Zhang, Shudong; Sun, Yongfu; Wu, Changzheng; Wang, Mingtai; Xie, Yi
2010-12-03
Vertically aligned BiVO(4) nanowall films on indium tin oxide (ITO) glass have been fabricated through a template-free hydrothermal method for the first time. Based on the structural understanding of both BiVO(4) and ITO, the lattice matches ({020}(BiVO4) and {040}(ITO), {200}(BiVO4) and {004}(ITO), respectively) and the similarity of metal atomic arrangement parallel to {001} planes turn out to be crucial for the fabrication of the nanowalls. Consequently, the growth of a BiVO(4) film begins from heteroepitaxy and undergoes an Ostwald ripening process to form an extended network, resulting in a c-orientation and exposing {010} facets. Through this process, it is much easier to obtain a range of nanowall films with different packing densities, as the surface state of ITO glass is alterable by adjusting the concentration of acid. The films can be directly used as an electrode, which exhibits an excellent response to visible light, especially light with low intensity, allowing for the electrical interconnection, highly active surface, appropriate orientation, and a good contact with the substrate. There are great benefits in improving the technique for detecting the weak light source signals.
Directory of Open Access Journals (Sweden)
John Rojas
2011-09-01
Full Text Available Metformin hydrochloride is an antidiabetic agent which improves glucose tolerance in patients with type 2 diabetes and reduces basal plasma levels of glucose. In this study, a simplex centroid experimental design with 69 runs was used to select the best combination of some hydrophilic polymers that rendered a 24 h in-vitro release profile of metformin.HCl. The Korsmeyer-Peppas model was used to model the dissolution profiles since it presented the best fit to the experimental data. Further, a cubic model predicted the best formulation of metformin.HCl containing polyvinyl pyrrolidone, ethyl cellulose, hydroxypropyl methyl cellulose, carrageenan, sodium alginate, and gum arabic at 6.26, 68.7, 6.26, 6.26, 6.26 and 6.26 % levels, respectively. The validation runs confirmed the accuracy of the cubic model with six components for predicting the best set of components which rendered a once-a-day modified release hydrophilic matrix tablet in compliance with the USP specifications.O cloridrato de metformina é um agente antidiabético que melhora a tolerância à glicose em pacientes com diabetes tipo 2 e reduz os níveis plasmáticos basais de glicose. Neste estudo, um projeto experimental do tipo "centróide simplex" com 69 tomadas foi usado para selecionar a melhor combinação de alguns polímeros hidrofílicos que gerou um perfil de liberação da metformina.HCl de 24 horas. O modelo Korsmeyer-Peppas foi usado para modelar os perfis de dissolução, uma vez que apresentou os melhores ajustes aos dados experimentais. Além disso, um modelo cúbico previu a melhor formulação de metformina.HCl sendo aquela contendo polivinilpirrolidona, etilcelulose, hidroxipropilmetil celulose, carragena, alginato de sódio e goma arábica nos níveis 6.26, 68.7, 6.26, 6.26, 6.26 e 6.26 %, respectivamente. As corridas de validação confirmaram a precisão do modelo cúbico com os seis componentes para prever o melhor conjunto de componentes que originou uma
Directory of Open Access Journals (Sweden)
Denise Rodrigues Costa Schmidt
2012-01-01
Full Text Available OBJETIVO: Avaliar a associação de Qualidade de Vida no Trabalho (QVT com os distúrbios osteomusculares (DORT entre profissionais de enfermagem que trabalham em bloco cirúrgico. MÉTODOS: Estudo de abordagem quantitativa, descritivo, transversal e correlacional, do qual participaram 211 trabalhadores de Enfermagem de 11 hospitais de Londrina-PR, Brasil. Para coleta de dados, foram utilizados três instrumentos: caracterização sociodemográfica e profissional, Escala Visual Analógica e o Questionário Nórdico. RESULTADOS: A maioria dos participantes era de auxiliares de enfermagem (62,6%, do sexo feminino (87,1%, casados (54,5%, com idade média de 40 anos. Dentre os participantes, 38,9% apresentavam queixas osteomusculares na região inferior das costas e 37,9%, na região dos ombros. Neste estudo, a QVT obteve associação estatisticamente significante com os distúrbios osteomusculares na região lombar e dos ombros nos últimos 12 meses (p=0,00. CONCLUSÃO: A ausência de lombalgia contribuiu significativamente para elevar a medida de QVT (p=0,010, embora o modelo final de regressão tenha explicado, apenas 22,6% da variância da medida de QVT.OBJETIVO: Evaluar la asociación de Calidad de Vida en el Trabajo (CVT con los disturbios osteomusculares (DORT entre profesionales de enfermería que trabajan en una área quirúrgica. MÉTODOS: Estudio de abordaje cuantitativa, descriptiva, transversal y correlacional, en la que participaron 211 trabajadores de Enfermería de 11 hospitales de Londrina-PR, Brasil. Para la recolección de los datos, fueron utilizados tres instrumentos: caracterización sociodemográfica y profesional, Escala Visual Analógica y el Cuestionario Nórdico. RESULTADOS: La mayoría de los participantes era de auxiliares de enfermería (62,6%, del género femenino (87,1%, casados (54,5%, con edad promedio de 40 años. De los participantes, 38,9% presentaban quejas osteomusculares en la región inferior de la espalda y
Measurement of the high-field Q drop in the TM010 and TE011 modes in a niobium cavity
Energy Technology Data Exchange (ETDEWEB)
Gianluigi Ciovati; Peter Kneisel
2006-04-01
In the last few years superconducting radio-frequency (rf) cavities made of high-purity (residual resistivity ratio>200) niobium achieved accelerating gradients close to the theoretical limits. An obstacle towards achieving reproducibly higher fields is represented by ''anomalous'' losses causing a sharp degradation of the cavity quality factor when the peak surface magnetic field (Bp) is above about 90 mT, in the absence of field emission. This effect, called ''Q drop'' has been measured in many laboratories with single- and multicell cavities mainly in the gigahertz range. In addition, a low-temperature (100-140 C) ''in situ'' baking of the cavity was found to be beneficial in reducing the Q drop. In order to gain some understanding of the nature of these losses, a single-cell cavity has been tested in the TM010 and TE011 modes at 2 K. The feature of the TE011 mode is to have zero electric field on the cavity surface, so that electric field effects can be excluded as a source for the Q drop. This article will present some of the experimental results for different cavity treatments and will compare them with existing models.
Measurement of the high-field Q drop in the TM_{010} and TE_{011} modes in a niobium cavity
Directory of Open Access Journals (Sweden)
Gianluigi Ciovati
2006-04-01
Full Text Available In the last few years superconducting radio-frequency (rf cavities made of high-purity (residual resistivity ratio>200 niobium achieved accelerating gradients close to the theoretical limits. An obstacle towards achieving reproducibly higher fields is represented by “anomalous” losses causing a sharp degradation of the cavity quality factor when the peak surface magnetic field (B_{p} is above about 90 mT, in the absence of field emission. This effect, called “Q drop” has been measured in many laboratories with single- and multicell cavities mainly in the gigahertz range. In addition, a low-temperature (100–140 °C “in situ” baking of the cavity was found to be beneficial in reducing the Q drop. In order to gain some understanding of the nature of these losses, a single-cell cavity has been tested in the TM_{010} and TE_{011} modes at 2 K. The feature of the TE_{011} mode is to have zero electric field on the cavity surface, so that electric field effects can be excluded as a source for the Q drop. This article will present some of the experimental results for different cavity treatments and will compare them with existing models.
Microstructures and coherent phase diagram for the pseudobinary system (AuCu)1-xPd x with x ≤ 0.10
International Nuclear Information System (INIS)
Luciano, Rhodora H.; Shiraishi, Takanobu; Udoh, Koh-ichi; Tanaka, Yasuhiro; Hisatsune, Kunihiro
2005-01-01
A coherent phase diagram for the pseudobinary system (AuCu) 1-x Pd x with x ≤ 0.10 was constructed based on phase identification and microstructural analysis by transmission electron microscopy. It was confirmed that the addition of palladium exceeding 1.0 at.% to the equiatomic AuCu eliminated the AuCu II long-period superstructure from the phase equilibria and stabilized the AuCu I superstructure. The AuCu-0.5 at.% Pd and AuCu-1.0 at.% Pd alloys isothermally aged for long time at temperatures ranging from 380 to 420 deg. C exhibited seven distinguishable regions; a single-phase region of disordered solid solution (α); a single-phase region of AuCu I ordered phase; a single-phase region of AuCu II ordered phase; a region of the coexisting AuCu I and AuCu II ordered phases; a region of the coexisting AuCu I ordered and α phases; a region of the coexisting AuCu II ordered and α phases; and a region of the coexisting AuCu I and AuCu II ordered and α phases
Publications | Page 626 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 6251 - 6260 of 7330 ... Economic valuation of environmental damages resulting from the ... Building Workshop on "Integrated Climate Risk Assessment" 27-31 August 2007, ... Environment and natural resources as a core asset for wealth ...
Publications | Page 626 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 6251 - 6260 of 6341 ... Supermarket supply chain for fresh fruits and vegetables : opportunities and challenges for small farmers (open access) ... lessons arising from our attempts to operationalise the INRM [integrated natural resources management] approach over the last 6 years in East and Central Africa (ECA).
7 CFR 58.626 - Packaging equipment.
2010-01-01
... containers with frozen desserts shall be constructed so that all product contact surfaces shall be of... Standards for Equipment for Packaging Frozen Desserts and Cottage Cheese. Quality Specifications for Raw...
Protein (Cyanobacteria): 440680064 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available YP_007154859.1 NC_019775 1117:3991 ... 1161:5387 ... 1162:6232 1163:4927 1165:626 272123:626 ... putative addicti...on module antidote protein Anabaena cylindrica PCC 7122 MALTKDFKETVNARIQRDPDFAIVLLDEAISLFLNGELETARLILRNMLNLSHF
Energy Technology Data Exchange (ETDEWEB)
Miah, Mohammad J., E-mail: mmjulhash@yahoo.com [Department of Physics, Bangladesh University of Engineering & Technology, Dhaka (Bangladesh); Department of Physics, Comilla University, Comilla (Bangladesh); Khan, M. N. I. [Materials Science Division, Atomic Energy Center, Dhaka (Bangladesh); Hossain, A. K. M. Akther [Department of Physics, Bangladesh University of Engineering & Technology, Dhaka (Bangladesh)
2016-07-12
Multiferroic xBa{sub 0.95}Sr{sub 0.05}TiO{sub 3}-(1-x)BiFe{sub 0.90}Gd{sub 0.10}O{sub 3} [xBST-(1-x)BFGO] (x = 0.00, 0.10 and 0.20) ceramics were prepared by the standard solid-state reaction technique. Crystal structure of the ceramics was determined by X-ray diffraction pattern. All the compositions exhibited rhombohedral crystal structure. The tolerance factor ‘t’ varied from 0.847 to 0.864. The AC conductivity spectrum followed the Jonscher’s power law. The Nyquist plots indicated that only grains have the contribution to the resistance in this material and the values of grain resistance (R{sub g}) increased with BST content. The real part of complex initial permeability decreased with the increase in frequency and increased with increasing BST content. Magnetoelectric coefficient was determined for all compositions. The maximum value of magnetoelectric coefficient was found to be 1.467 mV.cm{sup −1}.Oe{sup −1} for x = 0.20.
Highly conductive homoepitaxial Si-doped Ga2O3 films on (010) β-Ga2O3 by pulsed laser deposition
Leedy, Kevin D.; Chabak, Kelson D.; Vasilyev, Vladimir; Look, David C.; Boeckl, John J.; Brown, Jeff L.; Tetlak, Stephen E.; Green, Andrew J.; Moser, Neil A.; Crespo, Antonio; Thomson, Darren B.; Fitch, Robert C.; McCandless, Jonathan P.; Jessen, Gregg H.
2017-07-01
Si-doped Ga2O3 thin films were fabricated by pulsed laser deposition on semi-insulating (010) β-Ga2O3 and (0001) Al2O3 substrates. Films deposited on β-Ga2O3 showed single crystal, homoepitaxial growth as determined by high resolution transmission electron microscopy and x-ray diffraction. Corresponding films deposited on Al2O3 were mostly single phase, polycrystalline β-Ga2O3 with a preferred (20 1 ¯ ) orientation. An average conductivity of 732 S cm-1 with a mobility of 26.5 cm2 V-1 s-1 and a carrier concentration of 1.74 × 1020 cm-3 was achieved for films deposited at 550 °C on β-Ga2O3 substrates as determined by Hall-Effect measurements. Two orders of magnitude improvement in conductivity were measured using native substrates versus Al2O3. A high activation efficiency was obtained in the as-deposited condition. The high carrier concentration Ga2O3 thin films achieved by pulsed laser deposition enable application as a low resistance ohmic contact layer in β-Ga2O3 devices.
Sharma, Neha; Kumar, Sanjay; Sharma, Varun
2018-05-01
The chemical precipitation method is followed for the synthesis of Al-doped ZnO nanoparticles (NPs) with varying doping concentrations (0, 0.02, 0.04, 0.06, 0.08, and 0.10 M). A single hexagonal crystalline phase of wurtzite structure has been confirmed for all the samples by X-ray diffraction. Crystalline size and microstrain of the un-doped and doped ZnO (NPs) is determined by the Williamson-Hall (W-H) analysis. The optical properties like band gap and Urbach energy are found out by the UV-visible spectroscopy. The functional bonds are detailed by Fourier transmission infrared spectroscopy. The dielectric properties have been shown by doped sample due to hopping mechanisms as compared to the undoped. The loss factor (tan δ) follows an inverse direction as correspond to frequency due to the presence of dielectric dispersion.
International Nuclear Information System (INIS)
Cui, J.L.; Xue, H.F.; Xiu, W.J.; Jiang, L.; Ying, P.Z.
2006-01-01
In this paper, pseudo-binary (Ag 0.365 Sb 0.558 Te) x -(Bi 0.5 Sb 1.5 Te 3 ) 1- x (x=0-1.0) alloys were prepared using spark plasma sintering technique, and the composition-dependent thermoelectric properties were evaluated. Electrical conductivities range from 7.9x10 4 to 15.6x10 4 Ω -1 m -1 at temperatures of 507 and 318 K, respectively, being about 3.0 and 8.5 times those of Bi 0.5 Sb 1.5 Te 3 alloy at the corresponding temperatures. The optimal dimensionless figure of merit (ZT) of the sample with molar fraction x=0.025 reaches 1.1 at 478 K, whereas that of the ternary Bi 0.5 Sb 1.5 Te 3 alloy is 0.58 near room temperature. The results also reveal that a direct introduction of Ag 0.365 Sb 0.558 Te in the Bi-Sb-Te system is much more effective to the property improvement than naturally precipitated Ag 0.365 Sb 0.558 Te in the Ag-doped Ag-Bi-Sb-Te system. - Graphical abstract: The temperature dependence of the dimensionless thermoelectric figure of merit ZT for different (Ag 0.365 Sb 0.558 Te) x -(Bi 0.5 Sb 1.5 Te 3 ) 1- x (x=0-1.0) alloys prepared by spark plasma sintering
Microbial Communities of Terrestrial Springs in Extensional Settings of the Western U.S.A.
Takacs-Vesbach, C.; Hall, J.; Crossey, L. J.; Karlstrom, K. E.; Fischer, T.; Cron, B.
2008-12-01
Gas and water chemistry from hot springs, gas vents, travertine-bearing cool springs, and high-pCO2 groundwaters of the western U.S. indicate a regionally extensive flux of deeply sourced volatiles through spring vents. We use the term "continental smokers" to emphasize and test analogs to mid-ocean vent systems, and are currently concentrating on vents in the Rocky Mountain/Colorado Plateau region as part of the Colorado Rockies and Experiment and Seismic transects (CREST). Measurable mantle-derived helium components (3He/4He = 0.10 to 2.1 RA) occur in nearly all springs in Colorado and New Mexico suggesting direct fast fluid pathways from the mantle to the surface hydrologic system. Important components of the CO2 are also derived from the mantle. We surveyed the geochemistry and microbial diversity of more than forty deeply sourced terrestrial springs that ranged in temperatures from 9° to 70°C. We hypothesize that degassing in continental extensional settings supports microbial assemblages that are analogous to chemolithotrophic communities at mid-ocean ridges and continental volcanic hydrothermal systems. Geochemical characteristics of the fluids and gases structure and sustain distinctive geomicrobiological communities as indicated by the widespread presence of archaea and thermophilic organisms in cool as well as hot springs.
Directory of Open Access Journals (Sweden)
N. Sdiri
2012-07-01
Full Text Available Using spectroscopic ellipsometry, we have studied the optical properties of doped manganites at the paramagnetic state in polycrystalline La0.7Ca0.3-xKxMnO3 samples for (x = 0.00, 0.05 and 0.10 in the energy range of 3.2-5.5 eV at room temperature. The surface morphology of the samples was obtained by using atomic force microscopy (AFM. Refractive indices, extinction coefficients, the transmission ellipsometric parameters Ψ and Δ are investigated at different wavelengths. The study of the optical conductivity σ reveals that optical behaviour and the activated transport in the paramagnetic state of these materials are consistent with Jahn-Teller small polaron. In addition, the spectrum of the complex dielectric constant ε reveals peaks for all samples, the results may be explained by the presence of space charges from the strongly dipole-allowed O(2p−Mn(3d transition.
Directory of Open Access Journals (Sweden)
Raju Suresh Kumar
2010-08-01
Full Text Available In the title compound, C37H32N2O3, an intramolecular O—H...N hydrogen bond generates a five-membered ring, producing an S(5 motif. The piperidone ring adopts a half-chair conformation. The two fused pyrrolidine rings have similar envelope conformations. The interplanar angles between the benzene rings A/B and C/D are 75.68 (7 and 30.22 (6°, respectively. In the crystal structure, adjacent molecules are interconnected into chains propagating along the [010] direction via intermolecular C—H...O hydrogen bonds. Further stabilization is provided by weak C—H...π interactions.
2012-12-14
... and track the impact of NSF funding that focuses on the Nation's science, technology, engineering, and... beyond). EHR also focuses on broadening participation in STEM learning and careers among United States... Engineering (HBCU-RISE) Monitoring System. Graduate STEM Fellows in K-12 Education 1,626 1,626 3,941 (GK-12...
2012-03-20
..., and any entity assisting in its compliance, in the procedures established pursuant to the preceding... compliance with Rule 626(c); and (4) The Member uses a process to prevent outbound telephone calls to any... numbers.\\32\\ \\32\\ See also FINRA Rule 3230(e). Outsourcing Telemarketing Proposed Rule 626(f) states that...
The quality of the Florisbad spring-water in relation to the quality of ...
African Journals Online (AJOL)
drinie
2001-01-01
Jan 1, 2001 ... Nitrate. 0.733. 1.186. 0.901. 2.335. 4.807. Phosphate. 1.929. 0.100. 0.010. 0.010 ..... depth of 34 m, that six of the holes produced slightly saline water, and that ... Nitrogen. -. -. -. 27.4. 18.500. -. Methane. -. -. -. 6.9. 71.500. -. STABLE ... Ammonium bicarbonate (NH4HCO3) ... Aluminum oxide (Al2O3). 1.610.
Polhamus, Edward C.; King, Thomas J., Jr.
1949-01-01
An investigation was made in the Langley high-speed 7- by 10-foot tunnel to determine the high-speed lateral and directional stability characteristics of a 0.10-scale model of the Grumman XF9F-2 airplane in the Mach number range from 0.40 to 0.85. The results indicate that static lateral and directional stability is present throughout the Mach number range investigated although in the Mach number range from 0.75 to 0.85 there is an appreciable decrease in rolling moment due to sideslip. Calculations of the dynamic stability indicate that according to current flying-quality requirements the damping of the lateral oscillation, although probably satisfactory for the sea-level condition, may not be satisfactory for the majority of the altitude conditions investigated
Amaral, J. B.; Araujo, R. M.; Pedra, P. P.; Meneses, C. T.; Duque, J. G. S.; dos S. Rezende, M. V.
2016-09-01
In this work, the effect of insertion of transition metal, TM (=Ni, Zn, Al and Fe), ions in Cu1-xTMxO samples (0
2010-10-01
... tunnel. (e) Freeing port means any direct opening through the vessel's bulwark or hull to quickly drain... 600 nautical miles (1111 kilometers). (o) Scupper means a pipe or tube of at least 30 millimeters (1.25 inches) in diameter leading down from a deck or sole and through the hull to drain water overboard...
Lifescience Database Archive (English)
Full Text Available 4. 5' end sequence. DK954060 CL412Contig1 Show DK954060 Clone id TST39A01NGRL0019_G24 Library TST39 Length 6...26 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_G24. 5' end sequence. Accession DK95406...s Res. 25:3389-3402. Query= DK954060|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0019_G24, 5' (626 le...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954060|Adiantum ca...TST39A01NGRL0019_G24 626 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_G2
Energy Technology Data Exchange (ETDEWEB)
Jayakumar, O.D. [Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Gopalakrishnan, I.K. [Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)], E-mail: ikgopal@barc.gov.in; Vinu, A. [Nano-Ionics Materials Group, Fuel Cell Materials Center, National Institute for Materials Science, 1-1 Namiki, Tsukuba, Ibaraki 305-0044 (Japan); Asthana, A. [Advanced Electron Microscopy Group, National Institute for Materials Science, 1-1 Namiki, Tsukuba, Ibaraki 305-0044 (Japan); Tyagi, A.K. [Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)
2008-08-11
Nanocrystalline (Th{sub 1-x}Fe{sub x})O{sub 2-{delta}} particles with different Fe concentrations (x = 0.0, 0.05, 0.10, 0.15, 0.20 and 0.25) have been prepared by a gel combustion method. Rietveld refinement analyses of X-ray diffraction data revealed the formation of an impurity free cubic type Th{sub 1-x}Fe{sub x}O{sub 2-{delta}} structure up to x = 0.20. This observation is further confirmed from the detailed studies conducted on 10 at.% Fe doped ThO{sub 2} using high-resolution transmission electron microscopy (HRTEM) imaging and indexing of the selected-area electron diffraction (SAED) patterns. DC magnetization studies as a function field indicate that they are ferromagnetic with Curie temperature (T{sub c}) well above room temperature.
Hwang, Seok-Ho; Moorefield, Charles N; Wang, Pingshan; Fronczek, Frank R; Courtney, Brandy H; Newkome, George R
2006-08-07
Synthesis of a novel bis(terpyridine) ligand, 4,4'-bis(2,2':6',2''-terpyridinyl)triphenylamine, utilizing triphenylamine, as a specific angle controller, has led to the self-assembly of a unique hexagonal metallomacrocycle family, [Fe6(2)6(PF6)12] and [Zn6(2)6(BF4)12], utilizing terpyridine-metal(II)-terpyridine connectivity. The crystal structure of the novel ligand shows that the angle between the two terpyridinyl moieties is 119.69 degrees , which enabled the formation of the hexagonal-shaped macrocycles. The crystal packing architectures of this starting ligand revealed channels induced by solvent encapsulation. Following complexation of this ligand with transition metals [Fe(II) or Zn(II)] in a one-pot reaction, the resultant structures were characterized by (1)H and (13)C NMR, UV/Vis and mass spectroscopies. The expected metal-to-ligand charge transfer (MLCT; lambda(max) = 582 nm) and emission (lambda(em) = 575 nm) characteristics were exhibited by both [Fe6(2)6(PF6)12] and[Zn6(2)6(BF4)12]. The photoelectrochemical characteristics of these hexagonal metallomacrocycles demonstrate that they can be used as sensitizers in dye-sensitized solar cells.
Effects of Different Soil Tillage Intensity on Yields of Spring Barley
Directory of Open Access Journals (Sweden)
Alena Pernicová
2014-01-01
Full Text Available Within the period 1990–2012, effects of different soil tillage intensity on yields of spring barley were studied in a field experiment in the sugar-beet producing region (Ivanovice na Hané, Czech Republic. The forecrop of the spring barley was always sugar beet; following in three different crop rotations, after maize for silage, winter wheat and spring barley. Four variants of tillage were evaluated: Variant 1 – ploughing to the depth of 0.22 m; Variant 2 – shallow ploughing to the depth of 0.15 m; Variant 3 – no tillage; Variant 4 – shallow loosening soil to the depth of 0.10 m.Effect of different tillage on yields of spring barley was statistically insignificant. In all three crop rotations, the highest and the lowest average yields were obtained in Variant 2 (ploughing to the depth of 0.15 m and Variant 1 (ploughing to the depth of 0.22 m, respectively. Average yields in variants of soil tillage were these: variant 1 – 6.42 t.ha−1; variant 2 – 6.57 t.ha−1, variant 3 – 6.53 t.ha−1, variant 4 – 6.50 t.ha−1. The obtained results indicate that in these pedo-climatic conditions reduction of intensity soil tillage represented a very suitable alternative in case of growing spring barley after sugar beet as compared with the conventional method of tillage by ploughing to the depth of 0.22 m.
Annibaldi, Anna; Illuminati, Silvia; Truzzi, Cristina; Scarponi, Giuseppe
2018-02-01
Heavy metal concentrations (cadmium, lead, and copper) in spring, tap, and bottled waters of the Sibylline Mountains National Park (central Italy) were investigated using square wave anodic stripping voltammetry from 2004 to 2011. The mean (±SD) concentrations detected (1.3 ± 0.4 ng L -1 cadmium, 14 ± 6 ng L -1 lead, and 0.16 ± 0.10 μg L -1 copper) were below the limits stipulated by Italian and European legislation for drinking and natural mineral water. In the three studied areas of the park (Mount Bove north, Mount Bove south, and springs of River Nera) with very few exceptions, both mineral waters bottled in the area and aqueduct waters from public fountains had approximately the same metal concentrations as did the spring waters from which they were derived. Conversely, substantially higher metal concentrations were found at some sites in private houses, which may be due to release of metals from old metal pipes. At the time of this study, waters of Sibylline Mountains National Park were of good quality, and no influence of the bottling process on heavy metal concentrations was found.
International Nuclear Information System (INIS)
Wynveen, R.A.; Smith, W.H.; Sholeen, C.M.; Mayes, C.B.; Justus, A.L.; Flynn, K.F.
1984-04-01
Based on the results of the radiological assessment, the Argonne National Laboratory Radiological Survey Group arrived at the following conclusions: (1) soil contaminated with the radionuclides 60 Co and 152 Eu of undetermined origin was detected in the southwest quadrant of the Building 010 site. 60 Co was also detected in one environmental sample taken from an area northwest of the site and in a borehole sample taken from the area that previously held the radioactive gas hold-up tanks. Uranium was detected in soil from a hole in the center of the building site and in a second hole southwest of the building site. In all cases, the radionuclide levels encountered in the soil were well below the criteria set by DOE for this site; and (2) the direct instrument readings at the surface of the site were probably the result of natural radiation (terrestrial and celestial), as well as shine from the material being stored at the nearby RMDF facility. There was no evidence that the contaminated soil under the asphalt pad contributed detectable levels to the total background readings
DEFF Research Database (Denmark)
Pirou, Stéven; Bermudez, Jose M.; Tak Na, Beom
2018-01-01
Self-standing, planar dual-phase oxygen transport membranes consisting of 70 vol.% (ZrO2)0.89(Y2O3)0.01(Sc2O3)0.10 (10Sc1YSZ) and 30 vol.% LaCr0.85Cu0.10Ni0.05O3-δ (LCCN) were successfully developed and tested. The stability of the composite membrane was studied in simulated oxy-fuel power plant...
40 CFR 180.626 - Prothioconazole; tolerances for residues.
2010-07-01
...]-1H-1,2,4-triazole-1-ethanol, calculated as parent in or on the commodity. Commodity Parts per million Beet, sugar, roots 0.25 Corn, sweet, kernel plus cob with husks removed 0.04 Grain, aspirated grain...-ethanol, and conjugates that can be converted to these two compounds by acid hydrolysis, calculated as...
Directory of Open Access Journals (Sweden)
M. Saidi
2015-03-01
Full Text Available Polycrystalline of [(Na0.535K0.4800.966Li0.058](Nb0.90Ta0.10O3 samples were prepared using the high-temperature solid-state reaction technique. X-ray diffraction (XRD analysis indicates the formation of a single-phase with orthorhombic structure. AC impedance plots were used as tool to analyze the electrical behavior of the sample as a function of frequency at different temperatures. The AC impedance studies revealed the presence of grain effect, from 425°C onwards. Complex impedance analysis indicated non-Debye type dielectric relaxation. The Nyquist plot showed the negative temperature coefficient of resistance (NTCR characteristic of NKLNT. The AC conductivity results were used to correlate with the barrier hopping (CBH model to evaluate the binding energy (Wm, the minimum hopping distance (Rmin, the density of states at Fermi level (N(Ef, and the activation energy of the compound.
Liu, Zhi Juan; Yang, Xiao Guang; Lyu, Shuo; Wang, Jing; Lin, Xiao Mao
2018-01-01
Based on meteorological data, agro-meteorological observations, and agricultural statistical data in Northeast China (NEC), by using the validated Agricultural Production System sIMulator (APSIM-maize), the potential, attainable, potential farmers' and actual farmers' yields of spring maize during the period 1961 to 2015 were analyzed, and the effects of climate variation on maize potential yield in NEC were quantified. Results indicated that the potential yield of spring maize was 12.2 t·hm -2 during the period 1961 to 2015, with those in northeast being lower than southwest within the study region. The attainable yield of spring maize was 11.3 t·hm -2 , and showed a similar spatial distribution with potential yield. Under the current farmers' management practices, mean simulated potential and actual farmers' yields were 6.5 and 4.5 t·hm -2 , respectively. Assuming there were no changes in cultivars and management practices in NEC, the mean potential, attainable, and potential farmers' yields of spring maize would decrease by 0.34, 0.25 and 0.10 t·hm -2 per decade in NEC. However, the actual farmers' yields increased with the value of 1.27 t·hm -2 per decade averaged over NEC. Due to climate variation, year-to-year variations of spring maize potential, attainable, and potential farmers' yields were significant, ranging from 10.0 to 14.4, 9.8 to 13.3, 4.4 to 8.5 t·hm -2 , respectively.
On Geometric Variational Models for Inpainting Surface Holes (PREPRINT)
2006-01-01
email: haro@ima.umn.edu Phone: (612) 626-1501 Fax: (612) 626-7370 Affiliations: 1 Dept. de Tecnologia , University of Pompeu-Fabra, Passeig de...regions where the 3D model is incomplete. The main cause of holes are occlusions, but these can also be due to low reflectance, constraints in the...major areas where range scanners are used. With the increasing popularity of range scanners as 3D shape acquisition devices, with applications in
2011-08-01
Specimen 625 -58 Cleaned with 50-ksi Water Jet ....................... 18 Figure 12. SEM Images of Inconel Specimen 626-63 Cleaned with 50-ksi Water...SEM Images of Inconel Specimen 626-22 Cleaned with Wet Glass Bead.......................... 21 Figure 15. SEM Images of Titanium Specimen 625 -02...Figure 18. SEM Images of Titanium Specimen 625 -40 Cleaned with Dry Al2O3 (240 grit) ............... 24 Figure 19. SEM Images of Inconel Specimen
MICROBIOLOGICAL MONITORING AND AUTOMATED EVENT SAMPLING AT KARST SPRINGS USING LEO-SATELLITES
Stadler, Hermann; Skritek, Paul; Sommer, Regina; Mach, Robert L.; Zerobin, Wolfgang; Farnleitner, Andreas H.
2010-01-01
Data communication via Low-Earth-Orbit Satellites between portable hydro-meteorological measuring stations is the backbone of our system. This networking allows automated event sampling with short time increments also for E.coli field analysis. All activities of the course of the event-sampling can be observed on an internet platform based on a Linux-Server. Conventionally taken samples by hand compared with the auto-sampling procedure revealed corresponding results and were in agreement to the ISO 9308-1 reference method. E.coli concentrations were individually corrected by event specific die-off rates (0.10–0.14 day−1) compensating losses due to sample storage at spring temperature in the auto sampler. Two large summer events 2005/2006 at a large alpine karst spring (LKAS2) were monitored including detailed analysis of E.coli dynamics (n = 271) together with comprehensive hydrological characterisations. High resolution time series demonstrated a sudden increase of E.coli concentrations in spring water (approx. 2 log10 units) with a specific time delay after the beginning of the event. Statistical analysis suggested the spectral absorbent coefficient measured at 254nm (SAC254) as an early warning surrogate for real time monitoring of faecal input. Together with the LEO-Satellite based system it is a helpful tool for Early-Warning-Systems in the field of drinking water protection. PMID:18776628
African Journals Online (AJOL)
userpc
1Department of Soil Science, Faculty of Agriculture/Institute for Agricultural Research, Ahmadu. Bello University ... grown on large scale and mostly in India, China,. Nigeria, USA ... the Nigerian Sudan savannah at Minjibir (120. 8.73' N and 80 ...
40 CFR 86.010-2 - Definitions.
2010-07-01
... maintained. In general, limp-home operation implies that a component or system is not operating properly or...-volatile random access memory (NVRAM). A permanent DTC can only be erased by the OBD system itself and...
Filling machine preventive maintenance using age replacement method in PT Lucas Djaja
Directory of Open Access Journals (Sweden)
Mustofa Fifi Herni
2018-01-01
Full Text Available PT Lucas Djaja is a company engaged in the pharmaceutical industry which produce sterile drugs and non-sterile. Filling machine has a high failure rate and expensive corrective maintenance cost. PT Lucas Djaja has a policy to perform engine maintenance by way of corrective maintenance. The study focused on the critical components, namely bearing R2, bearing 625 and bearing 626. When the replacement of the failure done by the company is currently using the formula mean time to failure with the result of bearing R2 at point 165 days, bearing 625 at a point 205 days, and bearing 626 at a point 182 days. Solutions generated by using age replacement method with minimization of total maintenance cost given on the bearing R2 at a point 60 days, bearing 625 at the point of 80 days and bearing 626 at a point 40 days.
DEFF Research Database (Denmark)
Sjåvik, Kristin; Bartek, Jiri; Solheim, Ole
2015-01-01
neurosurgical centers with population-based referral. We compared two different treatment strategies analyzing frequencies of VTE and proportions of postoperative intracranial hematomas requiring surgery or intensified subsequent observation or care (ICU or other intensified observation and/or treatment). One......: In the LMWH routine group, VTE was diagnosed after 24/626 operations (3.9%), while VTE was diagnosed after 11/353 (3.1%) operations in the LMWH as needed group (p=0.56). Clinically relevant postoperative hematomas occurred after 57/626 operations (9.1%) in the LMWH routine group compared to 23/353 (6.......5%) in the LMWH as needed group (p=0.16). Surgically evacuated postoperative hematomas occurred after 19/626 operations (3.0%) in the LMWH routine group compared to 8/353 operations (2.3%) in the LMWH as needed group (p=0.26). CONCLUSION: There is no benefit of routine preoperative LMWH starting before...
Martinandresite, Ba2(Al4Si12O32)·10H2O, a new zeolite from Wasenalp, Switzerland
Chukanov, Nikita V.; Zubkova, Natalia V.; Meisser, Nicolas; Ansermet, Stefan; Weiss, Stefan; Pekov, Igor V.; Belakovskiy, Dmitriy I.; Vozchikova, Svetlana A.; Britvin, Sergey N.; Pushcharovsky, Dmitry Yu.
2018-06-01
The new zeolite martinandresite, ideally Ba2(Al4Si12O32)·10H2O, was discovered in the armenite locality of Wasenalp near the Isenwegg peak, Ganter valley, Simplon region, Switzerland. The associated minerals are armenite, quartz, dickite, and chlorite. Martinandresite forms tan-coloured blocky crystals up to 8 × 5 × 3.5 mm, their aggregates up to 6 cm across, as well as cruciform twins up to 3.5 mm. The major form is {010}; the subordinate forms are {100} and {001}. Indistinct cleavage is observed, presumably on (010) and in a direction across (010). The Mohs' hardness is 4½. Density measured by flotation in heavy liquids is 2.482(5) g/cm3. Density calculated using the empirical formula is equal to 2.495 g/cm3. Martinandresite is optically biaxial, negative, α = 1.500(2), β = 1.512(2), γ = 1.515(2) ( λ = 589 nm). 2 V (meas.) = 55(10)°. The IR spectrum is given. The chemical composition of martinandresite is (wt%; electron microprobe, H2O determined by the modified Penfield method): Na2O 0.37, K2O 0.12, BaO 21.55, Al2O3 15.03, SiO2 49.86, H2O 12.57, total 99.50. The empirical formula based on 16 atoms Si + Al pfu is Na0.17K0.04Ba2.00(Al4.19Si11.81O32)H19.85O9.93. The crystal structure was determined using single-crystal X-ray diffraction data. The new mineral is orthorhombic, space group Pmmn, with a = 9.4640(5), b = 14.2288(6), c = 6.9940(4) Å, V = 941.82(8) Å3 and Z = 1. The crystal structure of martinandresite is unique and is based on the Al-Si-O tetrahedral framework containing four-, six- and eight-membered rings of tetrahedra. Si and Al are disordered between the two independent tetrahedral sites. The strongest lines of the powder X-ray diffraction pattern [ d, Å ( I, %) ( hkl)] are: 6.98 (74) (001), 6.26 (83) (011), 5.61 (100) (101), 3.933 (60) (220, 031), 3.191 (50) (112), 3.170 (62) (041), 3.005 (79) (231, 141). Martinandresite is named after Martin Andres (b. 1965), the discoverer of the armenite locality of Wasenalp.
Martinandresite, Ba2(Al4Si12O32)·10H2O, a new zeolite from Wasenalp, Switzerland
Chukanov, Nikita V.; Zubkova, Natalia V.; Meisser, Nicolas; Ansermet, Stefan; Weiss, Stefan; Pekov, Igor V.; Belakovskiy, Dmitriy I.; Vozchikova, Svetlana A.; Britvin, Sergey N.; Pushcharovsky, Dmitry Yu.
2017-12-01
The new zeolite martinandresite, ideally Ba2(Al4Si12O32)·10H2O, was discovered in the armenite locality of Wasenalp near the Isenwegg peak, Ganter valley, Simplon region, Switzerland. The associated minerals are armenite, quartz, dickite, and chlorite. Martinandresite forms tan-coloured blocky crystals up to 8 × 5 × 3.5 mm, their aggregates up to 6 cm across, as well as cruciform twins up to 3.5 mm. The major form is {010}; the subordinate forms are {100} and {001}. Indistinct cleavage is observed, presumably on (010) and in a direction across (010). The Mohs' hardness is 4½. Density measured by flotation in heavy liquids is 2.482(5) g/cm3. Density calculated using the empirical formula is equal to 2.495 g/cm3. Martinandresite is optically biaxial, negative, α = 1.500(2), β = 1.512(2), γ = 1.515(2) (λ = 589 nm). 2V (meas.) = 55(10)°. The IR spectrum is given. The chemical composition of martinandresite is (wt%; electron microprobe, H2O determined by the modified Penfield method): Na2O 0.37, K2O 0.12, BaO 21.55, Al2O3 15.03, SiO2 49.86, H2O 12.57, total 99.50. The empirical formula based on 16 atoms Si + Al pfu is Na0.17K0.04Ba2.00(Al4.19Si11.81O32)H19.85O9.93. The crystal structure was determined using single-crystal X-ray diffraction data. The new mineral is orthorhombic, space group Pmmn, with a = 9.4640(5), b = 14.2288(6), c = 6.9940(4) Å, V = 941.82(8) Å3 and Z = 1. The crystal structure of martinandresite is unique and is based on the Al-Si-O tetrahedral framework containing four-, six- and eight-membered rings of tetrahedra. Si and Al are disordered between the two independent tetrahedral sites. The strongest lines of the powder X-ray diffraction pattern [d, Å (I, %) (hkl)] are: 6.98 (74) (001), 6.26 (83) (011), 5.61 (100) (101), 3.933 (60) (220, 031), 3.191 (50) (112), 3.170 (62) (041), 3.005 (79) (231, 141). Martinandresite is named after Martin Andres (b. 1965), the discoverer of the armenite locality of Wasenalp.
