26 CFR 1.642(f)-1 - Amortization deductions.
2010-04-01
....642(f)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Estates, Trusts, and Beneficiaries § 1.642(f)-1 Amortization deductions. An estate... respect to qualified railroad rolling stock as defined in section 184(d), with respect to certified coal...
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSM642 (Link to dictyBase) ssm642 G00916 DDB0229937 Contig-U05906-1 SSM6...S (Link to library) Clone ID SSM642 (Link to dictyBase) Atlas ID ssm642 NBRP ID G00916 dictyBase ID DDB02299...42E (Link to Original site) SSM642F 689 SSM642Z 617 SSM642P 1306 SSM642E 907 Show SSM642 Library S...37 Link to Contig Contig-U05906-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSM6-B/SSM6...42Q.Seq.d/ Representative seq. ID SSM642E (Link to Original site) Representative DNA sequence >SSM642 (SSM6
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHD642 (Link to dictyBase) - - - Contig-U11361-1 - (Link to Or...iginal site) VHD642F 629 - - - - - - Show VHD642 Library VH (Link to library) Clone ID VHD642 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11361-1 Original site URL http://dictycdb.b...us erato cDNA clone He_wd2a1_74D09 5' similar to UniRef90_UPI000051A2A9 Cluster related to UPI000051A2A9; PREDICT...DNA, mRNA sequence. 56 1e-12 4 EE133491 |EE133491.1 SiJWH07ADU Lausanne fire ant library Solenopsis invicta
1998-05-26
Figure 2 shows LE spectra in preform B which is composed uniquely by cladding material. The excitation of luminescence has been achieved by...Ge02 concentration, i.e. larger than 20 mol%. Figure 3 shows LE spectra for various luminescence wavelengths collected from preform C. In that...doped fluoride glasses, F. Smektala, R. Sramek, J. Lucas, Laboratoire des Verres et Ceramiques, Universite de Rennes I, 35000 Rennes, France; W. Xie, P
Razavi, S.; Tolson, B.; Burn, D.; Seglenieks, F.
2012-04-01
Reformulated Neural Network (ReNN) has been recently developed as an efficient and more effective alternative to feedforward multi-layer perceptron (MLP) neural networks [Razavi, S., and Tolson, B. A. (2011). "A new formulation for feedforward neural networks." IEEE Transactions on Neural Networks, 22(10), 1588-1598, DOI: 1510.1109/TNN.2011.2163169]. This presentation initially aims to introduce the ReNN to the water resources community and then demonstrates ReNN applications to water resources related problems. ReNN is essentially equivalent to a single-hidden-layer MLP neural network but defined on a new set of network variables which is more effective than the traditional set of network weights and biases. The main features of the new network variables are that they are geometrically interpretable and each variable has a distinct role in forming the network response. ReNN is more efficiently trained as it has a less complex error response surface. In addition to the ReNN training efficiency, the interpretability of the ReNN variables enables the users to monitor and understand the internal behaviour of the network while training. Regularization in the ReNN response can be also directly measured and controlled. This feature improves the generalization ability of the network. The appeal of the ReNN is demonstrated with two ReNN applications to water resources engineering problems. In the first application, the ReNN is used to model the rainfall-runoff relationships in multiple watersheds in the Great Lakes basin located in northeastern North America. Modelling inflows to the Great Lakes are of great importance to the management of the Great Lakes system. Due to the lack of some detailed physical data about existing control structures in many subwatersheds of this huge basin, the data-driven approach to modelling such as the ReNN are required to replace predictions from a physically-based rainfall runoff model. Unlike traditional MLPs, the ReNN does not necessarily
Inmueble-torre ''Los horizontes'' Rennes – Francia
Directory of Open Access Journals (Sweden)
Maillols, Georges
1975-09-01
Full Text Available This building constitutes a part of the renovation operation in the «Distrito del Obispo», in the street of «Brest» at Rennes. The complex contains: 2,000 apartments, parking places for approximately 600 cars, shopping centre, social centre, schools, hotel restaurant, etc. The two towers that are being described specially in the article comprise: two basements, two mezzanine floors, thirty floors for housing and offices and two technical storeys; with a separate circular garage, surface parking place and a separate building for meetings. Foundation on piles of 1.50 diameter anchored in the bare rock: structure of reinforced concrete and prefabricated facades, with additional installations of all kinds to assure comfort and perfect functioning.Este edificio forma parte de la operación de renovar el «Distrito del Obispo» de la calle de Brest a Rennes. El conjunto comprende: 2.000 apartamentos, oficinas, aparcamientos para unos 600 automóviles, zona comercial, centro social, escuelas, hotel restaurante, etc. Las dos torres, que se describen especialmente en el artículo, tienen: dos sótanos, planta baja, dos entreplantas, treinta plantas para viviendas y oficinas, y dos plantas técnicas; con garaje circular separado, aparcamiento en superficie y edificio exento para reuniones. Cimentación a base de pilotes de 1,50 de diámetro, anclados en la roca sana; estructura de hormigón armado y fachadas prefabricadas, con toda suerte de instalaciones complementarias para asegurar el confort y el perfecto funcionamiento debidos.
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Example. 1.642(h)-5 Section 1.642(h)-5 Internal... TAXES Estates, Trusts, and Beneficiaries § 1.642(h)-5 Example. The application of section 642(h) may be illustrated by the following example: Example. (a) A decedent dies January 31, 1954, leaving a will which...
46 CFR 169.642 - Vital systems.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Vital systems. 169.642 Section 169.642 Shipping COAST... Electrical Piping Systems § 169.642 Vital systems. For the purpose of this part, the following are considered vital systems— (a) A marine engineering system identified by the OCMI as being crucial to the survival...
International Nuclear Information System (INIS)
Djahel, Thierry
2017-01-01
To develop a concrete policy for saving energy and for the energy transition, the Rennes metropolitan area and Schneider Electric have launched RennesGrid, a 20-year experiment with managing energy consumption at Ker Lann, an urban development zone located in Bruz township, 12 kilometers southwest of Rennes, France. Covering more than 160 hectares, Ker Lann groups: approximately sixty companies specialized in high technology; seventeen establishments of higher education, research and training; and residential units and dormitories for students. RennesGrid will make it less dependent on carbon energy thanks to the production of local, renewable sources using photovoltaic installations. For consumers, the objective is to reduce their energy needs and consume a renewable form of energy produced locally. Planned for operation at the end of 2017 and endowed with a global investment budget of Euro 5.8 million, this experiment is a private business with a hold over three hectares of land under a 20-year concession. Its business model is, however, mainly based on a cooperative approach (in particular with residents of the zone) and on innovative arrangements for participatory funding
Welker, Frido; Hajdinjak, Mateja; Talamo, Sahra; Jaouen, Klervia; Dannemann, Michael; David, Francine; Julien, Michèle; Meyer, Matthias; Kelso, Janet; Barnes, Ian; Brace, Selina; Kamminga, Pepijn; Fischer, Roman; Kessler, Benedikt M; Stewart, John R; Pääbo, Svante; Collins, Matthew J; Hublin, Jean-Jacques
2016-10-04
In Western Europe, the Middle to Upper Paleolithic transition is associated with the disappearance of Neandertals and the spread of anatomically modern humans (AMHs). Current chronological, behavioral, and biological models of this transitional period hinge on the Châtelperronian technocomplex. At the site of the Grotte du Renne, Arcy-sur-Cure, morphological Neandertal specimens are not directly dated but are contextually associated with the Châtelperronian, which contains bone points and beads. The association between Neandertals and this "transitional" assemblage has been controversial because of the lack either of a direct hominin radiocarbon date or of molecular confirmation of the Neandertal affiliation. Here we provide further evidence for a Neandertal-Châtelperronian association at the Grotte du Renne through biomolecular and chronological analysis. We identified 28 additional hominin specimens through zooarchaeology by mass spectrometry (ZooMS) screening of morphologically uninformative bone specimens from Châtelperronian layers at the Grotte du Renne. Next, we obtain an ancient hominin bone proteome through liquid chromatography-MS/MS analysis and error-tolerant amino acid sequence analysis. Analysis of this palaeoproteome allows us to provide phylogenetic and physiological information on these ancient hominin specimens. We distinguish Late Pleistocene clades within the genus Homo based on ancient protein evidence through the identification of an archaic-derived amino acid sequence for the collagen type X, alpha-1 (COL10α1) protein. We support this by obtaining ancient mtDNA sequences, which indicate a Neandertal ancestry for these specimens. Direct accelerator mass spectometry radiocarbon dating and Bayesian modeling confirm that the hominin specimens date to the Châtelperronian at the Grotte du Renne.
Directory of Open Access Journals (Sweden)
Hervé Quenol
2009-10-01
Full Text Available Este trabalho teve como objetivo analisar e comparar as características térmicas do clima urbano em duas cidades de médio porte: Rennes (França e Presidente Prudente (Brasil, por meio de registros da temperatura do ar (pontos fixos e medidas itinerantes e dados térmicos de superfície obtidos pelo tratamento de imagens do satélite Landsat 7. Verificou-se o aumento das temperaturas, ligeiramente maiores em Rennes, do que em Presidente Prudente e a geração de ilhas de calor urbanas (ICU, decorrentes do processo de urbanização nas duas cidades.Cet article a pour objectif d’étudier les caractéristiques du climat dans deux villes moyennes (Rennes en France et Presidente Prudente au Brésil à partir de trois types de mesures de températures : des mesures réalisées dans des stations fixes, des mesures itinérantes et des données de températures de surface obtenues à partir d’images du satellite Landsat 7. On montre que l’augmentation des températures est légèrement plus importante à Rennes qu’à Presidente Prudente ainsi que le développement d’îlots de chaleur urbains (ICU résultant de l’extension de la tache urbaine des deux agglomérations.This paper aims to analyze and compare thermal characteristics of urban climate of two middle size cities: Rennes (France and Presidente Prudente (Brazil, by registering air temperature (network pointes and mobile transect and surface data obtained by using Landsat7 satellite thermal images. Results shows that temperature grows faster in Rennes than Presidente Prudente and urban heat island generation (UHI by different cities urbanization processes.
7 CFR 58.642 - Quality control tests.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Quality control tests. 58.642 Section 58.642... Procedures § 58.642 Quality control tests. All mix ingredients shall be subject to inspection for quality and condition throughout each processing operation. Quality control tests shall be made on flow line samples as...
Directory of Open Access Journals (Sweden)
Charlery De La Masseliere Bernard
2001-11-01
Full Text Available Les termes de référence de cette conférence ont rappelé l’importance majeure des cultures pérennes pour de nombreux pays en développement. Cette importance n’est pas seulement économique. Elle prend son sens au sein de l’évolution d’un système global où les exigences écologiques de la plante ainsi que les aptitudes bio-climatiques et pédologiques des milieux tropicaux interfèrent avec les conditions historiques du marché mondial, de la formation de sociétés paysannes ouvertes à l’innovation et de la destruction/reconstruction de l’État. Le mouvement d’introduction et de développement des cultures pérennes peut être considéré comme une véritable innovation, voire un fait de civilisation, inscrit dans une longue durée et dont on peut repérer les moments et lieux de l’intégration. Histoire souvent décrite, selon les pays, comme plus ou moins exemplaire, ayant apporté des transformations irréversibles de la société, jusqu’à produire des modèles spécifiques, comme au Kenya le modèle du « petit producteur capitaliste » de la Province centrale, des identités individuelles, à travers le statut de « planteur » comme en Côte d’Ivoire, ou des identités collectives, à travers la proclamation ethnique, comme en pays Bamileke. Réfléchir aujourd’hui sur l’avenir des cultures pérennes dans un contexte de crise nous place bien au cœur des temporalités, complexes, qui animent les éléments du système. François Ruf a bien montré pour le cacao comment la conjonction de facteurs fait passer une région de production, souvent en un très court laps de temps, de l’âge d’or à la crise, comment le transfert spatial des foyers de production vers de nouvelles régions, par une sorte d’accumulation extensive à l’échelle mondiale, a d’une certaine façon occulté, à l’échelle locale ou régionale, les principes élémentaires qui déterminent le cycle de l’innovation. Faut
Skew cyclic codes over F_q+uF_q+vF_q+uvF_q
Directory of Open Access Journals (Sweden)
Ting Yao
2015-09-01
Full Text Available In this paper, we study skew cyclic codes over the ring $R=F_q+uF_q+vF_q+uvF_q$, where $u^{2}=u,v^{2}=v,uv=vu$, $q=p^{m}$ and $p$ is an odd prime. We investigate the structural properties of skew cyclic codes over $R$ through a decomposition theorem. Furthermore, we give a formula for the number of skew cyclic codes of length $n$ over $R.$
Gao, Jian; Wang, Yongkang
2018-01-01
Structural properties of u-constacyclic codes over the ring F_p+u{F}_p are given, where p is an odd prime and u^2=1. Under a special Gray map from F_p+u{F}_p to F_p^2, some new non-binary quantum codes are obtained by this class of constacyclic codes.
DEFF Research Database (Denmark)
Welker, Frido; Hajdinjak, Mateja; Talamo, Sahra
2016-01-01
In Western Europe, the Middle to Upper Paleolithic transition is associated with the disappearance of Neandertals and the spread of anatomically modern humans (AMHs). Current chronological, behavioral, and biological models of this transitional period hinge on the Châtelperronian technocomplex....... At the site of the Grotte du Renne, Arcy-sur-Cure, morphological Neandertal specimens are not directly dated but are contextually associated with the Châtelperronian, which contains bone points and beads. The association between Neandertals and this "transitional" assemblage has been controversial because...... specimens through zooarchaeology by mass spectrometry (ZooMS) screening of morphologically uninformative bone specimens from Châtelperronian layers at the Grotte du Renne. Next, we obtain an ancient hominin bone proteome through liquid chromatography-MS/MS analysis and error-tolerant amino acid sequence...
5 CFR 831.642 - Marriage duration requirements.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Marriage duration requirements. 831.642... REGULATIONS (CONTINUED) RETIREMENT Survivor Annuities Eligibility § 831.642 Marriage duration requirements. (a... in paragraph (b) of this section; or (2) A child was born of the marriage, as explained in paragraph...
The [U{sub 2}F{sub 12}]{sup 2-} anion of Sr[U{sub 2}F{sub 12}
Energy Technology Data Exchange (ETDEWEB)
Scheibe, Benjamin; Pietzonka, Clemens; Conrad, Matthias; Kraus, Florian [Fachbereich Chemie, Philipps-Universitaet Marburg (Germany); Mustonen, Otto; Karppinen, Maarit; Karttunen, Antti J. [Department of Chemistry, Aalto University (Finland); Atanasov, Mihail; Neese, Frank [Max-Planck Institute for Chemical Energy Conversion, Muelheim an der Ruhr (Germany)
2018-03-05
The D{sub 2h}-symmetric dinuclear complex anion [U{sub 2}F{sub 12}]{sup 2-} of pastel green Sr[U{sub 2}F{sub 12}] shows a hitherto unknown structural feature: The coordination polyhedra around the U atoms are edge-linked monocapped trigonal prisms, the U{sup V} atoms are therefore seven-coordinated. This leads to a U-U distance of 3.8913(6) Aa. A weak U{sup V}-U{sup V} interaction is observed for the dinuclear [U{sub 2}F{sub 12}]{sup 2-} complex and described by the antiferromagnetic exchange J{sub exp} of circa -29.9 cm{sup -1}. The crystalline compound can be easily prepared from SrF{sub 2} and β-UF{sub 5} in anhydrous hydrogen fluoride (aHF) at room temperature. It was studied by means of single crystal X-ray diffraction, IR, Raman and UV/VIS spectroscopy, magnetic measurements, and by molecular as well as by solid-state quantum chemical calculations. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
International Nuclear Information System (INIS)
Montoya, Modesto
2013-01-01
The Coulomb effect hypothesis, formerly used to interpret fluctuations in the curve of maximal total kinetic energy as a function of light fragment mass in reactions 233 U(n th ,f), 235 U(n th ,f) and 239 Pu(n th ,f), is confirmed in high kinetic energy as well as in low excitation energy windows, respectively. Data from reactions 233 U(n th ,f), 235 U(n th ,f), 239 Pu(n th ,f) and 252 Cf(sf) show that, between two isobaric fragmentations with similar Q-values, the more asymmetric charge split reaches the higher value of total kinetic energy. Moreover, in isobaric charge splits with different Q-values, similar preference for asymmetrical fragmentations is observed in low excitation energy windows. (author).
26 CFR 1.642(g)-2 - Deductions included.
2010-04-01
... tax purposes. Section 642(g) has no application to deductions for taxes, interest, business expenses... 642(g) is applicable to deductions for interest, business expenses, and other items not accrued at the... administration expenses under section 2053(a)(2). Although deductible under section 2053(a)(3) in determining the...
Fission Fragment Angular Distributions in the $^{234}$U(n,f) and $^{236}$U(n,f) reactions
We propose to measure the fission fragment angular distribution (FFAD) of the $^{234}$U(n,f) and $^{236}$U (n,f) reactions with the PPAC detection setup used in previous n_TOF-14 experiment. This experiment would take advantage of the high resolution of the n_TOF facility to investigate the FFAD behaviour in the pronounced vibrational resonances that have been observed between 0.1 and 2 MeV for the thorium cycle isotopes. In addition, the angular distribution of these isotopes will be measured for the first time beyond 14 MeV. Furthermore, the experiment will also provide the fission cross section with reduced statistical uncertainty, extending the $^{236}$U(n,f) data up to 1 GeV
13 CFR 120.642 - Requirements before the FTA issues Pool Certificates.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Requirements before the FTA issues Pool Certificates. 120.642 Section 120.642 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Miscellaneous Provisions § 120.642 Requirements before the FTA issues Pool...
Sobral, D; Le Cann, P; Gerard, A; Jarraud, S; Lebeau, B; Loisy-Hamon, F; Vergnaud, G; Pourcel, C
2011-10-01
Two legionellosis outbreaks occurred in the city of Rennes, France, during the past decade, requiring in-depth monitoring of Legionella pneumophila in the water network and the cooling towers in the city. In order to characterize the resulting large collection of isolates, an automated low-cost typing method was developed. The multiplex capillary-based variable-number tandem repeat (VNTR) (multiple-locus VNTR analysis [MLVA]) assay requiring only one PCR amplification per isolate ensures a high level of discrimination and reduces hands-on and time requirements. In less than 2 days and using one 4-capillary apparatus, 217 environmental isolates collected between 2000 and 2009 and 5 clinical isolates obtained during outbreaks in 2000 and 2006 in Rennes were analyzed, and 15 different genotypes were identified. A large cluster of isolates with closely related genotypes and representing 77% of the population was composed exclusively of environmental isolates extracted from hot water supply systems. It was not responsible for the known Rennes epidemic cases, although strains showing a similar MLVA profile have regularly been involved in European outbreaks. The clinical isolates in Rennes had the same genotype as isolates contaminating a mall's cooling tower. This study further demonstrates that unknown environmental or genetic factors contribute to the pathogenicity of some strains. This work illustrates the potential of the high-throughput MLVA typing method to investigate the origin of legionellosis cases by allowing the systematic typing of any new isolate and inclusion of data in shared databases.
Uniqueness of Positive Solutions of Δu+f(u)=0 in N, N<=3
Cortázar, Carmen; Elgueta, Manuel; Felmer, Patricio
We study the uniqueness of radial ground states for the semilinear elliptic partial differential equation $Δ u+f(u)=0 {(*)}$ in N. We assume that the function f has two zeros, the origin and u0>0. Above u0 the function f is positive, is locally Lipschitz continuous and satisfies convexity and growth conditions of a superlinear nature. Below u0, f is assumed to be non-positive, non-identically zero and merely continuous. Our results are obtained through a careful analysis of the solutions of an associated initial-value problem, and the use of a monotone separation theorem. It is known that, for a large class of functions f, the ground states of (*) are radially symmetric. In these cases our result implies that (*) possesses at most one ground state.
26 CFR 1.642(e)-1 - Depreciation and depletion.
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Depreciation and depletion. 1.642(e)-1 Section 1... (CONTINUED) INCOME TAXES Estates, Trusts, and Beneficiaries § 1.642(e)-1 Depreciation and depletion. An estate or trust is allowed the deductions for depreciation and depletion, but only to the extent the...
Characterization data on the topical carrier DDC642
Directory of Open Access Journals (Sweden)
Eline Desmet
2016-06-01
Full Text Available This article contains original data, figures and methods used in the characterization of the liposomal carrier ‘DDC642’ for topical applications, described in “An elastic liposomal formulation for RNAi-based topical treatment of skin disorders: proof-of-concept in the treatment of psoriasis” (Desmet et al., 2016 [1]. Several elastic liposomal formulations have been evaluated for their ability to encapsulate and deliver RNA interference (RNAi molecules to cultured primary skin cells. The efficiency and effectiveness of these liposomes were compared to that of our previously characterized liposomes, the ‘SECosomes’ (SEC (Geusens et al., 2010 [2]. After selection of a potential superior carrier, based on encapsulation and transfection efficiency data (Desmet et al., 2016 [1], the selected DDC642 liposomes were characterized more in-depth. Herein, a detailed characterization of the DDC642 liposome and RNAi-loaded lipoplexes is given, including the matching protocols.