Petrozzi, M. T.; Milam, M. D.
1975-01-01
Experimental aerodynamic investigations were conducted in the NASA/Langley unitary plan wind tunnel on a sting mounted 0.010-scale outer mold line model of the 140A/B configuration of the Rockwell International Space Shuttle Vehicle. The primary test objectives were to obtain: (1) six component force and moment data for the mated vehicle at subsonic and transonic conditions, (2) effects of configuration build-up, (3) effects of protuberances, ET/orbiter fairings and attach structures, and (4) elevon deflection effects on wing bending moment. Six component aerodynamic force and moment data and base and balance cavity pressures were recorded over Mach numbers of 1.6, 2.0, 2.5, 2.86, 3.9, and 4.63 at a nominal Reynolds number of 20 to the 6th power per foot. Selected configurations were tested at angles of attack and sideslip from -10 deg to +10 deg. For all configurations involving the orbiter, wing bending, and torsion coefficients were measured on the right wing.
Energy Technology Data Exchange (ETDEWEB)
Khatoon, Sarvari [Nanochemistry Laboratory, Department of Chemistry, Jamia Millia Islamia, New Delhi 110025 (India); Coolahan, Kelsey; Lofland, Samuel E. [Department of Physics and Astronomy, Rowan University, 201 Mullica Hill Road, Glassboro, NJ 08028 (United States); Ahmad, Tokeer, E-mail: tahmad3@jmi.ac.in [Nanochemistry Laboratory, Department of Chemistry, Jamia Millia Islamia, New Delhi 110025 (India)
2012-12-25
Highlights: Black-Right-Pointing-Pointer Monophasic Mn-doped In{sub 2}O{sub 3} nanoparticles by solvothermal method for first time. Black-Right-Pointing-Pointer Plausible reaction mechanism and kinetics study using thermogravimetric analysis. Black-Right-Pointing-Pointer Highest surface area obtained so far as compared to the literature report. Black-Right-Pointing-Pointer Particle size decreases with increasing Mn concentration. Black-Right-Pointing-Pointer High degree of optical transparency ({approx}95%) is observed. - Abstract: Mn-doped indium oxide (In{sub 2-x}Mn{sub x}O{sub 3}) nanoparticles (7-12 nm) with x = 0.05, 0.10 and 0.15 have been synthesized by solvothermal method using oxalate precursor route for the first time. Powder X-ray diffraction studies showed the formation of monophasic cubic structure of In{sub 2-x}Mn{sub x}O{sub 3} solid solutions. X-ray diffraction and UV-visible reflectance studies revealed that Mn{sup 2+} ions are doped into the In{sub 2}O{sub 3} lattice. Reflectance measurements showed red shift in an energy band gap which decreases with an increase in the Mn concentration. Maximum surface area of 768 m{sup 2} g{sup -1} is obtained for In{sub 1.85}Mn{sub 0.15}O{sub 3} nanoparticles. Magnetization measurement revealed that all the samples are paramagnetic in nature with very weak antiferromagnetic interactions.
All projects related to | Page 626 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Region: South Asia, Central Asia, Far East Asia, Bangladesh, Sri Lanka, India, Nepal, Pakistan, Afghanistan. Program: Governance and Justice. Total Funding: CA$ 76,500.00. Reforming Security Sector Governance South Asia. Project. In South Asia, security discourse has traditionally been confined to government circles, ...
10 CFR 626.6 - Acquiring oil by direct purchase.
2010-01-01
..., DOE may increase the rate of purchases if prices fall below recent price trends or futures markets... accordance with the FAR and the DEAR. (b) Acquisition strategy. (1) DOE solicitations: (i) May be either... availability of ships, pipelines and terminals to move and receive the oil. (3) Based on the market analysis...
40 CFR 63.626 - Performance tests and compliance provisions.
2010-07-01
... Analysis For Phosphate Rock, No. 3 Phosphorus-P2O5 or Ca3(PO4)2, Method B—Gravimetric Quimociac Method. (D..., No. 3 Total Phosphorus-P2O5, Method B—Gravimetric Quimociac Method. (G) Section XI, Methods of..., Method B—Gravimetric Quimociac Method. (C) Section XI, Methods of Analysis For Phosphoric Acid...
Juel, N G; Brox, J I; Hellund, J C; Holte, K B; Berg, T J
2017-12-14
This study compares the prevalence of radiological osteoarthritis (OA) in patients with type 1 diabetes mellitus (DM1) for > 45 years and controls, and explores the association with shoulder pain and glycaemic burden in patients with DM1. The Dialong study is a cross-sectional, observational study with 30 years of historical data on long-term glycaemic control. We included 102 patients with DM1 and 73 diabetes-free controls. Demographic data, worst shoulder pain last week [numeric rating scale (NRS) 0-10], pain on abduction at examination (NRS 0-10), and current and historical glycosylated haemoglobin (HbA 1c ) levels were collected. Standardized shoulder X-rays were taken and interpreted for OA applying the Kellgren-Lawrence classification. In the diabetes group (49% women), the mean ± sd duration of DM1 was 50.6 ± 4.8 years, mean 30 year HbA 1c 7.4%, and age 61.9 ± 7.1 years. The mean age of controls (57% women) was 62.6 ± 7.0 years. Radiological glenohumeral OA was found in 36 diabetes patients (35%) and 10 controls (14%) [odds ratio (OR) 3.4, 95% confidence interval (CI) 1.6 to 7.5; p = 0.002]. Few persons had moderate and severe OA [6.9% vs 1.3%, OR 5.3 (95% Cl 0.6 to 44.1); p = 0.1]. Fifteen diabetes patients had painful OA versus two controls (adjusted OR 5.4, 95% CI 0.6 to 47.9; p = 0.13). There was no association between OA and long-term glycaemic burden (mean 30 year HbA 1c ) in the diabetes group (p > 0.2). Radiological glenohumeral OA was more common in patients with DM1 than in controls for mild, but not moderate and severe OA. The radiological findings were not associated with shoulder pain or long-term glycaemic burden.
Julien, M.-H.; Campana, A.; Rigamonti, A.; Carretta, P.; Borsa, F.; Kuhns, P.; Reyes, A. P.; Moulton, W. G.; Horvatić, M.; Berthier, C.; Vietkin, A.; Revcolevschi, A.
2001-04-01
We report on 139La and 63Cu NMR/NQR measurements in the high-Tc superconductor La1.90Sr0.10CuO4, with Tc=26.5 K. Spin fluctuations probed by 139La spin-lattice relaxation (T1) continuously slow down on cooling through Tc. We argue that spin freezing and superconductivity are bulk effects in this sample. Thus both phenomena have to coexist microscopically. The distribution of 139La T1 values at low temperature reveals a wide spread of spin fluctuation frequencies in CuO2 planes. A simple estimate shows that 63Cu nuclei at sites where electronic fluctuations are the slowest are not observable (wipeout effect) because relaxation times are too short. This means that the 63Cu NQR wipeout, observed in this sample, can be explained primarily by slow magnetic, rather than charge, fluctuations. The magnetic origin of the wipeout is still compatible with a connection between wipeout and charge order [as proposed by Hunt et al., Phys. Rev. Lett. 82, 4300 (1999)], but this connection is indirect. On the other hand, since the wipeout fraction is not an intensive quantity it cannot define a proper order parameter and cannot be used by itself as a criterion for the existence of a stripe phase.
Guyonnet, D; Chassany, O; Ducrotte, P; Picard, C; Mouret, M; Mercier, C-H; Matuchansky, C
2007-08-01
Health-related quality of life (HRQoL) has been rarely evaluated as a primary endpoint in the assessment of the effect of probiotics on the irritable bowel syndrome (IBS). To study the effects of fermented milk containing Bifidobacterium animalis DN-173 010 and yoghurt strains on the IBS in a multicentre, double-blind, controlled trial. A total of 274 primary care adults with constipation-predominant IBS (Rome II) were randomized to consume for 6 weeks either the test fermented milk or a heat-treated yoghurt (control). HRQoL and digestive symptoms were assessed after 3 and 6 weeks on an intention-to-treat population of 267 subjects. The HRQoL discomfort score, the primary endpoint, improved (P food on discomfort HRQoL score and bloating in constipation-predominant IBS, and on stool frequency in subjects with <3 stools/week.
International Nuclear Information System (INIS)
Barroso, J.; Mena, I.; Gomez, L. S.; Milosevic, O.; Rabanal, M. E.
2012-01-01
Spray Pyrolysis (SP) is performed at 700 degree centigrade in dry air atmosphere using common nitrate aqueous solutions (0,1M) as precursor in order to obtain nano structured particles with the composition Gd 2 -xEu x O 3 (x= 0.05, 0.10 and 0.30). In this work, three samples with different atomic europium concentration (1, 2 and 6%) were studied. After, the obtained particles were subjected to different thermal treatments with varying temperatures between 800 and 1000 degree centigrade/12 h in dry air atmosphere. The obtained particles were characterized by XRD, SEM techniques, laser dispersion and steady state fluorescence spectroscopy. The existence of two cubic phases with different symmetry cubic phases (Ia-3, Fm-3m) was identified within the as-prepared samples. Moreover, the presence of Gd 2 O 3 monoclinic phase (C 2 /m) which disappears during the thermal treatments was proved. In all thermally treated samples, it was observed the stabilization of an only Ia-3 phase. Fluorescence emission measurements in all studied samples the presence of Eu 2 + (λ= 430nm), whose intensity increases as long as the content of the monoclinic phase decreases of the Eu 3 + percentage. (Author) 35 refs.
ORF Alignment: NC_002929 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... MGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVETGRGVVTFLDTPGHEAFTAMRA 69 ... Query: 626 EEVVPEEYGGDVPFVPVSAKTGAGIDDLLE...NVLLQAEILELKAPIEAPAKGLVIEARLDK 685 ... EEVVPEEYGGDVPFVPVSAKTGAGIDDLLENVLLQ...AEILELKAPIEAPAKGLVIEARLDK Sbjct: 130 EEVVPEEYGGDVPFVPVSAKTGAGIDDLLENVLLQAEILELKAPIEAPAKGLVIEARLDK 189 ... Query
pBEAM Documentation: Release 0.1.0
Energy Technology Data Exchange (ETDEWEB)
Ning, S. A. [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2013-09-01
The Polynomial Beam Element Analysis Module (pBEAM) is a finite element code for beam-like structures. It was originally written to analyze tower/monopiles and rotor blades of wind turbines but can be used for any beam-like structure. This document discusses installation, usage, and documentation of the module.
40 CFR 86.010-38 - Maintenance instructions.
2010-07-01
... and reasonable cost. These tools shall also be made available in a timely fashion either through the... for later years may be set higher based on the Consumer Price Index, as specified in 40 CFR part 19...
PC-FINPACK, Version 1.010, Documentation Report
National Research Council Canada - National Science Library
Clark, Morris
1993-01-01
...) is that the constancy of the ratio of Total Operating Revenues to Total Assets is an appropriate basis for financial simulation analysis of the accounting data for water supply and waste water...
ORF Alignment: NC_002927 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 10 ... MGHVDHGKTSLLDYIRRAKVASGEAGGITQHIGAYHVETGRGVVTFLDTPGHEAFTAMRA 69 ... Query: 626 EEVVPEEYGGDVPFVPVSAKTGAGIDDL...LENVLLQAEILELKAPIEAPAKGLVIEARLDK 685 ... EEVVPEEYGGDVPFVPVSAKTGAGIDDLLENVL...LQAEILELKAPIEAPAKGLVIEARLDK Sbjct: 130 EEVVPEEYGGDVPFVPVSAKTGAGIDDLLENVLLQAEILELKAPIEAPAKGLVIEARLDK 189 ... Que
Energy Technology Data Exchange (ETDEWEB)
Gaigneaux, E.M. [Fonds National de la Recherche Scientifique of Belgium (Belgium); Naeye, M.L.; Dupont, O.; Ruiz, P.; Delmon, B. [Unite de Catalyse et Chimie des Materiaux Divises, Universite Catholique de Louvain, Louvain-La-Neuve (Belgium); Callant, M.; Kartheuser, B. [CERTECH, Senefffe (Belgium)
1998-12-31
This article concerns the synergetic effects between an MoO{sub 3} sample composed of crystallites exposing preferentially the (010) basal faces and {alpha}-Sb{sub 2}O{sub 4} in the oxygen-assisted dehydration of 2-butanol at 220 C. The conversion of 2-butanol and the yield to butene improved when MoO{sub 3} was reacted in the presence of {alpha}-Sb{sub 2}O{sub 4}. The origin of the synergism is discussed. When reacted in the absence of {alpha}-Sb{sub 2}O{sub 4}, MoO{sub 3} got over-reduced and fragmented to MoO{sub 2}. MoO{sub 2} is intrinsically less active than MoO{sub 3} thus explaining that the deep reduction of MoO{sub 3} corresponds to its tendency to deactivate. In the presence of {alpha}-Sb{sub 2}O{sub 4}, the formation of MoO{sub 2} is inhibited with, as a consequence, the absence of deactivation. This leads to the synergetic effects obtained with the mechanical mixture of MoO{sub 3} with {alpha}-Sb{sub 2}O{sub 4}. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Xu, Chenhong [Key Laboratory of Inorganic Functional Materials and Devices, Shanghai Institute of Ceramics, Chinese Academy of Sciences, 1295 Dingxi Road, Shanghai 200050 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Liu, Zhen; Chen, Xuefeng; Yan, Shiguang; Cao, Fei; Dong, Xianlin; Wang, Genshui, E-mail: genshuiwang@mail.sic.ac.cn [Key Laboratory of Inorganic Functional Materials and Devices, Shanghai Institute of Ceramics, Chinese Academy of Sciences, 1295 Dingxi Road, Shanghai 200050 (China)
2016-08-21
The energy storage performance and charge-discharge properties of Pb{sub 0.98}La{sub 0.02}(Zr{sub 0.35}Sn{sub 0.55}Ti{sub 0.10}){sub 0.995}O{sub 3} (PLZST) antiferroelectric ceramics were investigated through directly measuring the hysteresis loops and pulse discharge current-time curves. The energy density only varies 0.2% per degree from 25 °C to 85 °C, and the energy efficiency maintains at about 90%. Furthermore, an approximate calculating model of maximum power density p{sub max} was established for the discharge process. Under a relatively high working electric field (8.2 kV/mm), this ceramics possess a greatly enhanced power density of 18 MW/cm{sup 3}. Moreover, the pulse power properties did not show degradation until 1500 times of charge-discharge cycling. The large released energy density, high energy efficiency, good temperature stability, greatly enhanced power density, and excellent fatigue endurance combined together make this PLZST ceramics an ideal candidate for pulse power applications.
Abazari, M.; Akdoǧan, E. K.; Safari, A.
2008-05-01
Single phase, epitaxial, ⟨001⟩ oriented, undoped and 1mol% Mn-doped (K0.44,Na0.52,Li0.04)(Nb0.84,Ta0.10,Sb0.06)O3 thin films of 400nm thickness were synthesized on SrRuO3 coated SrTiO3. Such films exhibit well saturated hysteresis loops and have a spontaneous polarization (Ps) of 10μC /cm2, which is a 150% higher over the Ps of the undoped composition. The coercive field of 1mol% Mn doped films is 13kV/cm. Mn-doping results in three orders of magnitude decrease in leakage current above 50kV/cm electric field, which we attribute to the suppression of intrinsic p-type conductivity of undoped films by Mn donors.
40 CFR 180.452 - Primisulfuron-methyl; tolerances for residues.
2010-07-01
... Corn, sweet, stover 0.10 Egg 0.10 Goat, fat 0.10 Goat, meat 0.10 Goat, meat byproducts 0.10 Hog, fat 0.10 Hog, meat 0.10 Hog, meat byproducts 0.10 Horse, fat 0.10 Horse, meat 0.10 Horse, meat byproducts 0..., fat 0.10 Cattle, meat 0.10 Cattle, meat byproducts 0.10 Corn, field, forage 0.10 Corn, field, grain 0...
Energy Technology Data Exchange (ETDEWEB)
Gruber, Mathis; Hermann, Klaus [Fritz-Haber-Institut der MPG, und Sfb 546, Berlin (Germany)
2009-07-01
Various selective oxidation reactions as the selective catalytic reduction (SCR) of NO{sub x} or the ammoxidation of propane/propene to acrylonitrile are processed on vanadium based metal-oxide catalysts in the presence of ammonia. In the reactions the intermediates NH{sub 2}, NH{sub 3}, and NH{sub 4} are involved indicating that the adsorption and dehydrogenation of NH{sub x}, x < 4, are important steps. We have performed theoretical studies of corresponding reaction steps where the catalyst is simulated by a finite section of the V{sub 2}O{sub 5} (010) surface. The calculations apply density-functional theory combined with clusters modeling the adsorbate system. The substrate lowers corresponding dehydrogenation energies considerably compared with values for the gas phase reaction. However, the lowering is too small to make dehydrogenation of NH{sub 3} likely to happen. Our results on the role of oxygen vacancies for the dehydrogenation indicate that such surface defects become important for the reaction. Besides the energetics also the diffusion at the surface influences the reaction. A nudged elastic band (NEB) routine has been implemented to evaluate diffusion paths and barriers. Hydrogen diffusion on the surface will be discussed and additional examples for NH{sub x} diffusion will be shown. Based on these results possible reaction scenarios for the dehydrogenation reaction will be presented.
Abazari, M.; Akdoǧan, E. K.; Safari, A.
2008-11-01
Oxygen partial pressure (PO_2) in pulsed laser deposition significantly influences the composition, microstructure, and electrical properties of epitaxial misfit strain-relieved 450nm ⟨001⟩ oriented epitaxial (K0.44,Na0.52,Li0.04)(Nb0.84,Ta0.10,Sb0.06)O3 thin films on SrRuO3 coated SrTiO3. Films deposited at 400mTorr exhibit high remnant and saturated polarization of 7.5 and 16.5μC /cm2, respectively, which is ˜100% increase over the ones grown at 100mTorr. The dielectric constant linearly increases from 220 to 450 with increasing PO2. The observed changes in surface morphology of the films and their properties are shown to be due to the suppression of volatile A-site cation loss.
Energy Technology Data Exchange (ETDEWEB)
Barroso, J.; Mena, I.; Gomez, L. S.; Milosevic, O.; Rabanal, M. E.
2012-11-01
Spray Pyrolysis (SP) is performed at 700 degree centigrade in dry air atmosphere using common nitrate aqueous solutions (0,1M) as precursor in order to obtain nano structured particles with the composition Gd{sub 2}-xEu{sub x}O{sub 3} (x= 0.05, 0.10 and 0.30). In this work, three samples with different atomic europium concentration (1, 2 and 6%) were studied. After, the obtained particles were subjected to different thermal treatments with varying temperatures between 800 and 1000 degree centigrade/12 h in dry air atmosphere. The obtained particles were characterized by XRD, SEM techniques, laser dispersion and steady state fluorescence spectroscopy. The existence of two cubic phases with different symmetry cubic phases (Ia-3, Fm-3m) was identified within the as-prepared samples. Moreover, the presence of Gd{sub 2}O{sub 3} monoclinic phase (C{sub 2}/m) which disappears during the thermal treatments was proved. In all thermally treated samples, it was observed the stabilization of an only Ia-3 phase. Fluorescence emission measurements in all studied samples the presence of Eu{sup 2}+ ({lambda}= 430nm), whose intensity increases as long as the content of the monoclinic phase decreases of the Eu{sup 3}+ percentage. (Author) 35 refs.
40 CFR 180.515 - Carfentrazone-ethyl; tolerances for residues.
2010-07-01
..., group 16, except rice; straw 0.10 Grain, cereal, group 15 0.10 Grain, cereal, group 15 (except rice... 0.10 Rice, grain 1.3 Rice, hulls 3.5 Rice, straw 1.0 Rye, bran 0.80 Rye, flour 0.80 Safflower, seed 0.10 Salal 0.10 Sapodilla 0.10 Sapote, black 0.10 Sapote, mamey 0.10 Sheep, fat 0.10 Sheep, meat 0...
40 CFR 180.316 - Pyrazon; tolerances for residues.
2010-07-01
... Cattle, liver 0.15 Cattle, meat 0.10 Cattle, meat byproducts, except liver 0.10 Goat, fat 0.10 Goat, liver 0.15 Goat, meat 0.10 Goat, meat byproducts, except liver 0.10 Horse, fat 0.10 Horse, liver 0.15 Horse, meat 0.10 Horse, meat byproducts, except liver 0.10 Milk 0.02 Sheep, fat 0.10 Sheep, liver 0.15...
International Nuclear Information System (INIS)
Sun, Shaowei; Wen, Juan; Qiu, Fei; Yin, Yufang; Xu, Guina; Li, Tianping; Nie, Juan; Xiong, Guozuo; Zhang, Caiping; Liao, Duangfang; Chen, Jianxiong; Tuo, Qinhui
2016-01-01
Daxx is a highly conserved nuclear transcriptional factor, which has been implicated in many nuclear processes including transcription and cell cycle regulation. Our previous study demonstrated Daxx also plays a role in regulation of intracellular cholesterol content. Daxx contains several domains that are essential for interaction with a growing number of proteins. To delineate the underlying mechanism of hypocholesterolemic activity of Daxx, we constructed a set of plasmids which can be used to overexpress different fragments of Daxx and transfected to HepG2 cells. We found that the C- terminal region Daxx626–740 clearly reduced intracellular cholesterol levels and inhibited the expression of SREBPs and SCAP. In GST pull-down experiments and Double immunofluorescence assays, Daxx626–740 was demonstrated to bind directly to androgen receptor (AR). Our findings suggest that the interaction of Daxx626-740 and AR abolishes the AR-mediated activation of SCAP/SREBPs pathway, which suppresses the de novo cholesterol synthesis. Thus, C-terminal domain of Daxx acts as a potential regulator of intracellular cholesterol content in HepG2 cells. - Highlights: • Daxx C-terminal domain reduces cholesterol levels. • Daxx C-terminal domain binds directly to AR. • The interaction of Daxx C-terminal domain and AR suppresses cholesterol synthesis.
Energy Technology Data Exchange (ETDEWEB)
Kolte, Jayant, E-mail: jayantkolte@gmail.com [Department of Metallurgical Engineering and Materials Science, Indian Institute of Technology Bombay, Mumbai (India); Daryapurkar, A.S., E-mail: asdarypaurkar@gmail.com [Department of Basic Sciences, Indian Institute of Information Technology, Nagpur (India); Agarwal, Mohit, E-mail: mohit2705@gmail.com [Department of Electronics and Communication Engineering, Thapar University, Patiala, Punjab (India); Gulwade, D.D., E-mail: devidasgulwade@gmail.com [Department of Physics, V.E.S. College of Arts, Commerce and Science, Chembur, Mumbai (India); Gopalan, P., E-mail: pgopalan@iitb.ac.in [Department of Metallurgical Engineering and Materials Science, Indian Institute of Technology Bombay, Mumbai (India)
2017-06-01
Multiferroic materials have attracted the attention of scientific community all over the world due to smart functionality and attractive applications such as in magnetoelectric memory and magnetoelectric sensors. In this paper, we report on the ferroelectric, magnetic and magnetoelectric properties of microwave sintered BiFeO{sub 3} (BFO) and Bi{sub 0.90}La{sub 0.10}Fe{sub 0.95}Mn{sub 0.05}O{sub 3} (BLFMO) ceramics. The ferromagnetic and paramagnetic components have been deconvoluted using standard magnetization equation. The ferromagnetic saturation and paramagnetic susceptibility for BFO are found to be 0.046 emu/g and 1.17 × 10{sup -5} emu/g·Oe respectively. The magnetization in BLFMO increases enormously as compared to BFO due to suppression of cycloid spin. The magnetoelectric voltage coefficient for BFO is 3.37 mV/cm·Oe, while for BLFMO it is 10.11 mV/cm·Oe. As compared to BFO, BLFMO exhibits improved ferroelectric, magnetic and magnetoelectric properties. - Highlights: • Ferromagnetic and paramagnetic components calculated from total magnetization. • Magnetoelectric and magnetodielectric coefficients of BFO and BLFMO were measured. • BFO shows linear change in magnetoelectric voltage coefficient with ac magnetic field. • Both BFO and BLFMO follows Ginzburg Landau equation for multiferroics. • Relative to BFO, BLFMO exhibits leakage current that is three order lower.
46 CFR 160.010-1 - Incorporation by reference.
2010-10-01
... Bureau of Standards (NBS) “The Universal Color Language” and “The Color Names Dictionary” in Color: Universal Language and Dictionary of Names, National Bureau of Standards Special Publication 440. Military...
1935 15' Quad #010 Aerial Photo Mosaic Index
Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...
46 CFR 160.010-3 - Inflatable buoyant apparatus.
2010-10-01
... capacity of 25 or more persons must be provided with self-bailing floor drains. If the floor of a reversible one includes one or more drains, each drain must be arranged to completely drain the floor of... the buoyancy tubes are not vivid reddish orange, vivid yellow, or a fluorescent color of a similar hue...
Uuring : Eesti autostumisel on Lääne-Euroopaga võrreldes palju arenguruumi
2007-01-01
Autostumisest Eestis ja Euroopa Liidu liikmesriikides, Euroopa Komisjoni poolt tellitud Eurobaromeetri uuringu tulemustest. Lisa: 2006. aastal esmaregistreeriti Eestis kokku 74 212 sõiduautot, aasta varem 60 626 sõiduautot.
Energy Technology Data Exchange (ETDEWEB)
Beltrán, J.J., E-mail: jjbj08@gmail.com [Grupo de Energías Alternativas y Biomasa (GEAB-CIDTEC), Universidad Popular del Cesar, UPC, Balneario Hurtado Via Patillal, Valledupar (Colombia); Grupo de Estado Sólido, Facultad de Ciencias Exactas y Naturales, Universidad de Antioquia, UdeA, Calle 70 No 52-21, Medellín (Colombia); Barrero, C.A. [Grupo de Estado Sólido, Facultad de Ciencias Exactas y Naturales, Universidad de Antioquia, UdeA, Calle 70 No 52-21, Medellín (Colombia); Punnoose, A. [Department of Physics, Boise State University, Boise, ID 83725-1570 (United States)
2016-08-15
We have carefully investigated the structural, optical and electronic properties and related them with changes in the magnetism of sol-gel synthesized Zn{sub 1−x}Co{sub x}O (0≤x≤0.10) nanoparticles. Samples with x≤0.05 were free of spurious phases. Samples with x≤0.03 were found to be with only high spin Co{sup 2+} ions into ZnO structure, whereas sample with x=0.05, exhibited the presence of high spin Co{sup 2+} and low spin Co{sup 3+}. We found that the intensity of the main EPR peak associated with Co{sup 2+} varies with the nominal Co content in a similar manner as the saturation magnetization and coercive field do. These results point out that the ferromagnetism in these samples should directly be correlated with the presence of divalent cobalt ions. Bound magnetic polaron (BMP) model and the charge transfer model are insufficient to explain the ferromagnetic properties of Zn{sub 1−x}Co{sub x}O nanoparticles. The room temperature ferromagnetism (RTFM) may be originated from a combination of several factors such as the interaction of high spin Co{sup 2+} ions, perturbation/alteration and/or changes in the electronic structure of ZnO close to the valence band edge and grain boundary effects. - Graphical abstract: The intensity of the main EPR peak associated with Co{sup 2+} varies with the nominal Co content in a similar manner as the saturation magnetization and coercive field do. These results point out that the ferromagnetism in these samples should directly be correlated with the presence of Co{sup 2+} ions. Display Omitted - Highlights: • Systematic and carefully study of physical-chemical properties of Zn{sub 1−x}Co{sub x}O nanoparticles. • Samples with x=0.01 and 0.03 were found to be with only high spin Co{sup 2+}. • Sample with x=0.05, exhibited the presence of high spin Co{sup 2+} and low spin Co{sup 3+}. • The BMP and charge transfer models seem not explain the ferromagnetic properties. • RTFM: high spin Co{sup 2+} ions
2012-06-15
.... Cir. 1990) (``Timken''), as clarified by Diamond Sawblades Mfrs. Coalition v. United States, 626 F.3d... information and data from the investigation. The Department's redetermination resulted in changing Taifa's...
75 FR 58376 - Environmental Impacts Statements; Notice of Availability
2010-09-24
... Seastrand 626-574-5278. EIS No. 20100378, Draft Supplement, USFS, OR, North Fork Burnt River Mining Project... Restoration Plan DOI/DOC, New Circumstances Bearing on the Council's Restoration Effort, Implementation...
: tous les projets | Page 626 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sujet: BIRDS, ZOONOSES, INFECTIOUS DISEASES. Région: Central Asia, Far East Asia, South Asia, Cambodia, China, Viet Nam, Thailand. Programme: Alimentation, environnement et santé. Financement total : CA$ 750,000.00. Grippe aviaire chez les oiseaux migrateurs : réseau régional de surveillance et de suivi.
African Journals Online (AJOL)
pc
protozoa belonging to the genus Plasmodium. 2014) ... evaluating the phytochemicals, acute toxicity and in vitro antiplasmodi chloroform leaf ..... Genetics can Teach us about Malaria. Am. J. Hum. ... nigricans. Pharmaceutical Biology, 42: 626-.
2013-11-27
... Diamond Sawblades Mfrs. Coalition v. United States, 626 F.3d 1374 (Fed. Cir. 2010) (Diamond Sawblades... does not change TUTRIC's cash deposit rate. \\7\\ See Implementation of Determinations Under Section 129...
Energy Technology Data Exchange (ETDEWEB)
Gweon, Hye Mi [Seoul National University College of Medicine, Seoul National University Hospital, Department of Radiology, Seoul (Korea, Republic of); Gangnam Severance Hospital, Yonsei University College of Medicine, Department of Radiology, Seoul (Korea, Republic of); Cho, Nariya; Kim, Soo-Yeon [Seoul National University College of Medicine, Seoul National University Hospital, Department of Radiology, Seoul (Korea, Republic of); Koo, Hye Ryoung [Hanyang University College of Medicine, Department of Radiology, Seoul (Korea, Republic of); Seo, Mirinae [Kyung Hee University College of Medicine, Department of Radiology, Seoul (Korea, Republic of); Chu, Ajung [Seoul National University College of Medicine, Boramae Medical Center, Department of Radiology, Seoul (Korea, Republic of); Son, Eun Ju [Gangnam Severance Hospital, Yonsei University College of Medicine, Department of Radiology, Seoul (Korea, Republic of)
2017-08-15
To retrospectively evaluate characteristics of and determine appropriate follow-up recommendations for BI-RADS category 3 lesions detected in preoperative MRI of breast cancer patients. BI-RADS category 3 assessments were identified from the breast MRI database for 5,110 consecutive breast cancer patients who had undergone preoperative MRI and surgery. Patient and lesion characteristics, malignancy rate, and interval between lesion detection and cancer diagnosis were analysed. Histopathological results or imaging at or after 2-year follow-up were used as reference standards. Of the 626 lesions, morphological features included a single focus in 26.5% (n = 166), multiple foci in 47.1% (n = 295), mass in 21.7% (n = 136) and non-mass enhancement in 4.6% (n = 29). Cancer was found in 0.8% (5/626) at a median interval of 50 months (range, 29-66 months). Malignancy rate according to morphological feature was: 1.8% (3/166) in a single focus, 0.7% (1/136) in mass and 3.4% (1/29) in non-mass enhancement. All detected cancers were stage 0 or IA. Annual follow-up might be adequate for BI-RADS category 3 lesions detected at preoperative MRI because of the 0.8% (5/626) malignancy rate, long interval between lesion detection and cancer diagnosis, and early stage of diagnosed cancers. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Ahmad, Tokeer, E-mail: tahmad3@jmi.ac.in [Nanochemistry Laboratory, Department of Chemistry, Jamia Millia Islamia, New Delhi 110025 (India); Khatoon, Sarvari [Nanochemistry Laboratory, Department of Chemistry, Jamia Millia Islamia, New Delhi 110025 (India); Coolahan, Kelsey [Department of Physics and Astronomy, Rowan University, 201 Mullica Hill Road, Glassboro, NJ 08028 (United States)
2013-09-01
Graphical abstract: Monophasic and crystalline In{sub 2−x}Ni{sub x}O{sub 3} nanoparticles of size 8–15 nm have been synthesized solvothermally and showed red shift in energy band gap which decreases on increasing Ni{sup 2+} concentration in In{sub 2}O{sub 3} host lattice. - Highlights: • Monophasic Ni-doped In{sub 2}O{sub 3} nanoparticles by solvothermal method for first time. • Plausible reaction mechanism using thermogravimetric analysis. • High surface area with small particle size obtained. • Solid solutions exhibit paramagnetism with very weak antiferromagnetic interactions. - Abstract: In{sub 2−x}Ni{sub x}O{sub 3} (x = 0.05, 0.10 and 0.15) nanoparticles were successfully synthesized by solvothermal method by the thermal decomposition of oxalate precursor at 450 °C for the first time. X-ray diffraction studies showed the formation of highly crystalline and monophasic cubic structure of In{sub 2}O{sub 3} which is attributed to the formation of solid solution. These nanoparticles show good optical transmittance in the visible region. Optical measurements showed an energy band gap which decreases with increasing Ni concentration. The grain size decreases from 15 nm to 8 nm and surface area increases from 90 to 254 m{sup 2} g{sup −1} on increasing the Ni concentration. High dielectric constant and dielectric loss has been obtained which indicates the conducting nature of these solid solutions. Magnetic measurements showed that the samples are strong paramagnetic in nature with very weak antiferromagnetic interactions. No evidence of ferromagnetism is observed for these solid solutions at room temperature.
Project Title: Partnering to establish emergency medicine in Ethiopia ...
International Development Research Centre (IDRC) Digital Library (Canada)
2014-03-31
Mar 31, 2014 ... current graduate working in. Ethiopia). Procedures ..... majority (62.6%) of deaths occurred within 48 hours of admission to the emergency department. ..... encourage graduates to pursue careers within Ethiopia. Conclusion: A ...
2013-09-25
... Sawblades Mfrs. Coalition v. United States, 626 F.3d 1374 (Fed. Cir. 2010) (``Diamond Sawblades''), the... a complaint with the CIT to challenge various aspects of the Final Results. \\2\\ Tapered Roller...
Energy Technology Data Exchange (ETDEWEB)
Julien, M.-H.; Campana, A.; Rigamonti, A.; Carretta, P.; Borsa, F.; Kuhns, P.; Reyes, A. P.; Moulton, W. G.; Horvatic, M.; Berthier, C. (and others)
2001-04-01
We report on {sup 139}La and {sup 63}Cu NMR/NQR measurements in the high-T{sub c} superconductor La{sub 1.90}Sr{sub 0.10}CuO{sub 4}, with T{sub c}=26.5 K. Spin fluctuations probed by {sup 139}La spin-lattice relaxation (T{sub 1}) continuously slow down on cooling through T{sub c}. We argue that spin freezing and superconductivity are bulk effects in this sample. Thus both phenomena have to coexist microscopically. The distribution of {sup 139}La T{sub 1} values at low temperature reveals a wide spread of spin fluctuation frequencies in CuO{sub 2} planes. A simple estimate shows that {sup 63}Cu nuclei at sites where electronic fluctuations are the slowest are not observable (wipeout effect) because relaxation times are too short. This means that the {sup 63}Cu NQR wipeout, observed in this sample, can be explained primarily by slow magnetic, rather than charge, fluctuations. The magnetic origin of the wipeout is still compatible with a connection between wipeout and charge order [as proposed by Hunt , Phys. Rev. Lett. 82, 4300 (1999)], but this connection is indirect. On the other hand, since the wipeout fraction is not an intensive quantity it cannot define a proper order parameter and cannot be used by itself as a criterion for the existence of a stripe phase.
2012-02-06
... clarified by Diamond Sawblades Mfrs. Coalition v. United States, 626 F.3d 1374 (Fed. Cir. 2010) (``Diamond.... The Department's redetermination resulted in changing DunAn's margin from 12.95 percent to 11.83...
Directory of Open Access Journals (Sweden)
Akihiro Fukushima
2018-01-01
Full Text Available Oseltamivir has a hypothermic effect in mice when injected intraperitoneally (i.p. and intracerebroventricularly (i.c.v.. Here we show that the hypothermia evoked by i.c.v.-oseltamivir is inhibited by non-selective dopamine receptor antagonists (sulpiride and haloperidol and the D2-selective antagonist L-741,626, but not by D1/D5-selective and D3-selective antagonists (SCH-23390 and SB-277011-A, respectively. The hypothermic effect of i.p.-administered oseltamivir was not inhibited by sulpiride, haloperidol, L-741,626 and SCH-23390. In addition, neither sulpiride, haloperidol nor SCH-23390 blocked hypothermia evoked by i.c.v.-administered oseltamivir carboxylate (a hydrolyzed metabolite of oseltamivir. These results suggest that oseltamivir in the brain induces hypothermia through activation of dopamine D2 receptors.
DEFF Research Database (Denmark)
Thomsen, Morgane; Barrett, Andrew C.; Butler, Paul
2017-01-01
effects of dopamine D2- and D3-preferring ligands on choice between intravenous cocaine and palatable food in rats. Under baseline conditions, cocaine maintained dose-dependent increases in cocaine choice and reciprocal decreases in food choice. Acutely, the D2 agonist R-(2)-norpropylapomorphine (NPA......) and antagonist L-741,626 [3-[[4-(4-chlorophenyl)-4-hydroxypiperidin-lyl] methyl-1H-indole] produced leftward and rightward shifts in cocaine dose-effect curves, respectively, whereas the partial agonist terguride had no effect. All three drugs dose-dependently decreased food-maintained responding. Chronically......, the effects of R-(2)-norpropylapomorphine and L-741,626 on cocaine selfadministration showed marked tolerance, whereas suppression of food-reinforced behavior persisted. Acute effects of the D3 ligands were less systematic and most consistent with nonselective decreases in cocaine- and food-maintained...
Implementation of trinary logic in a polarization encoded optical shadow-casting scheme.
Rizvi, R A; Zaheer, K; Zubairy, M S
1991-03-10
The design of various multioutput trinary combinational logic units by a polarization encoded optical shadow-casting (POSC) technique is presented. The POSC modified algorithm is employed to design and implement these logic elements in a trinary number system with separate and simultaneous generation of outputs. A detailed solution of the POSC logic equations for a fixed source plane and a fixed decoding mask is given to obtain input pixel coding for a trinary half-adder, full adder, and subtractor.
Czech Academy of Sciences Publication Activity Database
Liščák, R.; Vladyka, V.; Novotný Jr., J.; Brožek, G.; Náměstková, Kateřina; Mareš, V.; Hájek, M.; Herynek, V.; Syková, Eva
2002-01-01
Roč. 97, č. 5 (2002), s. 666-673 ISSN 0022-3085 Institutional research plan: CEZ:AV0Z5039906 Keywords : radiosurgery * Leksell gamma knife Subject RIV: FH - Neurology Impact factor: 2.626, year: 2002
2011-09-15
... clarified by Diamond Sawblades Mfrs. Coalition v. United States, 626 F.3d 1374 (Fed. Cir. 2010) (``Diamond... Department's redetermination resulted in a change to Rongxin's margin from 11.48 percent in the Final Results...
Czech Academy of Sciences Publication Activity Database
Mendel, Jan; Urbánková, Soňa; Vyskočilová, M.
2013-01-01
Roč. 13, č. 3 (2013), s. 546-549 ISSN 1755-098X Institutional support: RVO:68081766 Keywords : genetic database * microsatellite marker loci Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.626, year: 2013
77 FR 71807 - Changes in Flood Hazard Determinations
2012-12-04
... P. Street, Plainfield, team.com/starr/LOMR/ 05-6606P). Collins, IL 60544. Pages/RegionV.aspx... Lake The Honorable 626 Geneva Street, http://www.starr- June 4, 2012 550466 Geneva (11-05- Jim Connors...
Causes of sudden natural death: A medicolegal (coroner's) autopsy ...