7 CFR 205.642 - Fees and other charges for certification.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Fees and other charges for certification. 205.642...) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Administrative Fees § 205.642 Fees and other charges for certification. Fees charged by a certifying agent must be reasonable, and a certifying...
26 CFR 1.642(h)-2 - Excess deductions on termination of an estate or trust.
2010-04-01
... trust. 1.642(h)-2 Section 1.642(h)-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Estates, Trusts, and Beneficiaries § 1.642(h)-2...)) in excess of gross income, the excess is allowed under section 642(h)(2) as a deduction to the...
Itinerant f-electron behavior in Ce and U compounds
International Nuclear Information System (INIS)
Crabtree, G.W.
1985-04-01
The experimentally observed Fermi surface properties in URh 3 , UIr 3 , UGe 3 , CeSn 3 , CeB 6 , U 3 As 4 , U 3 P 4 , and CeSb are reviewed. For the compounds with no magnetic order, band structure models of the Fermi surface geometry are confirmed and f-ligand hybridization is found to be dominant. For CeB 6 , U 3 As 4 , and U 3 P 4 the experiments show that both local moments and f hybridization are important. In CeSb new data can be explained by a purely local model with no f-hybridization
A new perspective on Renn and Klinke's approach to risk evaluation and management
International Nuclear Information System (INIS)
Kristensen, V.; Aven, T.; Ford, D.
2006-01-01
In this paper we discuss Renn and Klinke's approach for risk evaluation and selection of risk management strategies. The main focus in the discussion is the foundational basis and the understanding of what risk is, and how a different foundational basis may simplify and improve the characterization of risk. We will present and discuss an alternative set of characteristics, and give some recommendations with respect to selection of risk management strategies based on different values or magnitudes of these characteristics. We believe that the main focus when describing and managing risk should be the potential consequences, represented by observable quantities, and the uncertainty related to their future values
First (18)F-labeled ligand for PET imaging of uPAR
DEFF Research Database (Denmark)
Persson, Morten; Liu, Hongguang; Madsen, Jacob
2013-01-01
Urokinase-type plasminogen activator receptor (uPAR) is overexpressed in human prostate cancer and uPAR has been found to be associated with metastatic disease and poor prognosis. AE105 is a small linear peptide with high binding affinity to uPAR. We synthesized an N-terminal NOTA......-conjugated version (NOTA-AE105) for development of the first (18)F-labeled uPAR positron-emission-tomography PET ligand using the Al(18)F radiolabeling method. In this study, the potential of (18)F-AlF-NOTA-AE105 to specifically target uPAR-positive prostate tumors was investigated....
F-GUTs with Mordell-Weil U(1)'s
Antoniadis, I
2014-01-01
In this note we study the constraints on F-theory GUTs with extra $U(1)$'s in the context of elliptic fibrations with rational sections. We consider the simplest case of one abelian factor (Mordell-Weil rank one) and investigate the conditions that are induced on the coefficients of its Tate form. Converting the equation representing the generic hypersurface $P_{112}$ to this Tate's form we find that the presence of a U(1), already in this local description, is consistent with the exceptional ${\\cal E}_6$ and ${\\cal E}_7$ non-abelian singularities. We briefly comment on a viable ${\\cal E}_6\\times U(1)$ effective F-theory model.
Reversibility of U → F processes in X or UV irradiated KCl: H- systems
International Nuclear Information System (INIS)
Bressiani, Ana Helena A.
1979-01-01
Potassium Chloride crystals, pure, additively colored or hydrogenated have been exposed to X and UV radiations for correlation studies' of formation processes of defects. In hydrogenated samples, these irradiations are responsible-for a direct U→F centers conversion with the simultaneous creation of H 2 molecules besides the intrinsic formation of F/hole centers. After prolonged irradiation, F aggregate centers react with H 2 molecules forming U center pairs. As the two U centers have independent electronic transitions they add up, increasing the maximum height of the U band after F→U reversed reation. The saturation levels of defects produced by these two types of radiation are different because UV light also excites F centers while producing them. This effect is responsible by the F center aggregation and the inversion F→U decreasing the U→F efficiency. Crystals with F and U centers under F light also show F→U inversion but with higher efficiency than when under UV light. This F→U process gives back 90% of the initial U center concentration. This same F→U process was observed but at smaller rate of formation if samples containing U, F and F aggregates are left in the dark for prolonged periods of time. The same reactions take place namely H 2 molecules annihilation F aggregates. (author)
Vertes, Francoise; Benoit, Marc; Dorioz, Jean Marcel
2010-01-01
Outre des fonctions de production, les prairies assurent diverses fonctions environnementales dont la protection de la qualité des eaux et des sols. Dans quelle mesure et à quelles conditions ces fonctions non productives sont elles assurées par les couverts herbacés pérennes ? Après la présentation des principaux processus impliqués dans les cycles de l'azote et du phosphore, les moyens de limiter les pertes en N et P sont rappelés, à l'échelle de la parcelle, de l'exploitation et du bassin ...
26 CFR 1.642(h)-1 - Unused loss carryovers on termination of an estate or trust.
2010-04-01
... estate or trust. 1.642(h)-1 Section 1.642(h)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF....642(h)-1 Unused loss carryovers on termination of an estate or trust. (a) If, on the final termination...(h)(1) to the beneficiaries succeeding to the property of the estate or trust. See § 1.641(b)-3 for...
26 CFR 1.642(h)-3 - Meaning of “beneficiaries succeeding to the property of the estate or trust”.
2010-04-01
... property of the estate or trustâ. 1.642(h)-3 Section 1.642(h)-3 Internal Revenue INTERNAL REVENUE SERVICE... § 1.642(h)-3 Meaning of “beneficiaries succeeding to the property of the estate or trust”. (a) The... excess of deductions over gross income for which a deduction is allowed, under section 642(h). (b) With...
International Nuclear Information System (INIS)
Arnold, Polly L.; Cowie, Bradley E.; Suvova, Marketa; Zegke, Markus; Love, Jason B.; Magnani, Nicola; Colineau, Eric; Griveau, Jean-Christophe; Caciuffo, Roberto
2017-01-01
The reduction of U"V"I uranyl halides or amides with simple Ln"I"I or U"I"I"I salts forms highly symmetric, linear, oxo-bridged trinuclear U"V/Ln"I"I"I/U"V, Ln"I"I"I/U"I"V/Ln"I"I"I, and U"I"V/U"I"V/U"I"V complexes or linear Ln"I"I"I/U"V polymers depending on the stoichiometry and solvent. The reactions can be tuned to give the products of one- or two-electron uranyl reduction. The reactivity and magnetism of these compounds are discussed in the context of using a series of strongly oxo-coupled homo- and heterometallic poly(f-block) chains to better understand fundamental electronic structure in the f-block. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Energy Technology Data Exchange (ETDEWEB)
Arnold, Polly L.; Cowie, Bradley E.; Suvova, Marketa; Zegke, Markus; Love, Jason B. [EaStCHEM School of Chemistry, University of Edinburgh (United Kingdom); Magnani, Nicola; Colineau, Eric; Griveau, Jean-Christophe; Caciuffo, Roberto [European Commission, Directorate for Nuclear Safety and Security, Joint Research Centre, Karlsruhe (Germany)
2017-08-28
The reduction of U{sup VI} uranyl halides or amides with simple Ln{sup II} or U{sup III} salts forms highly symmetric, linear, oxo-bridged trinuclear U{sup V}/Ln{sup III}/U{sup V}, Ln{sup III}/U{sup IV}/Ln{sup III}, and U{sup IV}/U{sup IV}/U{sup IV} complexes or linear Ln{sup III}/U{sup V} polymers depending on the stoichiometry and solvent. The reactions can be tuned to give the products of one- or two-electron uranyl reduction. The reactivity and magnetism of these compounds are discussed in the context of using a series of strongly oxo-coupled homo- and heterometallic poly(f-block) chains to better understand fundamental electronic structure in the f-block. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Theoretical modeling of the uranium 4f XPS for U(VI) and U(IV) oxides
Energy Technology Data Exchange (ETDEWEB)
Bagus, Paul S. [Department of Chemistry, University of North Texas, Denton, Texas 76203-5017 (United States); Nelin, Connie J. [Consulting and Services, 6008 Maury' s Trail, Austin, Texas 78730 (United States); Ilton, Eugene S. [Pacific Northwest National Laboratory, Richland, Washington 99352 (United States)
2013-12-28
A rigorous study is presented of the physical processes related to X-Ray photoelectron spectroscopy, XPS, in the 4f level of U oxides, which, as well as being of physical interest in themselves, are representative of XPS in heavy metal oxides. In particular, we present compelling evidence for a new view of the screening of core-holes that extends prior understandings. Our analysis of the screening focuses on the covalent mixing of high lying U and O orbitals as opposed to the, more common, use of orbitals that are nominally pure U or pure O. It is shown that this covalent mixing is quite different for the initial and final, core-hole, configurations and that this difference is directly related to the XPS satellite intensity. Furthermore, we show that the high-lying U d orbitals as well as the U(5f) orbital may both contribute to the core-hole screening, in contrast with previous work that has only considered screening through the U(5f) shell. The role of modifying the U-O interaction by changing the U-O distance has been investigated and an unexpected correlation between U-O distance and XPS satellite intensity has been discovered. The role of flourite and octahedral crystal structures for U(IV) oxides has been examined and relationships established between XPS features and the covalent interactions in the different structures. The physical views of XPS satellites as arising from shake processes or as arising from ligand to metal charge transfers are contrasted; our analysis provides strong support that shake processes give a more fundamental physical understanding than charge transfer. Our theoretical studies are based on rigorous, strictly ab initio determinations of the electronic structure of embedded cluster models of U oxides with formal U(VI) and U(IV) oxidation states. Our results provide a foundation that makes it possible to establish quantitative relationships between features of the XPS spectra and materials properties.
Theoretical modeling of the uranium 4f XPS for U(VI) and U(IV) oxides
Bagus, Paul S.; Nelin, Connie J.; Ilton, Eugene S.
2013-12-01
A rigorous study is presented of the physical processes related to X-Ray photoelectron spectroscopy, XPS, in the 4f level of U oxides, which, as well as being of physical interest in themselves, are representative of XPS in heavy metal oxides. In particular, we present compelling evidence for a new view of the screening of core-holes that extends prior understandings. Our analysis of the screening focuses on the covalent mixing of high lying U and O orbitals as opposed to the, more common, use of orbitals that are nominally pure U or pure O. It is shown that this covalent mixing is quite different for the initial and final, core-hole, configurations and that this difference is directly related to the XPS satellite intensity. Furthermore, we show that the high-lying U d orbitals as well as the U(5f) orbital may both contribute to the core-hole screening, in contrast with previous work that has only considered screening through the U(5f) shell. The role of modifying the U-O interaction by changing the U-O distance has been investigated and an unexpected correlation between U-O distance and XPS satellite intensity has been discovered. The role of flourite and octahedral crystal structures for U(IV) oxides has been examined and relationships established between XPS features and the covalent interactions in the different structures. The physical views of XPS satellites as arising from shake processes or as arising from ligand to metal charge transfers are contrasted; our analysis provides strong support that shake processes give a more fundamental physical understanding than charge transfer. Our theoretical studies are based on rigorous, strictly ab initio determinations of the electronic structure of embedded cluster models of U oxides with formal U(VI) and U(IV) oxidation states. Our results provide a foundation that makes it possible to establish quantitative relationships between features of the XPS spectra and materials properties.
En procesorienteret miljøvurdering af F&U
DEFF Research Database (Denmark)
Lyhne, Ivar
Miljøperformance af fremtidens energiteknologier defineres i høj grad i de tidlige F&U aktiviteter. Energinet.dk har i flere år miljøvurderet ForskEL-programmet og i dette projekt forbedres systemets nytte ved at muliggøre øgede krav til programmets samlede performance og følge op på projekternes...
2010-03-02
... SECURITIES AND EXCHANGE COMMISSION [File No. 500-1] U.S. Biomedical Corp., (f/k/a United Textiles & Toys, Inc.), U.S. Environmental Solutions, Inc. (n/k/a EnviroResolutions, Inc.), USA Bridge....S. Biomedical Corp. (f/k/a United Textiles & Toys, Inc.) because it has not filed any periodic...
β decays on the rotational levels of the 5/2+[642] 169Yb band
International Nuclear Information System (INIS)
Dzhelepov, B.S.; Zhukovskij, N.N.; Shestopalova, S.A.
1993-01-01
Competing 169 Lu β decays into rotational levels of 5/2 + [642] 169 Yb band are considered. Schemes of resolved β decay into 3 levels of deformed nucleus rotational bands, γ transitions linked with excitation and discharge of 169 Yb 5/2, 7/2, 9/2, 5/2 + [642] levels are presented. Matrix elements of axial-vector decay are determined. Data on 12 γ transitions in 169 Lu are presented
Les cultures pérennes sont-elles menacées ?
Directory of Open Access Journals (Sweden)
Despreaux Denis
2001-11-01
Full Text Available Au cours des dernières décennies, les cultures pérennes ont connu un formidable essor dans les zones tropicales humides. Grâce à une demande toujours croissante en chocolat, café et caoutchouc naturel, les plantations de cacaoyers, de caféiers et d’hévéas se sont répandues sur plusieurs dizaines de millions d’hectares à travers tous les continents. Pour ce qui concerne les oléagineux, les cultures de cocotiers et, plus récemment, de palmiers à huile, ont connu des évolutions comparables. Les retours financiers que procurent ces cultures sont considérables et pèsent souvent de manière déterminante sur les économies des pays producteurs. Par ailleurs, ces productions agricoles alimentent aussi des filières économiques dynamiques et importantes pour les pays du Nord, telles que celles des pneumatiques, de l’agro-alimentaire ou des produits cosmétiques. Cependant, le nouveau contexte de politiques libéralisées et mondialisées, ainsi que l’émergence de questions nouvelles sur la gestion durable des territoires et des ressources naturelles, amènent à s’interroger sur la place qui sera réservée à ces productions agricoles au cours du xxie siècle.
Preparation of sodium fluoride agglomerates for selective adsorption of uranium hexafluoride (U F6)
International Nuclear Information System (INIS)
Castro, A.R.; Maximiano, C.; Shimba, R.; Silva, E.R.F.
1995-01-01
Uranium hexafluoride (U F 6 ) and Sodium Fluoride (NaF) reacts reversibly to form a solid complex. Such reversibility accounts for the great interest in using Sodium Fluoride (NaF) to separate Uranium Hexafluoride (U F 6 ) from other gases. Therefore a chemical trap offers an alternative to the cryogenic trapping device. (author). 3 refs, 1 fig, 4 tabs
Magnetic hyperfine interactions of U2 center in CaF2, SrF2 and BaF2
International Nuclear Information System (INIS)
Graf, C.J.F.
1976-02-01
The magnetic hyperfine parameters of the U 2 center in CaF 2 , SeF 2 and BaF 2 , using a molecular orbitals scheme have been calculated. The need for the inclusion of mechanisms such as Pauli Repulsion and Covalence in order to describe the electronic structure of the defect has been shown. In the molecular orbitals model a weak covalence parameter has been phenomenologically introduced, mixing the is atomic wavefunction of hydrogen with a properly symmetrized linear combination of 2p F - functions centered on the ions of the first fluorine shell. The results obtained are compared with experimental measurements of EPR and ENDOR. (Author) [pt
F-theory GUTs with U(1) symmetries: Generalities and survey
International Nuclear Information System (INIS)
Dolan, Matthew J.; Marsano, Joseph; Saulina, Natalia; Schaefer-Nameki, Sakura
2011-01-01
We study the structure of SU(5) F-theory grand unified theory (GUT) models that engineer additional U(1) symmetries. These are highly constrained by a set of relations observed by Dudas and Palti (DP) that originate from the physics of four-dimensional anomaly cancellation. Using the DP relations, we describe a general tension between unification and the suppression of dimension 5 proton decay when one or more U(1)'s are Peccei-Quinn (PQ) symmetries and hypercharge flux is used to break the SU(5) GUT group. We then specialize to spectral cover models, whose global completions in F theory we know how to construct. In that setting, we provide a technical derivation of the DP relations, construct spectral covers that yield all possible solutions to them, and provide a complete survey of spectral cover models for SU(5) GUTs that exhibit two U(1) symmetries.
Simon, Sylvaine; Marliac, Gaëlle; Capowiez, Yvan
2015-01-01
Les vergers constituent un habitat pérenne, multi-strate et complexe, potentiellement favorable dans le temps et dans l’espace, au maintien des chaînes trophiques et à la régulation naturelle des ravageurs. Or, ils dépendent fortement de l’utilisation des pesticides, ce qui compromet leur durabilité et l’expression de ce potentiel de régulation. Deux expérimentations en verger de pommiers ont analysé (1) la réduction de l’utilisation des pesticides permise par la combinaison de plusieurs levi...
Sonographic differentiation of pneumobilia from intrahepatic stone: U.F.O. sign
International Nuclear Information System (INIS)
Han, Sang Suk; Kim, S. S.; Kwon, D. Y.; Kim, C. D.; Cha, S. S.; Jeon, J. R.; Jung, D. H.
1990-01-01
Pneumobilia is one of the most troublesome problem in the sonographic examination of the hepatobiliary system, and the differentiation of air from intrahepatic stone is very important. We have analyzed the sonographic characteristics of 42 cases of pneumobilia dn 56 cases of intrahepatic stones over a period of 4 years. New findings of pneumobilia we observed were U.F.O. sign, wing like artefact, and nonvisualization of the lumen of the bile filled duct. Findings of pneumobilia only were U.F.O. sign, nng down and wing like artefact. Findings of stone only were ecdhogenic foci larger than 1.5cm, heterogeneous echo, wedge, shell, or sandwich like contour, and visible lumen of the bile duct
Cvetic, Mirjam; Piragua, Hernan; Taylor, Washington
2015-01-01
We construct the general form of an F-theory compactification with two U(1) factors based on a general elliptically fibered Calabi-Yau manifold with Mordell-Weil group of rank two. This construction produces broad classes of models with diverse matter spectra, including many that are not realized in earlier F-theory constructions with U(1)xU(1) gauge symmetry. Generic U(1)xU(1) models can be related to a Higgsed non-Abelian model with gauge group SU(2)xSU(2)xSU(3), SU(2)^3xSU(3), or a subgroup thereof. The nonlocal horizontal divisors of the Mordell-Weil group are replaced with local vertical divisors associated with the Cartan generators of non-Abelian gauge groups from Kodaira singularities. We give a global resolution of codimension two singularities of the Abelian model; we identify the full anomaly free matter content, and match it to the unHiggsed non-Abelian model. The non-Abelian Weierstrass model exhibits a new algebraic description of the singularities in the fibration that results in the first expl...
International Symposium on Halide Glasses (2nd) (Extended Abstracts).
1983-08-05
Tuesday, Agust 2 09.00 Introductory Remarks - C. T. Moynihan Welcome - George Ansell , Dean, School of Engineering, RPI Session 1: Synthesis Techniques and...low viscosity melt. 15.55 *sed NHide Eflet In Ruorozirconate Glaom" Marcel Poulain and J.-L. Adam , U. Rennes, Rennes, France Variable amounts of NaCI
Structure and migration in U.S. Blumeria graminis f. sp. tritici populations
While wheat powdery mildew occurs throughout the south-central and eastern U.S.A, epidemics are especially damaging in the Mid-Atlantic states. The structure of the U.S. Blumeria graminis f. sp. tritici population was assessed based on a sample of 238 single-spored isolates. The isolates were coll...