African Journals Online (AJOL)
SNDs) that occurred in medical cases in an African referral centre. Design: A descriptive retrospective study. Setting: University of Benin Teaching Hospital, between January 2005 and December 2011. Subjects: Autopsy reports of 626 cases that ...
2013-10-31
...''), as clarified by Diamond Sawblades Mfrs. Coalition v. United States, 626 F.3d 1374 (Fed. Cir. 2010... for the AT&M entity.\\6\\ Therefore, this amended final determination does not change the AT&M entity's...
40 CFR 421.284 - Standards of performance for new sources.
2010-07-01
...) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Secondary Tantalum... 25.860 12.320 Lead 5.656 2.626 Nickel 11.110 7.474 Zinc 20.600 8.484 Tantalum 9.090 Total suspended...
Czech Academy of Sciences Publication Activity Database
Ntougias, S.; Baldrian, Petr; Ehaliotis, C.; Nerud, František; Antoniou, T.; Merhautová, Věra; Zervakis, G.
2012-01-01
Roč. 88, č. 5 (2012), s. 620-626 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z50200510 Keywords : White-rot fungi * Mushroom * Toxicity Subject RIV: EE - Microbiology, Virology Impact factor: 3.137, year: 2012
2012-06-26
... (Fed. Cir. 1990) (Timken), as clarified by Diamond Sawblades Mfrs. Coalition v. United States, 626 F.3d... margin changed from 67.37 percent to 66.06 percent. On June 14, 2012, the Court sustained the Department...
Energy Technology Data Exchange (ETDEWEB)
Li, Junliang; Wang, Shaorong; Sun, Xiufu; Liu, Renzhu; Ye, Xiaofeng; Wen, Zhaoyin [Shanghai Institute of Ceramics, Chinese Academy of Sciences, 1295 Dingxi Road, Shanghai 200050 (China)
2008-12-01
Porous composite cathodes including (La{sub 0.74}Bi{sub 0.10}Sr{sub 0.16})MnO{sub 3-{delta}} (LBSM) and Bi{sub 1.4}Er{sub 0.6}O{sub 3} (ESB) were fabricated and characterized using AC impedance spectroscopy. In our earlier work, the growth and aggregation of ESB particles were found in LBSM-ESB composite cathodes. In this study, therefore, two approaches were used to restrain the growth and aggregation of ESB particles. First, the sintering temperature of the composite cathode was reduced by introducing a sintering function layer, which caused a 22% reduction in the initial polarization resistance (R), but the cathode polarization resistance decreased at a rate of 2.15 x 10{sup -4} {omega} cm{sup 2} h{sup -1} at 700 C during a period of 100 h. Second, nano-sized Gd-doped ceria powder (CGO) was added to the composite cathode system. Stability improvement was achieved at 10 vol% CGO, and the degradation rate at 700 C was 4.01 x 10{sup -5} {omega} cm{sup 2} h{sup -1} during a period of 100 h. (author)
Evaluation of radon in hot spring waters in Zacatecas State, Mexico
International Nuclear Information System (INIS)
Favila R, E.; Lopez del Rio, H.; Davila R, I.; Mireles G, F.
2010-10-01
It is well know that radon is a potent human carcinogen. Because of the health concern of radon exposure, concentrations of 222 Rn were determined in ten hot spring water samples from the Mexican state of Zacatecas. The thermal water is collected in pools and used mainly for recreational purposes. In addition to radon level, the water samples were characterized for temperature, conductivity, and ph. Liquid scintillation spectrometry was used to measure 222 Rn and its decay products by mixing directly an aliquot of water with a commercial liquid scintillation. All measurements were carried out using a liquid scintillation counter (Wallac 1411). The water temperature ranged from 28 to 59 C, while the ph varied from 7.2 to 9.0, and the water conductivity was between 202.4 and 1072 μS/cm. The 222 Rn concentration varied in the range 3.9-32.6 Bq/L. In addition, the risk to radon exposure was assessed by considering three -real and possible- radon exposure scenarios: 1) ingestion of bottled thermal water, 2) direct ingestion of thermal water; and 3) vapor inhalation. The annual effective dose calculated for ingestion of bottled thermal water was 0.010-0.083 mSv/yr; for ingestion of water was 0.65-5.47 mSv/yr; and for inhalation was 0.28-2.81 mSv/yr. (Author)
TMACS test procedure TP010: Integration summary. Revision 6
International Nuclear Information System (INIS)
Spurling, D.G.
1994-01-01
The TMACS Software Project Test Procedures translate the project's acceptance criteria into test steps. Software releases are certified when the affected Test Procedures are successfully performed and the customers authorize installation of these changes. This Test Procedure verifies that Test Procedures 1, 2, 3, 5 and 9 (WHC-SD-WM-TRP-105, 106, 107, 109 and 113) of TMACS Software Release 4.1 have been successfully completed
TMACS Test Procedure TP010: Integration summary. Revision 5
International Nuclear Information System (INIS)
Spurling, D.G.
1994-01-01
The TMACS Soft Project Test Procedures translate the project's acceptance criteria into test steps. Software releases are certified when the affected Test Procedures are successfully performed and the customers authorize installation of these changes
16 CFR 0.10 - Office of the Executive Director.
2010-01-01
... on strategic planning and assessing the management and resource implications of any proposed action..., financial management, information technology, and human resources. [65 FR 78408, Dec. 15, 2000] ... Chairman, is the chief operating official who develops and implements management and administrative...
Mental health and psychiatry research in Brazil: scientific production from 1999 to 2003.
Razzouk, Denise; Zorzetto, Ricardo; Dubugras, Maria Thereza; Gerolin, Jerônimo; Mari, Jair de Jesus
2006-08-01
To assess the extent of mental health scientific production in Brazil from 1999 to 2003, and to identify the nature of the publications generated, their sources of finance and the ways of publicly disseminating the research findings. Searches for publications were conducted in the Medline and PsychInfo databases for the period 1999-2003. A semi-structured questionnaire developed by an international team was applied to 626 mental health researchers, covering each interviewee's educational background, research experience, access to funding sources, public impact and research priorities. The sample was composed by 626 mental health researchers identified from 792 publications indexed on Medline and PsychInfo databases for the period above, and from a list of reviewers of Revista Brasileira de Psiquiatria. In Brazil, 792 publications were produced by 525 authors between 1999 and 2003 (441 indexed in Medline and 398 in the ISI database). The main topics were: depression (29.1%), substance misuse (14.6%), psychoses (10%), childhood disorders (7%) and dementia (6.7%). Among the 626 Brazilian mental health researchers, 329 answered the questionnaire. There were steadily increasing numbers of Brazilian articles on mental health published in foreign journals from 1999 to 2003: the number of articles in Medline tripled and it doubled in the ISI database. The content of these articles corresponded to the priorities within mental health, but there is a need for better interlinking between researchers and mental health policymakers.
Differences in hydrolytic abilities of two crude lipases from Geotrichum candidum 4013
Czech Academy of Sciences Publication Activity Database
Brabcová, Jana; Zarevúcka, Marie; Macková, M.
2010-01-01
Roč. 27, č. 12 (2010), s. 1029-1038 ISSN 0749-503X Institutional research plan: CEZ:AV0Z40550506 Keywords : lipase * Geotrichum candidum * substrate specificity Subject RIV: CC - Organic Chemistry Impact factor: 1.626, year: 2010
Post‑Operative Complications and Visual Outcome in Eye Camp ...
African Journals Online (AJOL)
Background: Cataract is the principal cause of blindness in India, accounting for 62.6%. This problem can be .... base hospital, 413 patients met the inclusion criteria and were enrolled in ..... Financial support and sponsorship. Nil. Conflicts of ...
Czech Academy of Sciences Publication Activity Database
Kuncírová, V.; Poništ, S.; Mihalová, D.; Dráfi, F.; Nosáľ, R.; Acquaviva, A.; Gardi, C.; Harmatha, Juraj; Hrádková, I.; Bauerová, K.
2014-01-01
Roč. 28, č. 6 (2014), s. 616-626 ISSN 0767-3981 Institutional support: RVO:61388963 Keywords : arthritis * inflammation * oxidative stress * combination therapy * methotrexate * N-feruloylserotonin Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.121, year: 2014
Assessing spring direct mortality to avifauna from wind energy facilities in the Dakotas
Graff, Brianna J.; Jenks, Jonathan A.; Stafford, Joshua D.; Jensen, Kent C.; Grovenburg, Troy W.
2016-01-01
The Northern Great Plains (NGP) contains much of the remaining temperate grasslands, an ecosystem that is one of the most converted and least protected in the world. Within the NGP, the Prairie Pothole Region (PPR) provides important habitat for >50% of North America's breeding waterfowl and many species of shorebirds, waterbirds, and grassland songbirds. This region also has high wind energy potential, but the effects of wind energy developments on migratory and resident bird and bat populations in the NGP remains understudied. This is troubling considering >2,200 wind turbines are actively generating power in the region and numerous wind energy projects have been proposed for development in the future. Our objectives were to estimate avian and bat fatality rates for wind turbines situated in cropland- and grassland-dominated landscapes, document species at high risk to direct mortality, and assess the influence of habitat variables on waterfowl mortality at 2 wind farms in the NGP. From 10 March to 7 June 2013–2014, we completed 2,398 searches around turbines for carcasses at the Tatanka Wind Farm (TAWF) and the Edgeley-Kulm Wind Farm (EKWF) in South Dakota and North Dakota. During spring, we found 92 turbine-related mortalities comprising 33 species and documented a greater diversity of species (n = 30) killed at TAWF (predominately grassland) than at EKWF (n = 9; predominately agricultural fields). After accounting for detection rates, we estimated spring mortality of 1.86 (SE = 0.22) deaths/megawatt (MW) at TAWF and 2.55 (SE = 0.51) deaths/MW at EKWF. Waterfowl spring (Mar–Jun) fatality rates were 0.79 (SE = 0.11) and 0.91 (SE = 0.10) deaths/MW at TAWF and EKWF, respectively. Our results suggest that future wind facility siting decisions consider avoiding grassland habitats and locate turbines in pre-existing fragmented and converted habitat outside of high densities of breeding waterfowl and major migration corridors.
Common business objects: Demonstrating interoperability in the oil and gas industry
International Nuclear Information System (INIS)
McLellan, S.G.; Abusalbi, N.; Brown, J.; Quinlivan, W.F.
1997-01-01
The PetroTechnical Open Software Corp. (POSC) was organized in 1990 to define technical methods to make it easier to design interoperable data solutions for oil and gas companies. When POSC rolls out seed implementations, oilfield service members must validate them, correct any errors or ambiguities, and champion these corrections into the original specifications before full integration into POSC-compliant, commercial products. Organizations like POSC are assuming a new role of promoting formation of projects where E and P companies and vendors jointly test their pieces of the migration puzzle on small subsets of the whole problem. The authors describe three such joint projects. While confirming the value of such open cross-company cooperation, these cases also help to redefine interoperability in terms of business objects that will be common across oilfield companies, their applications, access software, data, or data stores
Sunkara, Sesh Kamal; Antonisamy, Belavendra; Selliah, Hepsy Y; Kamath, Mohan S
2017-02-01
Is PGD associated with the risk of adverse perinatal outcomes such as pre-term birth (PTB) and low birth weight (LBW)? There was no increase in the risk of adverse perinatal outcomes of PTB, and LBW following PGD compared with autologous IVF. Pregnancies resulting from ART are associated with a higher risk of pregnancy complications compared with spontaneously conceived pregnancies. The possible reason of adverse obstetric outcomes following ART has been attributed to the underlying infertility itself and embryo specific epigenetic modifications due to the IVF techniques. It is of interest whether interventions such as embryo biopsy as performed in PGD affect perinatal outcomes. Anonymous data were obtained from the Human Fertilization and Embryology Authority (HFEA), the statutory regulator of ART in the UK. The HFEA has collected data prospectively on all ART performed in the UK since 1991. Data from 1996 to 2011 involving a total of 88 010 singleton live births were analysed including 87 571 following autologous stimulated IVF ± ICSI and 439 following PGD cycles. Data on all women undergoing either a stimulated fresh IVF ± ICSI treatment cycle or a PGD cycle during the period from 1996 to 2011 were analysed to compare perinatal outcomes of PTB and LBW among singleton live births. Logistic regression analysis was performed adjusting for female age category, year of treatment, previous IVF cycles, infertility diagnosis, number of oocytes retrieved, whether IVF or ICSI was used and day of embryo transfer. There was no increase in the risk of PTB and LBW following PGD versus autologous stimulated IVF ± ICSI treatment, unadjusted odds of PTB (odds ratio (OR) 0.68, 95% CI: 0.46-0.99) and LBW (OR 0.56, 95% CI: 0.37-0.85). After adjusting for the potential confounders, there was again no increase in the risk of the adverse perinatal outcomes following PGD: PTB (adjusted odds ratio (aOR) 0.66, 95% CI: 0.45-0.98) and LBW (aOR 0.58, 95% CI: 0.38-0.88). Although the
Carneiro-Júnior, M A; Quintão-Júnior, J F; Drummond, L R; Lavorato, V N; Drummond, F R; Amadeu, M A; Oliveira, E M; Felix, L B; Cruz, J S; Mill, J G; Natali, A J; Prímola-Gomes, T N
2014-08-29
In cardiomyocytes, calcium (Ca2+) release units comprise clusters of intracellular Ca2+ release channels located on the sarcoplasmic reticulum, and hypertension is well established as a cause of defects in calcium release unit function. Our objective was to determine whether endurance exercise training could attenuate the deleterious effects of hypertension on calcium release unit components and Ca2+ sparks in left ventricular myocytes of spontaneously hypertensive rats. Male Wistar and spontaneously hypertensive rats (4 months of age) were divided into 4 groups: normotensive (NC) and hypertensive control (HC), and normotensive (NT) and hypertensive trained (HT) animals (7 rats per group). NC and HC rats were submitted to a low-intensity treadmill running protocol (5 days/week, 1 h/day, 0% grade, and 50-60% of maximal running speed) for 8 weeks. Gene expression of the ryanodine receptor type 2 (RyR2) and FK506 binding protein (FKBP12.6) increased (270%) and decreased (88%), respectively, in HC compared to NC rats. Endurance exercise training reversed these changes by reducing RyR2 (230%) and normalizing FKBP12.6 gene expression (112%). Hypertension also increased the frequency of Ca2+ sparks (HC=7.61±0.26 vs NC=4.79±0.19 per 100 µm/s) and decreased its amplitude (HC=0.260±0.08 vs NC=0.324±0.10 ΔF/F0), full width at half-maximum amplitude (HC=1.05±0.08 vs NC=1.26±0.01 µm), total duration (HC=11.51±0.12 vs NC=14.97±0.24 ms), time to peak (HC=4.84±0.06 vs NC=6.31±0.14 ms), and time constant of decay (HC=8.68±0.12 vs NC=10.21±0.22 ms). These changes were partially reversed in HT rats (frequency of Ca2+ sparks=6.26±0.19 µm/s, amplitude=0.282±0.10 ΔF/F0, full width at half-maximum amplitude=1.14±0.01 µm, total duration=13.34±0.17 ms, time to peak=5.43±0.08 ms, and time constant of decay=9.43±0.15 ms). Endurance exercise training attenuated the deleterious effects of hypertension on calcium release units of left ventricular myocytes.
Carneiro-Júnior, M A; Quintão-Júnior, J F; Drummond, L R; Lavorato, V N; Drummond, F R; Amadeu, M A; Oliveira, E M; Felix, L B; Cruz, J S; Mill, J G; Natali, A J; Prímola-Gomes, T N
2014-11-01
In cardiomyocytes, calcium (Ca²⁺) release units comprise clusters of intracellular Ca²⁺ release channels located on the sarcoplasmic reticulum, and hypertension is well established as a cause of defects in calcium release unit function. Our objective was to determine whether endurance exercise training could attenuate the deleterious effects of hypertension on calcium release unit components and Ca²⁺ sparks in left ventricular myocytes of spontaneously hypertensive rats. Male Wistar and spontaneously hypertensive rats (4 months of age) were divided into 4 groups: normotensive (NC) and hypertensive control (HC), and normotensive (NT) and hypertensive trained (HT) animals (7 rats per group). NC and HC rats were submitted to a low-intensity treadmill running protocol (5 days/week, 1 h/day, 0% grade, and 50-60% of maximal running speed) for 8 weeks. Gene expression of the ryanodine receptor type 2 (RyR2) and FK506 binding protein (FKBP12.6) increased (270%) and decreased (88%), respectively, in HC compared to NC rats. Endurance exercise training reversed these changes by reducing RyR2 (230%) and normalizing FKBP12.6 gene expression (112%). Hypertension also increased the frequency of Ca²⁺ sparks (HC=7.61 ± 0.26 vs NC=4.79 ± 0.19 per 100 µm/s) and decreased its amplitude (HC=0.260 ± 0.08 vs NC=0.324 ± 0.10 ΔF/F0), full width at half-maximum amplitude (HC=1.05 ± 0.08 vs NC=1.26 ± 0.01 µm), total duration (HC=11.51 ± 0.12 vs NC=14.97 ± 0.24 ms), time to peak (HC=4.84 ± 0.06 vs NC=6.31 ± 0.14 ms), and time constant of decay (HC=8.68 ± 0.12 vs NC=10.21 ± 0.22 ms). These changes were partially reversed in HT rats (frequency of Ca²⁺ sparks=6.26 ± 0.19 µm/s, amplitude=0.282 ± 0.10 ΔF/F0, full width at half-maximum amplitude=1.14 ± 0.01 µm, total duration=13.34 ± 0.17 ms, time to peak=5.43 ± 0.08 ms, and time constant of decay=9.43 ± 0.15 ms). Endurance exercise training attenuated the deleterious effects of hypertension on calcium release
Directory of Open Access Journals (Sweden)
M.A. Carneiro-Júnior
2014-11-01
Full Text Available In cardiomyocytes, calcium (Ca2+ release units comprise clusters of intracellular Ca2+ release channels located on the sarcoplasmic reticulum, and hypertension is well established as a cause of defects in calcium release unit function. Our objective was to determine whether endurance exercise training could attenuate the deleterious effects of hypertension on calcium release unit components and Ca2+ sparks in left ventricular myocytes of spontaneously hypertensive rats. Male Wistar and spontaneously hypertensive rats (4 months of age were divided into 4 groups: normotensive (NC and hypertensive control (HC, and normotensive (NT and hypertensive trained (HT animals (7 rats per group. NC and HC rats were submitted to a low-intensity treadmill running protocol (5 days/week, 1 h/day, 0% grade, and 50-60% of maximal running speed for 8 weeks. Gene expression of the ryanodine receptor type 2 (RyR2 and FK506 binding protein (FKBP12.6 increased (270% and decreased (88%, respectively, in HC compared to NC rats. Endurance exercise training reversed these changes by reducing RyR2 (230% and normalizing FKBP12.6 gene expression (112%. Hypertension also increased the frequency of Ca2+ sparks (HC=7.61±0.26 vs NC=4.79±0.19 per 100 µm/s and decreased its amplitude (HC=0.260±0.08 vs NC=0.324±0.10 ΔF/F0, full width at half-maximum amplitude (HC=1.05±0.08 vs NC=1.26±0.01 µm, total duration (HC=11.51±0.12 vs NC=14.97±0.24 ms, time to peak (HC=4.84±0.06 vs NC=6.31±0.14 ms, and time constant of decay (HC=8.68±0.12 vs NC=10.21±0.22 ms. These changes were partially reversed in HT rats (frequency of Ca2+ sparks=6.26±0.19 µm/s, amplitude=0.282±0.10 ΔF/F0, full width at half-maximum amplitude=1.14±0.01 µm, total duration=13.34±0.17 ms, time to peak=5.43±0.08 ms, and time constant of decay=9.43±0.15 ms. Endurance exercise training attenuated the deleterious effects of hypertension on calcium release units of left ventricular myocytes.
International Nuclear Information System (INIS)
Carneiro-Júnior, M.A.; Quintão-Júnior, J.F.; Drummond, L.R.; Lavorato, V.N.; Drummond, F.R.; Amadeu, M.A.; Oliveira, E.M.; Felix, L.B.; Cruz, J.S.; Mill, J.G.; Natali, A.J.; Prímola-Gomes, T.N.
2014-01-01
In cardiomyocytes, calcium (Ca 2+ ) release units comprise clusters of intracellular Ca 2+ release channels located on the sarcoplasmic reticulum, and hypertension is well established as a cause of defects in calcium release unit function. Our objective was to determine whether endurance exercise training could attenuate the deleterious effects of hypertension on calcium release unit components and Ca 2+ sparks in left ventricular myocytes of spontaneously hypertensive rats. Male Wistar and spontaneously hypertensive rats (4 months of age) were divided into 4 groups: normotensive (NC) and hypertensive control (HC), and normotensive (NT) and hypertensive trained (HT) animals (7 rats per group). NC and HC rats were submitted to a low-intensity treadmill running protocol (5 days/week, 1 h/day, 0% grade, and 50-60% of maximal running speed) for 8 weeks. Gene expression of the ryanodine receptor type 2 (RyR2) and FK506 binding protein (FKBP12.6) increased (270%) and decreased (88%), respectively, in HC compared to NC rats. Endurance exercise training reversed these changes by reducing RyR2 (230%) and normalizing FKBP12.6 gene expression (112%). Hypertension also increased the frequency of Ca 2+ sparks (HC=7.61±0.26 vs NC=4.79±0.19 per 100 µm/s) and decreased its amplitude (HC=0.260±0.08 vs NC=0.324±0.10 ΔF/F 0 ), full width at half-maximum amplitude (HC=1.05±0.08 vs NC=1.26±0.01 µm), total duration (HC=11.51±0.12 vs NC=14.97±0.24 ms), time to peak (HC=4.84±0.06 vs NC=6.31±0.14 ms), and time constant of decay (HC=8.68±0.12 vs NC=10.21±0.22 ms). These changes were partially reversed in HT rats (frequency of Ca 2+ sparks=6.26±0.19 µm/s, amplitude=0.282±0.10 ΔF/F 0 , full width at half-maximum amplitude=1.14±0.01 µm, total duration=13.34±0.17 ms, time to peak=5.43±0.08 ms, and time constant of decay=9.43±0.15 ms). Endurance exercise training attenuated the deleterious effects of hypertension on calcium release units of left ventricular myocytes
Energy Technology Data Exchange (ETDEWEB)
Carneiro-Júnior, M.A. [Universidade Federal do Espírito Santo, Departamento de Ciências Fisiológicas, Vitória, ES (Brazil); Universidade Federal de Viçosa, Laboratório de Biologia do Exercício, Departamento de Educação Física, Viçosa, MG (Brazil); Quintão-Júnior, J.F.; Drummond, L.R.; Lavorato, V.N.; Drummond, F.R. [Universidade Federal de Viçosa, Laboratório de Biologia do Exercício, Departamento de Educação Física, Viçosa, MG (Brazil); Amadeu, M.A.; Oliveira, E.M. [Universidade de São Paulo, Laboratório de Bioquímica e Biologia Molecular do Exercício, Escola de Educação Física e Esportes, São Paulo, SP (Brazil); Felix, L.B. [Universidade Federal de Viçosa, Departamento de Engenharia Elétrica, Viçosa, MG (Brazil); Cruz, J.S. [Universidade Federal de Minas Gerais, Laboratório de Membranas Excitáveis e Biologia Cardiovascular, Departamento de Bioquímica e Imunologia, Belo Horizonte, MG (Brazil); Mill, J.G. [Universidade Federal do Espírito Santo, Departamento de Ciências Fisiológicas, Vitória, ES (Brazil); Natali, A.J.; Prímola-Gomes, T.N. [Universidade Federal de Viçosa, Laboratório de Biologia do Exercício, Departamento de Educação Física, Viçosa, MG (Brazil)
2014-08-29
In cardiomyocytes, calcium (Ca{sup 2+}) release units comprise clusters of intracellular Ca{sup 2+} release channels located on the sarcoplasmic reticulum, and hypertension is well established as a cause of defects in calcium release unit function. Our objective was to determine whether endurance exercise training could attenuate the deleterious effects of hypertension on calcium release unit components and Ca{sup 2+} sparks in left ventricular myocytes of spontaneously hypertensive rats. Male Wistar and spontaneously hypertensive rats (4 months of age) were divided into 4 groups: normotensive (NC) and hypertensive control (HC), and normotensive (NT) and hypertensive trained (HT) animals (7 rats per group). NC and HC rats were submitted to a low-intensity treadmill running protocol (5 days/week, 1 h/day, 0% grade, and 50-60% of maximal running speed) for 8 weeks. Gene expression of the ryanodine receptor type 2 (RyR2) and FK506 binding protein (FKBP12.6) increased (270%) and decreased (88%), respectively, in HC compared to NC rats. Endurance exercise training reversed these changes by reducing RyR2 (230%) and normalizing FKBP12.6 gene expression (112%). Hypertension also increased the frequency of Ca{sup 2+} sparks (HC=7.61±0.26 vs NC=4.79±0.19 per 100 µm/s) and decreased its amplitude (HC=0.260±0.08 vs NC=0.324±0.10 ΔF/F{sub 0}), full width at half-maximum amplitude (HC=1.05±0.08 vs NC=1.26±0.01 µm), total duration (HC=11.51±0.12 vs NC=14.97±0.24 ms), time to peak (HC=4.84±0.06 vs NC=6.31±0.14 ms), and time constant of decay (HC=8.68±0.12 vs NC=10.21±0.22 ms). These changes were partially reversed in HT rats (frequency of Ca{sup 2+} sparks=6.26±0.19 µm/s, amplitude=0.282±0.10 ΔF/F{sub 0}, full width at half-maximum amplitude=1.14±0.01 µm, total duration=13.34±0.17 ms, time to peak=5.43±0.08 ms, and time constant of decay=9.43±0.15 ms). Endurance exercise training attenuated the deleterious effects of hypertension on calcium release units of
Li, Yan; Yu, Hua; Zheng, Siqian; Miao, Yang; Yin, Shi; Li, Peng; Bian, Ying
2016-01-01
Rare earth elements (REEs) have undergone a steady spread in several industrial, agriculture and medical applications. With the aim of exploring a sensitive and reliable indicator of estimating exposure level to REEs, a simple, accurate and specific ICP-MS method for simultaneous direct quantification of 15 REEs (89Y, 139La, 140Ce, 141Pr, 146Nd, 147Sm, 153Eu, 157Gd, 159Tb, 163Dy, 165Ho, 166Er, 169Tm, 172Yb and 175Lu) in human urine has been developed and validated. The method showed good linearity for all REEs in human urine in the concentrations ranging from 0.001–1.000 μg∙L−1 with r2 > 0.997. The limits of detection and quantification for this method were in the range of 0.009–0.010 μg∙L−1 and 0.029–0.037 μg∙L−1, the recoveries on spiked samples of the 15 REEs ranged from 93.3% to 103.0% and the relative percentage differences were less than 6.2% in duplicate samples, and the intra- and inter-day variations of the analysis were less than 1.28% and less than 0.85% for all REEs, respectively. The developed method was successfully applied to the determination of 15 REEs in 31 urine samples obtained from the control subjects and the workers engaged in work with manufacturing of ultrafine and nanoparticles containing cerium and lanthanum oxide. The results suggested that only the urinary levels of La (1.234 ± 0.626 μg∙L−1), Ce (1.492 ± 0.995 μg∙L−1), Nd (0.014 ± 0.009 μg∙L−1) and Gd (0.023 ± 0.010 μg∙L−1) among the exposed workers were significantly higher (p < 0.05) than the levels measured in the control subjects. From these, La and Ce were the primary components, and accounted for 88% of the total REEs. Lanthanum comprised 27% of the total REEs while Ce made up the majority of REE content at 61%. The remaining elements only made up 1% each, with the exception of Dy which was not detected. Comparison with the previously published data, the levels of urinary La and Ce in workers and the control subjects show a higher trend
Ruumid Mozarti ümber / Saale Kareda
Kareda, Saale, 1968-
2006-01-01
Mozarti muusika peegeldusi tänapäeva ühiskonnas ja muusikas. Georg Friedrich Haasi teosest "Sieben Klangräume zu den unvollendeten Fragmenten des Requiems KV 626 von W. A. Mozart" ("Seitse kõlaruumi Mozarti Reekviemi lõpetamata fragmentidele")
Magnetic mapping of distribution of wood ash used for fertilization of forest soil
Czech Academy of Sciences Publication Activity Database
Petrovský, Eduard; Remeš, J.; Kapička, Aleš; Podrázský, V.; Grison, Hana; Borůvka, L.
2018-01-01
Roč. 626, June (2018), s. 228-234 ISSN 0048-9697 Institutional support: RVO:67985530 Keywords : forest soil * wood ash * fertilizing * tree plants * iron oxides * rock magnetism Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 4.900, year: 2016
Properties of GD-152 collective states
Czech Academy of Sciences Publication Activity Database
Adam, Jindřich; Honusek, Milan; Dobeš, Jan; Kalinnikov, V. G.; Mrázek, Jaromír; Pronskikh, V. S.; Čaloun, Pavel; Lebeděv, NA.; Stegailov, V. I.; Tsoupko-Sitnikov, V. M.
2003-01-01
Roč. 18, č. 4 (2003), s. 605-626 ISSN 1434-6001 Institutional research plan: CEZ:AV0Z1048901 Keywords : interacting boson model * multipole-mixing ratios * negative parity states Subject RIV: BE - Theoretical Physics Impact factor: 2.097, year: 2003
Westinghouse Learning Corp., Annapolis, MD.
Test items for the introduction to psychology and leadership course (see the final reports which summarize the course development project, EM 010 418, EM 010 419, and EM 010 484) which were compiled as part of the project documentation and which are coordinated with the text-workbook on morale and esprit de corps (EM 010 439, EM 010 440, and EM…
Panova-Noeva, M; Hermanns, I M; Schulz, A; Laubert-Reh, D; Zeller, T; Blankenberg, S; Spronk, H M; Münzel, T; Lackner, K J; Ten Cate, H; Wild, P S
2016-04-01
The advancements in cancer treatment and detection of early cancer have resulted in steady increase of adult cancer survivors over the years. However, due to the long term toxic effects of chemotherapy and radiotherapy, the incidence of cardiovascular diseases (CVD) is increasing in survivors. Identifying risk factors and interventions to reduce the excess burden of CVD in this vulnerable population is urgently needed. To investigate the cardiovascular risk factors (CVRFs), inflammation and coagulation profile in cancer survivors from a large population-based study. Presence of CVRFs and laboratory markers have been compared in individuals with (n=1,359) and without (n=13,626) history of cancer. Standard laboratory profile, including blood glucose and lipid profile, has been evaluated in 15,010 individuals from the Gutenberg Health Study (GHS). Coagulation factors, D-dimer and von Willebrand factor (vWF) activity were available in N=4,993. The individuals with history of cancer were older compared to no history of cancer with mean age of 61,5years and 54.4years, respectively (pprofile showed cancer survivors with lower erythrocyte, platelet and white blood cell counts and higher C-reactive protein (CRP), glucose, HbA1c and triglycerides levels (pprofile in individuals with history of cancer from a well characterized population-representative adult sample. It gives evidence for higher prevalence of CVRFs, particularly diabetes in this vulnerable population. Markers of inflammation as CRP and fibrinogen and vWF activity were higher in cancer survivors independent of the cardiovascular risk profile. These results underline the increased risk of CVD and need for development of cardio-oncology programs offering cardiovascular prevention. © 2016 Elsevier Ltd. All rights reserved.
Weak Properties and Robustness of t-Hill Estimators
Czech Academy of Sciences Publication Activity Database
Jordanova, P.; Fabián, Zdeněk; Hermann, P.; Střelec, L.; Rivera, A.; Girard, S.; Torres, S.; Stehlík, M.
2016-01-01
Roč. 19, č. 4 (2016), s. 591-626 ISSN 1386-1999 Institutional support: RVO:67985807 Keywords : asymptotic properties of estimators * point estimation * t-Hill estimator * t-lgHill estimator Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.679, year: 2016
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 7. Irving Langmuir - A Pioneering Industrial Physical Chemist. Anil K Rajvanshi. General Article Volume 13 Issue 7 July 2008 pp 619-626. Fulltext. Click here to view fulltext PDF. Permanent link:
Vzpomínka na Lubomíra Doležela
Czech Academy of Sciences Publication Activity Database
Sládek, Ondřej
2017-01-01
Roč. 88, č. 3 (2017), s. 623-626 ISSN 0080-2557 Institutional support: RVO:68378068 Keywords : Lubomír Doležel; Structuralism; Narrative Semantics; Semiotics * Structuralism * Narrative Semantics * Semiotics Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures
Czech Academy of Sciences Publication Activity Database
Arias, M. C.; Atteke, C.; Augusto, S. C.; Bailey, J.; Bazaga, P.; Beheregaray, L. B.; Benoit, L.; Blatrix, R.; Born, C.; Brito, R. M.; Chen, H.-K.; Covarrubias, S.; de Vega, C.; Djiéto-Lordon, C.; Dubois, M.-P.; Francisco, F. O.; García, C.; Concalves, P. H. P.; González, C.; Gutiérrez-Rodríguez, C.; Hammer, M. P.; Herrera, C. M.; Itoh, H.; Kamimura, S.; Karaoglu, H.; Kojima, S.; Li, S.-L.; Ling, H. J.; Matos Maravi, Pavel F.; McKey, D.; Mezui-M’Eko, J.; Ornelas, J. F.; Park, R. F.; Pozo, M. I.; Ramula, S.; Rigueiro, C.; Sandoval-Castillo, J.; Santiago, L. R.; Seino, M. M.; Song, C.-B.; Takeshima, H.; Vasemägi, A.; Wellings, C. R.; Yan, J.; Du, Y.-Z.; Zhang, C.-R.; Zhang, T.-Y.
2013-01-01
Roč. 13, č. 4 (2013), s. 760-762 ISSN 1755-098X Institutional support: RVO:60077344 Keywords : molecular ecology Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.626, year: 2013 http://onlinelibrary.wiley.com/doi/10.1111/1755-0998.12121/pdf
Workshop on Scientific Analysis and Policy in Network Security
2010-09-10
Government through the UJAP Programme tinder contract P6/26 BCRYPT. References 1. ANSI X9.19, Financial Institution Retail Message Authentication, American... tinder what circumstances. Implementers are concerned with mechanisms. Our observation is that commanders and implementers communicate through de- scripl
Lubrication of the human ankle joint in running
Czech Academy of Sciences Publication Activity Database
Hlaváček, Miroslav
2009-01-01
Roč. 3, č. 5 (2009), s. 619-626 ISSN 1970-8734 R&D Projects: GA ČR(CZ) GA103/07/0043 Institutional research plan: CEZ:AV0Z20710524 Keywords : human ankle joint * lubrication * running Subject RIV: JJ - Other Materials
Electric Vehicle Sharing Planning and Operations
2018-02-01
Dongfang Zhao (ORCID ID 0000-0002-5424-9915); Xiaopeng (Shaw) Li (ORCID ID 0000-0002-5264-3775); Yu Zhang (ORCID ID 0000-0003-1202-626X) This project includes literature review and proposing a model for EV planning and operations. We first conducted ...
2013-02-27
... no U.S.-approved vaccines or treatments for the virus. In accordance with the regulations, APHIS..., which was adjusted from 12,010 to 1,072. The estimated total annual burden hours has now decreased from... Washington, DC, this 20th day of February 2013. Kevin Shea, Acting Administrator, Animal and Plant Health...
2010-01-06
....10 ppm; cattle; meat at 0.10 ppm; cattle; meat byproducts; except liver at 0.10 ppm; cattle; liver at 1.2 ppm; eggs at 0.1 ppm; goat; fat at 0.10 ppm; goat; meat at 0.10 ppm; goat; meat byproducts; except liver at 0.10 ppm; goat; liver at 1.2 ppm; hog; fat at 0.01 ppm; hog; meat at 0.01 ppm; hog; meat...
78 FR 69597 - Airworthiness Directives; Piaggio Aero Industries S.p.A Airplanes
2013-11-20
...-Italy; phone: +39 010 6481353; fax: +39 010 6481881; email: [email protected] ; Internet..., economic, environmental, and energy aspects of this proposed AD. We will consider all comments received by... Genova-Italy; phone: +39 010 6481353; fax: +39 010 6481881; email: [email protected
2010-07-01
...) DDC 6V92TA 1979-1987 0.50 0.30 1988-1989 0.30 0.10 DDC 6V92TA DDECI 1986-1987 0.30 0.30 DDC 6V92TA DDECII 1988-1991 0.31 0.10 1992 0.25 0.10 1993 (no trap) 0.25 0.10 1993 (trap) 0.07 0.07 DDC Series 50 1993 0.16 0.10 DDC 6V71N 1973-1987 0.50 0.50 1988-1989 0.50 0.10 DDC 6V71T 1985-1986 0.50 0.50 DDC...
Lifescience Database Archive (English)
Full Text Available 5060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete cds. 626 0.0 8 AC1170...bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 254 4e-77 AC117076_18( AC1
Morphological adaptations of Porrhomma spiders (Araneae: Linyphiidae) inhabiting soil
Czech Academy of Sciences Publication Activity Database
Růžička, Vlastimil; Laška, V.; Mikula, J.; Tuf, I.H.
2011-01-01
Roč. 39, č. 2 (2011), s. 355-357 ISSN 0161-8202 Grant - others:National Research Programme II(CZ) 2B06101 Institutional research plan: CEZ:AV0Z50070508 Keywords : Araneae * soil profile * troglomorphisms Subject RIV: EG - Zoology Impact factor: 0.626, year: 2011
Czech Academy of Sciences Publication Activity Database
Šestáková, L.; Bermejo, R.; Chlup, Zdeněk; Danzer, R.
2011-01-01
Roč. 102, č. 6 (2011), s. 613-626 ISSN 1862-5282 Institutional research plan: CEZ:AV0Z20410507 Keywords : Ceramic laminates * Layered ceramics * Residual stress * Fracture toughness * Threshold strength Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.830, year: 2011
2012-12-11
... announced below concerns Occupational Safety and Health Education and Research Centers (ERC) PAR 10-217... evaluation of applications received in response to ``Occupational Safety and Health Education and Research... Officer, CDC/NIOSH, 626 Cochrans Mill Road, Mailstop P-05, Pittsburgh, Pennsylvania 15236, Telephone: (412...
Czech Academy of Sciences Publication Activity Database
Šplíchal, Igor; Trebichavský, Ilja; Šplíchalová, Alla; Barrow, P. A.
2005-01-01
Roč. 103, - (2005), s. 155-161 ISSN 0165-2427 R&D Projects: GA ČR GA524/01/0917 Institutional research plan: CEZ:AV0Z5020903 Keywords : salmonella typhimurium * gnotobiotic pig * cytokine Subject RIV: EE - Microbiology, Virology Impact factor: 1.626, year: 2005
Czech Academy of Sciences Publication Activity Database
Piwosz, Kasia; Kownacka, J.; Ameryk, A.; Zalewski, M.; Pernthalter, J.
2016-01-01
Roč. 52, č. 4 (2016), s. 626-637 ISSN 0022-3646 R&D Projects: GA ČR GA13-11281S Institutional support: RVO:61388971 Keywords : Baltic Sea * chromalveolate hypothesis * coastal waters Subject RIV: EE - Microbiology, Virology Impact factor: 2.608, year: 2016
2012-05-15
... FURTHER INFORMATION CONTACT: Dr. Jeff Kohler, NIOSH, Associate Director for Mining, 626 Cochrans Mill Road... DEPARTMENT OF HEALTH AND HUMAN SERVICES Centers for Disease Control and Prevention [Docket Number... Health (NIOSH) of the Centers for Disease Control and Prevention (CDC), Department of Health and Human...
Adsorption and intercalation of anionic surfactants onto layered ...
Indian Academy of Sciences (India)
Unknown
Department of Polymer Technology, Kamaraj College of Engineering and Technology, Virudhunagar 626 ... Layered double hydroxides (LDH) with brucite like structure was modified with various anionic ... Recently the application of layered double hydroxides ..... Yuan Q, Wei M, Wang Z and Duan X 2004 Clays Clay Miner.