Energy Technology Data Exchange (ETDEWEB)
Bergere, R; Veyssiere, A; Daujat, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1966-06-01
This paper contains a digest of a series of studies on the frequency modulation of U.H.F. fields and signals associated with the linear electron accelerator at Saclay. We first consider the frequency modulation of a U. H. F. pulse before its injection into an accelerating structure and after its subsequent propagation when no accelerated electrons are present. We then apply a similar analysis to the frequency modulation due to the direct interaction of the electron beam itself, and the accelerating U.H.F. fields. Finally we consider the phase modulation of the elementary electron packet itself. This phase modulation can be correctly interpreted by considering the dynamics of the electron beam as such. This analysis moreover, gives a correct interpretation of the evolution of the phase modulation with time, as the elementary electron packets move along with the sinusoidal U.H.F. accelerating fields. (authors) [French] Cet article resume les etudes faites sur l'accelerateur lineaire d'electrons de Saclay a propos de la modulation de frequence des divers signaux U.H.F. presents autour de l'accelerateur. On etudie d'abord la modulation de frequence des impulsions U.H.F. entrant sur la structure acceleratrice ou transmises par cette structure en l'absence de faisceau d'electrons acceleres. On analyse ensuite la modulation de frequence resultant de l'interaction d'une de ces ondes avec le faisceau d'electrons acceleres. On etudie enfin, la modulation de phase des divers paquets elementaires constituant une impulsion d'electrons acceleres. On montre comment cette modulation de phase peut s'expliquer par des considerations sur la dynamique du faisceau et conduire a une representation dans les divers cas possibles de l'evolution de la phase d'accrochage des electrons sur l'onde sinusoidale progressive de champ accelerateur. (auteurs)
Energy Technology Data Exchange (ETDEWEB)
Yeon, Jeongho; Smith, Mark D. [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Tapp, Joshua; Möller, Angela [Department of Chemistry and Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Loye, Hans-Conrad zur, E-mail: zurloye@mailbox.sc.edu [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States)
2016-04-15
Two new uranium(IV) fluorides, Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} (1) and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30} (2), were synthesized through an in situ mild hydrothermal route, and were structurally characterized by single crystal X-ray diffraction. The compounds exhibit complex crystal structures composed of corner- or edge-shared UF{sub 9} and MF{sub 6} (M=Mg, Mn) polyhedra, forming hexagonal channels in the three-dimensional framework, in which ordered or disordered divalent metal and sodium atoms reside. The large hexagonal voids contain the nearly regular M(II)F{sub 6} octahedra and sodium ions, whereas the small hexagonal cavities include M(II) and sodium ions on a mixed-occupied site. Magnetic susceptibility measurements yielded effective magnetic moments of 8.36 and 11.6 µ{sub B} for 1 and 2, respectively, confirming the presence and oxidation states of U(IV) and Mn(II). The large negative Weiss constants indicate the spin gap between a triplet and a singlet state in the U(IV). Magnetization data as a function of applied fields revealed that 2 exhibits paramagnetic behavior due to the nonmagnetic singlet ground state of U(IV) at low temperature. UV–vis diffuse reflectance and X-ray photoelectron spectroscopy data were also analyzed. - Graphical abstract: Two new quaternary U(IV) fluorides, Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30}, were crystallized via an in situ reduction step of U(VI) to U(IV) under mild hydrothermal conditions. The compounds show complex crystal structures based on the 3-D building block of U{sub 6}F{sub 30}. Magnetic property measurements revealed that the U(IV) exhibits a nonmagnetic singlet ground state at low temperature with a spin gap. - Highlights: • Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30} have been synthesized and characterized. • The U(IV) fluorides exhibit complex three-dimensional crystal structures. • The
The Effect of fO2 on Partition Coefficients of U and Th between Garnet and Silicate Melt
Huang, F.; He, Z.; Schmidt, M. W.; Li, Q.
2014-12-01
Garnet is one of the most important minerals controlling partitioning of U and Th in the upper mantle. U is redox sensitive, while Th is tetra-valent at redox conditions of the silicate Earth. U-series disequilibria have provided a unique tool to constrain the time-scales and processes of magmatism at convergent margins. Variation of garnet/meltDU/Th with fO2 is critical to understand U-series disequilibria in arc lavas. However, there is still no systematic experimental study about the effect of fO2 on partitioning of U and Th between garnet and melt. Here we present experiments on partitioning of U, Th, Zr, Hf, Nb, Ta, and REE between garnet and silicate melts at various fO2. The starting material was hydrous haplo-basalt. The piston cylinder experiments were performed with Pt double capsules with C-CO, MnO-Mn3O4 (MM), and hematite-magnetite (HM) buffers at 3 GPa and 1185-1230 oC. The experiments produced garnets with diameters > 50μm and quenched melt. Major elements were measured by EMPA at ETH Zurich. Trace elements were determined using LA-ICP-MS at Northwestern University (Xi'an, China) and SIMS (Cameca1280 at the Institute of Geology and Geophysics, Beijing, China), producing consistent partition coefficient data for U and Th. With fO2 increasing from CCO to MM and HM, garnet/meltDU decreases from 0.041 to 0.005, while garnet/meltDTh ranges from 0.003 to 0.007 without correlation with fO2. Notably, garnet/meltDTh/U increases from 0.136 at CCO to 0.41 at HM. Our results indicate that U is still more compatible than Th in garnet even at the highest fO2 considered for the subarc mantle wedge (~NNO). Therefore, we predict that if garnet is the dominant phase controlling U-Th partitioning during melting of the mantle wedge, melts would still have 230Th excess over 238U. This explains why most young continental arc lavas have 230Th excess. If clinopyroxene is the dominant residual phase during mantle melting, U could be more incompatible than Th at high fO2
MCTS (Exams 70-640, 70-642 and 70-643)
Panek, William
2011-01-01
The must-have study guide for all three Windows Server 2008 R2 MCTS examsNetwork administrators boost their value to their employers with certification, and Microsoft?s three Windows Server 2008 exams offer certification specialties in configuring Active Directory, Network Infrastructure, and Applications Infrastructure. With complete coverage to prepare you for all three exams, this comprehensive study guide has three times the value. Real-world scenarios and hands-on exercises supplement the information to facilitate learning.The three Windows Server 2008 R2 exams (70-640, 70-642, and 70-643
Conditions of integrability of two equations of the type usub(t)=A(u)usub(xx) + F(u, usub(x)). 1
International Nuclear Information System (INIS)
Mikhajlov, A.V.; Shabat, A.B.; AN SSSR, Ufa. Bashkirskij Filial)
1985-01-01
Necessary conditions of the existence of nontrivial conservation laws for systems of nonlinear equations usub(t)=a(u, ν)usub(xx)+b(u, ν)νsub(xx)+f(u, ν, usub(x), νsub(x)); -νsub(t)=c(u, ν)usub(xx)+d(u, ν)νsub(xx)+g(u, ν, usub(x), νsub(x) are found. They are of the form of densities of local conservation laws constructed from the coefficients of the system. They can easily be checked in each concrete case. Modulus of simple invertible substitutions is discussed which makes it possible to bring the system into the canonical form if certain integrability conditions are fulfilled
Directory of Open Access Journals (Sweden)
Salvador-Castiñeira Paula
2017-01-01
Full Text Available Cross section measurements in the fast energy region are being demanded as one of the key ingredients for modelling Generation-IV nuclear power plants. However, in facilities where there are no time-of-flight possibilities or it is not convenient to use them, using the 235U(n,f cross section as a benchmark would require a careful knowledge of the room scatter in the experimental area. In this paper we present measurements of two threshold reactions, 238U(n,f and 237Np(n,f, that could become a standard between their fission threshold and 2.5 MeV, if the discrepancies shown in the evaluations and in some experimental data can be solved. The preliminary results are in agreement with the present ENDF/B-VII.1 evaluation.
F-theory and all things rational: surveying U(1) symmetries with rational sections
International Nuclear Information System (INIS)
Lawrie, Craig; Schäfer-Nameki, Sakura; Wong, Jin-Mann
2015-01-01
We study elliptic fibrations for F-theory compactifications realizing 4d and 6d supersymmetric gauge theories with abelian gauge factors. In the fibration these U(1) symmetries are realized in terms of additional rational section. We obtain a universal characterization of all the possible U(1) charges of matter fields by determining the corresponding codimension two fibers with rational sections. In view of modelling supersymmetric Grand Unified Theories, one of the main examples that we analyze are U(1) symmetries for SU(5) gauge theories with 5̄ and 10 matter. We use a combination of constraints on the normal bundle of rational curves in Calabi-Yau three- and four-folds, as well as the splitting of rational curves in the fibers in codimension two, to determine the possible configurations of smooth rational sections. This analysis straightforwardly generalizes to multiple U(1)s. We study the flops of such fibers, as well as some of the Yukawa couplings in codimension three. Furthermore, we carry out a universal study of the U(1)-charged GUT singlets, including their KK-charges, and determine all realizations of singlet fibers. By giving vacuum expectation values to these singlets, we propose a systematic way to analyze the Higgsing of U(1)s to discrete gauge symmetries in F-theory.
77 FR 22483 - Guidance Under Sections 642 and 643 (Income Ordering Rules)
2012-04-16
... 26 CFR part 1, confirming that a provision in a trust, a will, or a provision of local law that... (Code) section 642(c) with regard to the Federal tax consequences of an ordering provision in a trust, a will, or a provision of local law that attempts to determine the tax character of the amounts paid to a...
Tuned and non-Higgsable U(1)s in F-theory
Energy Technology Data Exchange (ETDEWEB)
Wang, Yi-Nan [Center for Theoretical Physics, Department of Physics, Massachusetts Institute of Technology,77 Massachusetts Avenue, Cambridge, MA 02139 (United States)
2017-03-27
We study the tuning of U(1) gauge fields in F-theory models on a base of general dimension. We construct a formula that computes the change in Weierstrass moduli when such a U(1) is tuned, based on the Morrison-Park form of a Weierstrass model with an additional rational section. Using this formula, we propose the form of “minimal tuning” on any base, which corresponds to the case where the decrease in the number of Weierstrass moduli is minimal. Applying this result, we discover some universal features of bases with non-Higgsable U(1)s. Mathematically, a generic elliptic fibration over such a base has additional rational sections. Physically, this condition implies the existence of U(1) gauge group in the low-energy supergravity theory after compactification that cannot be Higgsed away. In particular, we show that the elliptic Calabi-Yau manifold over such a base has a small number of complex structure moduli. We also suggest that non-Higgsable U(1)s can never appear on any toric bases. Finally, we construct the first example of a threefold base with non-Higgsable U(1)s.
Phenomenology with F-theory S U (5 )
Leontaris, George K.; Shafi, Qaisar
2017-09-01
We explore the low-energy phenomenology of an F-theory-based S U (5 ) model which, in addition to the known quarks and leptons, contains Standard Model (SM) singlets and vectorlike color triplets and S U (2 ) doublets. Depending on their masses and couplings, some of these new particles may be observed at the LHC and future colliders. We discuss the restrictions by Cabibbo-Kobayashi-Maskawa matrix constraints on their mixing with the ordinary down quarks of the three chiral families. The model is consistent with gauge coupling unification at the usual supersymmetric GUT scale; dimension-five proton decay is adequately suppressed, while dimension-six decay mediated by the superheavy gauge bosons is enhanced by a factor of 5-7. The third generation charged fermion Yukawa couplings yield the corresponding low-energy masses in reasonable agreement with observations. The hierarchical nature of the masses of lighter generations is accounted for via nonrenormalizable interactions, with the perturbative vacuum expectation values (VEVs) of the SM singlet fields playing an essential role.