Dicty_cDB: Contig-U04414-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available -1A; AltName: Full... 68 4e-10 AB241241_1( AB241241 |pid:none) Symbiotic protist ...48727 |pid:none) Salmo salar clone ssal-rgb2-626-04... 65 3e-09 AB241242_1( AB241242 |pid:none) Symbiotic
Effects of size on mass density and its influence on mechanical and ...
Indian Academy of Sciences (India)
MS received 30 November 2015; accepted 10 March 2016 ... diameter of 4 nm, the mass density values of zirconia nanoparticles are 3.898, 3.626 and 3.488 g· cm ... Botan Jawdat Abdullah et al ..... [3] Christensen A and Carter E A 1998 Phys.
Clinical analysis of firework-related ocular injuries during Spring Festival 2009.
Jing, Yuan; Yi-qiao, Xing; Yan-ning, Yang; Ming, Ai; An-huai, Yang; Lian-hong, Zhou
2010-03-01
To document the clinical features, management and visual outcome of fireworks-related ocular injuries during the Spring Festival. A retrospective analysis of all patients with fireworks-related ocular injuries attending the Department of Ophthalmology in Renmin Hospital of Wuhan University from January 20 to February 10, 2009. Age, gender, laterality, type of fireworks, location of incident, initial best-corrected visual acuity (BCVA), diagnosis, management, and final BCVA at last follow-up were documented. Relevant clinical features and visual outcome were evaluated. We observed 25 eyes in 24 patients. Injuries were more frequent in children (ten, 41.7%), males (19, 79.2%), and as open globe injury (15, 62.5%). The most common pyrotechnical products causing accidents were firecrackers (12, 50%). Rural residents had significantly higher rates of injury compared to urban residents (P = 0.023). Of 25 eyes, the most common injuries were corneal/scleral/corneoscleral open globe trauma (15, 60%), traumatic cataract (14, 56%), vitreous hemorrhage (seven, 28%) and retinal detachment (seven, 28%). Most eyes (23, 92%) received surgical intervention, including one (4%) eye enucleation. Vitrectomy was the most surgical treatment. After management, visual outcomes showed statistically significant improvement (P = 0.008). Initial BCVA correlated strongly with final BCVA (P = 0.010). Fireworks-related ocular injuries occur mainly in children, males and rural settings, are frequently severe and visually devastating. Therefore, preventive measures should be strengthened, including public education and legal restriction on the sale and use of fireworks.
Beinart, R A; Gartman, A; Sanders, J G; Luther, G W; Girguis, P R
2015-05-07
Symbiotic associations between animals and chemoautotrophic bacteria crowd around hydrothermal vents. In these associations, symbiotic bacteria use chemical reductants from venting fluid for the energy to support autotrophy, providing primary nutrition for the host. At vents along the Eastern Lau Spreading Center, the partially oxidized sulfur compounds (POSCs) thiosulfate and polysulfide have been detected in and around animal communities but away from venting fluid. The use of POSCs for autotrophy, as an alternative to the chemical substrates in venting fluid, could mitigate competition in these communities. To determine whether ESLC symbioses could use thiosulfate to support carbon fixation or produce POSCs during sulfide oxidation, we used high-pressure, flow-through incubations to assess the productivity of three symbiotic mollusc genera-the snails Alviniconcha spp. and Ifremeria nautilei, and the mussel Bathymodiolus brevior-when oxidizing sulfide and thiosulfate. Via the incorporation of isotopically labelled inorganic carbon, we found that the symbionts of all three genera supported autotrophy while oxidizing both sulfide and thiosulfate, though at different rates. Additionally, by concurrently measuring their effect on sulfur compounds in the aquaria with voltammetric microelectrodes, we showed that these symbioses excreted POSCs under highly sulfidic conditions, illustrating that these symbioses could represent a source for POSCs in their habitat. Furthermore, we revealed spatial disparity in the rates of carbon fixation among the animals in our incubations, which might have implications for the variability of productivity in situ. Together, these results re-shape our thinking about sulfur cycling and productivity by vent symbioses, demonstrating that thiosulfate may be an ecologically important energy source for vent symbioses and that they also likely impact the local geochemical regime through the excretion of POSCs.
2018-01-31
Aritra Pal (ORCID ID 0000-0002-2256-2464) Yu Zhang (ORCID ID 0000-0003-1202-626X) Changhyun Kwon (ORCID ID 0000-0001-8455-6396) Bike Sharing is a sustainable mode of urban mobility, not only for regular commuters but also for casual users and tourist...
Reconstruction of the anterior cruciate ligament: dynamic strain evaluation of the graft
Czech Academy of Sciences Publication Activity Database
Handl, Milan; Držík, M.; Cerulli, G.; Povýšil, C.; Chlpík, J.; Varga, F.; Amler, Evžen; Trč, T.
2007-01-01
Roč. 15, - (2007), s. 233-241 ISSN 0942-2056 R&D Projects: GA AV ČR(CZ) 1ET400110403 Institutional research plan: CEZ:AV0Z50390512 Keywords : Anterior cruciate ligament * Tendon * Material properties Subject RIV: BO - Biophysics Impact factor: 1.626, year: 2007
Czech Academy of Sciences Publication Activity Database
Kavan, Ladislav; Vlčková Živcová, Zuzana; Petrák, Václav; Frank, Otakar; Janda, Pavel; Tarábková, Hana; Nesladek, M.; Mortet, Vincent
2015-01-01
Roč. 179, OCT 2015 (2015), s. 626-636 ISSN 0013-4686 R&D Projects: GA ČR GA13-31783S Institutional support: RVO:61388955 ; RVO:68378271 Keywords : Raman spectroelectrochemistry * atomic force microscopy * boron doped diamond Subject RIV: CG - Electrochemistry Impact factor: 4.803, year: 2015
general practitioners and national health insurance
African Journals Online (AJOL)
preferences with regard to financing, provision, benefits, ... publicly funded alternative, with the express aim of ensuring ..... Finance (13.4%). In each case the remaining respondents disapproved. The preferred levels at which NHI should be administered were stated to be national (62.6%), provincial (55.2%) or district.
Characterization of Anopheles Pseudopunctipennis Larval Habitats
1996-01-01
conditions for growth in the small, slow-mov- ing streams and side pools of receding rivers con- taining a rich growth of green algae (Shannon and...Sanchez, J. L. Cespedes, R. Vargas- Sagarnaga and R. Rodriguez. 1992. Evidencia genetica 626 JOURNAL OF THE AMERICAN MOSQUITO CONTROL ASSOCIATION
Blood pressure, lipids, and obesity are associated with retinopathy : the hoorn study
van Leiden, Hendrik A; Dekker, Jacqueline M; Moll, Annette C; Nijpels, Giel; Heine, Robert J; Bouter, Lex M; Stehouwer, Coen D A; Polak, Bettine C P
OBJECTIVE: To study potential risk factors for retinopathy in diabetic and nondiabetic individuals. RESEARCH DESIGN AND METHODS: The Hoorn Study is a population-based study including 2,484 50- to 74-year-old Caucasians. A subsample of 626 individuals stratified by age, sex, and glucose tolerance
Illicit drug use and violence in acute psychosis among acute adult ...
African Journals Online (AJOL)
Department of Psychiatry, Faculty of Medicine and Health Sciences, Stellenbosch ... Background and objective: The prevalence of mental illness and illicit .... risk to the patients or adverse implications on their rights ... (age, gender, and drainage area), illicit drug use, violent ... whom (62.6%) were older than 35 years.
Czech Academy of Sciences Publication Activity Database
Kohutiar, Matej; Ivica, Josko; Vytášek, R.; Skoumalová, A.; Illner, Jan; Šantorová, P.; Wilhelm, Jiří
2016-01-01
Roč. 65, č. 4 (2016), s. 617-626 ISSN 0862-8408 R&D Projects: GA ČR(CZ) GAP303/11/0298 Institutional support: RVO:67985823 Keywords : oxidative stress * free radicals * lipid peroxidation * lipofuscinlike pigments * nitrotyrosine Subject RIV: ED - Physiology Impact factor: 1.461, year: 2016
International Nuclear Information System (INIS)
Woodbury, F.B.W.
1980-12-01
The Bureau of Mines is evaluating alternative technologies to treat oxidized taconites. Since process control is an essential element in the application of these process technologies, research was performed on a prototype monitoring system utilizing a californium-252 (252-Cf) neutron source and a thermal neutron capture-gamma ray spectra analysis method to measure the amount of iron and percent solids in process slurries. The prototype system was used to monitor the concentrate and tailing streams in a 900-lb/hr flotation pilot plant during continuous around-the-clock tests. The iron content of the process slurries was determined by measuring the total peak areas under the capture spectrum peaks at 7.626-7.632 MeV, the associated escape peaks at 7.136-7.122 and 6.626-6.612 MeV, and the iron doublets at 4.900 and 4.998 MeV. A potential method for determining the percent solids in process slurries using the 2.22 MeV hydrogen capture peak is discussed
Moody AFB, Georgia. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.
1982-05-21
626 626 3oo ŕ 8IlL AL3 3 16 . 4o 8.4 84,] 89.1 841. - 100 21. .1 86 0 6S 7. So0 $S .O S .1 08.0 ISO 6S.? S . 8 6350 ? $S0 2 00 21. 57. 66. jT Ii &Tel...0 71. 762 72@ . 72. 72.. 72a 72a 72C 72, 72. 72, m 8000 32. 75 75. 75. 75o 75. 76. 76o 76. 2 76. 2 76.2 76. Z 76.2 76.2 76.2 7a. 27000 327 -76J 760b...79 7,. Ti 76.• I .7.7 76.7 76. 76. 6.7 76T.7 76. >1o4000 15.1 72.1 77.1 78. 74. 78 78.5 78.5 78.5 78.* 78.5 78.5 78.5 78.5 78.5 78.5>2000o Iso 73+ 781
Directory of Open Access Journals (Sweden)
Rodrigo Meneses de Barros
2008-01-01
Full Text Available Este trabalho apresenta uma lista de dípteros sarcofagídeos adultos coletados em carcaça de porco Sus scrofa, em área de Cerrado, Distrito Federal, Brasil, sendo um estudo sobre a composição da fauna de Diptera na região. O trabalho de campo acompanhou o processo de decomposição da carcaça e foi realizado durante 45 dias. A partir de 4.626 indivíduos coletados foram identificadas 28 espécies, sendo 16 novos registros para a região estudada.This work presents a list of adult flesh flies collected from a pig carrion Sus scrofa, in a Cerrado area of Distrito Federal, Brazil, being a study on the composition of the dipteran fauna in the region. The field work followed the decay of the carrion and was conduced for 45 days. From 4,626 collected flesh flies, 28 species were identified, consisting in 16 new records for this region.
Negi, N. S.; Kumar, Rakesh; Sharma, Hakikat; Shah, J.; Kotnala, R. K.
2018-06-01
High performance lead-free multiferroic composites with strong magnetoelectric coupling effect are desired to replace lead-based ceramics in multifunctional device applications due to increasing environmental issues. We report crystal structure, ferroelectric, magnetic, dielectric and magnetoelectric properties of (1-x)Ba0.85Ca0.15Ti0.90Zr0.10O3-(x)CoFe2O4 (BCTZ-CFO) lead-free composites with x = 0.1, 0.3, 0.5, 0.7 and 0.9 synthesized by chemical solution method. BCTZ power was synthesized by sol-gel method while CFO was prepared by metallo-organic decomposition (MOD) method. The XRD results confirm successful formation of the BCTZ-CFO composites without presence of any impurity phase. At room temperature, the BCTZ-CFO composites show multiferroic behavior characterized by ferroelectric and ferromagnetic hysteresis curves. The composite having 10 wt% of CFO exhibited maximum polarization, remnant polarization and coercive field of Ps ∼ 5.1 μC/cm2, Pr ∼ 1.4 μC/cm2 and Ec ∼ 11.6 kV/cm respectively. The BCTZ-CFO composite with 90 wt% of CFO incorporation exhibits improved ferromagnetic properties with Ms ∼ 32 emu/g, Mr ∼ 11.7 emu/g and Hc ∼ 504 Oe. Mӧssbauer spectra analysis show two sets of six-line hyperfine patterns for BCTZ-CFO composites, indicating the presence of Fe3+ ions in both A and B sites. Increasing BCTZ content was found to decrease the hyperfine field strength at both sites and is consistent with the decreasing magnetic moment observed for the samples. The maximum dielectric constant value ε‧ ∼ 678 is obtained at 1 MHz for composite with 10 wt% of CFO phase. The results indicate that the BCTZ-CFO composites are potential lead-free room temperature multiferroic systems.
Energy Technology Data Exchange (ETDEWEB)
Fadhalaoui, Amor [Laboratoire de Chimie des Matériaux, Faculté des Sciences de Bizerte, Zarzouna, Bizerte 7021 (Tunisia); Dhaouadi, Hassouna, E-mail: dhaouadihassouna@yahoo.fr [Laboratoire Matériaux Traitement et Analyse, INRAP, Technopôle Sidi-Thabet, Tunis 2020 (Tunisia); Marouani, Houda [Laboratoire de Chimie des Matériaux, Faculté des Sciences de Bizerte, Zarzouna, Bizerte 7021 (Tunisia); Kouki, Abdessalem [L3M, FSB, Zarzouna, Bizerte 7021 (Tunisia); Madani, Adel [Department of Physics, Applied Science College, Umm Al Qura University, Makkah (Saudi Arabia); Rzaigui, Mohamed [Laboratoire de Chimie des Matériaux, Faculté des Sciences de Bizerte, Zarzouna, Bizerte 7021 (Tunisia)
2016-01-15
Graphical abstract: The Cr{sub x}Ce{sub 1−x}PO{sub 4} (x = 0.00, 0.08, 0.10 and 0.20) nanorods synthesized under hydrothermal conditions. - Highlights: • Cr{sub x}Ce{sub 1−x}PO{sub 4} (x = 0.00–0.20) nanorods were synthesized by hydrothermal method. • Mean crystallite size of the products decreases with Cr-content. • Obvious improvements of the electrical conductivity comparatively to CePO4. - Abstract: Cr{sub x}Ce{sub 1−x}PO{sub 4} (x = 0.00–0.20) nanorods were synthesized using the hydrothermal method. The as-prepared samples were characterized by X-ray diffraction (XRD), infrared absorption spectroscopy (IR) and transmission electron microscopy (TEM). The XRD results revealed the formation of a pure CePO{sub 4} hexagonal phase. TEM images confirmed the nano-size character of the as-prepared samples. Impedance spectroscopy analysis was used to analyze the electrical behavior of samples as a function of frequency at different temperatures. The increase of Cr-amount led to an increase in the total conductivities and decreased the activation energies (E{sub a} (x = 0.00) = 1.08 eV to E{sub a} (x = 0.20) = 0.80 eV). The optical properties of Cr{sub x}Ce{sub 1−x}PO{sub 4} nanomaterials were investigated using UV–vis spectroscopy. The band-gap energy values decreased with increasing Cr-content showing a red-shift trend. The improvement of the electrical conductivity and optical properties makes the Cr{sub x}Ce{sub 1−x}PO{sub 4} nanomaterials possible candidates to be used as electrolytes in solid oxide fuel cells, in photocatalytic and photovoltaic applications.
Energy Technology Data Exchange (ETDEWEB)
Li, Junliang; Wang, Shaorong; Wang, Zhenrong; Liu, Renzhu; Ye, Xiaofeng; Sun, Xiufu; Wen, Tinglian; Wen, Zhaoyin [Shanghai Institute of Ceramics, Chinese Academy of Sciences, 1295 Dingxi Road, Shanghai 200050 (China)
2009-03-15
Porous composite cathodes were fabricated by impregnating (La{sub 0.74}Bi{sub 0.10}Sr{sub 0.16})MnO{sub 3-{delta}} (LBSM) electronic conducting structure with the ionic conducting Ce{sub 0.8}Gd{sub 0.2}O{sub 2-{delta}} (GDC) phase. The ion impregnation of the GDC phase significantly enhanced the electrocatalytic activity of the LBSM electrodes for the O{sub 2} reduction reactions, and the ion-impregnated LBSM-GDC composite cathodes showed excellent performance. At 700 C, the value of the cathode polarization resistance (Rc) was only 0.097 {omega} cm{sup 2} for an ion-impregnated LBSM-GDC cathode, and the performance was gradually improved by increasing the loading of the impregnated GDC. For the performance testing of single cells, the maximum power density was 1036 mW cm{sup -2} at 700 C for a cell with the LBSM-GDC cathode. The results demonstrated the unique combination of the LBSM electronic conducting structure with high ionic conducting GDC phase was a valid method to improve the electrode performance, and the ion-impregnated LBSM-GDC was a promising composite cathode material for the intermediate-temperature solid oxide fuel cells. (author)
Westinghouse Learning Corp., Annapolis, MD.
The ninth volume of the introduction to psychology and leadership course (see the final reports which summarize the development project, EM 010 418, EM 010 419, and EM 010 484) concentrates on morale and esprit de corps and is presented in two documents. Like Volume One (EM 010 420), this document is a self-instructional syndactic text with…
46 CFR 160.010-4 - General requirements for buoyant apparatus.
2010-10-01
... light twine. (h) Each peripheral body type buoyant apparatus without a net or platform on the inside... pigmented in a dark color. A typical method of securing lifelines and pendants to straps of webbing is shown...
MDX-010 in Treating Patients With Recurrent or Refractory Lymphoma
2014-05-22
Adult Grade III Lymphomatoid Granulomatosis; B-cell Chronic Lymphocytic Leukemia; Cutaneous B-cell Non-Hodgkin Lymphoma; Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue; Intraocular Lymphoma; Nodal Marginal Zone B-cell Lymphoma; Recurrent Adult Burkitt Lymphoma; Recurrent Adult Diffuse Large Cell Lymphoma; Recurrent Adult Diffuse Mixed Cell Lymphoma; Recurrent Adult Diffuse Small Cleaved Cell Lymphoma; Recurrent Adult Grade III Lymphomatoid Granulomatosis; Recurrent Adult Hodgkin Lymphoma; Recurrent Adult Immunoblastic Large Cell Lymphoma; Recurrent Adult Lymphoblastic Lymphoma; Recurrent Grade 1 Follicular Lymphoma; Recurrent Grade 2 Follicular Lymphoma; Recurrent Mantle Cell Lymphoma; Recurrent Marginal Zone Lymphoma; Refractory Hairy Cell Leukemia; Small Intestine Lymphoma; Splenic Marginal Zone Lymphoma; Testicular Lymphoma; Waldenström Macroglobulinemia
GenMed 010: a one day workshop on generic medicines
Directory of Open Access Journals (Sweden)
Shankar PR
2011-03-01
Full Text Available This report outlines the content of a one-day workshop onGeneric Medicines that was held at KIST Medical College,Lalitpur, Nepal on 13th December 2010, which was attendedby 32 delegates from different institutions in Nepal, includingpharmacists, pharmacologists and medical doctors. Rightmedicine, right patient, right dose, right frequency andduration, right information and right monitoring areconditions to be fulfilled for the rational use of medicine(RUM. The World Health Organization (WHO defines genericmedicine as ‘a pharmaceutical product, usually intended to beinterchangeable with the innovator product, marketed afterthe expiry of patent or other exclusivity rights’. Economicfactors, supportive legislation and regulation, public andprofessional acceptance and quality assurance are keyenabling factors promoting use of generics. Increased patentprotection for medicines and removing process patents is akey feature of new trade agreements and newer medicines fordiseases like HIV/AIDS, tuberculosis and infectious diseasesare likely to be more expensive. The Medicine andTherapeutics Committee (MTC can play a key role inpromoting generic medicine use in institutions.Nepal being among the Least Developed Countries (LDCsneed not provide patent protection for medicines until 31stDecember 2015. Only a few ‘true’ generics are available inNepal and there is huge cost variation in the price of differentbranded generics. Clinicians have concerns about the qualityof medicines in general, substitution of poor quality brands bypharmacists and about therapeutic substitution. Genericshave to meet the same regulatory requirements and bebioequivalent to reference preparations assuring their quality.
46 CFR 159.010-3 - Independent laboratory: Standards for acceptance.
2010-10-01
... engaged, as a regular part of its business, in performing inspections and tests that are the same as or... manufacturer; (4) Not be dependent on Coast Guard acceptance under this subchapter to remain in business; and (5) Not advertise or promote the manufacturer's equipment or material that the laboratory inspects...
Genetic variation near IRS1 associates with reduced adiposity and an impaired metabolic profile
DEFF Research Database (Denmark)
Oskari Kilpeläinen, Tuomas; Zillikens, M Carola; Stančákova, Alena
2011-01-01
Genome-wide association studies have identified 32 loci influencing body mass index, but this measure does not distinguish lean from fat mass. To identify adiposity loci, we meta-analyzed associations between ∼2.5 million SNPs and body fat percentage from 36,626 individuals and followed up the 14...
David N. Wear; Robert Huggett; Ruhong Li; Benjamin Perryman; Shan Liu
2013-01-01
The 626 million acres of forests in the conterminous United States represent significant reserves of biodiversity and terrestrial carbon and provide substantial flows of highly valued ecosystem services, including timber products, watershed protection benefits, and recreation. This report describes forecasts of forest conditions for the conterminous United States in...
Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II ...
Indian Academy of Sciences (India)
Unknown
Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II) Schiff base complexes derived from o-phenylenediamine and acetoacetanilide. N RAMAN*, Y PITCHAIKANI RAJA and A KULANDAISAMY. Department of Chemistry, VHNSN College, Virudhunagar 626 001, India e-mail: ra_man@123india.com.
DEFF Research Database (Denmark)
Sloth, Jens Jørgen; Larsen, Erik Huusfeldt; Julshamn, Kåre
2003-01-01
and dimethylarsinoylacetic acid, whereas the cationic arsenocholine ion and tetramethylarsonium ion were not affected. The accuracy of the method for DMA, AsB and TMAs was validated with the CRMs DORM-2 and BCR626 Tuna. The concentrations found for arsenobetaine, dimethylarsinic acid and tetramethylarsonium ion were within...
2013-02-08
... clarified by Diamond Sawblades Mfrs. Coalition v. United States, 626 F.3d 1374 (Fed. Cir. 2010) (``Diamond... must correct Shaoxing Xiangyu Green Packing Co. Ltd.'s (``Green Packing'') per unit water and... Packing's reported per-unit water and electricity consumption. To correct the error, the Department has...
78 FR 55698 - Ocean Transportation Intermediary License Applicants
2013-09-11
...), Karla Costilla, Member/Manager, Application Type: New NVO & OFF License. ICAT Logistics, Inc. (OFF..., Washington, DC 20573, by telephone at (202) 523-5843 or by email at [email protected] . Abaco Logistics Corporation..., CFO, Application Type: QI Change & Add OFF Service. American General Logistics, Inc. (NVO), 626 N...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
September 2009, pages 215-626a. Non-Hermitian Hamiltonians in Quantum Physics - Part II ... Entanglement in non-Hermitian quantum theory · Arun K Pati · More Details Abstract ... Minimal classical communication and measurement complexity for quantum information splitting of a two-qubit state · Prasanta K Panigrahi ...
2011-01-26
... pipe fittings from the People's Republic of China (``PRC'') used in structural applications, pursuant... Timken Co. v. United States, 893 F.2d 337 (Fed. Cir. 1990) (``Timken''), as clarified by Diamond Sawblades Mfrs. Coalition v. United States, 626 F.3d 1374 (Fed. Cir. 2010) (``Diamond Sawblades''), the...
Czech Academy of Sciences Publication Activity Database
Tabatabaee, M.; Mahmoodikhah, H.; Ahadiat, G.; Dušek, Michal; Pojarová, Michaela
2013-01-01
Roč. 144, č. 5 (2013), s. 621-626 ISSN 0026-9247 R&D Projects: GA ČR(CZ) GAP204/11/0809 Institutional support: RVO:68378271 Keywords : manganese complex * vanadium complex * dipicolinic ligand * crystal structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.347, year: 2013
Czech Academy of Sciences Publication Activity Database
Liščák, R.; Vladyka, V.; Novotný ml., J.; Brožek, G.; Náměstková, K.; Mareš, Vladislav; Herynek, V.; Jirák, D.; Hájek, M.; Syková, E.
2002-01-01
Roč. 97, Suppl. 5 (2002), s. 666-673 ISSN 0022-3085 R&D Projects: GA MZd NF5161 Institutional research plan: CEZ:AV0Z5011922 Keywords : Leksell gamma knife * rats * memory Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.626, year: 2002
2013-07-25
... clarified by Diamond Sawblades Mfrs. Coalition v. United States, 626 F.3d 1374 (Fed. Cir. 2010) (``Diamond... garlic filed a complaint with the CIT to challenge various aspects of the Final Results and Amended Final... administrative remedies to challenge surrogate value decisions concerning the cardboard packing cartons and...
Body, heart, thyroid gland and skeletal muscle weight changes in rats with altered thyroid status
Czech Academy of Sciences Publication Activity Database
Soukup, Tomáš; Zachařová, Gisela; Smerdu, V.; Jirmanová, Isa
2001-01-01
Roč. 50, č. 6 (2001), s. 619-626 ISSN 0862-8408 R&D Projects: GA ČR GA304/00/1653 Institutional research plan: CEZ:AV0Z5011922 Keywords : thyroid state * skeletal muscles * body and organ weight Subject RIV: FH - Neurology Impact factor: 1.027, year: 2001
Surface preparation of TiO2 anatase (101): Pitfalls and how to avoid them
Czech Academy of Sciences Publication Activity Database
Setvín, M.; Daniel, B.; Mansfeldová, Věra; Kavan, Ladislav; Scheiber, P.; Fidler, M.; Schmid, M.; Diebold, U.
2014-01-01
Roč. 626, AUG 2014 (2014), s. 61-67 ISSN 0039-6028 R&D Projects: GA ČR GA13-07724S Grant - others: COST (XE) CM1104 Institutional support: RVO:61388955 Keywords : TiO2 * anatase * sample preparation Subject RIV: CG - Electrochemistry Impact factor: 1.925, year: 2014
40 CFR 180.506 - Cyclanilide; tolerances for residues.
2010-07-01
... Goat, fat 0.10 Goat, meat 0.02 Goat, meat byproducts, except kidney 0.20 Goat, kidney 2.0 Horse, fat 0.10 Horse, meat 0.02 Horse, meat byproducts, except kidney 0.20 Horse, kidney 2.0 Hog, fat 0.10 Hog... commodities and processed feed: Commodity Parts Per Million Cattle, fat 0.10 Cattle, meat 0.02 Cattle, meat...
40 CFR 180.547 - Prohexadione calcium; tolerances for residues.
2010-07-01
..., straw 1 1.2 Hog, kidney 0.10 Hog, meat byproducts, except kidney 0.05 Horse, kidney 0.10 Horse, meat byproducts, except kidney 0.05 Peanut 1.0 Peanut, hay 0.60 Sheep, kidney 0.10 Sheep, meat byproducts, except....10 Cattle, meat byproducts, except kidney 0.05 Fruit, pome, group 11 3.0 Goat, kidney 0.10 Goat, meat...
Westinghouse Learning Corp., Annapolis, MD.
The content is outlined and the terminal and enabling objectives are provided for a curriculum area on morale and esprit de corps (see EM 010 439, EM 010 440, and EM 010 461), part of an introduction to psychology and leadership course for the United States Naval Academy (see the final reports which summarize the course development project, EM 010…
Westinghouse Learning Corp., Annapolis, MD.
The ninth volume of the introduction to psychology and leadership course (see the final reports which summarize the development project, EM 010 418, EM 010 419, and EM 010 484) concentrates on morale and esprit de corps and is presented in two documents. This document uses an audiotape and panelbook format. EM 010 440 is the second document of the…
Investigation of the dew-point temperature scale maintained at the MIKES
Heinonen, Martti
1999-01-01
For the investigation of the dew-point temperature scale realized by the MIKES primary dew-point generator, a two-pressure generator and a dew-point indicator based on condensation in a cooled coil were constructed and tested. In addition, a chilled mirror hygrometer was validated by means of an uncertainty analysis. The comparison of these systems was focused on the dew-point temperature range from 0957-0233/10/1/010/img1 to 0957-0233/10/1/010/img2 but measurements were made up to 0957-0233/10/1/010/img3. The generator systems were compared using a dew-point comparator based on two relative humidity sensors. According to the results of the comparisons, the differences between the measurement systems were less than 0957-0233/10/1/010/img4, while the expanded uncertainty of the MIKES generator was between 0957-0233/10/1/010/img5 and 0957-0233/10/1/010/img6. The uncertainty of the other systems was from 0957-0233/10/1/010/img7 to 0957-0233/10/1/010/img8. It was concluded that the dew-point temperature scale was not dependent on the realization method.
2001-06-01
Promoci6n General del Conocimiento , Ministerio de Educaci6n y Cultura. We thank Mr. E. Sfnchez and directors and staff of the Hospital del Aire and CIMA... based mechanism for the neuroprotective and neurodestructive effects of nitric oxide and related nitroso-compounds. Nature 364: 626-632. Lowenstein, C.J
An extended sampling of the configurational space of HPr from E-coli
de Groot, B.L.; Amadei, A; Scheek, R.M.; van Nuland, N.A.J.; Berendsen, H.J.C.
1996-01-01
Recently, we developed a method (Amadei et al., J. Biomol, Str. Dyn, 13: 815-626; de Groot et al., J. Biomol. Str. Dyn. 13: 741-751, 1996) to obtain an extended sampling of the configurational space of proteins, casing an adapted form of molecular dynamics (MD) simulations, based on the essential
Czech Academy of Sciences Publication Activity Database
Šplíchal, Igor; Trebichavský, Ilja; Šplíchalová, Alla; Barrow, P. A.
2005-01-01
Roč. 103, - (2005), s. 155-161 ISSN 0165-2427 R&D Projects: GA ČR GA524/01/0917; GA MŠk ME 580 Institutional research plan: CEZ:AV0Z5020903 Keywords : salmonella typhymurium * gnotobiotic pig * cytokine Subject RIV: EE - Microbiology, Virology Impact factor: 1.626, year: 2005
Applying a Systemic Procedure to Locate Career Decision-Making Difficulties
Gati, Itamar; Amir, Tamar
2010-01-01
Locating clients' career decision-making difficulties is one of the first steps in career counseling. The authors demonstrate the feasibility and utility of a systematic 4-stage procedure for locating and interpreting career decision-making difficulties by analyzing responses of 626 college students (collected by Tai, 2007) to the Career…
Lifescience Database Archive (English)
Full Text Available RP11-626A3 map 2, WORKING DRAFT SEQUENCE, 29 unordered pieces. 42 6.4 1 AE014305 |AE014305.1 Homo sapiens chromosome 13q34 schizophre...nia region contig 1 section 2 of 11 of the complete sequence. 42 6.4 1 BZ851208 |BZ
Czech Academy of Sciences Publication Activity Database
Říhová, Blanka; Etrych, Tomáš; Pechar, Michal; Jelínková, Markéta; Šťastný, Marek; Hovorka, Ondřej; Kovář, Marek; Ulbrich, Karel
2001-01-01
Roč. 74, - (2001), s. 225-232 ISSN 0168-3659 R&D Projects: GA MZd NC5050; GA ČR GV307/96/K226 Institutional research plan: CEZ:AV0Z5020903 Keywords : HPMA copolymer carrier * proteolytically cleavable bond Subject RIV: EC - Immunology Impact factor: 2.626, year: 2001
Lifescience Database Archive (English)
Full Text Available ll open reading fra... 76 1e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 1e-... BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 2e-12 protein update 2009. 6.26 PS
An extended sampling of the configurational space of HPr from E-coli
de Groot, B.L.; Amadei, A; Scheek, R.M.; van Nuland, N.A.J.; Berendsen, H.J.C.
Recently, we developed a method (Amadei et al., J. Biomol, Str. Dyn, 13: 815-626; de Groot et al., J. Biomol. Str. Dyn. 13: 741-751, 1996) to obtain an extended sampling of the configurational space of proteins, casing an adapted form of molecular dynamics (MD) simulations, based on the essential
Di Tecco, Cristina; Borgogni, Laura
2014-05-28
Absenteeism is a major concern for organizations and companies since it has negative repercussions on productivity and represents a huge cost due to sick pay and expensive temporary replacement of employees who are obliged to take long-term absences. The current study aimed at focussing on absenteeism and its causes through the investigation of a conceptual model founded on social cognitive theory where self-efficacy and Perceptions of Social Context (PoSC, i.e., perceptions of immediate supervisor, colleagues and top management) concur to predict absence from work through the mediating role of job satisfaction. A group of 361 sales assistants and administrative staff employed by the Italian branch of a retail clothing multinational were administered a self-report questionnaire for measuring self-efficacy, PoSC and job satisfaction. We then matched the self-report answers with objective absence measures. Structural equation modelling lent support to the presumed relationships between variables. We found that: 1) self-efficacy was positively related to the three PoSC; 2) PoSC had a positive relationship with job satisfaction; 3) job satisfaction was negatively related to absence from work; 4) job satisfaction mediated the relationship between PoSC and absence from work. Overall, our contribution offers a theoretical basis for further investigations on the role of individual characteristics and perceptions of social context in absenteeism studies via both observational and intervention studies and cost-effectiveness analysis.
40 CFR 180.274 - Propanil; tolerances for residues.
2010-07-01
... Cattle, meat 0.05 Cattle, meat byproducts 1.0 Crayfish 0.05 Egg 0.30 Goat, fat 0.10 Goat, meat 0.05 Goat, meat byproducts 1.0 Hog, fat 0.10 Hog, meat 0.05 Hog, meat byproducts 1.0 Horse, fat 0.10 Horse, meat 0.05 Horse, meat byproducts 1.0 Milk 0.05 Poultry, fat 0.05 Poultry, meat 0.10 Poultry, meat byproducts...
Vivar-Ocampo, Rodrigo; Pardo, Lorena; Ávila, David; Morán, Emilio; González, Amador M.; Bucio, Lauro; Villafuerte-Castrejón, María-Elena
2017-01-01
Research and development of lead-free piezoelectric materials are still the hottest topics in the field of piezoelectricity. One of the most promising lead-free family of compounds to replace lead zirconate–titanate for actuators is that of Bi0.50Na0.50TiO3 (BNT) based solid solutions. The pseudo-binary (1 − x)Bi0.50Na0.50TiO3–xBa1 − yCayTiO3 system has been proposed for high temperature capacitors and not yet fully explored as piezoelectric material. In this work, the solid solution with x = 0.06 and y = 0.10 was obtained by two different synthesis routes: solid state and Pechini, aiming at using reduced temperatures, both in synthesis (<800 °C) and sintering (<1150 °C), while maintaining appropriated piezoelectric performance. Crystal structure, ceramic grain size, and morphology depend on the synthesis route and were analyzed by X-ray diffraction, together with scanning and transmission electron microscopy. The effects of processing and ceramic microstructure on the structural, dielectric, ferroelectric, and piezoelectric properties were discussed in terms of a shift of the Morphotropic Phase Boundary, chemically induced by the synthesis route. PMID:28773096
Energy Technology Data Exchange (ETDEWEB)
Li, Junliang; Wang, Shaorong; Wang, Zhengrong; Liu, Renzhu; Wen, Tinglian; Wen, Zhaoyin [Shanghai Institute of Ceramics, Chinese Academy of Sciences, 1295 Dingxi Road, Shanghai 200050 (China)
2008-05-01
(La{sub 0.74}Bi{sub 0.10}Sr{sub 0.16})MnO{sub 3-{delta}} (LBSM)-(Bi{sub 2}O{sub 3}){sub 0.7}(Er{sub 2}O{sub 3}){sub 0.3}(ESB) composite cathodes were fabricated for intermediate-temperature solid oxide fuel cells with Sc-stabilized zirconia as the electrolyte. The performance of these cathodes was investigated at temperatures below 750 C by AC impedance spectroscopy and the results indicated that LBSM-ESB had a better performance than traditional composite electrodes such as LSM-GDC and LSM-YSZ. At 750 C, the lowest interfacial polarization resistance was only 0.11 {omega} cm{sup 2} for the LBSM-ESB cathode, 0.49 {omega} cm{sup 2} for the LSM-GDC cathode, and 1.31 {omega} cm{sup 2} for the LSM-YSZ cathode. The performance of the cathode was improved gradually by increasing the ESB content, and the performance was optimal when the amounts of LBSM and ESB were equal in composite cathodes. This study shows that the sintering temperature of the cathode affected performance, and the optimum sintering temperature for LBSM-ESB was 900 C. (author)
What Greek Secondary School Students Believe about Climate Change?
Liarakou, Georgia; Athanasiadis, Ilias; Gavrilakis, Costas
2011-01-01
The purpose of this study was to investigate what Greek secondary school students (grades 8 and 11) believe about the greenhouse effect and climate change. A total of 626 students completed a closed-form questionnaire consisting of statements regarding the causes, impacts and solutions for this global environmental issue. The possible influence of…
Public, Private, and Home School Children's Views of Forgiveness and Retribution in "Cinderella."
Knafle, June D.; Wescott, Alice Legenza
Fifth Graders (N=626) from public, Catholic, Christian, and home schools reacted to values of forgiveness versus retribution in the two main versions of "Cinderella" by choosing which ending they preferred for themselves, for a 4-year old sister, and for a 4-year old brother. Girls preferred the forgiveness ending for themselves…
Assemblage of wool and silk textiles from medieval waste layers in Prague, Czech Republic
Czech Academy of Sciences Publication Activity Database
Březinová, Helena; Kohout, D.
Roč. 25, č. 6 ( 2017 ), s. 119-125 ISSN 1230-3666 R&D Projects: GA ČR(CZ) GA14-06451S Institutional support: RVO:67985912 Keywords : archaeological textiles * Middle Ages * Prague * waste layers * dyeing analyses Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 0.626, year: 2016
76 FR 14001 - Office of Safe and Drug-Free Schools Discretionary Grant Programs
2011-03-15
.... 2005; 62(6) 593-602. These challenges--crime, early drug and alcohol abuse, anxiety, aggressive or... Programs): Grants to Reduce Alcohol Abuse (CFDA No. 84.184A). Grants for the Integration of Schools and... abuse and mental health crises that affect AI/AN students. DATES: We must receive your comments on or...
File list: InP.Spl.20.Input_control.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.Spl.20.Input_control.AllCell mm9 Input control Input control Spleen ERX662629,E...626,ERX662620,SRX701168,SRX701169,SRX701170,ERX662615,ERX662625 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Spl.20.Input_control.AllCell.bed ...
Paternal Influences and Adolescents' Sexual Risky Behaviours ...
African Journals Online (AJOL)
05) and adolescents' sexual risky behaviour. The results further showed the significant position between Parents adolescent disclosure (X2 cal = 32.856) is the most potent factor followed Parental autonomy (X2 cal = 24.642); Parent adolescent relationship (X2 cal = 18.986); Positive adolescent behaviour (X2 cal = 11.626); ...
Smith, K N; Iwanejko, L; Loeillet, S; Fabre, F; Nicolas, A
1999-09-15
In the context of the EUROFAN project, we have carried out the systematic disruption of seven ORFs on chromosome IV of Saccharomyces cerevisiae using the long flanking homology technique to replace each ORF with the KanMX cassette. Targeted disruption of YDL057w, YDL012c, or YDL010w with YDL009c (the two ORFs overlap) confers no overt defects in haploid growth on a variety of media at different temperatures, in mating, or in the sporulation of diploids homozygous for the disruption. By contrast, YDL008w and YDL003w disruptants are non-viable. The product of YDL008w (elsewhere identified as APC11) is a component of the anaphase promoting complex. YDL003w (also termed MCD1) is a homologue of Schizosaccharomyces pombe rad21, an essential gene implicated in DNA double-strand break repair and nuclear organization in fission yeast. In budding yeast, this ORF has been shown by several laboratories to encode a protein involved in sister chromatid cohesion and chromosome condensation. The remaining ORF, YDL005c (also termed MED2), encodes a component of the transcriptional activator complex known as Mediator. Disruption of YDL005c confers a modest slow growth phenotype on rich medium and a more severe phenotype on minimal medium, aberrant cellular morphology, and mating defects; diploids homozygous for the disruption cannot sporulate. Copyright 1999 John Wiley & Sons, Ltd.
X-ray and electron microscopy investigation of the topotactic transformation of MoO3 into MoO2
International Nuclear Information System (INIS)
Bertrand, O.; Dufour, L.C.
1980-01-01
The reduction of MoO 3 is investigated by X-ray analysis and electron microscopy from MoO 3 (010) platelets between 1000 A and 5 mm long. In all cases, the following orientation relationship between both lattices is found: [100] 2 parallel [010] 3 , [122] 2 parallel [100] 3 . [-12-2] 2 parallel [001] 3 . MoO 3 crystallites twinning and misorientation are discussed in relation with the particular importance of [101] 3 directions in MoO 3 preserved in the transformation and becoming [010] 2 of MoO 2 . A model for this topotactic reduction is proposed where the reaction develops layer (010) 3 by layer (010) 3 to form [20-1] 2 type planes in MoO 2 structure. Data on the kinetics of the boundary moving in [010] 3 direction are also presented. (author)
40 CFR 180.623 - Flufenoxuron; tolerances for residues.
2010-07-01
..., fat 1 4.5 Cattle, meat 1 0.10 Cattle, meat byproducts 1 0.50 Goat, fat 1 4.5 Goat, meat 1 0.10 Goat, meat byproducts 1 0.50 Grape 1 0.70 Grape, raisin 1 2.0 Horse, fat 1 4.5 Horse, meat 1 0.10 Horse, meat..., meat 1 0.10 Sheep, meat byproducts 1 0.50 1There are no U.S. registrations as of September 30, 2006. (b...
Directory of Open Access Journals (Sweden)
Risma Kerina Kaban
2011-02-01
Full Text Available Background Glucose-6-phosphate dehydrogenase (G6PD deficiency is the most connnon enzyme deficiency in the world. Itis a risk factor for hyperbilirubinemia in neonates, which can cause serious complications such as bilirubininduced encephalopathy or kernicterus. WHO recommends universal neonatal screening for G6PD deficiency when the frequency exceeds 35% of male newborns. Objective To assess the prevalence of G6PD deficiency among neonates in Bunda Women and C hildren Hospital (Bunda WCH, Jakarta, in order to detennine if there is a need for routine G6PD neonatal screening. Methods This is a cross-sectional and retrospective study; infants' data were obtained from medical records. From January 2009 to May 2010, all neonates in Bunda WCH were screened for G6PD deficiency on the yd day of life. Blood samples were collected using filter papers. We considered a result to be nonnal if it exceeded 3.6 U/g Hb. Results A total 1802 neonates were screened. We found 94 neonates (5.2% with G6PD deficiency. Out of 943 males, 59 (6.26% were G6PD deficient, and out of 859 females, 35 (4.07% were G6PD deficient. We observed that prevalence of G6PD deficiency according to sex distribution was significantly higher in males than females (6.26% vs. 4.07%, P=0.037. There was no significant difference in the risk for severe hyperbilirubinemia between the G6PD deficient infants and the nonnal infants (P=0.804. Conclusions The frequencies of G6PD deficiency were 6.26% of male neonates and 4.07% of female neonates. We recommend universal neonatal screening for G6PD deficiencies in Jakarta since our findings exceed the WHO recommendation for routine testing.
Incik, Eylem Yalcin; Akay, Cenk
2017-01-01
The main purpose of this research is to identify the competency and the perceptions of pre-service teachers on technopedagogical education. While study group of quantitative dimension is composed of 626 pre-service teachers; study group of qualitative extent is composed of 67 pre-service teachers. The sample represents 35% of the population of…
Attitudes toward Online Communications in Open and Distance Learning
Erdem Aydin, Irem
2012-01-01
This article intended to reveal the results of a survey study in which the students' attitudes toward online communication in open and distance learning were investigated. In the study, affects of the students' gender and computer experience on their attitudes were also examined. A total of 626 subjects participated in the study and "Online…
Economic impact of the 2008 American Folk Festival in Bangor, Maine
Bernardita Silva; Marilynne Mann; Harold Daniel
2010-01-01
Festivals and events are becoming increasingly important drivers of tourism activity in Maine. Based on a survey of festival visitors, this study used an IMPLANTM input-output model to estimate the economic impact of the 2008 American Folk Festival in Bangor, ME. The Center for Tourism Research and Outreach estimated that 95,626 local and...
African Journals Online (AJOL)
year ofage. Birth and weaning weights (90 days) averaged 1.79 + 0,02 kg and 6.26 + 0,02 kg, respec- tively. ... for birth weight with later weights were low and positive. .... Lambs were ear-tagged soon after .... This variation, associated with nutritional problems, ... early lamb growth than ongrowth after weaning This could be ...
Cotton gin electrical energy use trends and 2009 audit results
Cotton gin energy costs have risen more than other operating costs. Energy audits were conducted in twenty US cotton gins representing a range of capacities in six states. The average participating saw gin used 39.5 kWh to process a bale. The average roller gin used 62.6 kWh. Gins have become la...
Energy Technology Data Exchange (ETDEWEB)
Lombard, C.C.; Mancini, C. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente
1999-07-01
The carcinogenic risk represents a main problem of Health and Safety at Work Act. Chemical carcinogens regulation has been recently improved by the Italian Decree No. 626/94. The aim of the present work is to outline the criteria for the protection of working people in a complex workplace such as research laboratories, focusing on its peculiar occupational health factors, such as the hazardous exposure to a vast array of chemicals also due to the frequent turnover in the personnel activities. [Italian] Il tema dell'esposizione ad agenti cancerogeni costituisce un vasto e complesso problema di igiene del lavoro e medicina preventiva. Limitatamente ai cancerogeni chimici, un impulso importante in materia di prevenzione e' venuto dalla promulgazione del D.lgs. 626/94 e successive modificazioni. Il presente lavoro ha lo scopo di fornire indicazioni concrete per la messa in atto delle misure di prevenzione e protezione dei lavoratori, ponendo particolare attenzione ai laboratori di ricerca che costituiscono ambienti lavorativi, particolari caratterizzati dal gran numero di agenti manipolati e dal continuo mutamento delle attivita' e del personale.
Factor Analysis Affecting The Audit Quality Study On Inspectorate In Riau Province
Directory of Open Access Journals (Sweden)
Nur Azlina
2017-07-01
Full Text Available This study aims to determine 1 the influence of integrity on audit quality 2 the influence of objectivity on audit quality 3 the effect of work experience on audit quality 4 the influence of knowledge on financial management on audit quality and 5 Motivation to audit quality. The sample of this study is the auditor who works in inspectorate in Riau Province precisely in Inspectorate of Bengkalis Siak Pelalawan Kuantan Singingi and Pekanbaru City. Data were analyzed by using multiple regression method using SPSS version 21. The data used is primary data by using questionnaire. The analytical technique used to perform the hypothesis is random sampling. The results showed that integrity work experience knowledge of local financial management and motivation had no effect on audit quality while objectivity had an effect on audit quality. Adjusted R Square of 0.626. This shows that the quality of audit on Inspectorate in Riau Province can be influenced by factors studied by 62.6 and 37.4 influenced by factors not observed in this study.
Study onthe prevalence of pulmonary lesions of slaughtered sheep at Urmia abattoir
Directory of Open Access Journals (Sweden)
abdollah araghisoureh
2013-11-01
Full Text Available In regard to importance of various pathologic factors affecting respiratory system and its role in the selection of specific therapies in the sheep, 626 slaughtered sheep were examined to describe the pathological lesions of lower respiratory tract at Urmia abattoir. A total of 114/626 lungs (18.12% with macroscopic lesions were condemned and macro-microscopically examined. The specimens were processed through routine method for paraffin embedded sectioning (5-7micron and stained by Hematoxillin& Eosin method. Incidence of lesions in order of frequency were interstitial pneumonia (51; 8.14%,verminous pneumonia(23;3.67%, atelectasis (22; 3.51%, granulomatous pneumonia (22;3.51%, chronic bronchitis (21; 3.35%, fibrosis (13;2.07%, adenocarcinomas (11;1.75%,chronic bronchiolitis (10;1.59%, hydatic cyst (8;1.27 %, pulmonary abscesses (7;1.11%, emphysema (6;0.95%, pleuritis (2;0.31% and pulmonary edema (2;0.319%. The result of this study showed that interstitial pneumonia was interestingly predominant among other lesions of condemned lungs which may reflect a seasonal difference.
Nikkaji Dictionary: アミノメタンスルホン酸 [MeCab user dictionary for science technology term[Archive
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term アミノメタンスルホン酸 名詞 一般 * * * * アミノメタンスルホン酸 ... Nikkaji J93.626J 200906021695034958 C CA06 UNKNOWN_2 アミノメタンスルホン 酸
1979-08-31
CONDITIONSEOFWEAHE CONDI!T IONS FRWJ4 HOUR~LY ORSIURVAT IONS MNH HOURS THNE*AAIN FREEZING SNOW % OF SMOKE BOIG DUST % OF OBS ’TOTALMONT THUNDEORS AD...MAY JUN. JUL AUG, SEP OCT NOV, DEC. MONTHYEAR MNH 79 6.26 8.66 I -4 MEN if 3* 5 __________ 4.79Z_____ 3.16--____ 3___482___ __________ _________ 18K
Amanda H. Lang; Shawn A. Baker; W. Dale Greene; Glen E. Murphy
2010-01-01
We compared value recovery of a modified treelength (MTL) logging system that measures product diameter and length using a Waratah 626 harvester head to that of a treelength (TL) system that estimates dimensions. A field test compared the actual value cut to the maximum potential value suggested by the log bucking optimization program Assessment of Value by Individual...
African Journals Online (AJOL)
Sumera, Matthew. Vol 12, No 1-2 (2015) - Articles Johnson, Bruce & Martin Cloonan (2009). Dark Side of the Tune: Popular Music and Violence Abstract. ISSN: 2070-626X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...
Science Teaching Methods Preferred by Grade 9 Students in Finland
Juuti, Kalle; Lavonen, Jari; Uitto, Anna; Byman, Reijo; Meisalo, Veijo
2010-01-01
Students find science relevant to society, but they do not find school science interesting. This survey study analyzes Finnish grade 9 students' actual experiences with science teaching methods and their preferences for how they would like to study science. The survey data were collected from 3,626 grade 9 students (1,772 girls and 1,832 boys)…
2013-01-25
....'' PLF argues that this case falls under the first asserted principle, as the procedural requirement... New Jersey v. EPA, 626 F. 2d 1038, 1049-50 (D.C. Cir. 1980) and Sugar Cane Growers Coop. of Fla. v... general rule petitioners claim, and are not on point. Both State of New Jersey and Sugar Cane Growers...
2013-10-03
... Administrative Code (WAC) as well as corresponding local Olympic Region Clean Air Agency regulations. The EPA is... Paperwork Reduction Act (44 U.S.C. 3501, et seq.); is certified as not having a significant economic impact... end titled ``TABLE 8-- Olympic Region Clean Air Agency Regulations'' with the entries 6.2.3, 6.2.6, 6...
Multiple biological effects of inhibitors of arachidonic acid metabolism on human keratinocytes
Czech Academy of Sciences Publication Activity Database
Pacherník, Jiří; Hampl, Aleš; Souček, Karel; Kovaříková, Martina; Andrysík, Zdeněk; Hofmanová, Jiřina; Kozubík, Alois
2002-01-01
Roč. 293, č. 12 (2002), s. 626-633 ISSN 0340-3696 R&D Projects: GA ČR GA524/99/0694; GA AV ČR IBS5004009; GA ČR GA524/98/0190 Institutional research plan: CEZ:AV0Z5004920 Keywords : lipoxygenase * keratinocytes * cell cycle Subject RIV: BO - Biophysics Impact factor: 1.452, year: 2002
Building of RNA and DNA double helices into electron density
Czech Academy of Sciences Publication Activity Database
Pavelčík, F.; Schneider, Bohdan
2008-01-01
Roč. 64, č. 6 (2008), s. 620-626 ISSN 0907-4449 R&D Projects: GA MŠk LC512 Grant - others:VEGA(SK) 1/2333/05; NSF(US) DBI0110076 Institutional research plan: CEZ:AV0Z40550506 Keywords : RNA * double helix * x-ray crystallography Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.943, year: 2008
Variation in Antibiotic Susceptibility of Uropathogens by Age among Ambulatory Pediatric Patients
Quach, Yennie; Bearden, David T.; Smith, David H.; Sharp, Susan E.; Guzman-Cottrill, Judith A.
2013-01-01
We compared uropathogen antibiotic susceptibility across age groups of ambulatory pediatric patients. For Escherichia coli (n=5,099) and other Gram-negative rods (n=626), significant differences (purinary anti-infectives may be lower in the youngest children. Further investigation into these differences is needed to facilitate appropriate and prudent treatment of urinary tract infections. PMID:24091131
Czech Academy of Sciences Publication Activity Database
De Palma, G.; Cinová, Jana; Štěpánková, Renata; Tučková, Ludmila; Sanz, Y.
2010-01-01
Roč. 87, č. 5 (2010), s. 765-778 ISSN 0741-5400 R&D Projects: GA AV ČR IAA500200801; GA MŠk 2B06155; GA ČR GA310/07/0414 Institutional research plan: CEZ:AV0Z50200510 Keywords : gliadins * IFN-gamma Subject RIV: EC - Immunology Impact factor: 4.626, year: 2010
Sharks caught in the protective gill nets off KwaZulu-Natal, South ...
African Journals Online (AJOL)
Between 1978 and 1999, a total of 5 626 dusky sharks Carcharhinus obscurus, constituting 20% of the total shark catch, was caught in the protective nets off KwaZulu-Natal, South Africa. The mean annual catch was 256 sharks (SD = 107.5, range 129–571). There was no significant linear trend in catch rate with time.
The effects of different nitrogen doses on herbage and seed yields of ...
African Journals Online (AJOL)
The effects of different nitrogen doses on herbage and seed yields of annual ... 250, 270 and 290 kg ha-1) of and some agricultural characteristics of annual ryegrass cv. ... doses are observed to be important for all properties of herbage yield and ... It was obtained for the seed production that the highest number of tiller (626 ...
Cyclin-dependent kinase inhibitors for cancer therapy: a patent review (2009-2014)
Czech Academy of Sciences Publication Activity Database
Malínková, Veronika; Vylíčil, Jakub; Kryštof, Vladimír
2015-01-01
Roč. 25, č. 9 (2015), s. 953-970 ISSN 1354-3776 R&D Projects: GA MŠk(CZ) LO1204; GA MŠk(CZ) ED3.1.00/14.0327; GA ČR(CZ) GA15-15264S Institutional support: RVO:61389030 Keywords : cancer * CDK * cyclin Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.626, year: 2015
78 FR 28258 - mPower\\TM\\ Design-Specific Review Standard
2013-05-14
... Pressure Boundary Leakage Detection. 5.3.1 Reactor Vessel ML12272A008 Materials. 5.3.2 Pressure-Temperature... focus on integral pressurized water reactor (iPWR) designs. The Commission directed the staff to more... Containment. 6.2.6 Containment Leakage ML12276A127 Testing. 6.2.7 Fracture Prevention of ML12278A103...
InterProScan Result: BP124291 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available BP124291 BP124291_5_ORF1 92B626ADD33C8436 PFAM PF00067 p450 1.8e-09 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...
Czech Academy of Sciences Publication Activity Database
Dobeš, Ferdinand; Dymáček, Petr; Besterci, M.
2015-01-01
Roč. 626, FEB (2015), s. 313-321 ISSN 0921-5093 R&D Projects: GA ČR(CZ) GAP108/12/1452; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : Mechanical characterization * Aluminium alloys * Composites * Equal channel angular processing * Grain refinement Subject RIV: JI - Composite Materials Impact factor: 2.647, year: 2015
40 CFR 86.096-8 - Emission standards for 1996 and later model year light-duty vehicles.
2010-07-01
... 0.08 Natural Gas 0.25 3.4 0.4 0.08 LPG 0.41 0.25 3.4 0.4 0.08 Table A96-2—Full Useful Life Standards....31 4.2 1.25 0.10 Methanol 0.31 4.2 0.6 0.10 Natural Gas 0.31 4.2 0.6 0.10 LPG 0.31 4.2 0.6 0.10 (ii... Fueled, Natural Gas-Fueled, Liquefied Petroleum Gas-Fueled and Methanol-Fueled Heavy-Duty Vehicles § 86...
Directory of Open Access Journals (Sweden)
Agnieszka I. Piotrowicz-Cieślak
2011-01-01
Full Text Available Germinability and the content of soluble carbohydrates were analysed in cereal seed (winter rye, cv. Warko; spring wheat, cv. Santa; hexaploid winter triticale, cv. Fidelio and cv. Woltario. Seed moisture content (mc was equilibrated over silica gel to 0.08 g H2O/g dry mass and stored in a desiccator at 20oC for up to 205 weeks or were equilibrated to mc 0.06, 0.08 or 0.10 g H2O/g dm and subjected to artificial aging at 35oC in air-tight laminated aluminium foil packages for 205 weeks. It was shown that the rate of seed aging depended on the species and seed moisture content. The fastest decrease of germinability upon storage was observed in seed with the highest moisture level. Complete germinability loss for winter rye, winter triticale cv. Fidelio, winter triticale cv. Woltario and spring wheat seed with mc 0.10 g H2O/g dm3 occurred after 81, 81, 101 and 133 weeks, respectively. Fructose, glucose, galactose, myo-inositol, sucrose, galactinol, raffinose, stachyose and verbascose were the main soluble carbohydrates found in the seed. The obtained data on the contents of specific sugars and the composition of soluble sugars fraction in seed of rye, wheat and triticale did not corroborate any profound effect of reducing sugars, sucrose and oligosaccharides on seed longevity.
Borg, G.J.A.
2011-01-01
Column Gert Borg | Spring in the Arab Spring door dr. Gert Borg, onderzoeker bij Islam en Arabisch aan de Radboud Universiteit Nijmegen en voormalig directeur van het Nederlands-Vlaams Instituut Caïro Spring If, in Google, you type "Arab Spring" and hit the button, you get more than
46 CFR 160.010-7 - Methods of sampling, inspections and tests.
2010-10-01
... laboratory must inspect the place of manufacture, observe the various operations involved in the construction... section. (g) Painter attachment strength test. The apparatus must be positioned with its painter attachment fitting at the lowest point of the apparatus, directly below the center of buoyancy. The apparatus...
WS-010: EPR-First Responders: Personal monitoring techniques and protective clothing
International Nuclear Information System (INIS)
2011-01-01
The purpose of this working session is that the participant can apply their knowledge in relation to the personal monitoring techniques and protective clothing. They have to know the use of the radiation measurement instrumentation available in each region
40 CFR 180.368 - Metolachlor; tolerances for residues.
2010-07-01
...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances....02 Poultry, meat byproducts 0.05 Pumpkin 0.10 Safflower, seed 0.10 Shallot, bulb 0.10 Sheep, fat 0.02... or on the following food commodities: Commodity Parts per million Animal feed, nongrass, group 18 1.0...
SU-F-T-626: Intracranial SRS Re-Treatment Without Acquisition of New CT Images
International Nuclear Information System (INIS)
Wiant, D; Manning, M; Liu, H; Maurer, J; Hayes, T; Sintay, B
2016-01-01
Purpose: Linear accelerator based stereotactic radiosurgery (SRS) for multiple intracranial lesions with frequent surveillance is becoming a popular treatment option. This strategy leads to retreatment with SRS as new lesions arise. Currently, each course of treatment uses magnetic resonance (MR) and computed tomography (CT) images for treatment planning. We propose that new MR images, with course 1 CT images, may be used for future treatment plans with negligible loss of dosimetric accuracy. Methods: Ten patients that received multiple courses of SRS were retrospectively reviewed. The treatment plans and contours from non-initial courses were copied to the initial CTs and recalculated. Doses metrics for the plans calculated on the initial CTs and later CTs were compared. All CT scans were acquired on a Philips CT scanner with a 600 mm field of view and 1 mm slice thickness (Philips Healthcare, Andover, MA). All targets were planned to 20 Gy and calculated in Eclipse V. 13.6 (Varian, Palo Alto, CA) using analytic anisotropic algorithm with 1 mm calculation grid. Results: Sixteen lesions were evaluated. The mean time between courses was 250 +/− 215 days (range 103–979). The mean target volume was 2.0 +/− 2.9 cc (range 0.1–10.1). The average difference in mean target dose between the two calculations was 0.2 +/− 0.3 Gy (range 0.0 – 1.0). The mean conformity index (CI) was 1.28 +/− 0.14 (range 1.07 – 1.82). The average difference in CI was 0.03 +/− 0.16 (range 0.00 – 0.44). Targets volumes < 0.5 cc showed the largest changes in both metrics. Conclusion: Continued treatment based on initial CT images is feasible. Dose calculation on the initial CT for future treatments provides reasonable dosimetric accuracy. Changes in dose metrics are largest for small volumes, and are likely dominated by partial volume effects in target definition.
20 CFR 626.4 - Table of contents for the Job Training Partnership Act regulations.
2010-04-01
.... 628.210State Job Training Coordinating Council. 628.215State Human Resource Investment Council... and for general program management. Subpart G [Reserved] Subpart H—Job Training Partnership Act... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Table of contents for the Job Training...
Energy Technology Data Exchange (ETDEWEB)
McAndless, J.M.
1995-12-31
This paper reviews a project in which stockpiles of aged mustard (bis-2-chloroethyl sulfide), lewisite (2-chlorovinyl-dichloro arsine), nerve agents, and contaminated scrap metal were incinerated or chemically neutralized in a safe, environmentally responsible manner. Sections of the paper describe the public consultation program conducted prior to destruction operations, the environmental assessment of the destruction projects, the environmental protection plan implemented to eliminate or mitigate risks with respect to the installation and operation of the destruction equipment, the environmental monitoring procedures, the agent destruction operations, and the destruction process performance, including incinerator emissions.
Cropping Effects on Microbial Population and Nitrogenase Activity in Saline Arid Soil
EGAMBERDIEVA, Dilfuza; KUCHAROVA, Zulfiya
2008-01-01
Soil salinization is a major problem in irrigated agriculture. A field study was conducted in the Sariosiyo district in the Surkhandarya region of southeast Uzbekistan to evaluate soil nitrogenase activity and nitrogen-fixing bacteria populations in saline serozem soils under wheat, maize, and alfalfa, as well as from adjacent fallow land. Composite soil samples were randomly collected from depths of 0-10, 10-20, and 20-30 cm in autumn, winter, spring, and summer, which were then 2-mm sieved ...
SEASONAL CHANGES IN PHOSPHORUS LOAD FLOWING OUT OF SMALL AGRICULTURAL CATCHMENTS
Krzysztof Pulikowski; Katarzyna Pawęska; Aleksandra Bawiec
2014-01-01
In this article distribution of monthly phosphorus loads flowing out of two agricultural catchments which are located in different physiographic conditions of Lower Silesia was analysed. Loads of phosphorus runoff from the catchment located in the piedmont part of Lower Silesia in each month rarely exceed 0.10 kg P ∙ ha-1. The size of annual load is determined by loads obtained in two months of early spring. Much lower loads obtained for lowland catchment, located near Wroclaw. Values calcu...
Energy Technology Data Exchange (ETDEWEB)
Huang, Xing [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Pan, Qinglin, E-mail: pql1964@126.com [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Li, Bo [School of Materials Science and Engineering, Central South University, Changsha 410083 (China); Liu, Zhiming; Huang, Zhiqi [Guangdong Fenglu Aluminum Co., Ltd, Foshan 528133 (China); Yin, Zhimin [School of Materials Science and Engineering, Central South University, Changsha 410083 (China)
2015-11-25
Microstructural and property evolution of the Al–Zn–Mg–0.10%Sc–0.10%Zr alloy sheet during its preparation were investigated in detail by means of optical microscopy (OM), scanning electron microscope (SEM), energy dispersive X-ray (EDX), transmission electron microscopy (TEM), Vickers micro-hardness test and room temperature tensile test. Stress corrosion cracking (SCC) behavior of the Al–Zn–Mg–0.10%Sc–0.10%Zr alloy under different heat treatments was studied using slow strain rate test. The results showed that serious dendritic segregation existed in as-cast condition. The suitable homogenization treatment for Al–Zn–Mg–0.10%Sc–0.10%Zr alloy was 470 °C/24 h. After homogenization treatment, dissoluble Zn and Mg enriched non-equilibrium phases dissolved into α-Al matrix completely. The suitable solid solution-aging treatment for Al–Zn–Mg–0.10%Sc–0.10%Zr alloy was solution treated at 470 °C for 60 min, followed by water quenching and then aged at 120 °C for 24 h. Under this aging temper, the grain structures were composed of sub-grains, η′ phases and nanometer-sized, spherical Al{sub 3}(Sc, Zr) particles. Grain boundary precipitates (GBPs) area fraction was found to be an important parameter to evaluate the SCC susceptibility. The improved corrosion resistance from increasing aging temperature or prolonging aging time was due to the discontinuous η precipitates along the grain boundary and the high area fraction of GBPs. The main strengthening mechanisms of Al–Zn–Mg–0.10%Sc–0.10%Zr alloy are precipitation strengthening derived from η′ precipitates, dispersion strengthening, sub-grain strengthening and grain refinement caused by coherent Al{sub 3}(Sc, Zr) particles. - Highlights: • The suitable homogenization treatment of the alloy has been identified. • Evolution of microstructure and mechanical properties is investigated. • Strengthening mechanisms of the alloy has been established. • The basic mechanism has
Directory of Open Access Journals (Sweden)
Román Maza Ortega
2016-02-01
Full Text Available The objective of this study was to evaluate the effect of substituting soybean meal for cottonseed meal in multiple supplements on the nutritional characteristics and performance of beef heifers in their postweaning phase on Brachiaria decumbens pastures during the dry season. Twenty-four Nellore beef heifers (average initial age and weight of 8 mo and 210±6 kg, respectively were used. The design was completely randomized, with four treatments and six replicates. Supplements contained approximately 30% crude protein (CP and a progressive substitution of soybean meal for cottonseed meal (0, 50 and 100%. The control animals received only a mineral mixture ad libitum, and those on the other treatments received supplementation at 1.0 kg/animal/day. No differences were found in ADG between supplemented and control animals (P>0.10. Supplementation increased crude protein (CP intake only (P<0.10. The level of substitution of soybean meal for cottonseed meal did not affect (P>0.10 the intake of supplemented animals. Supplementation elevated the apparent digestibility coefficients (P<0.10 of OM, CP, NFC and TDN, but not EE or NDFap (P>0.10. A positive linear effect (P<0.10 of the level of substitution of soybean meal for cottonseed cake was observed on the digestibility of OM, NFC and TDN. Supplementation and the level of substitution had an effect (P<0.10 on the serum urea nitrogen and urine urea nitrogen contents. Supplementation or substitution level had no effect on the flow of microbial nitrogen to the intestine (MICN or efficiency of microbial protein synthesis (EMPS (P>0.10. Substitution caused a decreasing linear effect (P<0.10 on microbial nitrogen/nitrogen intake ratio (MICNR. In conclusion, substitution of soybean meal for cottonseed meal in multiple supplements during the dry season does not impair the productive performance of beef heifers.
Czech Academy of Sciences Publication Activity Database
Xavier, N.M.; Goncalves-Pereira, R.; Jorda, Radek; Řezníčková, Eva; Kryštof, Vladimír; Oliveira, M.C.
2017-01-01
Roč. 89, č. 9 (2017), s. 1267-1281 ISSN 0033-4545 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : anticancer activity * azido nucleosides * bioactive molecules * ics-28 * N-glycosylation * nucleoside phosphoramidates * nucleoside/nucleotide analogs * Staudinger-phosphite reaction Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Organic chemistry Impact factor: 2.626, year: 2016
Nikkaji Dictionary: ジアミノジフェニルメタン [MeCab user dictionary for science technology term[Archive
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term ジアミノジフェニルメタン 名詞 一般 * * * * ジアミノジフェニルメタン ... Nikkaji J626.037C 200906094614017423 C CA06 UNKNOWN_1 ジアミノジフェニルメタン
International Nuclear Information System (INIS)
Sharma, K.K.; Rameshwar Rao, D.; Azmi, R.J.; Gopalan, K.; Pantulu, G.V.C.
1991-01-01
The recently reported faunal evidence for placing the Precambrian-Cambrian boundary within the main phosphorite unit of the Chert-Phosphorite Member of the Tal Formation, Garhwal Lesser Himalaya, is supported by the present report of 626 ± 13 myr for the whole-rock Rb-Sr isochron age of the black shales directly underlying the phosphorite band. (author). 15 refs., 2 figs., 1 tab
Real ray tracing in anisotropic viscoelastic media
Czech Academy of Sciences Publication Activity Database
Vavryčuk, Václav
2008-01-01
Roč. 175, č. 2 (2008), s. 617-626 ISSN 0956-540X R&D Projects: GA AV ČR IAA300120801 Grant - others:EC(XE) MTKI-CT-2004-517242 Institutional research plan: CEZ:AV0Z30120515 Keywords : elasticity and anelasticity * body waves * seismic anisotropy * seismic attenuation * wave propagation Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.219, year: 2008
A National Study of the Prevalence of Autism among Five-Year-Old Children in Iran
Samadi, Sayyed Ali; Mahmoodizadeh, Ameneh; McConkey, Roy
2012-01-01
In Iran, more than 1.3 million five-year olds have been screened for autism over three academic years, with the Social Communication Questionnaire (SCQ). The Autism Diagnostic Interview-Revised (ADI-R) is used to confirm a diagnosis of typical autism. The resulting prevalence of 6.26 per 10,000 for typical autism is in line with rates for certain…
Electrochemical behavior of Li2FeSiO4 with ionic liquids at elevated temperature
Czech Academy of Sciences Publication Activity Database
Nádherná, Martina; Dominko, R.; Hanzel, D.; Reiter, Jakub; Gabersček, M.
2009-01-01
Roč. 156, č. 7 (2009), A619-A626 ISSN 0013-4651 R&D Projects: GA MŠk LC523; GA AV ČR KJB400320701; GA MŠk(CZ) MEB090806 Institutional research plan: CEZ:AV0Z40320502 Keywords : ionic liquid * lithium -iont battery * lithium iron silicate Subject RIV: CG - Electrochemistry Impact factor: 2.241, year: 2009
Czech Academy of Sciences Publication Activity Database
Rejfek, Luboš; Mošna, Zbyšek; Beran, L.; Chmelař, P.; Chmelařová, N.; Dobrovolný, P.; Rozsíval, P.
2015-01-01
Roč. 2, č. 12 (2015), s. 67-71 ISSN 2313-626X R&D Projects: GA ČR(CZ) GAP209/12/2440 Institutional support: RVO:68378289 Keywords : Ionospheric communication channel * Digisonde * Continuous Doppler Sounding System Subject RIV: DG - Athmosphere Science s, Meteorology http://www. science -gate.com/IJAAS/ Articles /2015-2-12/12%202015-2-12-pp.67-71.pdf
Czech Academy of Sciences Publication Activity Database
Mungse, P.B.; Saravanan, G.; Nishibori, M.; Šubrt, Jan; Labhsetwar, N.K.
2017-01-01
Roč. 89, č. 4 (2017), s. 511-521 ISSN 0033-4545. [International Conference Solid State Chemistry 2016 /12./. Prague, 18.09.2016-23.09.2016] Institutional support: RVO:61388980 Keywords : CO capture and sequestration * Lattice * Mixed metal oxides * Reactive oxygen * Thermal power plants Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 2.626, year: 2016
Spring performance tester for miniature extension springs
Salzbrenner, Bradley; Boyce, Brad
2017-05-16
A spring performance tester and method of testing a spring are disclosed that has improved accuracy and precision over prior art spring testers. The tester can perform static and cyclic testing. The spring tester can provide validation for product acceptance as well as test for cyclic degradation of springs, such as the change in the spring rate and fatigue failure.
Li, Min-chao; Perelman, Juliy M; Kolosov, Victor P; Zhou, Xiang-dong
2011-10-01
To explore the role of transient receptor potential melastatin 8 cation channels (TRPM8) in cold-induced production of inflammatory factors in airway epithelial cells and related signal transduction mechanism. The 16HBE human airway epithelial cells were stimulated with cold temperature (18°C). In intervention experiments, cells were pretreated with TRPM8 channel antagonist BCTC, protein kinase C (PKC) specific inhibitor calphostin C and transfected with TRPM8 shRNA or control shRNA respectively, and thereafter cold stimulation was applied. Cells were divided into 6 groups: a control group (incubated at 37°C), a cold stimulation group, a cold stimulation + BCTC group, a cold stimulation + TRPM8 shRNA group, a cold stimulation + control shRNA group, a cold stimulation + calphostin C group. Western blot was performed to show the extent of knockdown in TRPM8 protein expression in the TRPM8 shRNA transfected cells. Dynamics of relative concentration of intracellular Ca(2+) in the former 5 groups were measured by calcium imaging techniques. Images were taken at one frame per 10 seconds. The levels of interleukin (IL)-6, IL-8, tumor necrosis factor (TNF)-α mRNA and protein were detected by real-time PCR and ELISA respectively. The highest relative concentration of intracellular calcium in cold stimulation group (2.36 ± 0.24) was higher than that of control group (1.01 ± 0.02) (t = 12.52, P cold stimulation group (t = 6.69 and 9.12, all P cold stimulation group[0.66 ± 0.16, 0.77 ± 0.15, 0.73 ± 0.09 and (92 ± 13) ng/L, (125 ± 22) ng/L, (88 ± 12) ng/L ] were significantly higher than those in control group [0.37 ± 0.08, 0.32 ± 0.07, 0.48 ± 0.10 and (52 ± 8) ng/L, (50 ± 9) ng/L, (61 ± 8) ng/L] (t = 3.20 - 6.26, all P cold stimulation + BCTC group [0.42 ± 0.09, 0.52 ± 0.13, 0.52 ± 0.12 and (72 ± 8) ng/L, (92 ± 14) ng/L, (68 ± 11) ng/L], cold stimulation + TRPM8 shRNA group [0.41 ± 0.10, 0.49 ± 0.08, 0.50 ± 0.08 and (60 ± 12) ng/L, (89 ± 14) ng
40 CFR 180.505 - Emamectin; tolerances for residues.
2010-07-01
..., fat 0.010 Cattle, liver 0.050 Cattle, meat 0.003 Cattle, meat byproducts, except liver 0.020 Goat, fat 0.010 Goat, liver 0.050 Goat, meat 0.003 Goat, meat byproducts, except liver 0.020 Hog, fat 0.003 Hog, liver 0.020 Hog, meat 0.002 Hog, meat byproducts (except liver) 0.005 Horse, fat 0.010 Horse...
Directory of Open Access Journals (Sweden)
Jiménez-Garay, R.
2000-08-01
Full Text Available The techniques of differential thermal analysis are frequently employed to study the kinetics of the transformation reactions and, in particular, the crystallization of the glassy alloys. The corresponding thermal data can be analyzed by the Kissinger method, which was originally derived for the study of homogeneous reactions. The consensus in the literature, in several decades, was that such applications (i.e. to heterogeneous solid state transformations of the Kissinger method are not valid. In the present work the principal objections to the mentioned applications are addressed and alternative derivations of theoretical results are provided. These results demonstrate that the Kissinger method is valid for heterogeneous reactions of the type described by Johnson-Mehl-Avrami equation in the isothermal case. Also the isothermal and non-isothermal data on crystallization of the Cu0.10As0.40Se0.50 glassy alloy are given. The experimental results and the discussion carried out here, help to clarify the effects of incubation time in non-isothermal transformation kinetics and provide a further demonstration of validity of the generalized Johnson-Mehl-Avrami theory for the description of heterogeneous solid state transformations.Las técnicas de análisis térmico diferencial se emplean con frecuencia para estudiar la cinética de las reacciones de transformación y, en particular la de la cristalización de aleaciones vítreas. Los datos térmicos correspondientes pueden analizarse por el método de Kissinger, que se desarrolló originalmente para el estudio de reacciones homogéneas. Durante varias décadas, el consenso en la literatura fue que tales aplicaciones (es decir, a transformaciones heterogéneas de estado sólido del método de Kissinger no eran válidas. En el presente trabajo se señalan las principales objeciones a las aplicaciones mencionadas y se da una deducción alternativa de los resultados teóricos. Estos resultados demuestran
78 FR 38226 - Sulfoxaflor; Pesticide Tolerances; Technical Correction
2013-06-26
... Fruit, stone, group 12 3.0 Goat, fat 0.10 Goat, meat 0.15 Goat, meat byproducts 0.40 Grain, aspirated fractions 20.0 Grape, raisin 6.0 Hog, fat 0.01 Hog, meat 0.01 Hog, meat byproducts 0.01 Horse, fat 0.10..., fat 0.10 Cattle, meat 0.15 Cattle, meat byproducts 0.40 Cauliflower 0.08 Citrus, dried pulp 3.6 Cotton...
Directory of Open Access Journals (Sweden)
Nora E Echeverría
2006-07-01
Full Text Available La erodabilidad de los suelos se puede medir a campo mediante simuladores de lluvia o predecir mediante modelos matemáticos como USLE y WEPP. El objetivo del trabajo fue medir la erodabilidad de tres suelos representativos del Sur de la Región semiárida argentina y compararla con la estimada por los modelos WEPP y USLE. En los suelos Bahía Blanca (SBB y Cabildo (SC -Paleustoles Petrocálcicos- y Villarino (SV -Calciustol Petrocálcicose aplicaron, mediante un simulador portátil, dos lluvias consecutivas de 32 mm en 30 minutos. Las pérdidas de suelo debido a la 1° y 2° lluvia indicaron: SV 3,26 y 5,86 Mg ha-1 h-1; SC 2,04 y 5,53 Mg ha-1 h-1; SBB 0,75 y 2,66 Mg ha-1 h-1, respectivamente. La resistencia del suelo a la erosión correlacionó con la relación limo: arcilla (r:0,60, CO (r:0,55 y estabilidad estructural (r:0,56.Las tasas de escurrimiento y sedimentación promedio fueron para SV: 12,4 10-6 m s-1 y 15,6 10-5 kg s-1 m-2; para SC: 9,9 10-6 m s-1 y 13,5 10-5 kg s-1 m-2 y para SBB: 9,6 10-6 m s-1 y 6,1 10-5 kg s-1 m-2, respectivamente. El comportamiento de SV se debió al rápido sellado del horizonte superficial, mientras que el de SBB y el SC se relacionó con la estabilidad estructural. En el modelo WEPP, la erodabilidad medida entre surcos (Ki fue, para SV: 2,5; SC: 1,89 y SBB: 1,39 (10(6 kg s m-4; mientras que la estimada (Kib fue significativamente más alta, SV: 6,26; SC: 10,2 y SBB: 10,2 (10(6 kg s m-4. Los índices de erosión (IE fueron, SV: 0,30; SC: 0,21 y SBB: 0,10 Mg MJ-1 y discreparon significativamente de los valores K estimados a partir del nomograma, confirmando que las predicciones del mismo resultan poco confiables en suelos con el 65% o más de arenas.Water erodibility of soils can be measured in the field using rainfall simulators or be predicted with mathematical models as USLE and WEPP. The objective of our research was to determine water erodibility of three representative soils in the southern semiarid
Czech Academy of Sciences Publication Activity Database
Mikeš, J.; Hýžďalová, Martina; Kočí, Lenka; Jendželovský, R.; Koval, J.; Vaculová, Alena; Hofmanová, Jiřina; Kozubík, Alois; Fedoročko, P.