Yeon, Jeongho; Smith, Mark D.; Tapp, Joshua; Möller, Angela; zur Loye, Hans-Conrad
2016-04-01
Two new uranium(IV) fluorides, Na3.13Mg1.43U6F30 (1) and Na2.50Mn1.75U6F30 (2), were synthesized through an in situ mild hydrothermal route, and were structurally characterized by single crystal X-ray diffraction. The compounds exhibit complex crystal structures composed of corner- or edge-shared UF9 and MF6 (M=Mg, Mn) polyhedra, forming hexagonal channels in the three-dimensional framework, in which ordered or disordered divalent metal and sodium atoms reside. The large hexagonal voids contain the nearly regular M(II)F6 octahedra and sodium ions, whereas the small hexagonal cavities include M(II) and sodium ions on a mixed-occupied site. Magnetic susceptibility measurements yielded effective magnetic moments of 8.36 and 11.6 μB for 1 and 2, respectively, confirming the presence and oxidation states of U(IV) and Mn(II). The large negative Weiss constants indicate the spin gap between a triplet and a singlet state in the U(IV). Magnetization data as a function of applied fields revealed that 2 exhibits paramagnetic behavior due to the nonmagnetic singlet ground state of U(IV) at low temperature. UV-vis diffuse reflectance and X-ray photoelectron spectroscopy data were also analyzed.
Fresnel, A; Jarno, P; Burgun, A; Delamarre, D; Denier, P; Cleret, M; Courtin, C; Seka, L P; Pouliquen, B; Cléran, L; Riou, C; Leduff, F; Lesaux, H; Duvauferrier, R; Le Beux, P
1998-01-01
A pedagogical network has been developed at University Hospital of Rennes from 1996. The challenge is to give medical information and informatics tools to all medical students in the clinical wards of the University Hospital. At first, nine wards were connected to the medical school server which is linked to the Internet. Client software electronic mail and WWW Netscape on Macintosh computers. Sever software is set up on Unix SUN providing a local homepage with selected pedagogical resources. These documents are stored in a DBMS database ORACLE and queries can be provided by specialty, authors or disease. The students can access a set of interactive teaching programs or electronic textbooks and can explore the Internet through the library information system and search engines. The teachers can send URL and indexation of pedagogical documents and can produce clinical cases: the database updating will be done by the users. This experience of using Web tools generated enthusiasm when we first introduced it to students. The evaluation shows that if the students can use this training early on, they will adapt the resources of the Internet to their own needs.
238U (n,f) measurements below 30 keV
International Nuclear Information System (INIS)
Slovacek, R.E.; Cramer, D.S.; Bean, E.B.; Hockenbury, R.W.; Valentine, J.R.; Block, R.C.
1975-01-01
The 238 U (n,f) cross section has been measured from 3 eV to about 30 keV with the lead slowing down spectrometer at the RPI Linac. Four fission ionization chambers containing a total of about 0.8 gm of 238 U (4.1 ppm 235 U) were used for the measurements. The fission widths of the 6.67, 20.9, and the 36.8 eV resonances were measured as (10 +- 1), (58 +- 9), and (12 +- 2) nanoelectron-volts respectively. The fission cross section integrated over the two subthreshold groups at 720 and 1210 eV and the average fission cross section from 10 to 30 keV are in agreement with a previous time of flight measurement. The fission width at 6.67 eV is 20 times smaller than an upper limit set by the only reported measurement in this energy region; the fission widths obtained in the present investigation are consistent with the (30 +- 50) nanoelectronvolt average width previously obtained for the resonances between 37 and 327 eV in a time of flight measurement using a nuclear device. From the measured fission widths, the 238 U thermal fission cross section was determined to be 2.7 +- 0.3 μ barns. The resonance fission integral was also obtained from the data as 1.33 +- 0.15 mbarns for 238 U. (4 figures, 4 tables) (U.S.)
Zhang, Yachao; Yang, Yang; Jiang, Hong
2013-12-12
The 3d-4f exchange interaction plays an important role in many lanthanide based molecular magnetic materials such as single-molecule magnets and magnetic refrigerants. In this work, we study the 3d-4f magnetic exchange interactions in a series of Cu(II)-Gd(III) (3d(9)-4f(7)) dinuclear complexes based on the numerical atomic basis-norm-conserving pseudopotential method and density functional theory plus the Hubbard U correction approach (DFT+U). We obtain improved description of the 4f electrons by including the semicore 5s5p states in the valence part of the Gd-pseudopotential. The Hubbard U correction is employed to treat the strongly correlated Cu-3d and Gd-4f electrons, which significantly improve the agreement of the predicted exchange constants, J, with experiment, indicating the importance of accurate description of the local Coulomb correlation. The high efficiency of the DFT+U approach enables us to perform calculations with molecular crystals, which in general improve the agreement between theory and experiment, achieving a mean absolute error smaller than 2 cm(-1). In addition, through analyzing the physical effects of U, we identify two magnetic exchange pathways. One is ferromagnetic and involves an interaction between the Cu-3d, O-2p (bridge ligand), and the majority-spin Gd-5d orbitals. The other one is antiferromagnetic and involves Cu-3d, O-2p, and the empty minority-spin Gd-4f orbitals, which is suppressed by the planar Cu-O-O-Gd structure. This study demonstrates the accuracy of the DFT+U method for evaluating the 3d-4f exchange interactions, provides a better understanding of the exchange mechanism in the Cu(II)-Gd(III) complexes, and paves the way for exploiting the magnetic properties of the 3d-4f compounds containing lanthanides other than Gd.
International Nuclear Information System (INIS)
Ning Lixin; Jiang Ying; Xia Shangda; Tanner, Peter A
2003-01-01
The 5f 3 → 5f 2 6d absorption spectrum of U 3+ in LiY F 4 has been well calculated using the model proposed by Reid for calculations of 4f N ↔ 4f N-1 5d spectra. The relevant formulae for the matrix element calculations which were omitted in this model are now described in detail, and the values of the direct and exchange coefficients associated with the f-d Coulomb interactions within the f 2 d configuration are derived and listed. The amount of reduction for the f-d Coulomb interaction parameters from the free-ion values is found to be ∼ 67% , which is much larger than the value of 26% for the isoelectronic Nd 3+ lanthanide ion in the same host
2010-04-01
... ASSISTANCE: HOUSING CHOICE VOUCHER PROGRAM Special Housing Types Homeownership Option § 982.642 Homeownership... declared major disaster or emergency. (d) Amount and distribution of homeownership assistance payments. (1... payment on behalf of the family in accordance with § 982.635 and this section. (2) A family that is a low...
International Nuclear Information System (INIS)
Murin, I.V.; Andreev, A.M.; Amelin, Yu.V.
1982-01-01
The temperature dependence of electric conductivity of some double fluorides formed in the systems M 1 F-Th(U)F 4 (M 1 =K, Tl) and M 2 F 2 -ThF 4 (M 2 =Ca, Sr, Ba) as well as UF 3 in a wide temperature range is studied. It is shown that the values of electric conductivity and activation energy of these fluorides depend on the compound structure and cation nature. The temperature electric conductivity dependence for double fluorides with the tysonite structure is close to the lanthanum fluoride dependence. Taking into account low electron electric conductivity component the conclusion is drawn that the investigated compounds can be used as solid electrolytes
Influences suffered by agriculture production in the proximity of Krupp-Renn plants
Energy Technology Data Exchange (ETDEWEB)
Kozel, J; Maly, V
1965-01-01
The article presents the results obtained after the years of investigations of the effect produced by the exhalations of industrial plants upon the fertility of soil and the yields of agricultural crops in the vicinity of Krupp-Renn plants. The investigations were performed in situ. The amount of fall-out from these plants several times exceeded the tolerable quantity. Also the amount of SO/sub 2/ was higher than the permissible daily concentration. The average yearly volume of contaminants adhering on agricultural plants cultivated near these industrial enterprises has been found on root crops and maize, while it was considerably smaller on cereals. This depends on the size and on the possible coarseness of the leaf areas. The average content of sulfuric compounds in the ashes on the sticking impurities fluctuated between 4.93 and 9.60 p.c. and the content of SO/sub 3/ in the ashes of organic substances surpassed in the majority of cases the values fixed for normal conditions. The influence upon soil properties is, first of all, unfavorably manifested by a higher level of some compounds (especially sulfuric and ferrous) and by a reduced soil reaction, but on the other hand the level of some mineral nutrients increased as a result of their content in the fly-ashes. The strongest reduction of per hectare yields was shown by maize, beans and root crops. The damage to cereals was considerably lower. Besides a decrease in yields, the deterioration of their quality has to be taken into consideration, especially so far as fodder crops are concerned, which in its turn influence the decrease in performance of farm animals and deterioration of the conditions of their health. 16 references, 2 figures, 3 tables.
Time-scale calibration by U-Pb geochronology: Examples from the Triassic Period
Mundil, R.
2009-05-01
)) and the Early-Middle Triassic (Olenekian-Anisian) boundary (247.2 Ma, (8, 9)), resulting in a surprisingly short duration of the Early Triassic which has implications for the timing of biotic recovery and major changes in ocean chemistry during this time. Furthermore, the Anisian-Ladinian boundary is constrained to 242.0 Ma by new U-Pb and 40Ar/39Ar ages. Radio-isotopic ages for the Late Triassic are scarce and the only reliable and biostratigraphically controlled age is from an upper Carnian tuff dated to 230.9 Ma (10), yielding a duration of more than 35 Ma for the Late Triassic. The resulting time-scale is at odds with the most recent compilation (11) but arguably more accurate because it is entirely based on U-Pb analyses applied to closed-system zircons with uncertainties at the permil level or better. 1. T. E. Krogh, Geochimica et Cosmochimica Acta 37, 485 (1973); 2. T. E. Krogh, Geochimica et Cosmochimica Acta 46, 637 (1982); 3. J. M. Mattinson, Chemical Geology 220, 47 (2005); 4. R. Mundil, K. R. Ludwig, I. Metcalfe, P. R. Renne, Science 305, 1760 (2004); 5. U. Schaltegger, J. Guex, A. Bartolini, B. Schoene, M. Ovtcharova, Earth and Planetary Science Letters 267, 266 (2008); 6. R. Mundil, P. R. Renne, K. K. Min, K. R. Ludwig, in Eos Trans. AGU, Fall Meet. Suppl. (2006), vol. 87(52), pp. V21A-0543; 7. T. Galfetti et al., Earth and Planetary Science Letters 258, 593 (2007). 8. M. Ovtcharova et al., Earth and Planetary Science Letters 243, 463 (2006). 9. J. Ramezani et al., Earth and Planetary Science Letters 256, 244 (2007). 10. S. Furin et al., Geology 34, 1009 (2006); 11. J. G. Ogg, in A Geologic Time Scale 2004 F. M. Gradstein, J. G. Ogg, A. G. Smith, Eds. (University Press, Cambridge, 2004) pp. 271-306.
2010-07-01
... SOURCE CATEGORY Cadmium Pigments and Salts Production Subcategory § 415.642 Effluent limitations....32 any existing point source subject to this subpart and producing cadmium pigments must achieve the... of the best practicable control technology currently available (BPT). Subpart BL—Cadmium Pigments...