2011-01-01
Roč. 10, č. 4 (2011), s. 626-632 ISSN 1474-905X R&D Projects: GA ČR(CZ) GA301/07/1557 Grant - others:GA ČR(CZ) GA305/09/1526 Program:GA Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : photodynamic therapy * hypericin * colon cancer Subject RIV: BO - Biophysics Impact factor: 2.584, year: 2011
Bringing Intelligence About: Practitioners Reflect on Best Practices
2003-05-01
1 The Intelligence Pro and the Professor: Toward an Alchemy of Applied Arts and Sciences...Thursday, June 12, 2003 6:26 AM 7 THE INTELLIGENCE PRO AND THE PROFESSOR: TOWARD AN ALCHEMY OF APPLIED ARTS AND SCIENCES Pauletta Otis...research financed by the U.S. Government, but distance themselves from government “intrusion” in the social sci- ences. This is understandable but can be
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHK172 (Link to dictyBase) - - - Contig-U11104-1 - (Link to Or...iginal site) CHK172F 626 - - - - - - Show CHK172 Library CH (Link to library) Clone ID CHK172 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11104-1 Original site URL http://dictycdb.b...HEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYTRASKAYIHLAQYDQAASII VRGLVFDPRN...KMDHEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYT
Czech Academy of Sciences Publication Activity Database
Michalcová, A.; Marek, I.; Len, A.; Heczko, Oleg; Drahokoupil, Jan; Vojtěch, D.; Huber, Š.; Nováková, R.
2017-01-01
Roč. 89, č. 4 (2017), s. 545-552 ISSN 0033-4545 R&D Projects: GA ČR GBP108/12/G043 Institutional support: RVO:68378271 Keywords : magnetic properties * magnetization * nanocrystals * neutron scattering * nickel * SANS * SSC-2016 * X-ray diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.626, year: 2016
2012-09-01
Patricia.Haynes3@va.gov Fax: (520) 626-6050 E-mail: thaynes@email.arizona.edu Home Address: Citizenship : United States 2828 W. Calle...of the Ambivalent Sleeper [Board Review Question]. Journal of Clinical Sleep Medicine, 15, 511-512. Haynes, P. L. (2009). Is CBT-I effective for...Support Networks in Asymptomatic Individuals with a History of Depression Versus Never-Depressed Individuals. Personal Life Events: Birth of Child
2015-07-01
the advantages and disadvantages of using the different assignment approaches. In order to better understand how initial military training policies...account. We did not evaluate the advantages or disadvantages of either accounting practice. Page 31 GAO-15-626 Army Reserve Components...coordinate on a mutually agreeable time. The Army Reserve and Army National Guard provided us individual soldier availability data from the five main
Analysis of sub-bandgap losses in TiO2 coating deposited via single and dual ion beam deposition
Czech Academy of Sciences Publication Activity Database
Žídek, Karel; Hlubuček, Jiří; Horodyská, Petra; Budasz, Jiří; Václavík, Jan
2017-01-01
Roč. 626, March (2017), s. 60-65 ISSN 0040-6090 R&D Projects: GA MŠk(CZ) LO1206 Institutional support: RVO:61389021 Keywords : Ion beam deposition * Titanium dioxide * Optical coating * Sub-bandgap losses * Urbach tail Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.879, year: 2016 http://www.sciencedirect.com/science/article/pii/S0040609017301256
Directory of Open Access Journals (Sweden)
José Marín Riveros
2011-10-01
Full Text Available Nos proponemos estudiar en este artículo, dentro de una época decisiva para la historia del imperio bizantino, esto es, los siglos Vi al IX, un aspecto particular que dice relación con cambios que se operan en la mentalidad bizantina, en cuanto a sus concepciones históricas y religiosas. en efecto, en medio de una crisis generalizada de inseguridad, la población bizantina se volcó hacia la religión, depositando su confianza en la protección sobrenatural del imperio y su capital. Ai mismo tiempo, constatamos que el trabajo historiográfico pierde consistencia, ocupando su lugar la reflexión religiosa, dentro de un cuadro general de exaltaciones místicas y efervescencia escatológica. Dicho de otro modo, cuando se piensa que el fin del mundo es inminente, ya no tiene sentido escribir historia, pero sí lo tiene la interpretación de las profecías, de cara a la segunda venida del Mesías. se trata de un momento decisivo en la configuración de la mentalidad bizantina.We try to study in this article, within a critical time in the history of the Byzantine empire, that is, 6th to 9th Century, a particular aspect in relationship with changes operate in the Byzantine mentality, in his historical and religious conceptions. indeed, in the middle of a generalized crisis of insecurity, the Byzantine population turned toward religion, depositing their trutst in the supernatural protection of the empire and its capital. at the same time, we see how the historiographical work loses consistency, taking its place religious reflections within a general picture of mystical panegyrics and eschatological effervescence. in another way, when you think that the end of the world is imminent, no makes sense write history, but does it have the interpretation of the prophecies in regard to the second coming of the Messiah. TPus is a turning point in the configuration of the Byzantine mentality.
Baladi, Michelle G; Newman, Amy H; France, Charles P
2010-01-01
The discriminative stimulus effects of dopamine (DA) D3/D2 receptor agonists are thought to be mediated by D2 receptors. To maintain responding, access to food is often restricted, which can alter neurochemical and behavioral effects of drugs acting on DA systems. This study established stimulus control with quinpirole in free-feeding rats and tested the ability of agonists to mimic and antagonists to attenuate the effects of quinpirole. The same antagonists were studied for their ability to attenuate quinpirole-induced yawning and hypothermia. DA receptor agonists apomorphine and lisuride, but not amphetamine and morphine, occasioned responding on the quinpirole lever. The discriminative stimulus effects of quinpirole were attenuated by the D3 receptor-selective antagonist N-{4-[4-(2,3-dichlorophenyl)-piperazin-1-yl]-trans-but-2-enyl}-4-pyridine-2-yl-benzamide HCl (PG01037) and the nonselective D3/D2 receptor antagonist raclopride, but not by the D2 receptor-selective antagonist 3-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]methyl-1H-indole (L-741,626); the potencies of PG01037 and raclopride to antagonize this effect of quinpirole paralleled their potencies to antagonize the ascending limb of the quinpirole yawning dose-response curve (thought to be mediated by D3 receptors). L-741,626 selectively antagonized the descending limb of the quinpirole yawning dose-response curve, and both L-741,626 and raclopride, but not PG01037, antagonized the hypothermic effects of quinpirole (thought to be mediated by D2 receptors). Food restriction (10 g/day/7 days) significantly decreased quinpirole-induced yawning without affecting the quinpirole discrimination. Many discrimination studies on DA receptor agonists use food-restricted rats; together with those studies, the current experiment using free-feeding rats suggests that feeding conditions affecting the behavioral effects of direct-acting DA receptor agonists might also have an impact on the effects of indirect
42 CFR 62.6 - How will individuals be selected to participate in the scholarship program?
2010-10-01
...) academic performance. (2) Special consideration will be given to (i) medical and osteopathic students who indicate their intention to enter family practice, internal medicine, pediatrics, or osteopathic general... this part for a period of 1 school year. (e) Continuation awards. Subject to the availability of funds...
Dicty_cDB: Contig-U01585-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available mRNA, clone: ARN01A01NGRM0003_F0... 54 0.010 1 ( GE817509 ) EST_scau_evk_969928 scauevk mixed_tissue Sebaste...s... 54 0.010 1 ( GE798818 ) EST_scau_evk_889236 scauevk mixed_tissue Sebastes... 54 0.010 1 ( FK742846 ) av...Mus musculus NOD-derived CD11c +ve dendritic cell... 52 0.038 1 ( GE798817 ) EST_scau_evk_887700 scauevk mixed_tissue Sebaste
SORCE XPS Level 3 Solar Spectral Irradiance 6-Hour Means V010
National Aeronautics and Space Administration — The SORCE XUV Photometer System (XPS) Solar Spectral Irradiance (SSI) 6-Hour Data Product SOR3XPS6 contains solar XUV irradiances in the 0.1 to 27 nm range, as well...
A research for the improvement of the HF-010 anthropomentry data guidelines
Energy Technology Data Exchange (ETDEWEB)
Oh, In Seok; Lee, Jung Woon; Lee, Yong Hee; Lee, Hyun Chul [Korea Atomic Energy Research Institute, Taejeon (Korea); Lee, Dhong Ha [Suwon University, Whasung (Korea)
2002-05-01
In this study, we forecasted Korean anthropometry data of 2010 year, that SinGori 1 and 2 will operate, using Korean physical condition survey data. To estimate anthropometry data of 2010 year, we extracted design elements (examples, standing type console, seating type console, leg space, workstation height, and etc) of Control Room regarding anthropometry data. Next we also extracted the design parameter(examples, benchboard depth, benchboard height, area of control layout on benchboard, area of display layout) from the design elements. Also, we extracted the anthropometry data measurement items regarding design parameters, and calculated the forecasting anthropometry data of the 2010 using Korean physical condition data of 1980, 1986, 1992 and 1997 year. Finally, we developed anthropometry design guidelines using forecasting anthropometry data. 8 refs., 6 figs., 23 tabs. (Author)
Using Self-Description to Handle Change in Systems, CMS-CR-2002-010
Estrella, F; Le Goff, J M; McClatchey, R; Murray, S
2002-01-01
In the web age systems must be flexible, reconfigurable and adaptable in addition to being quick to develop. As a consequence, designing systems to cater for change is becoming not only desirable but required by industry. Allowing systems to be self-describing or description-driven is one way to enable these characteristics. To address the issue of evolvability in designing self-describing systems, this paper proposes a pattern-based, object-oriented, description-driven architecture. The proposed architecture embodies four pillars - first, the adoption of a multi-layered meta-modeling architecture and reflective meta-level architecture, second, the identification of four data modeling relationships that must be made explicit such that they can be examined and modified dynamically, third, the identification of five design patterns which have emerged from practice and have proved essential in providing reusable building blocks for data management, and fourth, the encoding of the structural properties of the fiv...
Evaluation report on CCTF CORE-I REFLOOD TEST Cl-1, (Run 010)
International Nuclear Information System (INIS)
Sudoh, Takashi; Murao, Yoshio.
1983-09-01
This report describes the effects of the loop flow resistance on the thermohydraulic behavior in the primary system during the reflood phase. The investigation is based on the results of the test Cl-1 which was performed with increased loop flow resistance in the Cylindrical Core Test Facility (CCTF) at Japan Atomic Energy Research Institute. The loop flow resistance was about 40% higher in the present test than in the reference test Cl-5. The results of two tests were compared and the following conclusions were obtained: 1) The total loop flow rate and the core flooding rate were reduced by about 20% with the increased loop flow resistance 2) The core heat transfer was also lowered, then, the turnaround and the quench times extended at the locations above the core midplane. 3) The measured maximum temperature in the core was 50 K higher for the present test than for the reference test. (author)
USSR and Eastern Europe Scientific Abstracts, Biomedical and Behavioral Sciences, Number 96.
1978-10-26
COMPONENTS IN THE FERMENTATION BROTH AFFECTING THE DISTRIBUTION OF 0LEAND0MYCIN DURING EXTRACTION Moscow ANTIBIOTIKI in Russian No 7, 1978 pp 626...Various extraction studies were conducted with fermentation broths which led to the conclusion that the broth contains component(s) that binds...had taken, internally, 80-150 ml of a vinegar essence. Twenty-six died in the first h6 hrs displaying decom- pensated shock. Studies included EKG
Investigation on the Status Quo of Migrant Workers’ Motivation for Vocational Training
HE, Jianhua; ZUO, Lu
2013-01-01
The understanding of migrant workers’ motivation for training is of significant importance to promote the vocational training effectiveness. The survey study of 626 migrant workers in Guangdong province identified that occupational development motivation is the most intensive, followed by the social environment and job responsibility while cognitive interest and interrelationship are among the least. Therefore, the authors suggest that appropriate guidance should be conducted to facilitate ...
Ehlers, Cindy L.; Phillips, Evelyn; Gizer, Ian R.; Gilder, David A.; Wilhelmsen, Kirk C.
2009-01-01
Native Americans have some of the highest rates of marijuana and alcohol use and abuse, yet neurobiological measures associated with dependence on these substances in this population remain unknown. The present investigation evaluated the heritability of spectral characteristics of the electroencephalogram (EEG) and their correlation with marijuana and alcohol dependence in an American Indian community. Participants (n=626) were evaluated for marijuana (MJ) and alcohol (ALC) dependence, as we...
Khelaifia, S; Caputo, A; Djossou, F; Raoult, D
2017-01-01
We report the draft genome sequence of Haloferax alexandrinus strain Arc-hr (CSUR P798), isolated from the human gut of a 10-year-old Amazonian individual. Its 3 893 626 bp genome exhibits a 66.00% GC content. The genome of the strain Arc-hr contains 37 genes identified as ORFans, seven genes associated to halocin and 11 genes associated with polyketide synthases or nonribosomal peptide synthetases.
Török, Lilla; Szabó, Zsolt Péter; Boda-Ujlaky, Judit
2014-01-01
Jones and Berglas (1978) define self-handicapping as any action or choice of performance setting that enhances the opportunity to externalize (or excuse) failure and to internalize (reasonably accept credit for) success (p. 406). The present study examined the role of potential precursors in the self-handicapping process. A total of 626 undergraduates from various Hungarian universities completed measures of dispositional self-handicapping, self-esteem, self-conscious emotions, trait anxiety,...
Automatic detection of the unknown number point targets in FMICW radar signals
Czech Academy of Sciences Publication Activity Database
Rejfek, L.; Mošna, Zbyšek; Beran, L.; Fišer, O.; Dobrovolný, M.
2017-01-01
Roč. 4, č. 11 (2017), s. 116-120 ISSN 2313-626X R&D Projects: GA ČR(CZ) GA15-24688S Institutional support: RVO:68378289 Keywords : FMICW radar * 2D FFT * signal filtration * taraget detection * target parameter estimation Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences http://science-gate.com/IJAAS/Articles/2017-4-11/18%202017-4-11-pp.116-120.pdf
Czech Academy of Sciences Publication Activity Database
Himics, D.; Střižík, L.; Holubová, J.; Beneš, L.; Pálka, K.; Frumarová, Božena; Oswald, Jiří; Tverjanovich, A. S.; Wágner, T.
2017-01-01
Roč. 89, č. 4 (2017), s. 429-436 ISSN 0033-4545. [International Conference Solid State Chemistry 2016 /12./. Prague, 18.09.2016-23.09.2016] Institutional support: RVO:61389013 ; RVO:68378271 Keywords : chalcogenide glasses * erbium * Ga-Ge-Sb-S Subject RIV: CA - Inorganic Chemistry; CA - Inorganic Chemistry (FZU-D) OBOR OECD: Inorganic and nuclear chemistry; Inorganic and nuclear chemistry (FZU-D) Impact factor: 2.626, year: 2016
Czech Academy of Sciences Publication Activity Database
Mudrák, Ondřej; Frouz, J.
2018-01-01
Roč. 32, č. 3 (2018), s. 626-636 ISSN 0269-8463 R&D Projects: GA ČR(CZ) GA17-09979S; GA ČR(CZ) GA17-19376S; GA ČR GA13-10377S; GA ČR(CZ) GA15-11635S Institutional support: RVO:67985939 Keywords : succession * earthworms * restoration Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 5.630, year: 2016
Lifescience Database Archive (English)
Full Text Available 006861 |pid:none) Chlamydophila felis Fe/C-56 DNA,... 35 3.5 D38156_1( D38156 |pid:none) Equine rotavirus RN...8155 |pid:none) Equine rotavirus RNA 5 for NSP1, compl... 35 3.5 AP006861_626( AP...ides DSM... 35 3.5 CP000409_286( CP000409 |pid:none) Rickettsia canadensis str. McKie... 35 3.5 D38155_1( D3
Directory of Open Access Journals (Sweden)
Itamar Francisco Andreazza
2009-08-01
Full Text Available The sodium alginate extracted from seasonal Sargassum cymosum samples (autumn, winter, spring and summer in Paciência Beach (Penha- SC-Brazil showed a viscosity of 18.3, 33.5, 62.6 and 34.2 mPa·s, respectively. Theophylline tablets(60 mg containing 35 % of sodium alginate samples were analyzed by dissolution profile in a dissolution device at 100 rev×min-1 and 37 °C, using water as dissolution medium, during 6 h. Tablets with the lesser viscous sodium alginate sample (autumn showed a complete disintegration and drug release after 1 h. Despite all others tablets have exhibited the same drug release mechanism, by diffusion, the winter sodium alginate tablets released > 90 % of theophylline after 3 h, while spring and summer sodium alginate tablets showed similar dissolution profile with a release > 90 % of drug after 6 h. In general, the less viscous polymers showed a faster drug release, but probably other characteristics beside viscosity have played role in this process.El alginato de sodio extraído de muestras estacionales de Sargassum cymosum (otoño, invierno, primavera y verano en la Playa de la Paciencia (Penha-SC-Brasil mostró viscosidad de 18,3, 33,5, 62,6 y 34,2 mPa·s, respectivamente. Tabletas de teofilina (60 mg que contenían 35 % de muestras de alginato de sodio fueron analizadas a través del perfil de disolución, en un disolutor a 100 rev×min-1 y 37 ºC, utilizando agua como medio de disolución, durante 6 h. Las tabletas con la muestra de alginato de sodio menos viscosa (otoño mostraron completa desintegración y liberación del fármaco después de 1 h. A pesar de que todas las demás tabletas mostraron el mismo mecanismo de liberación del fármaco, por difusión, las tabletas con la muestra de alginato de sodio de invierno liberó > 90 % de la teofilina después de 3 h, mientras las tabletas de alginato de sodio de primavera y verano presentaron un perfil de disolución semejante con liberación > 90 % de f
Needlestick Injuries in Interventional Radiology Are Common and Underreported.
Deipolyi, Amy R; Prabhakar, Anand M; Naidu, Sailendra; Oklu, Rahmi
2017-12-01
Purpose To determine the prevalence of and risk factors for needlesticks in interventional radiology physicians, as well as the attitudes, behaviors, and conditions that promote or interfere with reporting of these injuries. Materials and Methods A total of 3889 interventional radiologists from academic and private practice in the United States were surveyed by emailing all interventional radiologist members of the Society of Interventional Radiology, including attending-level physicians and trainees (April-August 2016). The institutional review board waived the need for consent. Questions inquired about the nature, frequency, and type of needlestick and sharps injuries and whether and to whom these incidents were reported. Stepwise regression was used to determine variables predicting whether injuries were reported. Results In total, 908 (23%) interventional radiologists completed at least a portion of the survey. Eight hundred fourteen (91%) of 895 respondents reported a prior needlestick injury, 583 (35%) of 895 reported at least one injury while treating an HIV-positive patient, and 626 (71%) of 884 reported prior training regarding needlestick injury. There was, on average, one needlestick for every 5 years of practice. Most needlestick or sharps injuries were self inflicted (711 [87%] of 817) and involved a hollow-bore device (464 [56%] of 824). Only 566 (66%) of 850 injuries were reported. The most common reasons for not reporting included perceived lack of utility of reporting (79 [28%] of 282), perceived low risk for injury (56 [20%] of 282), noncontaminated needle (53 [19%] of 282), too-lengthy reporting process (37 [13%] of 282), and associated stigma (23 [8%] of 282). Only 156 (25%) of 624 respondents informed their significant other. Stepwise regression assessing variables affecting the likelihood of reporting showed that male sex (P = .009), low-risk patient (P < .0001), self injury (P = .010), trainee status (P < .0001), and the total number of prior
International Nuclear Information System (INIS)
Jeong, Hae Chang; Ahn, Youngkeun; Jeong, Myung Ho
2009-01-01
Multi-detector computed tomography (MDCT) has high diagnostic value for detecting or excluding coronary artery stenosis. However, conventional coronary angiograms (CCA) are occasionally required in patients having persistent chest pain with normal MDCT. We retrospectively analyzed 90 patients who underwent CCA due to persistent chest pain with normal MDCT. The patients were classified into patients having more than 50% diameter stenosis in CCA (false negative, group I: n=14, 62.6±7.5 years, 7 males) and those having less than 50% diameter stenosis (true negative, group II: n=76, 52.1±12.0 years, 42 males). Significant stenosis was observed in 9 patients at the left anterior descending artery, 4 at the right coronary artery, and 1 at the left circumflex artery in group I. Group I patients were older than group II patients (63±8 versus 52±12 years, P<0.001). There were more patients with hypertension and smoking in group I (64.3% versus 7.9%, 35.7% versus 3.9%, P<0.001, P<0.001, respectively). The levels of uric acid and homocysteine were higher in group I than in group II (5.7±1.5 versus 4.6±1.2 mg/dL, 9.6±3.1 versus 7.4±2.5 mol/L, P=0.008, P=0.010, respectively). There were more ST or T changes in the electrocardiograms in group I (35.7% versus 1.3%) (P<0.001). In multivariate analysis, a history of hypertension, uric acid levels, and ischemic evidence in the electrocardiogram were independent factors for a false negative of MDCT (odds ratio 11.11, 4.76, 1.81, 95% confidence interval 4.67 to 10.00, 1.41 to 1.61, 1.05 to 3.33, P=0.009, P=0.012, P=0.046, respectively). In certain situations, the findings of coronary stenosis by MDCT do not always correlate with that of CCA. (author)
Crystal Structure-Ionic Conductivity Relationships in Doped Ceria Systems
DEFF Research Database (Denmark)
Omar, Shobit; Wachsman, Eric D.; Jones, Jacob L.
2009-01-01
lattice strain of 10 mol% trivalent cation-doped ceria systems at the same temperatures. A consistent set of ionic conductivity data is developed, where the samples are synthesized under similar experimental conditions. On comparing the grain ionic conductivity, Nd0.10Ce0.90O2−δ exhibits the highest ionic...... conductivity among other doped ceria systems. The grain ionic conductivity is around 17% higher than that of Gd0.10Ce0.90O2−δ at 500°C, in air. X-ray diffraction profiles are collected on the sintered powder of all the compositions, from room temperature to 600°C, in air. From the lattice expansion data...... at high temperatures, the minimal elastic strain due to the presence of dopant is observed in Dy0.10Ce0.90O2−δ. Nd0.10Ce0.90O2−δ exhibits larger elastic lattice strain than Dy0.10Ce0.90O2−δ with better ionic conductivity at intermediate temperatures. Therefore, it is shown that the previously proposed...
Type a behaviour pattern and performance as insurance representative
Directory of Open Access Journals (Sweden)
D. J. W. Strumpfer
1991-06-01
Full Text Available Participants were 155 insurance representatives and 116 of them who were still in the same position one year later. The performance criterion represented commission on policies and annuities sold; data were obtained for the year of testing and the next year. The Jenkins Activity Survey was administered. The Type A (M === 6.26; SD == 7.90 was not excessively high. The Factor H score correlated r (114 - 0,23, p = 0,05 with the criterion for the second year; no other score correlated significantly with criterion scores. Interventions to reduce Type A behaviour for health reasons seem unlikely to reduce business performance. Opsomming Die deelnemers was 155 assuransieverteenwoordigers en 116 van hulle wat een jaar later nog in dieselfde pos was. Die prestasiekriterium het kommissie op polisse en annuiteite verteenwoordig; gegewens is vir die jaar van toetsing en die volgende jaar verkry. Jenkins se Aktiviteitsvraelys is toegepas. Die Tipe A (X == 6.26; SA - 790 was nie buitengewoon hoog nie. Die Faktor H-telling het r (114 - 0,23, p - 0,05 met die kriterium vir die tweede jaar gekorreleer; geen ander tellings het beduidend met die kriteriumtellings gekorreleer nie. Dit lyk onwaarskynlik dat intervensies om Tipe A-gedrag om gesondheidsredes te verminder besigheidsprestasie sal verlaag.
Energy Technology Data Exchange (ETDEWEB)
Xiong, Zhi-bo, E-mail: xzb328@163.com [School of Energy and Power Engineering, University of Shanghai for Science & Technology, Shanghai 200093 (China); Collaborative Innovation Research Institute, University of Shanghai for Science & Technology, Shanghai 200093 (China); Shanghai Power Equipment Research Institute, Shanghai 200240 (China); Liu, Jing; Zhou, Fei; Liu, Dun-yu; Lu, Wei [School of Energy and Power Engineering, University of Shanghai for Science & Technology, Shanghai 200093 (China); Jin, Jing [School of Energy and Power Engineering, University of Shanghai for Science & Technology, Shanghai 200093 (China); Collaborative Innovation Research Institute, University of Shanghai for Science & Technology, Shanghai 200093 (China); Ding, Shi-fa [Shanghai Power Equipment Research Institute, Shanghai 200240 (China)
2017-06-01
Highlights: • Iron-cerium-tungsten mixed oxide catalysts were prepared through three different methods. • The effect of preparation methods on the NH{sub 3}-SCR activity and the surface structure properties of catalyst were investigated. • Iron-cerium-tungsten mixed oxide prepared through microwave irradiation assistant critic acid sol-gel shows higher NH{sub 3}-SCR activity. - Abstract: A series of magnetic Fe{sub 0.85}Ce{sub 0.10}W{sub 0.05}O{sub z} catalysts were synthesized by three different methods(Co-precipitation(Fe{sub 0.85}Ce{sub 0.10}W{sub 0.05}O{sub z}-CP), Hydrothermal treatment assistant critic acid sol-gel method(Fe{sub 0.85}Ce{sub 0.10}W{sub 0.05}O{sub z}-HT) and Microwave irradiation assistant critic acid sol-gel method(Fe{sub 0.85}Ce{sub 0.10}W{sub 0.05}O{sub z}-MW)), and the catalytic activity was evaluated for selective catalytic reduction of NO with NH{sub 3}. The catalyst was characterized by XRD, N{sub 2} adsorption-desorption, XPS, H{sub 2}-TPR and NH{sub 3}-TPD. Among the tested catalysts, Fe{sub 0.85}Ce{sub 0.10}W{sub 0.05}O{sub z}-MW shows the highest NO{sub x} conversion over per gram in unit time with NO{sub x} conversion of 60.8% at 350 °C under a high gas hourly space velocity of 1,200,000 ml/(g h). Different from Fe{sub 0.85}Ce{sub 0.10}W{sub 0.05}O{sub z}-CP catalyst, there exists a large of iron oxide crystallite(γ-Fe{sub 2}O{sub 3} and α-Fe{sub 2}O{sub 3}) scattered in Fe{sub 0.85}Ce{sub 0.10}W{sub 0.05}O{sub z} catalysts prepared through hydrothermal treatment or microwave irradiation assistant critic acid sol-gel method, and higher iron atomic concentration on their surface. And Fe{sub 0.85}Ce{sub 0.10}W{sub 0.05}O{sub z}-MW shows higher surface absorbed oxygen concentration and better dispersion compared with Fe{sub 0.85}Ce{sub 0.10}W{sub 0.05}O{sub z}-HT catalyst. These features were favorable for the high catalytic performance of NO reduction with NH{sub 3} over Fe{sub 0.85}Ce{sub 0.10}W{sub 0.05}O{sub z}-MW catalyst.
Kwon, Sangwoo; Yang, Woochul; Choi, Yun Kyong; Park, Jung Keuck
2014-05-01
Atomic force microscopy (AFM) is utilized in many studies for measuring the structure and the physical characteristics of soft and bio materials. In particular, the force spectroscopy function in the AFM system allows us to explore the mechanical properties of bio cells. In this study, we probe the variation in the membrane hardness of human neuroblastoma SH-SY5Y cells (SH-cells) before and after differentiation by using force spectroscopy. The SH-cell, which is usually differentiated by using a chemical treatment with retinoic acid (RA), is a neuronal cell line employed widely as an in-vitro model for neuroscience research. In force spectroscopy, the force-distance curves are obtained from both the original and the RA-treated cells while the AFM tip approaches and pushes on the cell membranes. The slope deduced from linear region in the force-distance curve is the spring constant and corresponds to the hardness of the cell membrane. The spring constant of the RA-treated cells (0.597 ± 0.010 nN/nm) was smaller than that of the original cells (0.794 ± 0.010 nN/nm), reflecting a hardness decrease in the cells differentiated with the RA treatments. The results clearly demonstrated that the differentiated cells are softer than the original cells. The change in the elasticity of the differentiated cells might be caused by morphological modification during differentiation process. We suggest that force spectroscopy can be employed as a novel method to determine the degree of differentiation of stem cells into various functional cells.
Morales, Jessica
2012-01-01
The present study examined the impact of pubertal onset, race/ethnicity, and school racial/ethnic composition on girls' body image and perceived school climate (school safety, school liking, and loneliness in school) during the middle school transition. The sample (N = 1,626) included 6th grade Black, Mexican American, White, and Asian girls from 20 diverse middle schools. Hierarchical analyses supported both the early-timing and stressful change hypothesis. That is, experiencing pubertal ons...
Attaei, MW; Khatib, R; McKee, M; Lear, S; Dagenais, G; Igumbor, EU; AlHabib, KF; Kaur, M; Kruger, L; Teo, K; Lanas, F; Yusoff, K; Oguz, A; Gupta, R; Yusufali, AM
2017-01-01
Hypertension is considered the most important risk factor for cardiovascular diseases, but its control is poor worldwide. We aimed to assess the availability and affordability of blood pressure-lowering medicines, and the association with use of these medicines and blood pressure control in countries at varying levels of economic development. We analysed the availability, costs, and affordability of blood pressure-lowering medicines with data recorded from 626 communities in 20 countries part...
Effect of extraction temperature on the yield and physicochemical ...
African Journals Online (AJOL)
The chemical properties of the extracted oil at the two temperatures of 55oC and 65oC are as follows: Saponification value of 156.61 and 199.62; acid value of 12.53 and 14.40; iodine value (mg iodine/100g) of 55.23 and 52.36; peroxide value of 8.55 and 7.59 and free fatty acid (mg KOH/g) of 6.26 and 7.20 respectively.
Czech Academy of Sciences Publication Activity Database
Perlíková, Pavla; Konečný, P.; Nauš, Petr; Snášel, Jan; Votruba, Ivan; Džubák, P.; Pichová, Iva; Hajdúch, M.; Hocek, Michal
2013-01-01
Roč. 4, č. 11 (2013), s. 1497-1500 ISSN 2040-2503 R&D Projects: GA ČR GAP207/11/0344 EU Projects: European Commission(XE) 241587 - SYSTEMTB Grant - others:Operational Programme Research and Development for Innovations(XE) CZ.1.05/2.1.00/01.0030 Institutional support: RVO:61388963 Keywords : mycobacterium- tuberculosis * enzyme-inhibition * 6-(het)aryl-7-deazapurine ribonucleosides Subject RIV: CC - Organic Chemistry Impact factor: 2.626, year: 2013
Cations and hydration in catalytic RNA: Molecular dynamics of the hepatitis delta virus ribozyme
Czech Academy of Sciences Publication Activity Database
Krasovská, Maryna V.; Šefčíková, J.; Réblová, Kamila; Schneider, Bohdan; Walter, N.G.; Šponer, Jiří
2006-01-01
Roč. 91, č. 2 (2006), s. 626-638 ISSN 0006-3495 R&D Projects: GA ČR(CZ) GA203/05/0388; GA ČR(CZ) GA203/05/0009; GA AV ČR(CZ) 1QS500040581; GA MŠk(CZ) LC512 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z40550506 Keywords : molecular dynamics * cations * hydration Subject RIV: BO - Biophysics Impact factor: 4.757, year: 2006
[Work conditions and results of the health screening in workers of linoleum producing industry].
Liubchenko, P N; Salganikova, B S; Gorenkov, R V; Kholod, O L; Alekseeva, G A
1993-01-01
Screening in 115 linoleum shop workers exposed to small concentrations (at the level of MAC) of dioctyiphthalate, cyclohexanone, lead, carbon dioxide revealed the complaints of digestive and nervous systems in 84.3% and 60.9% of examines respectively. The special questionnaire and neurologic examination revealed the autonomic nervous system dysfunction in 62.6% of examinees. According to the Kardo index 70.7% had parasympathicotonia, 21.2% of examinees--sympathicotonia and 8.1% had eutonic dysfunction.
Czech Academy of Sciences Publication Activity Database
Stuchlík, Aleš
2007-01-01
Roč. 178, č. 1 (2007), s. 47-52 ISSN 0166-4328 R&D Projects: GA ČR(CZ) GA309/06/1231; GA MŠk 1M0517; GA MŠk LC554; GA MZd(CZ) NR9178; GA MZd(CZ) NR9180; GA ČR(CZ) GA309/07/0341 Institutional research plan: CEZ:AV0Z50110509 Keywords : memory * dopamine * cognition Subject RIV: FH - Neurology Impact factor: 2.626, year: 2007
Actin complexes in the cell nucleus: new stones in an old field
Czech Academy of Sciences Publication Activity Database
Castano, Enrique; Philimonenko, Vlada; Kahle, Michal; Fukalová, Jana; Kalendová, Alžběta; Yildirim, Sukriye; Dzijak, Rastislav; Dingová, Hana; Hozák, Pavel
2010-01-01
Roč. 133, č. 6 (2010), s. 607-626 ISSN 0948-6143 R&D Projects: GA ČR(CZ) GA204/07/1592; GA ČR(CZ) GD204/09/H084; GA MŠk LC545; GA MŠk 2B06063 Institutional research plan: CEZ:AV0Z50520514 Keywords : RNA polymerase II * ABL tyrosine kinase * F-actin Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.727, year: 2010
Czech Academy of Sciences Publication Activity Database
Matějec, Vlastimil; Mrázek, Jan; Podrazký, Ondřej; Hayer, Miloš; Pospíšilová, Marie
2009-01-01
Roč. 7, č. 5 (2009), s. 900-904 ISSN 1546-198X. [6th Maghreb-Europe Meeting on Materials and Their Applications for Devices and Physical, Chemical and Biological Sensors. Rabat, 30.10.2008-01.11.2008] R&D Projects: GA MŠk OC08023 Institutional research plan: CEZ:AV0Z20670512 Keywords : photocatalysis * anatase laayer * fiber - optic sensor Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.626, year: 2009
Linear magnetic spring and spring/motor combination
Patt, Paul J. (Inventor); Stolfi, Fred R. (Inventor)
1991-01-01
A magnetic spring, or a spring and motor combination, providing a linear spring force characteristic in each direction from a neutral position, in which the spring action may occur for any desired coordinate of a typical orthogonal coordinate system. A set of magnets are disposed, preferably symmetrically about a coordinate axis, poled orthogonally to the desired force direction. A second set of magnets, respectively poled opposite the first set, are arranged on the sprung article. The magnets of one of the sets are spaced a greater distance apart than those of the other, such that an end magnet from each set forms a pair having preferably planar faces parallel to the direction of spring force, the faces being offset so that in a neutral position the outer edge of the closer spaced magnet set is aligned with the inner edge of the greater spaced magnet set. For use as a motor, a coil can be arranged with conductors orthogonal to both the magnet pole directions and the direction of desired spring force, located across from the magnets of one set and fixed with respect to the magnets of the other set. In a cylindrical coordinate system having axial spring force, the magnets are radially poled and motor coils are concentric with the cylinder axis.
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. N L Khobragade1 K C Deshmukh2. Department of Mathematics, Dharampeth M P Deo Memorial Science College, Nagpur 440 010, India; Post Graduate Department of Mathematics, Nagpur University, Nagpur 440 010, India ...
LITERATURE CURRICULUM III--TEST FOR "THE MERCHANT OF VENICE."
KITZHABER, ALBERT R.
THIS TEST--"THE MERCHANT OF VENICE"--WAS DESIGNED BY THE OREGON CURRICULUM STUDY CENTER FOR A NINTH-GRADE LITERATURE CURRICULUM. IT IS INTENDED TO ACCOMPANY CURRICULUM UNITS AVAILABLE AS ED 010 815 AND ED 010 816. (MM)
International Nuclear Information System (INIS)
Sasaki, Shunsaku; Fukuda, Nobuo
2006-01-01
This study was designed to elucidate the dose-response relationships for life-shortening and tumorigenic effect in the dose range below 1 Gy of gamma rays delivered during the infant period. Female B6C3F 1 mice were irradiated with 0.10, 0.48 or 0.95 Gy at 7 days of age. All irradiated mice were allowed to live out their entire life span together with a simultaneously ongoing control group under a specific pathogen-free condition. Shortening of the mean life span was 1.58% in mice irradiated with 0.10 Gy, which was statistically significant. The coefficient of the linear dose-response relationship for life-shortening was 11.21% Gy -1 . The attributable death fraction for all causes of death in 0.10 Gy group reached 0.092. The excess relative risk for death rate from all causes was 0.102 in the group irradiated with 0.10 Gy. The coefficient of the linear dose-response relationship of the excess relative risk for death rate from all causes was 1.30 Gy -1 . The mean number of types of solid tumors at the time of death in mice irradiated with 0.10 Gy was distinctly larger than that in the control group. The excess relative risk for death rate from solid tumors was 0.45 in mice irradiated with 0.10 Gy. The coefficient of the linear dose-response relationship of excess relative risk for death rate from solid tumors was 4.52 Gy -1 . Increase in incidences of the pituitary, ovarian and adrenal tumors was observed in mice irradiated with 0.10 Gy. The results of the present study showed that infant mice are susceptible to solid tumor induction, especially of the endocrine organs. (author)
Yamaguchi, Iwao; Manabe, Takaaki; Tsuchiya, Tetsuo; Nakajima, Tomohiko; Sohma, Mitsugu; Kumagai, Toshiya
2008-02-01
Epitaxial VO2 films were prepared on the C-planes of α-Al2O3 substrates by a metal organic deposition (MOD) process. It was difficult to obtain the single phase of (010)M-oriented VO2 films, in which the subscript M refers to the monoclinic indices, by the heat treatment of amorphous precursor films in the VO2-stable region after the pyrolysis of the coating solution. The product films consisted of discontinuous circular grains of 1-2 µm size on the substrate surface. Therefore, we prepared the (010)M-oriented epitaxial VO2 films using postepitaxial topotaxy (PET), that is, topotactic oxidation of (0001)-oriented epitaxial V2O3 films. First, epitaxial V2O3(0001) films were obtained by MOD starting with a vanadium naphthenate solution. Second, the epitaxial V2O3(0001) films were topotactically oxidized at 500 °C in an Ar-O2 gas mixture with pO2 = 10-4 atm to obtain (010)M-oriented epitaxial VO2 films. The epitaxial relationships were VO2(010)M ∥ α-Al2O3(0001) and VO2[100]M ∥ α-Al2O3[0110], [1010], [1100]. The VO2(010)M films exhibited metal-semiconductor transitions with hysteresis loops at 60-80 °C. The resistivity change before and after the transition of the VO2(010)M film oxidized for 6 h was three orders of magnitude.
International Nuclear Information System (INIS)
Liu, H. F.; Chua, S. J.; Xiang, N.
2007-01-01
The authors investigated the growth of Al thin films on GaAs (100) substrates by molecular beam epitaxy. It is found that the growth at 550 degree sign C results in a texture that consists of (100)Al[010](parallel sign)(100)GaAs[011] and (100)Al[010](parallel sign)(100)GaAs[010] rotated 45 degree sign with respect to each other, while the growth at 300 degree sign C leads to a mixture phase of (100)Al[010](parallel sign)(100)GaAs[011] and (110)Al[001](parallel sign)(100)GaAs[011]. In situ annealing of the Al film grown at 300 degree sign C causes a reorientation of the crystalline from (100)Al[010](parallel sign)(100)GaAs[011] to (110)Al[001](parallel sign)(100)GaAs[011]. The grain sizes of the Al film are increased by the increased growth temperature and in situ annealing; the ratio of the exposed to the covered surface is not changed significantly by changing the growth temperature but decreased by annealing; and the small islands in between the large ones are removed by annealing. These observations are explained based on island migration and coalescence
Energy Technology Data Exchange (ETDEWEB)
Manov, George G [Tracerlab Inc. (United States)
1960-06-15
Measurements of levels of radioactivity in the region of 0-1.0 disintegrations per minute are becoming increasingly useful in the standardization of radionuclides as well as in other branches of science such as geology and medicine. For example, there is frequent need for low-level counting in the field of biological and tracer applications, particularly, in those cases in which the use of a higher level of radiation would alter the course of the mechanism or process under study. Frequently such measurements must be made under conditions in which the sample possesses an activity of only 1% of the normal, unshielded background radiation. At other times, an additional requirement is imposed because the radionuclide may have a very short half-life. There are three general ways in which the reliability of low-level measurements can be increased: more efficient counters, smaller background corrections and more stable, noise-free electronic systems. In this paper, comparative tests are described of the relative merits of hree different types of guard (anti-coincidence) counters in reducing the background. Measurements were made of: (a) umbrella, (b) annular, and (c) scintillating plastic igloo. The increasing difficulty of obtaining activity-free materials for construction of counters is a matter of some concern. Data are presented for the range of activities of materials available commercially. Stockpiling of such materials, preferably of pre-War II origin is rapidly becoming a necessity. The stability of the electronic system is a prime requisite for low level counting, particularly to avoid the counting of spurious pulses. A system is described in which a slow, measured rate of pulses is fed into the electronics, passed through the amplifier and deducted from the gross output of the register. In general, transistorized circuitry including pre-amplifiers and power supplies are more satisfactory than conventional vacuum tube devices. (author) [French] La mesure des
An Economic Analysis of Alternative Tray Pack Sizes
1990-08-01
5464 Grape Juice, Instant 8915-01-010-1471 7 DIN Chicken W/Gravy 8940-01-153-8540 Buttered Noodles 8940-01-151 5844 Carrots, Sliced 8915-01-151-6914... Instant 8915-00-530-3414 8 DIN Beef w/Barbecue Sauce 8940-01-010-0881 Buttered Noodles 8940-01-151-5844 Peas and Mushrooms 8915-01-157-2281 Chocolate...154-3525 Buttered Noodles 8940-01-151-5844 Apple Dessert 8940-01-147-7855 Grape Juice, Instant 8915-01-010-1471 20 14-DAY BASELINE MENU IRaX Ma Item
Groundwater flow cycling between a submarine spring and an inland fresh water spring.
Davis, J Hal; Verdi, Richard
2014-01-01
Spring Creek Springs and Wakulla Springs are large first magnitude springs that derive water from the Upper Floridan Aquifer. The submarine Spring Creek Springs are located in a marine estuary and Wakulla Springs are located 18 km inland. Wakulla Springs has had a consistent increase in flow from the 1930s to the present. This increase is probably due to the rising sea level, which puts additional pressure head on the submarine Spring Creek Springs, reducing its fresh water flow and increasing flows in Wakulla Springs. To improve understanding of the complex relations between these springs, flow and salinity data were collected from June 25, 2007 to June 30, 2010. The flow in Spring Creek Springs was most sensitive to rainfall and salt water intrusion, and the flow in Wakulla Springs was most sensitive to rainfall and the flow in Spring Creek Springs. Flows from the springs were found to be connected, and composed of three repeating phases in a karst spring flow cycle: Phase 1 occurred during low rainfall periods and was characterized by salt water backflow into the Spring Creek Springs caves. The higher density salt water blocked fresh water flow and resulted in a higher equivalent fresh water head in Spring Creek Springs than in Wakulla Springs. The blocked fresh water was diverted to Wakulla Springs, approximately doubling its flow. Phase 2 occurred when heavy rainfall resulted in temporarily high creek flows to nearby sinkholes that purged the salt water from the Spring Creek Springs caves. Phase 3 occurred after streams returned to base flow. The Spring Creek Springs caves retained a lower equivalent fresh water head than Wakulla Springs, causing them to flow large amounts of fresh water while Wakulla Springs flow was reduced by about half. Published 2013. This article is a U.S. Government work and is in the public domain in the USA.
Sellars, S. L.; Gao, X.; Hsu, K. L.; Sorooshian, S.; McCabe-Glynn, S.
2014-12-01
Atmospheric Rivers (ARs), the large plumes of moisture transported from the tropics, impact many aspects of society in the Western U.S. When ARs make landfall, they are often associated with torrential rains, swollen rivers, flash flooding, and mudslides. We demonstrate that by viewing precipitation events associated with ARs as "objects", calculating their physical characteristics (mean intensity (mm/hr), speed (km/hr), etc.), assigning environmental characteristics (e.g. phase of the El Nino Southern Oscillation) for each system, and then performing empirical analyses, we can reveal interactions between different climate phenomena. To perform this analysis, we use a unique object oriented data set based on the gridded, satellite precipitation data from the Precipitation Estimation from Remotely Sensed Information using Artificial Neural Networks (PERSIANN) algorithm known as PERSIANN-CONNECT, for the period 3/2000 to 12/2010. The data is segmented into 4D objects (longitude, latitude, time and intensity). Each of the segmented precipitation systems is described by over 72 characteristics. A search of the PERSIANN-CONNECT database for all Western U.S. large-scale precipitation systems returns 626 systems. Out of the 626 large-scale precipitation systems, 200 occurred at the same time as documented Western U.S. land falling ARs (a list of ARs provided by Dr. Martin Ralph). Here we report the physical and environmental characteristics for these 200 storms including a comparison to the 426 non-AR storms. We also report results of an analysis of the δ18O measurements collected from Giant Forest, Sequoia National Park in the Southwestern Sierra Nevada Mountains (McCabe-Glynn et al., in prep.) for the 200 AR precipitation systems. For an overall assessment of the impacts of climate variability on all 626 precipitation systems, we focus on ENSO, and show that during El Nino/La Nina, as compared with Neutral phases of ENSO, the systems are larger (9505, 9097, vs. 6075km
Index to FAA Office of Aviation Medicine Reports: 1961 through 1998.
1999-01-01
marihuana . AD775889 73-13 Tobias, J. V., and Irons, F. M: Reception of distorted speech. AD777564 73-14 Thackray, R. I., Jones, K. N., and...involved in midair collisions. ADAO16277 75-6 Lewis, M. F., Ferraro, D. P., Mertens, H. W., and Steen, J. A: Interaction between marihuana and...71-17. ... human tolerance, 62-6. ... marihuana effects on performance, 75-6. ... oxygen masks, efficiency of, 62-21, 66-7, 66-9, 66-20, 67-3, 67
Dietary Mutagen Exposure and Risk of Pancreatic Cancer
Li, Donghui; Sue Day, Rena; Bondy, Melissa L.; Sinha, Rashmi; Nguyen, Nga T.; Evans, Douglas B.; Abbruzzese, James L.; Hassan, Manal M.
2007-01-01
To investigate the association between dietary exposure to food mutagens and risk of pancreatic cancer, we conducted a hospital-based case-control study at the University of Texas M. D. Anderson Cancer Center during June 2002 to May 2006. Atotal of 626 cases and 530 noncancer controls were frequency matched for race, sex and age (±5 years). Dietary exposure information was collected via personal interview using a meat preparation questionnaire. A significantly greater portion of the cases tha...
2008-12-03
STB stainless steel housing. Drive End Thrust Collar Free End Splash Guard Slave Thrust Bearing Face STB Flange Figure 12: Exploded view of slave...Bulk Flow Analysis of Hybrid Thrust Bearing for Process Fluid Applications.” ASME Trans., Journal of Tribology , January, Vol. 122 (1), pp. 170-180...ASME Journal of Tribology , Vol. 123, pp. 768-776 [5] San Andrés, L., (2006), “MEEN 626 Notes 2 Derivation of the Classical Reynolds Equation for
Directory of Open Access Journals (Sweden)
José J. P. R. Lira
2012-09-01
Full Text Available The condition factor is a parameter which acts as a general indicator of the "well-being" of a species, and it can be obtained through the analysis of width vs. weight relationships. The present work aims to investigate size vs. weight relationship and the condition factor of the crab Goniopsis cruentata (Latreille, 1803. The study area was the Mundaú/Manguaba estuarine complex, Maceió, state of Alagoas, Northeast Brazil. Samplings were monthly accomplished from August 2007 to July 2008. A total of 626 individuals were analyzed, being 309 males and 317 females. Males were larger and heavier than females, what is expected in many brachyuran. The growth was positive allometric to both males (b = 3.42 and females (b = 3.30, not obeying the "cube law". The condition factor of female was higher than that of male crabs, probably due to the gonad weight of females. It also varied seasonally for both sexes, being higher in the autumn and winter in males, and in the autumn and spring in females, and related to the molt and period of spawning intensification.
Asnani, Vivake M.; Benzing, Jim; Kish, Jim C.
2011-01-01
The spring tire is made from helical springs, requires no air or rubber, and consumes nearly zero energy. The tire design provides greater traction in sandy and/or rocky soil, can operate in microgravity and under harsh conditions (vastly varying temperatures), and is non-pneumatic. Like any tire, the spring tire is approximately a toroidal-shaped object intended to be mounted on a transportation wheel. Its basic function is also similar to a traditional tire, in that the spring tire contours to the surface on which it is driven to facilitate traction, and to reduce the transmission of vibration to the vehicle. The essential difference between other tires and the spring tire is the use of helical springs to support and/or distribute load. They are coiled wires that deform elastically under load with little energy loss.
2010-07-01
... $180,000. If your estimated or actual engine imports increase beyond the level appropriate for your current bond payment, you must post additional bond to reflect the increased sales within 90 days after... post a bond to cover any potential enforcement actions under the Clean Air Act before you or anyone...
Studying Springs in Series Using a Single Spring
Serna, Juan D.; Joshi, Amitabh
2011-01-01
Springs are used for a wide range of applications in physics and engineering. Possibly, one of their most common uses is to study the nature of restoring forces in oscillatory systems. While experiments that verify Hooke's law using springs are abundant in the physics literature, those that explore the combination of several springs together are…
LANGUAGES OF THE WORLD--INDO-PACIFIC FASCICLE FIVE.
VOEGELIN, FLORENCE M.
THE NON-AUSTRONESIAN LANGUAGES CENTERING IN NEW GUINEA ARE LISTED AND DESCRIBED IN THIS REPORT. IN ADDITION, SENTENCE SAMPLERS OF THE USARUFA AND WANTOAT LANGUAGES ARE PROVIDED. (THE REPORT IS PART OF A SERIES, ED 010 350 TO ED 010 367.) (JK)
APRIL 1998 ASIAN DUST EVENT OVER THE COLUMBIA PLATEAU. (R828678C010)
The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...
Complete genome sequence of Coraliomargarita akajimensis type strain (04OKA010-24T)
Energy Technology Data Exchange (ETDEWEB)
Mavromatis, Konstantinos; Abt, Birte; Brambilla, Evelyne; Lapidus, Alla; Copeland, Alex; Desphande, Shweta; Nolan, Matt; Lucas, Susan; Tice, Hope; Cheng, Jan-Fang; Han, Cliff; Detter, John C.; Woyke, Tanja; Goodwin, Lynne; Pitluck, Sam; Held, Brittany; Brettin, Thomas; Tapia, Roxanne; Ivanova, Natalia; Mikhailova, Natalia; Pati, Amrita; Liolios, Konstantinos; Chen, Amy; Palaniappan, Krishna; Land, Miriam; Hauser, Loren; Chang, Yun-Juan; Jeffries, Cynthia D.; Rohde, Manfred; G& #246; ker, Markus; Bristow, James; Eisen, Jonathan A.; Markowitz, Victor; Hugenholtz, Philip; Klenk, Hans-Peter; Kyrpides, Nikos C.
2010-06-25
Coraliomargarita akajimensis Yoon et al. 2007 the type species of the genus Coraliomargarita. C. akajimensis is an obligately aerobic, Gram-negative, non-spore-forming, non-motile, spherical bacterium which was isolated from seawater surrounding the hard coral Galaxea fascicularis. C. akajimensis organism is of special interest because of its phylogenetic position in a genomically purely studied area in the bacterial diversity. Here we describe the features of this organism, together with the complete genome sequence, and annotation. This is the first complete genome sequence of a member of the family Puniceicoccaceae. The 3,750,771 bp long genome with its 3,137 protein-coding and 55 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.
Guanicid and PHMG Toxicity Tests on Aquatic Organisms
Directory of Open Access Journals (Sweden)
Eva Poštulková
2016-01-01
Full Text Available The emergence and development of new algicidal products is caused by the ever increasing popularity of garden ponds as well as the use of these products in the fisheries sector, especially for disposal of cyanobacteria and algae. Most frequent means of combating cyanobacteria and algae are applications of algicidal substances. Newly developed algaecides include Guanicid and polyhexamethylene guanidine hydrochloride (PHMG. The aim of the study was to identify toxic effects of Guanicid and PHMG on zebrafish (Danio rerio and green algae (Desmodesmus communis. We determined the acute toxicity in fish according to ČSN EN ISO 7346-1, and conducted the freshwater algae growth inhibition test according to ČSN ISO 8692 methodology. For inhibition tests with green algae we chose Guanicid and PHMG concentrations of 0.001, 0.005, and 0.010 ml/L. For fish short-term acute toxicity tests we chose Guanicid concentrations of 0.010, 0.050, 0.150, 0.200, 0.250, and 0.300 ml/L and PHMG concentrations of 0.010, 0.025, 0.050, 0.075, 0.100, and 0.125 ml/L. In case of zebrafish (Danio rerio, the LC50 value for Guanicid is 0.086 ml/L, while the LC50 value for PHMG is 0.043 ml/L. Effects of Guanicid on inhibition of green algae (Desmodesmus communis appear highly significant (p < 0.010 at a concentration of 0.010 ml/L. For PHMG, these effects are highly significant (p < 0.001 at concentrations of 0.005 and 0.010 ml/L in 48 hours.
Caliskan, Mert
2015-01-01
Get up to speed quickly with this comprehensive guide toSpring Beginning Spring is the complete beginner's guide toJava's most popular framework. Written with an eye towardreal-world enterprises, the book covers all aspects of applicationdevelopment within the Spring Framework. Extensive samples withineach chapter allow developers to get up to speed quickly byproviding concrete references for experimentation, building askillset that drives successful application development byexploiting the full capabilities of Java's latest advances. Spring provides the exact toolset required to build anent
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Dipika Barbadikar1 Rashmi Gautam2 Sanjay Sahare2 Rajendra Patrikar2 Jatin Bhatt1. Department of Metallurgical and Material Engineering, Visvesvaraya National Institute of Technology, Nagpur 440 010, India; Department of Electronics Engineering, Visvesvaraya National Institute of Technology, Nagpur 440 010, India ...
LANGUAGES OF THE WORLD--INDO-PACIFIC FASCICLE FOUR.
VOEGELIN, C. F.; VOEGELIN, FLORENCE M.
THIS REPORT CONTAINS A LIST AND DESCRIPTIONS OF THE AUSTRONESIAN FAMILY OF LANGUAGES WHICH INCLUDE THE LANGUAGES OF INDONESIA, FORMOSA, MADAGASCAR, THE PHILIPPINE ISLANDS, AND PART OF SOUTHEAST ASIA. (THE REPORT IS PART OF A SERIES, ED 010 350 TO ED 010 367.) (JK)
40 CFR 86.097-9 - Emission standards for 1997 and later model year light-duty trucks.
2010-07-01
...-3750 0.25 3.4 0.4 0.08 Natural Gas 3751-5750 0.32 4.4 0.7 0.08 LPG 0-3750 0.25 3.4 0.4 0.08 LPG 3751...-3750 0.31 4.2 0.6 0.10 Natural Gas 3751-5750 0.40 5.5 0.97 0.10 LPG 0-3750 0.80 0.31 4.2 0.6 0.10 LPG....4 0.7 Natural Gas >5750 0.39 5.0 1.1 LPG 3751-5750 0.32 4.4 0.7 LPG >5750 0.39 5.0 1.1 Table A97-4...
Unplanned readmission after hospital discharge in burn patients in Iran.
Jafaryparvar, Zakiyeh; Adib, Masoomeh; Ghanbari, Atefeh; Leyli, Ehsan Kazemnezhad
2018-02-21
Burns are considered as one of the most serious health problems throughout the world. They may lead to adverse consequences and outcomes. One of these outcomes is unplanned readmission. Unplanned readmission has been commonly used as a quality indicator by hospitals and governments. This study aimed to determine the predictors of unplanned readmission in patients with burns hospitalized in a burn center in the North of Iran (Guilan province, Rasht). This retrospective analytic study has been done on the medical records of hospitalized patients with burns in Velayat Sub-Specialty Burn and Plastic Surgery Center, Rasht, Iran during 2008-2013. In general, 703 medical records have been reviewed but statistical analysis was performed on 626 medical records. All data were entered in SPSS (version 16) and analyzed by descriptive and inferential statistics. Among 626 patients with burns, the overall readmission rate was 5.1%. Predictors of readmission included total body surface area (OR 1.030, CI 1.011-1.049), hypertension (OR 2.923, CI 1.089-7.845) and skin graft (OR 7.045, CI 2.718-18.258). Considering the outcome, predictors following burn have a crucial role in the allocation of treatment cost for patients with burns and they can be used as one of the quality indicators for health care providers and governments.
Energy Technology Data Exchange (ETDEWEB)
Jeong, H.G. [Advanced Fusion Process Group, Production Technology R and D Department, Korea Institute of Industrial Technology, Incheon (Korea, Republic of); Lee, J.B., E-mail: ljb01@kitech.re.kr [Advanced Fusion Process Group, Production Technology R and D Department, Korea Institute of Industrial Technology, Incheon (Korea, Republic of)
2012-09-25
Highlights: Black-Right-Pointing-Pointer Compressibility and formability of Zr{sub 62.6}Ti{sub 11}Cu{sub 13.2}Ni{sub 9.8}Be{sub 3.4} BMG sheets increases with an increase in forging temperature and pressure. Black-Right-Pointing-Pointer Crystallization in the alloy BMG sheet began to occur during micro-scaled forming. Black-Right-Pointing-Pointer The volume fraction of crystalline phase increases as the forging temperature and pressure increase. - Abstract: We report the micro-scaled forming of Zr{sub 62.6}Ti{sub 11}Cu{sub 13.2}Ni{sub 9.8}Be{sub 3.4} bulk metallic glass (BMG) as a function of the forging pressure within super-cooled liquid region (SLR), and its effects on the transition to crystallization. The morphology after micro-scaled forming was examined by using a field emission scanning electron microscope (FE-SEM). Thermal behavior of the forged samples was analyzed by using a differential scanning calorimeter (DSC). It was found for perfect forming of the alloy BMG sheets that the temperature of 703 K and the pressure of 20 MPa are required in the present study. The compressibility and the volume fraction of crystalline phase increase with an increase of the forging pressure and temperature, and they are sensitive to temperature more than pressure within SLR.
Mortensen, Janne Kaergaard; Larsson, Heidi; Johnsen, Søren Paaske; Andersen, Grethe
2014-07-01
Selective serotonin reuptake inhibitors (SSRIs) have been associated with an increased risk of bleeding but also a possible neuroprotective effect in stroke. We aimed to examine the implications of prestroke SSRI use in hemorrhagic and ischemic stroke. We conducted a registry-based propensity score-matched follow-up study among first-ever patients with hemorrhage and ischemic stroke in Denmark (2003-2012). Multiple conditional logistic regression was used to compute adjusted odds ratios of severe stroke and death within 30 days. Among 1252 hemorrhagic strokes (626 prestroke SSRI users and 626 propensity score-matched nonusers), prestroke SSRI use was associated with an increased risk of the strokes being severe (adjusted propensity score-matched odds ratios, 1.41; confidence interval, 1.08-1.84) and an increased risk of death within 30 days (adjusted propensity score-matched odds ratios, 1.60; confidence interval, 1.17-2.18). Among 8956 patients with ischemic stroke (4478 prestroke SSRI users and 4478 propensity score-matched nonusers), prestroke SSRI use was not associated with the risk of severe stroke or death within 30 days. Prestroke SSRI use is associated with increased stroke severity and mortality in patients with hemorrhagic stroke. Although prestroke depression in itself may increase stroke severity and mortality, this was not found in SSRI users with ischemic stroke. © 2014 American Heart Association, Inc.
Konda, Madhusudhan
2011-01-01
Get a concise introduction to Spring, the increasingly popular open source framework for building lightweight enterprise applications on the Java platform. This example-driven book for Java developers delves into the framework's basic features, as well as advanced concepts such as containers. You'll learn how Spring makes Java Messaging Service easier to work with, and how its support for Hibernate helps you work with data persistence and retrieval. Throughout Just Spring, you'll get your hands deep into sample code, beginning with a problem that illustrates dependency injection, Spring's co
Accuracy of dental torque wrenches.
Wood, James S; Marlow, Nicole M; Cayouette, Monica J
2015-01-01
The aim of this in vitro study was to compare the actual torque of 2 manual wrench systems to their stated (target) torque. New spring- (Nobel Biocare USA, LLC) and friction-style (Zimmer Dental, Inc.) manual dental torque wrenches, as well as spring torque wrenches that had undergone sterilization and clinical use, were tested. A calibrated torque gauge was used to compare actual torque to target torque values of 15 and 35 N/cm. Data were statistically analyzed via mixed-effects regression model with Bonferroni correction. At a target torque of 15 N/cm, the mean torque of new spring wrenches (13.97 N/cm; SE, 0.07 N/cm) was significantly different from that of used spring wrenches (14.94 N/cm; SE, 0.06 N/cm; P torques of new spring and new friction wrenches (14.10 N/cm; SE, 0.07 N/cm; P = 0.21) were not significantly different. For torque measurements calibrated at 35 N/cm, the mean torque of new spring wrenches (35.29 N/cm; SE, 0.10 N/cm) was significantly different (P torque could impact the clinical success of screw-retained dental implants. It is recommended that torque wrenches be checked regularly to ensure that they are performing to target values.
CHEMICAL COMPOSITION AND ANTIMICROBIAL ACTIVITY OF SOLIDAGO CANADENSIS LINN. ROOT ESSENTIAL OIL
Mishra, Devendra; Joshi, Shivani; Bisht, Ganga; Pilkhwal, Sangeeta
2010-01-01
The essential oil from the roots of Solidago canadensis Linn. (fam. Asteraceae) was analyzed by GC, GC/MS and NMR spectroscopy. Thirty nine constituents comprising 75.4% of the total oil were identified from the oil. Thymol constituted 20.25% of the oil followed by α-copaene (6.26%) and carvacrol (5.51%). The antimicrobial activity of the oil was evaluated using disc diffusion method. Results showed that the oil exhibited significant antibacterial activity against S. feacalis and E. coli wher...
Czech Academy of Sciences Publication Activity Database
Šubrt, Jan; Pližingrová, Eva; Palkovská, Monika; Boháček, Jaroslav; Klementová, Mariana; Kupčík, Jaroslav; Bezdička, Petr; Sovová, Helena
2017-01-01
Roč. 89, č. 4 (2017), s. 501-509 ISSN 0033-4545. [International Conference Solid State Chemistry 2016 /12./. Prague, 18.09.2016-23.09.2016] R&D Projects: GA MŠk(CZ) LM2015073 Institutional support: RVO:61388980 ; RVO:67985858 Keywords : Aerogels * Critical point drying * Lyophilization * Peroxo-polytitanic acid * Titanium dioxide Subject RIV: CA - Inorganic Chemistry; CI - Industrial Chemistry, Chemical Engineering (UCHP-M) OBOR OECD: Inorganic and nuclear chemistry; Chemical process engineering (UCHP-M) Impact factor: 2.626, year: 2016
1984-01-01
HETRA CORPORATION 131 131 MARTIN MARIETTA CORPORATION 3,478 3,478 NEWPORT ELECTRO - OPTICS 36 36 OPTO MECHANIK INC 2,293 2,293 REGAL MATTRESS COMPANY INC...TELEPHONE & TELO CO 584 58 RIVIERA BEACH BIG THREE INDUSTRIES INC 628 626 KOEHLKE COMPONENTS INC 85 85 LENZAR OPTICS CORP 966 966 MICRO TOOL a ENGINEERING...LOCATION CONTRACTOR DOD AIR NAME NAME TOTAL ARMY NAVY FORCE DLA OCE AURORA ELECTRO -TEST INC 95 95 ELLIS THEODORE AND COMPANY 82 82 FAMILY MOTEL 27 27
International Conference on Environmental Ergonomics (4th) Held in Austin, Texas on 1-5 October 1990
1991-01-15
tennis players , marathon runners, joggers, walkers and hikers. Yet over the last 100 years there has been a paucity of literature examining this most...50 to 350 C, in each region. CONCLUSIONS A development effort has resulted in the successful construction of a series of THTS’s. The design approach...work time (85 mins) in AC irrespective of CBA and there was a small (not significant) reduction in work time in NBA if CBA was worn (71.5 and 62.6 mins
Isolation of an unidentified pink-pigmented bacterium in a clinical specimen.
Odugbemi, T; Nwofor, C; Joiner, K T
1988-01-01
An unidentified pink-pigmented bacterium isolated from a clinical specimen is reported. The organism was oxidase, urease, and catalase positive; it grew on Thayer-Martin and MacConkey media. The isolate is possibly similar to an unnamed taxon (G.L. Gilardi and Y.C. Faur, J. Clin. Microbiol. 20:626-629, 1984); however, it had unique characteristics of nonmotility with no flagellum detectable and was a gram-negative coccoid with a few rods in pairs and negative for starch hydrolysis.
Isolation of an unidentified pink-pigmented bacterium in a clinical specimen.
Odugbemi, T; Nwofor, C; Joiner, K T
1988-05-01
An unidentified pink-pigmented bacterium isolated from a clinical specimen is reported. The organism was oxidase, urease, and catalase positive; it grew on Thayer-Martin and MacConkey media. The isolate is possibly similar to an unnamed taxon (G.L. Gilardi and Y.C. Faur, J. Clin. Microbiol. 20:626-629, 1984); however, it had unique characteristics of nonmotility with no flagellum detectable and was a gram-negative coccoid with a few rods in pairs and negative for starch hydrolysis.
Business Models for M-Services: Exploring the E-Newspaper Case from a Consumer View
CarinaI. Eriksson; Thomas Kalling; Maria Åkesson; Tobias Fredberg
2008-01-01
This article presents the consumer view of an innovative m-service, that is, the e-newspaper, which is published for a mobile reading device equipped with an e-paper display. The research question of this article is: What are the implications of the consumer view of future m-service innovation on business models? In this article, we present empirical results from an online survey with 3,626 respondents representing the consumer view. The factor analysis revealed three aspects of consumer pref...
Directory of Open Access Journals (Sweden)
Geraldo M. de Resende
2005-07-01
Full Text Available O efeito de diferentes espaçamentos entrelinhas e entre plantas, foi avaliado nas características produtivas e na conservação pós-colheita de bulbos de cebola. O experimento foi conduzido de abril a novembro de 1998, na Embrapa Semi-Árido, em Petrolina (PE. O delineamento experimental utilizado foi de blocos ao acaso, no esquema fatorial 2x3, compreendendo dois espaçamentos entrelinhas (0,10 e 0,15 m e três espaçamentos entre plantas (0,10; 0,20 e 0,30 m, sendo utilizada a cultivar Franciscana IPA-10 com quatro repetições. O espaçamento entrelinhas com 0,10 m alcançou maior produtividade comercial (39,30 t/ha comparativamente a 0,15 m (37,67 t/ha. Ao se analisar o espaçamento entre plantas verificou-se uma redução linear com o aumento do espaçamento, tendo o espaçamento com 0,10 m propiciado o maior rendimento com 42,88 t/ha. O menor rendimento de bulbos não comerciais foi proporcionado pelos espaçamentos de 0,29 e 0,26 m entre plantas, respectivamente, para os espaçamentos entrelinhas de 0,10 e 0,15 m. O peso fresco dos bulbos aumentou linearmente à medida que se aumentaram os espaçamentos entre plantas. Maior porcentagem de bulbos pequenos e médios foi verificada nos menores espaçamentos. Entretanto, à medida que se incrementou o espaçamento entre plantas ocorreu maior perda de peso pós-colheita.The effect of different planting spacing was observed on the yield characteristics and the postharvest conservation of onion bulbs. The experiment was carried out from April to November/1998, in Petrolina, Pernambuco State, Brazil. The experimental design was of randomized complete blocks in a 2 x 3 factorial scheme, with four replications. The cultivar Franciscana IPA-10 was planted in 0.10 and 0.15 m between row spacing and in 0.10; 0.15 and 0.30 m within row spacing. Highest marketable yield (39.30 t/ha was obtained form 0.10 m between row spacing as compared to the row spacing of 0.15 m (37.67 t/ha. A negative linear
Specifics of soil temperature under winter oilseed rape canopy
Krčmářová, Jana; Středa, Tomáš; Pokorný, Radovan
2014-09-01
The aim of this study was to evaluate the course of soil temperature under the winter oilseed rape canopy and to determine relationships between soil temperature, air temperature and partly soil moisture. In addition, the aim was to describe the dependence by means of regression equations usable for pests and pathogens prediction, crop development, and yields models. The measurement of soil and near the ground air temperatures was performed at the experimental field Žabiče (South Moravia, the Czech Republic). The course of temperature was determined under or in the winter oilseed rape canopy during spring growth season in the course of four years (2010 - 2012 and 2014). In all years, the standard varieties (Petrol, Sherpa) were grown, in 2014 the semi-dwarf variety PX104 was added. Automatic soil sensors were positioned at three depths (0.05, 0.10 and 0.20 m) under soil surface, air temperature sensors in 0.05 m above soil surfaces. The course of soil temperature differs significantly between standard (Sherpa and Petrol) and semi-dwarf (PX104) varieties. Results of the cross correlation analysis showed, that the best interrelationships between air and soil temperature were achieved in 2 hours delay for the soil temperature in 0.05 m, 4 hour delay for 0.10 m and 7 hour delay for 0.20 m for standard varieties. For semi-dwarf variety, this delay reached 6 hour for the soil temperature in 0.05 m, 7 hour delay for 0.10 m and 11 hour for 0.20 m. After the time correction, the determination coefficient (R2) reached values from 0.67 to 0.95 for 0.05 m, 0.50 to 0.84 for 0.10 m in variety Sherpa during all experimental years. For variety PX104 this coefficient reached values from 0.51 to 0.72 in 0.05 m depth and from 0.39 to 0.67 in 0.10 m depth in the year 2014. The determination coefficient in the 0.20 m depth was lower for both varieties; its values were from 0.15 to 0.65 in variety Sherpa. In variety PX104 the values of R2 from 0.23 to 0.57 were determined. When using
Fuzzy clustering of mechanisms
Indian Academy of Sciences (India)
described with reference to various attributes using the concept of ...... 0.20. 0.40. 0.10. 0.30. 0.20. 0.10. 0.80. 0.60. 0.80. 6. Economic and v ery con ...... I I 1977 Mechanisms in modern engineering design: A hand-book for engineers, designers.
40 CFR Appendix A to Part 68 - Table of Toxic Endpoints
2010-07-01
... [Propanenitrile] 0.0037 109-61-5 Propyl chloroformate [Carbonochloridic acid, propylester] 0.010 75-55-8... Isopropyl chloroformate [Carbonochloride acid, 1-methylethyl ester] 0.10 126-98-7 Methacrylonitrile [2-Propenenitrile, 2-methyl-] 0.0027 74-87-3 Methyl chloride [Methane, chloro-] 0.82 79-22-1 Methyl chloroformate...
International Nuclear Information System (INIS)
Tinker, R.A.; Smith, J.D.
1998-01-01
Determinations of 226 Ra and 228 Ra in potable mineral waters from springs located in the Daylesford-Hepburn region of Victoria, Australia are presented. Concentrations ranged from 230-810 mBq L -1 for 226 Ra and 200-800 mBq L -1 for 226 Ra. These levels approach or exceed the guideline limits recommended in the Australian Drinking Water Guidelines. The annual committed effective dose and health risks from radium in potable water is discussed. Assuming consumption of 2 L per day the average annual committed effective dose received from 226 Ra was 0.087 mSv y -1 and from 226 Ra was 0.10 mSv y -1
Minella, Michael T
2011-01-01
Since its release, Spring Framework has transformed virtually every aspect of Java development including web applications, security, aspect-oriented programming, persistence, and messaging. Spring Batch, one of its newer additions, now brings the same familiar Spring idioms to batch processing. Spring Batch addresses the needs of any batch process, from the complex calculations performed in the biggest financial institutions to simple data migrations that occur with many software development projects. Pro Spring Batch is intended to answer three questions: *What? What is batch processing? What
Tubular solid oxide fuel cells with porous metal supports and ceramic interconnections
Huang, Kevin [Export, PA; Ruka, Roswell J [Pittsburgh, PA
2012-05-08
An intermediate temperature solid oxide fuel cell structure capable of operating at from 600.degree. C. to 800.degree. C. having a very thin porous hollow elongated metallic support tube having a thickness from 0.10 mm to 1.0 mm, preferably 0.10 mm to 0.35 mm, a porosity of from 25 vol. % to 50 vol. % and a tensile strength from 700 GPa to 900 GPa, which metallic tube supports a reduced thickness air electrode having a thickness from 0.010 mm to 0.2 mm, a solid oxide electrolyte, a cermet fuel electrode, a ceramic interconnection and an electrically conductive cell to cell contact layer.
Directory of Open Access Journals (Sweden)
ZhiJie Li et al
2007-01-01
Full Text Available Perovskite-type oxides BaCe0.90Sm0.10O3−δ (BCS and BaCe0.80Gd0.10Sm0.10O3−δ (BCGS were synthesized by the sol–gel method and characterized by thermal analysis (TG-DTA, X-ray diffraction (XRD, scanning electron microscopy (SEM, and transmission electron microscopy (TEM. Using the sintered samples as solid electrolytes and silver–palladium alloy as electrodes, ammonia was synthesized from nitrogen and hydrogen at atmospheric pressure in a solid-state proton-conducting cell reactor. The maximum rate of production of ammonia was 5.82×10−9 mol s−1 cm−2.
African Journals Online (AJOL)
MBI
2013-12-21
Dec 21, 2013 ... Leiocarpus Leaves on the Corrosion of Aluminium in HCl Solution. Ayuba, A. M. and .... Fe(0.50), Ni(0.013),. Cu(0.048), Ga(0.013), In(0.10), Te(0.010), ... using a rotar vapour (BUCHI R110, 40oC) to obtain thick syrup which ...
Chusri, S; Sompetch, K; Mukdee, S; Jansrisewangwong, S; Srichai, T; Maneenoon, K; Limsuwan, S; Voravuthikunchai, S P
2012-01-01
Development of biofilm is a key mechanism involved in Staphylococcus epidermidis virulence during device-associated infections. We aimed to investigate antibiofilm formation and mature biofilm eradication ability of ethanol and water extracts of Thai traditional herbal recipes including THR-SK004, THR-SK010, and THR-SK011 against S. epidermidis. A biofilm forming reference strain, S. epidermidis ATCC 35984 was employed as a model for searching anti-biofilm agents by MTT reduction assay. The results revealed that the ethanol extract of THR-SK004 (THR-SK004E) could inhibit the formation of S. epidermidis biofilm on polystyrene surfaces. Furthermore, treatments with the extract efficiently inhibit the biofilm formation of the pathogen on glass surfaces determined by scanning electron microscopy and crystal violet staining. In addition, THR-SK010 ethanol extract (THR-SK010E; 0.63-5 μg/mL) could decrease 30 to 40% of the biofilm development. Almost 90% of a 7-day-old staphylococcal biofilm was destroyed after treatment with THR-SK004E (250 and 500 μg/mL) and THR-SK010E (10 and 20 μg/mL) for 24 h. Therefore, our results clearly demonstrated THR-SK004E could prevent the staphylococcal biofilm development, whereas both THR-SK004E and THR-SK010E possessed remarkable eradication ability on the mature staphylococcal biofilm.
Sources And Compositional Distribution Of Polycyclic Aromatic ...
African Journals Online (AJOL)
For molecular mass 178, an anthracene to anthracene plus phenanthrene ratio ≤ 0.10 was taken as indication of petroleum related sources, while a ratio > 0.10 indicated dominance of combustion related sources. For molecular mass 202, a fluoranthene to fluoranthene plus pyrene ratio ≤ 0.50 was indication of petroleum ...
Energy Technology Data Exchange (ETDEWEB)
Breckenridge, R.M.; Hinckley, B.S.
1978-01-01
This bulletin attempts, first, to provide a comprehensive inventory of the thermal springs of Wyoming; second, to explore the geologic and hydrologic factors producing these springs; and, third, to analyze the springs collectively as an indicator of the geothermal resources of the state. A general discussion of the state's geology and the mechanisms of thermal spring production, along with a brief comparison of Wyoming's springs with worldwide thermal features are included. A discussion of geothermal energy resources, a guide for visitors, and an analysis of the flora of Wyoming's springs follow the spring inventory. The listing and analysis of Wyoming's thermal springs are arranged alphabetically by county. Tabulated data are given on elevation, ownership, access, water temperature, and flow rate. Each spring system is described and its history, general characteristics and uses, geology, hydrology, and chemistry are discussed. (MHR)
CERN. Geneva; Clozel, Brian
2017-01-01
Spring is a framework widely used by the world-wide Java community, and it is also extensively used at CERN. The accelerator control system is constituted of 10 million lines of Java code, spread across more than 1000 projects (jars) developed by 160 software engineers. Around half of this (all server-side Java code) is based on the Spring framework. Warning: the speakers will assume that people attending the seminar are familiar with Java and Spring’s basic concepts. Spring 5.0 and Spring Boot 2.0 updates (45 min) This talk will cover the big ticket items in the 5.0 release of Spring (including Kotlin support, @Nullable and JDK9) and provide an update on Spring Boot 2.0, which is scheduled for the end of the year. Reactive Spring (1h) Spring Framework 5.0 has been released - and it now supports reactive applications in the Spring ecosystem. During this presentation, we'll talk about the reactive foundations of Spring Framework with the Reactor project and the reactive streams specification. We'll al...
Strontium isotopic composition of hot spring and mineral spring waters, Japan
International Nuclear Information System (INIS)
Notsu, Kenji; Wakita, Hiroshi; Nakamura, Yuji
1991-01-01
In Japan, hot springs and mineral springs are distributed in Quaternary and Neogene volcanic regions as well as in granitic, sedimentary and metamorphic regions lacking in recent volcanic activity. The 87 Sr/ 86 Sr ratio was determined in hot spring and mineral spring waters obtained from 47 sites. The ratios of waters from Quaternary and Neogene volcanic regions were in the range 0.703-0.708, which is lower than that from granitic, sedimentary and metamorphic regions (0.706-0.712). The geographical distribution of the ratios coincides with the bedrock geology, and particularly the ratios of the waters in Quaternary volcanic regions correlate with those of surrounding volcanic rocks. These features suggest that subsurface materials control the 87 Sr/ 86 Sr ratios of soluble components in the hot spring and mineral spring waters. (author)
SMARTPHONES AND THEIR IMPACT ON NET INCOME PER EMPLOYEE FOR SELECTED U.S. FIRMS
Amod Choudhary
2014-01-01
For the last few years, the number of smartphone users has been on a remarkable rise. The number of users increased from 62.6 million in 2010 to 115.8 million in 2012, and expected to increase to 192.4 million by 2016. This increased usage of smartphones by employees poses a dilemma for organizations. Since smartphones can do almost all the tasks (email, internet, and run applications of popular Microsoft software) of a traditional desktop computer, laptop, and phone; smartphone users are exp...
Alves F.S.; Peixoto D.E.; Lippe E.M.O.
2013-01-01
Ten years after the enactment of the 10.436/2002 law, it is clear that the presence of deaf students in regular classrooms has become a reality. After the regulation of the Federal decree n°5.626/2005, advances can be noted regarding access and inclusion of deaf students in educational environments, consolidating historical efforts by the deaf community. As a result, there is a demand for pursuing new strategies for teaching and for learning assessment. However, we have noticed that many sign...
Corrosion protection of zirconium surface based on Heusler alloy
Czech Academy of Sciences Publication Activity Database
Horáková, Kateřina; Cichoň, Stanislav; Lančok, Ján; Kratochvílová, Irena; Fekete, Ladislav; Sajdl, P.; Krausová, A.; Macák, J.; Cháb, Vladimír
2017-01-01
Roč. 89, č. 4 (2017), s. 553-563 ISSN 0033-4545 R&D Projects: GA MŠk LO1409; GA ČR(CZ) GA16-03085S; GA ČR GJ17-19910Y; GA ČR(CZ) GA15-05095S Institutional support: RVO:68378271 ; RVO:67985858 Keywords : electrochemistry * silicon * spectroscopy * SSC-2016 * surface chemistry * wate * zirconium Subject RIV: JI - Composite Materials OBOR OECD: Composites (including laminates, reinforced plastics, cermets, combined natural and synthetic fibre fabrics Impact factor: 2.626, year: 2016
International Nuclear Information System (INIS)
Hartwell, J.K.; Mandler, J.W.; Duce, S.W.; Motes, B.G.