Phenomenology of U(1){sub F} extension of inert-doublet model with exotic scalars and leptons
Energy Technology Data Exchange (ETDEWEB)
Dhargyal, Lobsang [Harish-Chandra Research Institute, HBNI, Allahabad (India)
2018-02-15
In this work we will extend the inert-doublet model (IDM) by adding a new U(1){sub F} gauge symmetry to it, under which, a Z{sub 2} even scalar (φ{sub 2}) and Z{sub 2} odd right handed component of two exotic charged leptons (F{sub eR}, F{sub μR}), are charged. We also add one Z{sub 2} even real scalar (φ{sub 1}) and one complex scalar (φ), three neutral Majorana right handed fermions (N{sub 1}, N{sub 2}, N{sub 3}), two left handed components of the exotic charged leptons (F{sub eL}, F{sub μL}) as well as F{sub τ} are all odd under the Z{sub 2}, all of which are not charged under the U(1){sub F}. With these new particles added to the IDM, we have a model which can give two scalar DM candidates, together they can explain the present DM relic density as well as the muon (g-2) anomaly simultaneously. Also in this model the neutrino masses are generated at one loop level. One of the most peculiar feature of this model is that non-trivial solution to the axial gauge anomaly free conditions lead to the prediction of a stable very heavy partner to the electron (F{sub e}), whose present collider limit (13 TeV LHC) on its mass should be around m{sub F{sub e}} ≥ few TeV. (orig.)
Klinar, Walter J.; Berman, Theodore
1948-01-01
An investigation has been conducted in the Langley 20-foot free-spinning tunnel on the 1/20-scale model of the Chance Vought XF6U-1 airplane altered to represent the XF6U-1 airplane as it will be spin-tested in flight, and also altered to represent the F6U-1 airplane as it will be produced for service use. Spin tests were made to determine the effects of control settings and movements at the normal loading. The results show that the spins obtained on the revised XF6U-1 airplane will be oscillatory in roll and yaw and that recoveries by rudder reversal will be rapid. Model test results indicate that the F6U-1 airplane will probably not spin. Inasmuch as the results of this investigation show that the new designs are as good as or better than the original XF6U-1 design in regard to spin recovery, it is felt that the conclusions and recommendations reached for the original design can be applied to the new designs for all loading conditions.
Enzymatic U(VI) reduction by Desulfosporosinus species
International Nuclear Information System (INIS)
Suzuki, Y.; Kelly, S.D.; Kemner, K.M.; Banfield, J.F.
2004-01-01
Here we tested U(VI) reduction by a Desulfosporosinus species (sp.) isolate and type strain (DSM 765) in cell suspensions (pH 7) containing 1 mM U(VI) and lactate, under an atmosphere containing N 2 -CO 2 -H 2 (90: 5: 5). Although neither Desulfosporosinus species (spp.) reduced U(VI) in cell suspensions with 0.25% Na-bicarbonate or 0.85% NaCl, U(VI) was reduced in these solutions by a control strain, desulfovibrio desulfuricans (ATCC 642). However, both Desulfosporosinus strains reduced U(VI) in cell suspensions depleted in bicarbonate and NaCl. No U(VI) reduction was observed without lactate and H 2 electron donors or with heat-killed cells, indicating enzymatic U(VI) reduction. Uranium(VI) reduction by both strains was inhibited when 1 mM CuCl 2 was added to the cell suspensions. Because the Desulfosporosinus DSM 765 does not contain cytochrome c 3 used by Desulfovibrio spp. to reduce U(VI), Desulfosporosinus species reduce uranium via a different enzymatic pathway. (orig.)
Evaluation of 235U(n,f) between 100 keV and 20 MeV
International Nuclear Information System (INIS)
Poenitz, W.P.
1979-07-01
The 235 U(n,f) cross section is evaluated in the energy range from 100 keV to 20 MeV. Experimental data are included up to the 1978 Harwell Conference on Neutron Physics. The evaluation methodology is discussed in detail. The shape and the normalization of the cross section are evalutated in separate steps. An extensive comparison of the evaluation result with experimental data sets is made. The shape of the cross section obtained in a preliminary version of the present evaluation and a normalization factor extracted from data provided within the framework of this evaluation were used by the Subcommittee on Standards and Normalizations of the Cross Sections Evaluation Working Group to establish 235 U(n,f) for ENDF/B-V above 100 keV. 20 figures, 6 tables
(e,e'f) coincidence experiments for fission decay of giant resonances in 235,238U
International Nuclear Information System (INIS)
Weber, T.; Heil, R.D.; Kneissl, U.; Pecho, W.; Wilke, W.; Emrich, H.J.; Kihm, T.; Knoepfle, K.T.
1988-01-01
Extending previous work on 238 U, 235 U(e,e'f) coincidence data were taken at 4 momentum transfers yielding both E1, E2/E0 and E3 form factors and the respective multipole strength distributions in the giant resonance region of 238 U (4 x x /Γ a is obtained as a function of excitation energy for separated multipoles. The giant E2 resonance exhibits an increased symmetric fission contribution compared to E1 and E3 resonances. (orig.)
26 CFR 1.642(c)-1 - Unlimited deduction for amounts paid for a charitable purpose.
2010-04-01
... the election was made, (iii) The office of the district director, or the service center, where the....642(c)-1 Unlimited deduction for amounts paid for a charitable purpose. (a) In general. (1) Any part... election, to a related estate, as defined under § 1.645-1(b), for the amount so paid. (2) In determining...
Neutron-fragment angular correlations in /sup 235/U(n/sub th/,f)
International Nuclear Information System (INIS)
Franklyn, C.B.
1985-01-01
Neutron-fragment angular correlations in /sup 235/U(n/sub th/,f) as a function of neutron energy and fragment mass are presented. The results obtained in this experiment, together with data for neutron-neutron angular correlations, are compared with a Monte Carlo simulation of the fission process incorporating both a scission neutron component and an anisotropic neutron emission component
Khabiri, Masoud; Ebrahimi, Maziar; Saei, Mohammad Reza
2017-12-01
File fracture can interfere with cleaning and shaping of the canal and compromise periradicular healing. Autoclave sterilization may prone the files to fracture. The purpose of the present study was to determine the effect of autoclave sterilization on the cyclic fatigue resistance of Hero642 rotary instrument in two curvatures of 45 and 60 degrees. For this experimental in-vitro study, 90 Nickel-Titanium HERO 642 rotary files #30 with 0.06 taper were selected. They were divided into two groups (curvature of 45 and 60 degree) of 45 files. Each group was then subdivided into 3 subgroups; group I: no sterilization, group II: 5 cycles of sterilization and group III: 10 cycles of sterilization. Files were used in artificial canals until fracture. The cyclic fatigue was measured as the number of cycles before fracture. The data was statically analyzed by Student's t-test and two-way analysis of variance. There was a significant difference in cyclic fatigue of two curvature of 45 and 60 degrees ( p = 0.001). However, sterilization process has no significant effect on cyclic fatigue of HERO files ( p = 0.557). Sterilization had no effect on the cyclic fatigue of HERO 642 files when used in curvature of 45 or 60 degrees.
International Nuclear Information System (INIS)
Naik, H.; Goswami, A.; Suryanarayana, S.V.; Jagadeesan, K.C.; Thakare, S.V.; Joshi, P.V.; Nimje, V.T.; Mittal, K.C.; Venugopal, V.; Kailas, S.
2013-01-01
The radionuclide 99 Mo, which has a half-life of 65.94 h was produced from 238 U(γ, f) and 100 Mo(γ, n) reactions using a 10 MeV electron linac at EBC, Kharghar Navi-Mumbai, India. This has been investigated since the daughter product 99m Tc is very important from a medical point of view and can be produced in a generator from the parent 99 Mo. The activity of 99 Mo was analyzed by a γ-ray spectrometric technique using a HPGe detector. From the detected γ-rays activity of 140.5 and 739.8 keV, the amount of 99 Mo produced was determined. For comparison, the amount of 99 Mo from 238 U(γ, f) and 100 Mo(γ, n) reactions was also estimated using the experimental photon flux from 197 Au(γ, n) 196 Au reaction. The amount of 99 Mo from the detected γ-lines is in agreement with the estimated value for 238 U(γ, f) and 100 Mo(γ, n) reactions. The production of 99 Mo activity from 238 U(γ, f) and 100 Mo(γ, n) reactions is a relevant and novel approach, which provides alternative routes to 235,238 U(n, f) and 98 Mo(n, γ) reactions, circumventing the need for a reactor. The viability and practicality of the 99 Mo production from the 238 U(γ, f) and 100 Mo(γ, n) reactions alternative to 235,238 U(n, f) and 98 Mo(n, γ) reactions has been emphasize. An estimate has been also arrived based on the experimental data of present work to fulfill the requirement of DOE. (author)
International Nuclear Information System (INIS)
Ordejon, B.; Seijo, L.; Barandiaran, Z.
2007-01-01
Complete text of publication follows: Excitons trapped at impurity centres in highly ionic crystals were first described by McClure and Pedrini [Phys. Rev. B 32, 8465 (1985)] as excited states consisting of a bound electron-hole pair with the hole localized on the impurity and the electron on nearby lattice sites, and a very short impurity-ligand bond length. In this work we present a detailed microscopic characterization of an impurity - trapped exciton in Cs 2 GeF 6 doped with U 4+ . Its electronic structure has been studied by means of CASSCF/CASPT2/SOCI relativistic ab initio model potential (AIMP) embedded-cluster calculations on (UF 6 ) 2- and (UF 6 Cs 8 ) 6+ clusters embedded in Cs 2 GeF 6 . The local geometry of the impurity-trapped exciton, the potential energy curves, and the multi electronic wavefunctions, have been obtained as direct, non-empirical results of the methods. The calculated excited states appear to be significantly delocalized outside the UF 6 volume and their U-F bond length turns out to be very short, closer to that of a pentavalent uranium defect than to that of a tetravalent uranium defect. The wavefunctions of these excited states show a dominant U 5f 1 7s 1 configuration character. This result has never been anticipated by simpler models and reveals the unprecedented ability of diffuse orbitals of f-element impurities to act as electron traps in ionic crystals
Laurec, J.; Adam, A.; de Bruyne, T.; Bauge, E.; Granier, T.; Aupiais, J.; Bersillon, O.; Le Petit, G.; Authier, N.; Casoli, P.
2010-12-01
The yields of more than fifteen fission products have been carefully measured using radiochemical techniques, for 235U(n,f), 239Pu(n,f) in a thermal spectrum, for 233U(n,f), 235U(n,f), and 239Pu(n,f) reactions in a fission neutron spectrum, and for 233U(n,f), 235U(n,f), 238U(n,f), and 239Pu(n,f) for 14.7 MeV monoenergetic neutrons. Irradiations were performed at the EL3 reactor, at the Caliban and Prospero critical assemblies, and at the Lancelot electrostatic accelerator in CEA-Valduc. Fissions were counted in thin deposits using fission ionization chambers. The number of fission products of each species were measured by gamma spectrometry of co-located thick deposits.