1981-05-01
The Three Mile Island Unit-2 reactor building atmosphere was sampled prior to the reactor building purge. Samples of the containment atmosphere were obtained using specialized sampling equipment installed through penetration R-626 at the 358-foot (109-meter) level of the TMI-2 reactor building. The samples were subsequently analyzed for radionuclide concentration and for gaseous molecular components (O 2 , N 2 , etc.) by two independent laboratories at the Idaho National Engineering Laboratory (INEL). The sampling procedures, analysis methods, and results are summarized
Directory of Open Access Journals (Sweden)
Ching-Yu Chou
2015-10-01
Results: The study comprised 1310 newborn infants: 684 (52.2% male and 626 (47.8% female. Multivariate analysis showed a right or left prenatal AP renal pelvic diameter > 4 mm was associated with a higher risk of postnatal hydronephrosis compared with a right and left prenatal AP renal pelvic diameter ≤ 4 mm. Boys had a higher risk for postnatal hydronephrosis than girls (odds ratio = 2.42, p 4 mm on midtrimester ultrasound is predictive of postnatal hydronephrosis.
International bulletin on atomic and molecular data for fusion. No. 17
International Nuclear Information System (INIS)
Katsonis, K.; Langley, R.A.
1981-11-01
This bulletin deals with atomic and molecular data for fusion. A bibliography for the most recent data presented in the document is provided. Work in progress is briefly reported: Electron ionization cross sections for light elements, single electron capture by highly charged ions colliding with hydrogen, inconel 626 surface exfoliation, cavities in nickel induced by helium ion irradiation, electron impact excitation of hydrogenic ions. The bulletin contains a list of references for the publications on controlled fusion and plasma physics for 1980 and 1981
Digital Repository Service at National Institute of Oceanography (India)
Iyer, S.D; Mascarenhas-Pereira, M.B.L.; Nath, B.N
. Conference report. J. Geol. Soc. Am., 136, 621-626. Das, P., Iyer, S.D., Kodagali, V.N., Krishna, K.S., 2005. A new insight into the distribution and origin of seamounts in the Central Indian Ocean Basin. Mar. Geod., 28, 259-269. Davydov, M... Ridge, 26o N): Space trotter, guest from mantle, or a widespread mineral, connected with serpentinization? J. Geophys. Res., 111, B05103, doi:10.1029/ 2005JB003955. Dekov, V.M., Mandova, E.D., Dimitrov, K.C., Rekkalov, K.N., 1995. Native aluminium...
Dimova, Natasha T.; Burnett, William C.; Speer, Kevin
2011-04-01
This work presents results from a nearly two-year monitoring of the hydrologic dynamics of the largest submarine spring system in Florida, Spring Creek Springs. During the summer of 2007 this spring system was observed to have significantly reduced flow due to persistent drought conditions. Our examination of the springs revealed that the salinity of the springs' waters had increased significantly, from 4 in 2004 to 33 in July 2007 with anomalous high radon ( 222Rn, t1/2=3.8 days) in surface water concentrations indicating substantial saltwater intrusion into the local aquifer. During our investigation from August 2007 to May 2009 we deployed on an almost monthly basis a continuous radon-in-water measurement system and monitored the salinity fluctuations in the discharge area. To evaluate the springs' freshwater flux we developed three different models: two of them are based on water velocity measurements and either salinity or 222Rn in the associated surface waters as groundwater tracers. The third approach used only salinity changes within the spring area. The three models showed good agreement and the results confirmed that the hydrologic regime of the system is strongly correlated to local precipitation and water table fluctuations with higher discharges after major rain events and very low, even reverse flow during prolong droughts. High flow spring conditions were observed twice during our study, in the early spring and mid-late summer of 2008. However the freshwater spring flux during our observation period never reached that reported from a 1970s value of 4.9×10 6 m 3/day. The maximum spring flow was estimated at about 3.0×10 6 m 3/day after heavy precipitation in February-March 2008. As a result of this storm (total of 173 mm) the salinity in the spring area dropped from about 27 to 2 in only two days. The radon-in-water concentrations dramatically increased in parallel, from about 330 Bq/m 3 to about 6600 Bq/m 3. Such a rapid response suggests a direct
40 CFR 180.609 - Fluoxastrobin; tolerances for residues.
2010-07-01
... subgroup 4B 4.0 Peanut 0.010 Peanut, hay 20.0 Peanut, refined oil 0.030 Soybean, forage 9.0 Soybean, hay 1... Vegetable, tuberous and corm, subgroup 1C 0.010 (2) Tolerances are established for residues of fluoxastrobin... Vegetable, foliage of legume, group 7 0.050 [74 FR 67113, Dec. 18, 2009] ...
Anipamil prevents ST depression in patients with stable angina pectoris
DEFF Research Database (Denmark)
Larsen, C T; Sørum, C; Rasmussen, V
1993-01-01
test with > or = 0.10 mV horizontal or down-sloping ST-segment depression and limited by angina pectoris, and at least 10 attacks of angina pectoris in the initial single-blind placebo period. During the placebo period, a total duration of transient myocardial ischemia > or = 0.10 mV during the 24-hour...
International Nuclear Information System (INIS)
Xu, Guigui; Zhong, Kehua; Zhang, Jian-Min; Huang, Zhigao
2014-01-01
We present a first-principles calculation for the electronic and Li-ion diffusion properties of the LiFePO 4 (010) surface modified by sulfur. The calculated formation energy indicates that the sulfur adsorption on the (010) surface of the LiFePO 4 is energetically favored. Sulfur is found to form Fe-S bond with iron. A much narrower band gap (0.67 eV) of the sulfur surface-modified LiFePO 4 [S-LiFePO 4 (010)] is obtained, indicating the better electronic conductive properties. By the nudged elastic band method, our calculations show that the activation energy of Li ions diffusion along the one-dimensional channel on the surface can be effectively reduced by sulfur surface modification. In addition, the surface diffusion coefficient of S-LiFePO 4 (010) is estimated to be about 10 −11 (cm 2 /s) at room temperature, which implies that sulfur modification will give rise to a higher Li ion carrier mobility and enhanced electrochemical performance
TAXPAYERS KNOWLEDGE: A DESCRIPTIVE EVIDENCE ON DEMOGRAPHIC FACTORS IN MALAYSIA
Directory of Open Access Journals (Sweden)
Mohd Rizal Palil
2005-01-01
Full Text Available The objective of this paper is to determine the demographic factors in influence the behavior of taxpayers. Levene's test shows that there is no significant mean different between male and female, no significant mean different between government and private servants tax knowledge score. Furthermore, there is no significant different between Chinese and Indian score, the different is only 0.10%. As the analysis goes further, Levene' test shows that there is a significant mean different between Malay and Chinese (p < 0.10, a = 0.05 as well as Indian and Chinese (p < 0.10, a = 0.05. Abstract in Bahasa Indonesia : Penelitan ini bertujuan untuk menguji pengaruh faktor-faktor demogarafi yang mempengaruhi prilaku Wajib Pajak. Berdasarkan Uji Levene, penelitian ini membuktikan, bahwa tidak ada perbedaan yang signifikan atas pengetahuan Wajib Pajak antara laki-laki dan perempuan, antara pemerintah dan swasta. Perbedaan pengetahuan Wajib Pajak antara orang China dan Malaysia hanya menunjukkan nilai 0,10%. Analisa selanjutnya melalui uji Levene memperlihatkan bahwa, terdapat perbedaan tingkat pengetahuan pajak yang signifikan antara orang Malaysia dan China (p
Chiang, Geoff
2013-01-01
Filled with practical, step-by-step instructions and clear explanations for the most important and useful tasks. A tutorial guide that walks you through how to use the features of Spring Tool Suite using well defined sections for the different parts of Spring.Instant Spring Tool Suite is for novice to intermediate Java developers looking to get a head-start in enterprise application development using Spring Tool Suite and the Spring framework. If you are looking for a guide for effective application development using Spring Tool Suite, then this book is for you.
Energy Technology Data Exchange (ETDEWEB)
Namma, Haydar Aboud; Wagiran, H.; Hussin, R.; Ariwahjoedi, B. [Department of Physics, Universiti Teknologi Malaysia, Skudai 81310, Malaysia and Baghdad College of Economic Sciences University (Iraq); Fundamental and Applied Sciences Department, Universiti Teknologi PETRONAS, 31750 Tronoh (Malaysia)
2012-09-26
The SnO{sub 2} co-doped lithium potassium borate glasses doped with 0.05, 0.10, 0.25 and 0.50 mol% of Cu were synthesized by the melt quenching technique. The SnO{sub 2} co-dope was added to the compounds in the amounts of 0.05, 0.10, and 0.20 mol%. The photoluminescent spectrum for different concentrations of copper was studied. It was observed that the intensity of blue emission (450, 490 nm) varies with concentration mol%. In addition, with different concentration of SnO{sub 2} to 0.10 mol% Cu, the influence of the luminescence has been observed to enhance intensity and shifted to blue and red (490, 535 nm) emissions.
Spin asymmetries for events with high pT hadrons in DIS and an evaluation of the gluon polarization
International Nuclear Information System (INIS)
Adeva, B.; Gallas, A.; Gracia, G.; Plo, M.; Saborido, J.; Arik, E.; Ozben, C.; Unel, G.; Arvidson, A.; Rodriguez, M.; Badelek, B.; Baum, G.; Bueltmann, S.; Tripet, A.; Berglund, P.; Betev, L.; Haft, K.; Staude, A.; Vogt, J.; Birsa, R.
2004-01-01
We present a measurement of the longitudinal spin cross section asymmetry for deep-inelastic muon-nucleon interactions with two high transverse momentum hadrons in the final state. Two methods of event classification are used to increase the contribution of the photon-gluon fusion process to above 30%. The most effective one, based on a neural network approach, provides the asymmetries A p = 0.030±0.057(stat)±0.010(syst) and A d =0.070±0.076(stat)±0.010(syst). From these values we derive an averaged gluon polarization ΔG/G=-0.20±0.28(stat)±0.10(syst) at an average fraction of nucleon momentum carried by gluons =0.07
Effect of molybdenum on yield and nutrient content of the strawberry
International Nuclear Information System (INIS)
Bender, R.J.; Barros, I.B.I. de
1984-01-01
The cultivation of strawberries (Fragaria x ananassa Duch.) cv. Campinas in nutrient solution using five fields levels of molybdenum (MO), 0.010 ppm, 0.010 ppm, 0.10 ppm, 1.0 ppm and control (Without applying molybdenum). The experiment was carried out in greenhouse and phytothron to evaluate the changes in the mineral status of the leaves and the quality of the berries. The concentration of Mo in the leaves, at the beginning of fruiting stage, varied from 0.5 ppm to 64 ppm. The total N in the levels was affected significantly by Mo. Average weight of the berries were affected by treatments and presented a quadratic regression response. (M.A.C.) [pt
2010-07-01
... EMISSIONS FROM NEW, SMALL NONROAD SPARK-IGNITION ENGINES AND EQUIPMENT Special Compliance Provisions § 1054... provisions of this section and send us an annual report, as follows: (1) Notify the Designated Compliance... and manufacturing equipment. Companies that import equipment into the United States without meeting...
Lui, M; Chan, Andy; Long, Josh
2011-01-01
Pro Spring Integration is an authoritative book from the experts that guides you through the vast world of enterprise application integration (EAI) and application of the Spring Integration framework towards solving integration problems. The book is:. * An introduction to the concepts of enterprise application integration * A reference on building event-driven applications using Spring Integration * A guide to solving common integration problems using Spring Integration What makes this book unique is its coverage of contemporary technologies and real-world information, with a focus on common p
Investigation of Brittle Fractures in Graphite-Epoxy Composites Subjected to Impact
1975-05-01
Steel Impacto ; 121 CL• BIDIRECTION1AL PRD 49-EPOXYONIAGE ZONIE BIDIRECTIONAL THORNEL 300-EPOXY 0.10•,, A/0’.• 05 t=0.125 IN. 0 0.05 0.10 0.15 0.20...1973. 38. Olster, E. F., and Woodbury, H. A., EVALUATION OF BALLIS- TIC DAMAGE RESISTANCE AND FAILURE MECHANISMS OF COMPOSITE MATERIALS, AVCO Corp
Percolative nature of A-site disordered La0.75Ca0.25-xSrxMnO3 manganites
DEFF Research Database (Denmark)
Venkatesh, R.; Yadam, Sankararao; Venkateshwarlu, D.
2015-01-01
Magnetic, resistive, and magnetoresistance measurements were used to investigate the percolative nature of A-site disordered La0.75Ca0.25-xSrxMnO3(x = 0, 0.10) manganites. La0.75Ca0.15Sr0.10MnO3 has an orthorhombic structure and second order magnetic phase transition indicates the presence of two...
DEFF Research Database (Denmark)
Engen, John R.; Jørgensen, Thomas J. D.
2010-01-01
Please cite this article as: J.R. Engen, T.J.D. Jørgensen, Foreword, International Journal of Mass Spectrometry (2010), doi:10.1016/j.ijms.2011.02.010......Please cite this article as: J.R. Engen, T.J.D. Jørgensen, Foreword, International Journal of Mass Spectrometry (2010), doi:10.1016/j.ijms.2011.02.010...
2011-12-01
kind of base fiber used Fab-ric uni, stitched, weave, woven roving, textile form, tape, prepreg Laminate Schedu le [0]10 [0]14 [0]36 Manufacturing...roving, textile form, tape, prepreg Laminate Schedule [0]10 [0]14 [0]36 Manufacturing Date 2006 Test Facility/Date 2007 Program of Record AHM&ST...9 Laminate Schedule .......................................................................................................10 Cure
African Journals Online (AJOL)
MBI
2013-12-21
Dec 21, 2013 ... high-strength aluminium alloys (Bereket and Yurt,. 2001). It is generally .... (wt %) Al(98.70),. Si(0.48), Cl(0.014), K(0.04), Ca(0.01), Ti(0.005),. V(0.016), Mn(0.012), Fe(0.50), Ni(0.013),. Cu(0.048), Ga(0.013), In(0.10), Te(0.010),.
Study on Hot-wire Method for Measuring the Thermal Conductivity of food Materials%银杏淀粉的分离和纯化
Institute of Scientific and Technical Information of China (English)
敖自华; 王璋; 许时婴
2001-01-01
High ly purified amylopectin and amylose from ginkgo biloba L.starch could be obtained by recrystallization. Results of gel permeation chromatography (GPC) on sepharose 2B showed that molecular weight of ginkgo amylose appeared to be smaller than that of corn amylose,whereas the amylopectin molecular weight had a wide distribution in the GPC profile. For ginkgo amylose and amylopectin,iodine affinity values were 19.19% and 0.13% ,blue values 0.85 and 0.12.and λ max of I2-KI blue colour 626nm and 564nm ,respectively. Amylose content of ginkgo starch was 33%.%用重结晶法可以得到纯度较高的银杏直链淀粉和支链淀粉。凝胶过滤色谱表明:银杏直链淀粉的分子量比玉米直链淀粉的小,而支链淀粉的分子量则具有较宽的分布。银杏直、支链淀粉的碘亲和力分别为19.19%和0.1 3%,蓝值分别是0.85和0.12,λmax为626nm和564nm;银杏淀粉中直链淀粉含量为33%。
Migration intentions among Portuguese junior doctors: Results from a survey.
Ramos, Pedro; Alves, Hélio
2017-12-01
Migration of health personnel during periods of economic crisis represents a challenge for policymakers in origin and destination countries. Portugal is going through a period of economic hardship and much has been speculated about an increase in junior doctors' migration during this period. Using a questionnaire administered to a sample of Portuguese junior doctors who were still in the general residency (1st-year after medical school), we aim at determining the prevalence of migration intentions among Portuguese junior doctors and to identify the most important drivers of career choice for those who are considering emigrating in the near future. In our sample, 55% of Portuguese junior doctors are considering working abroad in the coming 10 years. Several variables were associated with an intention to work abroad: female sex (odds ratio [OR] 0.559; 95% confidence interval [CI] 0.488-0.640), the National Medical Exam score (OR 0.978; 95% CI 0.961-0.996;), having studied abroad (OR 1.756; 95% CI 1.086-2.867) and considering income and research opportunities as key factors for future specialty choice (OR 1.356; 95% CI 1.132-1.626; OR 2.626; 95% CI 1.228-4.172). Our study warns of the shortages the country may face due to doctors' migration and the main factors behind migration intentions in Portugal. Developing physician retention strategies is a priority to appropriately address these factors. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
María J. Pons
2012-03-01
Full Text Available El objetivo principal del estudio fue establecer el nivel de resistencia a antimicrobianos en un total de 222 cepas comensales de E. coli de origen fecal, en Perú. Las frecuencias de resistencia encontrados, frente los antimicrobianos evaluados, fueron: ampicilina (62,6%, cotrimoxazol (48,6%, tetraciclina (43,0% y cloranfenicol (15,8%. Destacan los elevados niveles de resistencia a quinolonas: 32% al ácido nalidíxico (NAL y 12% a ciprofloxacino (CIP. Estos elevados niveles hacia las quinolonas en cepas comensales aisladas en niños de esta franja de edad, realzan el uso extendido y el impacto de consumo de este tipo de antimicrobianos en la comunidad, mostrando el riesgo potencial de su pérdida de utilidad en el área.The main aim of this study was to establish the resistance levels to antimicrobial agents, in 222 non-pathogenic E. coli strains of fecal origin in Peru. The proportion of resistance found to the evaluated antimicrobials was ampicillin (62.6%, cotrimoxazole (48,6%, tetracycline (43,0% and chloramphenicol (15,8%. We emphasize the high resistance levels found for quinolones: 32% for nalidixic acid (NAL and 12% for ciprofloxacin (CIP. These high levels of quinoloneresistance in non-pathogenic strains isolated from children in this age group highlight the extensive use and the impact of the intake of this kind of antimicrobials in the community, showing the potential risk of the loss of their utility in the area.
Radiation-induced coloration of nitro blue tetrazolium gel dosimeter for low dose applications
International Nuclear Information System (INIS)
Abdel-Fattah, A.A.; Beshir, W.B.; Hassan, H.M.; Soliman, Y.S.
2017-01-01
A radiochromic sensor of nitro blue tetrazolium (NBT) in gelatin was evaluated as a new gel dosimeter for radiation applications. The NBT gel has the advantage of visual color change from faint yellow to violet at low absorbed doses (10–1000 Gy). This color change appears as a result of the reduction of NBT to colored formazan then to diformazan species with further increase of absorbed doses. Responses of the gel at different NBT concentrations were analyzed at the absorption maximum centered at 527 nm. An increase of NBT concentrations in the gel enhances the radiation dose sensitivity. Energy dependent study implies the tissue equivalency of the gel in the energy range of 0.15–20 MeV. Dependence of the gel response on irradiation temperature, and color stability before and after irradiation were also studied. The combined uncertainty associated with the dose monitoring (10–1000 Gy) is 6.26% (2σ). Thus, the NBT gel shows its suitability for food irradiation, insect population control, and some food irradiation applications. - Highlights: • Preparation of nitro blue tetrazolium (NBT) gel for the dose range of 10–1000 Gy. • The sensitivity of it increases with increasing NBT concentrations. • The response of irradiated dosimeter is stable after 5 h from irradiation. • The prepared gel dosimeter is a tissue equivalent. • Its combined uncertainty is equal to 6.26% for 10–1000 Gy dose level.
Tonial, Fabiana; Maia, Beatriz H L N S; Gomes-Figueiredo, Josiane A; Sobottka, Andrea M; Bertol, Charise D; Nepel, Angelita; Savi, Daiani C; Vicente, Vânia A; Gomes, Renata R; Glienke, Chirlei
2016-02-01
In this study, we analyzed the antimicrobial activity of extracts harvested from 17 endophytic fungi isolated from the medicinal plant Schinus terebinthifolius. Morphological and molecular analyses indicated that these fungal species belonged to the genera Alternaria, Bjerkandera, Colletotrichum, Diaporthe, Penicillium, and Xylaria. Of the endophytes analyzed, 64.7 % produced antimicrobial compounds under at least one of the fermentation conditions tested. Nine isolates produced compounds that inhibited growth of Staphylococcus aureus, four produced compounds that inhibited Candida albicans, and two that inhibited Pseudomonas aeruginosa. The fermentation conditions of the following endophytes were optimized: Alternaria sp. Sect. Alternata-LGMF626, Xylaria sp.-LGMF673, and Bjerkandera sp.-LGMF713. Specifically, the carbon and nitrogen sources, initial pH, temperature, and length of incubation were varied. In general, production of antimicrobial compounds was greatest when galactose was used as a carbon source, and acidification of the growth medium enhanced the production of compounds that inhibited C. albicans. Upon large-scale fermentation, Alternaria sp. Sect. Alternata-LGMF626 produced an extract containing two fractions that were active against methicillin-resistant S. aureus. One of the extracts exhibited high activity (minimum inhibitory concentration of 18.52 µg/mL), and the other exhibited moderate activity (minimum inhibitory concentration of 55.55 µg/mL). The compounds E-2-hexyl-cinnamaldehyde and two compounds of the pyrrolopyrazine alkaloids class were identified in the active fractions by gas chromatography-mass spectrometry.
Seamon, Kyle J; Bumpus, Namandjé N; Stivers, James T
2016-11-08
Sterile alpha motif and HD domain protein 1 (SAMHD1) is a unique enzyme that plays important roles in nucleic acid metabolism, viral restriction, and the pathogenesis of autoimmune diseases and cancer. Although much attention has been focused on its dNTP triphosphohydrolase activity in viral restriction and disease, SAMHD1 also binds to single-stranded RNA and DNA. Here we utilize a UV cross-linking method using 5-bromodeoxyuridine-substituted oligonucleotides coupled with high-resolution mass spectrometry to identify the binding site for single-stranded nucleic acids (ssNAs) on SAMHD1. Mapping cross-linked amino acids on the surface of existing crystal structures demonstrated that the ssNA binding site lies largely along the dimer-dimer interface, sterically blocking the formation of the homotetramer required for dNTPase activity. Surprisingly, the disordered C-terminus of SAMHD1 (residues 583-626) was also implicated in ssNA binding. An interaction between this region and ssNA was confirmed in binding studies using the purified SAMHD1 583-626 peptide. Despite a recent report that SAMHD1 possesses polyribonucleotide phosphorylase activity, we did not detect any such activity in the presence of inorganic phosphate, indicating that nucleic acid binding is unrelated to this proposed activity. These data suggest an antagonistic regulatory mechanism in which the mutually exclusive oligomeric state requirements for ssNA binding and dNTP hydrolase activity modulate these two functions of SAMHD1 within the cell.
Directory of Open Access Journals (Sweden)
S. Chusri
2012-01-01
Full Text Available Development of biofilm is a key mechanism involved in Staphylococcus epidermidis virulence during device-associated infections. We aimed to investigate antibiofilm formation and mature biofilm eradication ability of ethanol and water extracts of Thai traditional herbal recipes including THR-SK004, THR-SK010, and THR-SK011 against S. epidermidis. A biofilm forming reference strain, S. epidermidis ATCC 35984 was employed as a model for searching anti-biofilm agents by MTT reduction assay. The results revealed that the ethanol extract of THR-SK004 (THR-SK004E could inhibit the formation of S. epidermidis biofilm on polystyrene surfaces. Furthermore, treatments with the extract efficiently inhibit the biofilm formation of the pathogen on glass surfaces determined by scanning electron microscopy and crystal violet staining. In addition, THR-SK010 ethanol extract (THR-SK010E; 0.63–5 μg/mL could decrease 30 to 40% of the biofilm development. Almost 90% of a 7-day-old staphylococcal biofilm was destroyed after treatment with THR-SK004E (250 and 500 μg/mL and THR-SK010E (10 and 20 μg/mL for 24 h. Therefore, our results clearly demonstrated THR-SK004E could prevent the staphylococcal biofilm development, whereas both THR-SK004E and THR-SK010E possessed remarkable eradication ability on the mature staphylococcal biofilm.
Nsoh, Fuh Anold; Wung, Buh Amos; Atashili, Julius; Benjamin, Pokam Thumamo; Marvlyn, Eba; Ivo, Keumami Katte; Nguedia, Assob Jules Clément
2016-11-08
Access to potable water remains a major challenge particularly in resource-limited settings. Although the potential contaminants of water are varied, enteric pathogenic protozoa are known to cause waterborne diseases greatly. This study aimed at investigating the prevalence, characteristics and correlates of enteric pathogenic protozoa in drinking water sources in Buea, Cameroon. A cross-sectional study was conducted using 155 water samples collected from various drinking sources (boreholes, springs, taps and wells). Each sample was subjected to physicochemical examinations (pH, turbidity, odour and sliminess) and parasitological analysis (wet mount, modified Ziehl-Neelsen stain) to determine the presence of enteric pathogenic protozoa. A data collection tool was used to note characteristics of collected samples and the data was analysed using EPI-INFO Version 3.5.3. The overall prevalence of enteric pathogenic protozoa in water sources was 62.6 %. Eight species of enteric protozoa were observed with Cryptosporidium parvum being the most predominant (45.8 %). Spring water was the most contaminated source with enteric protozoa (85.7 %) while pipe borne water had all eight species of protozoa identified. A pH of 6 was the only significant factor associated with the prevalence of these pathogens in water sources. The prevalence of enteric protozoa in water sources in Molyko and Bomaka is high, spring water is the most contaminated water source and Cryptosporidium parvum is the most common protozoa contaminating water. A water pH of 6 is associated to the prevalence of protozoa. Community members need to be educated to treat water before drinking to avoid infection by enteric protozoa in water and further studies with larger samples of water need to be conducted to find other correlates of the presence of protozoa in water.
Test Operation Procedure (TOP) 01-1-010A Vehicle Test Course Severity (Surface Roughness)
2017-12-12
Increases in roughness may signify the need to change course maintenance patterns. For example, secondary gravel roads at YTC go through a cycle of...CSTE-DTC-AT-AD) U.S. Army Aberdeen Test Center 400 Colleran Road Aberdeen Proving Ground, MD 21005-5059 8. PERFORMING ORGANIZATION REPORT...test courses at ATEC Test Centers. 15. SUBJECT TERMS Automotive test course Roughness of roads Wave number spectrum Test course surface roughness
Low-power, Confocal Imaging of Protein Localization in Living Cells (7215-010), Phase II
National Aeronautics and Space Administration — The proposed innovative technology addresses the need to understand and develop countermeasures for the skeletal and cardiovascular changes to astronauts during...
Yeast Interacting Proteins Database: YGR010W, YLR328W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available 1 Nicotinic acid mononucleotide adenylyltransferase, involved in pathways of NAD biosynthesis, including the... de novo, NAD(+) salvage, and nicotinamide riboside salvage pathways Rows with th...ne name NMA1 Prey description Nicotinic acid mononucleotide adenylyltransferase, involved in pathways of NAD... biosynthesis, including the de novo, NAD(+) salvage, and nicotinamide riboside salvage pathways
Yeast Interacting Proteins Database: YLR328W, YGR010W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YLR328W NMA1 Nicotinic acid mononucleotide adenylyltransferase, involved in pathways... of NAD biosynthesis, including the de novo, NAD(+) salvage, and nicotinamide riboside salvage pathways Row... ORF YLR328W Bait gene name NMA1 Bait description Nicotinic acid mononucleotide adenylyltransferase, involved in pathways...otinamide riboside salvage pathways Rows with this bait as bait Rows with this bait as bait (2) Rows with th
Coexistence of charge density wave and superconductivity in Cu0.10TiSe2
Jat, K. S.; Nagpal, V.; Sagar, A. D.; Neha, P.; Patnaik, S.
2018-04-01
We report the synthesis and characterization of Cu intercalated TiSe2 superconductor. The resistivity variation with temperature indicates superconducting transition onset at 3.1K and resistivity drops down to zero at 2.1K. The magnetization measurement provides the diamagnetic transition at 3 K. The upper critical field Hc2, lower critical field Hc1, Ginzburg Landau coherence length (ξ) and penetration depth(λ) are estimated to be 0.93 T, 0.01T, 18.8 nm and 181.5 nm respectively. At 100K, CDW type feature is observed. The coexistence of CDW phase and superconductivity is summarized.
Teaching and Learning International Survey (TALIS) 2013: U.S. Technical Report. NCES 2015-010
Strizek, Gregory A.; Tourkin, Steve; Erberber, Ebru
2014-01-01
This technical report is designed to provide researchers with an overview of the design and implementation of the Teaching and Learning International Survey (TALIS) 2013. This information is meant to supplement that presented in OECD publications by describing those aspects of TALIS 2013 that are unique to the United States. Chapter 2 provides…
Associations between interleukin-1 polymorphisms and susceptibility to vasculitis: a meta-analysis.
Song, G G; Kim, J-H; Lee, Y H
2016-05-01
The objective of this study was to determine whether interleukin-1 (IL-1) polymorphisms are associated with susceptibility to vasculitis. A meta-analysis was conducted to investigate possible associations between IL-1A, IL-1B, and IL-1 receptor antagonist (IL1RN) polymorphisms and vasculitis. A total of 17 studies involving 1384 vasculitis cases [Behçet's disease (BD), IgA vasculitis, anti-neutrophil cytoplasmic antibody (ANCA)-associated vasculitis (AAV), Kawasaki disease (KD), giant cell arteritis, and Takayasu's arteritis] and 2710 controls were included in the meta-analysis. This analysis showed an association between BD and the TT + TC genotypes of the IL-1A-889 C/T polymorphism in the entire study population [odds ratio (OR) = 0.623, 95 % CI = 0.395-0.981, p = 0.045), and a trend toward an association in a Turkish population (OR = 0.578, 95 % CI = 0.331-1.010, p = 0.054). A meta-analysis of the IL1RN polymorphism revealed no association with vasculitis in all study subjects (OR for IL1RN*2 = 0.904, 95 % CI = 0.626-1.304, p = 0.588). However, stratification by ethnicity revealed a significant association between the IL1RN*2 allele and vasculitis including AAV, BD, KD in Asians (OR = 2.393, 95 % CI = 1.429-4.006, p = 0.001), but not in Caucasian and Turkish populations (OR = 0.776, 95 % CI = 0.487-1.238, p = 0.288; OR = 0.914, 95 % CI = 0.667-1.252, p = 0.576, respectively). No association was found between vasculitis and the IL-1B-511 C/T polymorphism, or the IL-1B+3953 C/T polymorphism. This meta-analysis suggests that the IL-1A-889 C/T polymorphism is associated with susceptibility to BD, and that the IL1RN*2 allele is associated with susceptibility to vasculitis including AAV, BD, and KD in Asians.
Rello, J; Nieto, M; Solé-Violán, J; Wan, Y; Gao, X; Solem, C T; De Salas-Cansado, M; Mesa, F; Charbonneau, C; Chastre, J
2016-11-01
Adopting a unique Spanish perspective, this study aims to assess healthcare resource utilization (HCRU) and the costs of treating nosocomial pneumonia (NP) produced by methicillin-resistant Staphylococcus aureus (MRSA) in hospitalized adults using linezolid or vancomycin. An evaluation is also made of the renal failure rate and related economic outcomes between study groups. An economic post hoc evaluation of a randomized, double-blind, multicenter phase 4 study was carried out. Nosocomial pneumonia due to MRSA in hospitalized adults. The modified intent to treat (mITT) population comprised 224 linezolid- and 224 vancomycin-treated patients. Costs and HCRU were evaluated between patients administered either linezolid or vancomycin, and between patients who developed renal failure and those who did not. Analysis of HCRU outcomes and costs. Total costs were similar between the linezolid- (€17,782±€9,615) and vancomycin-treated patients (€17,423±€9,460) (P=.69). The renal failure rate was significantly lower in the linezolid-treated patients (4% vs. 15%; Prenal failure (€19,626±€10,840 vs. €17,388±€9,369; P=.14). Among the patients who developed renal failure, HCRU (days on mechanical ventilation: 13.2±10.7 vs. 7.6±3.6 days; P=.21; ICU stay: 14.4±10.5 vs. 9.9±6.6 days; P=.30; hospital stay: 19.5±9.5 vs. 16.1±11.0 days; P=.26) and cost (€17,219±€8,792 vs. €20,263±€11,350; P=.51) tended to be lower in the linezolid- vs. vancomycin-treated patients. There were no statistically significant differences in costs per patient-day between cohorts after correcting for mortality (€1000 vs. €1,010; P=.98). From a Spanish perspective, there were no statistically significant differences in total costs between the linezolid and vancomycin pneumonia cohorts. The drug cost corresponding to linezolid was partially offset by fewer renal failure adverse events. Copyright © 2016 Elsevier España, S.L.U. y SEMICYUC. All rights reserved.
Yarnoff, Benjamin O; Hoerger, Thomas J; Simpson, Siobhan K; Leib, Alyssa; Burrows, Nilka R; Shrestha, Sundar S; Pavkov, Meda E
2017-03-13
Better treatment during early stages of chronic kidney disease (CKD) may slow progression to end-stage renal disease and decrease associated complications and medical costs. Achieving early treatment of CKD is challenging, however, because a large fraction of persons with CKD are unaware of having this disease. Screening for CKD is one important method for increasing awareness. We examined the cost-effectiveness of identifying persons for early-stage CKD screening (i.e., screening for moderate albuminuria) using published CKD risk scores. We used the CKD Health Policy Model, a micro-simulation model, to simulate the cost-effectiveness of using CKD two published risk scores by Bang et al. and Kshirsagar et al. to identify persons in the US for CKD screening with testing for albuminuria. Alternative risk score thresholds were tested (0.20, 0.15, 0.10, 0.05, and 0.02) above which persons were assigned to receive screening at alternative intervals (1-, 2-, and 5-year) for follow-up screening if the first screening was negative. We examined incremental cost-effectiveness ratios (ICERs), incremental lifetime costs divided by incremental lifetime QALYs, relative to the next higher screening threshold to assess cost-effectiveness. Cost-effective scenarios were determined as those with ICERs less than $50,000 per QALY. Among the cost-effective scenarios, the optimal scenario was determined as the one that resulted in the highest lifetime QALYs. ICERs ranged from $8,823 per QALY to $124,626 per QALY for the Bang et al. risk score and $6,342 per QALY to $405,861 per QALY for the Kshirsagar et al. risk score. The Bang et al. risk score with a threshold of 0.02 and 2-year follow-up screening was found to be optimal because it had an ICER less than $50,000 per QALY and resulted in the highest lifetime QALYs. This study indicates that using these CKD risk scores may allow clinicians to cost-effectively identify a broader population for CKD screening with testing for albuminuria
Directory of Open Access Journals (Sweden)
Miguel Gouveia
2013-10-01
Full Text Available Objectives: Fidaxomicin is a macrocyclic antibiotic drug indicated for the treatment of Clostridium difficile infections (CDI. The purpose of this study was to evaluate from a societal perspective the cost-effectiveness and cost-utility of fidaxomicin in the treatment of severe or recurrent CDI compared to the recommended alternative therapy, vancomycin. Methods: The effectiveness estimates of fidaxomicin and vancomycin, provided by two clinical trials in addition to other studies, were extrapolated to 10 days cycles and a time horizon of 1 year using a Markov model. The costs considered in the study included medication, hospitalization, complications and outpatient visits. Estimates of the indirect costs generated by productivity losses due to absenteeism were not included, for lack of relevant evidence for the Portuguese reality and because the population affected by CDI tends to be no longer active in the labor market. Results: Over a one year horizon and compared to vancomycin treatment, in the base case, fidaxomicin treatment in patients with severe ICD is associated with a gain of 0.010 QALY and a cost increase of 138 €. The treatment of patients with recurrent CDI with fidaxomicin is associated with a gain of 0.019 QALYs and a cost reduction of 626 €. Fidaxomicin treatment has an acceptable incremental cost-utility ratio in patients with severe CDI (ICUR: 13,245 €/ QALY and dominates in patients with recurrent CDI (ICUR: -33,701 €/ QALY. Fidaxomicin treatment in patients with severe and recurrent CDI is also associated with a reduction in the number of recurrences (ICER: 321 €/ recurrence avoided in patients with severe CDI and ICER: -828 €/ recurrence avoided in patients with recurrent CDI. These results are sensitive to the cost of hospitalization, decreasing with a rising cost of hospitalization. In the probabilistic sensitivity analysis the model predicts that the probability of cost-effectiveness of fidaxomicin is 44
Comparative study of different metals in rocks of heroshah malakand pakistan
International Nuclear Information System (INIS)
Zahoor, M.; Mabood, F.; Ullah, F.
2014-01-01
Six different rock samples were collected from Heroshah, Malakand District of Pakistan and were subjected to metal analysis by atomic absorption spectrophotometer and X-ray fluorescence (XRF). Metals analysis of a rocks sample showed the presences of Cr, Pb, Mn, Zn, Cu, Ni and Fe. Sample 1 was rich in manganese (216. to 387 ppm), sample 2 was rich in chromium and manganese, sample 3 was rich in chromium (38.7 to 89.6 ppm), manganese (235 to 889 ppm) and zinc (51.3 to 94.7 ppm). In sample 3 the amount of copper was from 27.6 to 34.7 ppm and nickel was from 23.2 to 59.1 ppm. Chromium was from 2.81 to 213 ppm, lead from 0 to 24.0 ppm, manganese from 0.10 to 0.382 ppm, zinc from 147 to 186 ppm, copper is from 32.7 to 49.0 ppm, nickel from 59.0 to 72.6 ppm and the amount of iron was from 6.08 to 6.79 ppm in rock sample 4. Sample 5 was rich in manganese and zinc. In sample 6 the concentration of chromium was from 0 to 17.8 ppm, lead from 0 to 2.97 ppm, manganese from 605 to 990 ppm, zinc from 8.87 to 21.8 ppm, copper from 0.626 to 33.3 ppm, nickel from 15.1 to 23.9 ppm and iron concentration was from 0.771 to 1.026 ppm. Different metal oxides like LOI, SiO/sub 2/, Al/sub 2/O/sub 3/, K/sub 2/O, Na/sub 2/O, Fe/sub 2/O/sub 3/, MgO, CaO, TiO/sub 2/, ZrO/sub 2/, BaO, MnO, P/sub 2/O/sub 5/, Cr/sub 2/O/sub 3/, Na/sub 2/O, SrO, Y/sub 2/O/sub 3/, Rb/sub 2/O, SO/sub 3/, ZnO, V/sub 2/O/sub 5/, CuO and NiO, were detected by XRF. Water samples from same areas were also investigated for the presence of metals present in rock samples. (author)
Chemical composition and antimicrobial activity of solidago canadensis linn. Root essential oil.
Mishra, Devendra; Joshi, Shivani; Bisht, Ganga; Pilkhwal, Sangeeta
2010-06-01
The essential oil from the roots of Solidago canadensis Linn. (fam. Asteraceae) was analyzed by GC, GC/MS and NMR spectroscopy. Thirty nine constituents comprising 75.4% of the total oil were identified from the oil. Thymol constituted 20.25% of the oil followed by α-copaene (6.26%) and carvacrol (5.51%). The antimicrobial activity of the oil was evaluated using disc diffusion method. Results showed that the oil exhibited significant antibacterial activity against S. feacalis and E. coli whereas it showed moderate antifungal activity against C. albicans.
Directory of Open Access Journals (Sweden)
Facultad de Medicina Revista
1944-07-01
Full Text Available British Medical Information Service. - 3, Hanover Street London, W. 1 Transfusión de sangre en la hemoglobinuria nocturna (Blood transfusion in nocturnal haemoglobinuria Por J. V. Dacie & D. Firth, British Medical Journal, 1, 626--628, 22-5-43 / Anemia hemolitica familiar (Ictericia acolurica con referencia especial a los cambios en la fragilidad producidos por esplenectomia (Familiar Haemolytic Anaemia (Acholuric Jaundice, with particular reference to changes in fragility produced by Splenectomy. Por J. V. Dacie, Quarterly Journal of Medicine, 12, 101-118, abril, 1943.