2010-04-01
... the gross income of the estate for 1972, and N University receives $100,000 from the estate in such... INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES... unlimited charitable contributions deduction. (a) Income in respect of a decedent. For purposes of §§ 1.642...
Froggatt-Nielsen meets Mordell-Weil: a phenomenological survey of global F-theory GUTs with U(1)s
International Nuclear Information System (INIS)
Krippendorf, Sven; Schäfer-Nameki, Sakura; Wong, Jin-Mann
2015-01-01
In F-theory, U(1) gauge symmetries are encoded in rational sections, which generate the Mordell-Weil group of the elliptic fibration of the compactification space. Recently the possible U(1) charges for global SU(5) F-theory GUTs with smooth rational sections were classified http://dx.doi.org/10.1007/JHEP09(2015)144. In this paper we utilize this classification to probe global F-theory models for their phenomenological viability. After imposing an exotic-free MSSM spectrum, anomaly cancellation (related to hypercharge flux GUT breaking in the presence of U(1) gauge symmetries), absence of dimension four and five proton decay operators and other R-parity violating couplings, and the presence of at least the third generation top Yukawa coupling, we generate the remaining quark and lepton Yukawa textures by a Froggatt-Nielsen mechanism. In this process we require that the dangerous couplings are forbidden at leading order, and when re-generated by singlet vevs, lie within the experimental bounds. We scan over all possible configurations, and show that only a small class of U(1) charge assignments and matter distributions satisfy all the requirements. The solutions give rise to the exact MSSM spectrum with realistic quark and lepton Yukawa textures, which are consistent with the CKM and PMNS mixing matrices. We also discuss the geometric realization of these models, and provide pointers to the class of elliptic fibrations with good phenomenological properties.
Zúñiga-Sánchez, Esther; Soriano, Diana; Martínez-Barajas, Eleazar; Orozco-Segovia, Alma; Gamboa-deBuen, Alicia
2014-12-02
DUF642 proteins constitute a highly conserved family of proteins that are associated with the cell wall and are specific to spermatophytes. Transcriptome studies have suggested that members of this family are involved in seed development and germination processes. Previous in vitro studies have revealed that At4g32460- and At5g11420-encoded proteins interact with the catalytic domain of pectin methyl esterase 3 (AtPME3, which is encoded by At3g14310). PMEs play an important role in plant development, including seed germination. The aim of this study was to evaluate the function of the DUF642 gene At4g32460 during seed germination and plant development and to determine its relation to PME activity regulation. Our results indicated that the DUF642 proteins encoded by At4g32460 and At5g11420 could be positive regulators of PME activity during several developmental processes. Transgenic lines overexpressing these proteins showed increased PME activity during seed germination, and improved seed germination performance. In plants expressing At4g32460 antisense RNA, PME activity was decreased in the leaves, and the siliques were very short and contained no seeds. This phenotype was also present in the SALK_142260 and SALK_054867 lines for At4g32460. Our results suggested that the DUF642 family contributes to the complexity of the methylesterification process by participating in the fine regulation of pectin status during plant development.
Intergranular tellurium cracking of nickel-based alloys in molten Li, Be, Th, U/F salt mixture
Ignatiev, Victor; Surenkov, Alexander; Gnidoy, Ivan; Kulakov, Alexander; Uglov, Vadim; Vasiliev, Alexander; Presniakov, Mikhail
2013-09-01
In Russia, R&D on Molten Salt Reactor (MSR) are concentrated now on fast/intermediate spectrum concepts which were recognized as long term alternative to solid fueled fast reactors due to their attractive features: strong negative feedback coefficients, easy in-service inspection, and simplified fuel cycle. For high-temperature MSR corrosion of the metallic container alloy in primary circuit is the primary concern. Key problem receiving current attention include surface fissures in Ni-based alloys probably arising from fission product tellurium attack. This paper summarizes results of corrosion tests conducted recently to study effect of oxidation state in selected fuel salt on tellurium attack and to develop means of controlling tellurium cracking in the special Ni-based alloys recently developed for molten salt actinide recycler and tranforming (MOSART) system. Tellurium corrosion of Ni-based alloys was tested at temperatures up to 750 °C in stressed and unloaded conditions in molten LiF-BeF2 salt mixture fueled by about 20 mol% of ThF4 and 2 mol% of UF4 at different [U(IV)]/[U(III)] ratios: 0.7, 4, 20, 100 and 500. Following Ni-based alloys (in mass%): HN80М-VI (Mo—12, Cr—7.6, Nb—1.5), HN80МТY (Mo—13, Cr—6.8, Al—1.1, Ti—0.9), HN80МТW (Mo—9.4, Cr—7.0, Ti—1.7, W—5.5) and ЕМ-721 (W—25.2, Cr—5.7, Ti—0.17) were used for the study in the corrosion facility. If the redox state the fuel salt is characterized by uranium ratio [U(IV)]/[U(III)] uranium intermetallic compounds and alloys with nickel and molybdenum. This leads to spontaneous behavior of alloy formation processes on the specimens' surface and further diffusion of uranium deep into the metallic phase. As consequence of this films of intermetallic compounds and alloys of nickel, molybdenum, tungsten with uranium are formed on the alloys specimens' surface, and intergranular corrosion does not take place. In the fuel salt with [U(IV)]/[U(III)] = 4-20 the potentials of uranium
International Nuclear Information System (INIS)
Lorenzelli, Nicole.
1979-09-01
The irradiation by 235 U fission fragments (F.F.) of two iron samples of different purities (the essential impurity being C) have been studied. Comparative measurements of electrical resistivity and dechanneling of 5 MeV α-particles have been made during irradiation and subsequent recovery. The production curves provide, from their slopes at the origin, the following informations: 14000 Frenkel pairs by F.F. (from electrical resistivity); aggregate's rate: 5 per mille (from dechanneling). These curves do not follow a simple law: it seems that one observes the superposition of two saturation mechanisms with very different kinetics. During recovery, the same stages that after electrons or neutrons irradiation are observed, but with very different proportions. Dechanneling puts in evidence: -great modifications in cementite precipitation of an Fe-C alloy, by irradiation; - the recovery stage of loops starting from 800 K and with an activation energy approximately 1 eV; - the preponderant effect of clustering during stages Isub(D), Isub(E), IIsub(C) and IIsub(D) [fr
International Nuclear Information System (INIS)
Shirotani, M.; Yui, Y.; Hattori, R.; Kawai, C.
1991-01-01
The effects of U-61,431F, ciprostene, a stable prostacyclin analogue, were examined on the proliferation of cultured quiescent bovine aortic endothelial cells (EC) and smooth muscle cells (SMC). After stimulation with 5% fetal calf serum, U-61,431F suppressed both the DNA synthesis and proliferation of SMC dose-dependently at the concentration of 3-100 microM, but had no effect on either of them in EC at a concentration of up to 30 microM. The inhibitory effect on DNA synthesis was greater in SMC than in EC at 3-50 microM. When SMC were stimulated with platelet-derived growth factor (PDGF) for 2 hrs followed by a 22-hr incubation with insulin, U-61,431F (1-50 microM) administered at the time of PDGF stimulation did not inhibit DNA synthesis. SMC initiated and terminated DNA synthesis at about 15-18 h and 24 h after stimulation with serum, respectively. Inhibition of DNA synthesis in serum-stimulated SMC as a function of the addition time of U-61,431F reduced at 3-12 h after the stimulation. U-61,431F raised the cyclic AMP (cAMP) content in SMC. Moreover, a phosphodiesterase inhibitor, 3-isobutyl-1-methylxanthine, and a more specific cAMP phosphodiesterase inhibitor, Ro 20-1724, augmented the inhibition of DNA synthesis in SMC concomitant with further elevation of cAMP level. These results suggest that U-61,431F inhibits DNA synthesis of SMC acting in the progression stage rather than in the competence stage, with little antiproliferative effect on EC. cAMP may play an important role in its antiproliferative action in SMC
Rubio-Codina, Marta; Attanasio, Orazio; Grantham-McGregor, Sally
2016-01-01
Research has previously shown a gap of near 0.5 of a standard deviation (SD) in cognition and language development between the top and bottom household wealth quartile in children aged 6-42 months in a large representative sample of low- and middle-income families in Bogota, using the Bayley Scales of Infant and Toddler Development. The gaps in…
{sup 235}U(n,F) prompt fission neutron spectra
Energy Technology Data Exchange (ETDEWEB)
Maslov, M.V.; Tetereva, N.A. [Joint Institute of Nuclear and Energy Research, Minsk-Sosny (Belarus); Pronyaev, V.P.; Kagalenko, A.B. [Institute of Physics and Power Engineering, Obninsk (Russian Federation); Capote, R. [International Atomic Energy Agency, Vienna (Austria); Granier, T.; Morillon, B. [CEA, Centre DAM-IIe de France, 91 - Arpajon (France); Hambsch, F.J. [EC-JRC Institute for Reference Materials and Measurements, Geel (Belgium); Sublet, J.C. [CEA Cadarache, 13 - Saint Paul lez Durance (France)
2009-07-01
The longstanding problem of inconsistency of integral thermal data testing and differential prompt fission neutron spectra data (PFNS) is mostly due to rather poor fits of differential PFNS data in major data libraries. The measured database is updated by using modern standards including Manhart's evaluation of the spontaneous fission neutron spectra of {sup 252}Cf(sf). That largely removes the inconsistency of older thermal neutron-induced PFNS measurements with newest data of JRC IRMM by Hambsch et al. (2009). A phenomenological approach, developed by Kornilov et al. (1999), for the first-chance fission and extended for the emissive fission domain by Maslov et al. (2005) is calibrated at E{sub th} to predict both the PFNS average energy
The design of red-blue 3D video fusion system based on DM642
Fu, Rongguo; Luo, Hao; Lv, Jin; Feng, Shu; Wei, Yifang; Zhang, Hao
2016-10-01
Aiming at the uncertainty of traditional 3D video capturing including camera focal lengths, distance and angle parameters between two cameras, a red-blue 3D video fusion system based on DM642 hardware processing platform is designed with the parallel optical axis. In view of the brightness reduction of traditional 3D video, the brightness enhancement algorithm based on human visual characteristics is proposed and the luminance component processing method based on YCbCr color space is also proposed. The BIOS real-time operating system is used to improve the real-time performance. The video processing circuit with the core of DM642 enhances the brightness of the images, then converts the video signals of YCbCr to RGB and extracts the R component from one camera, so does the other video and G, B component are extracted synchronously, outputs 3D fusion images finally. The real-time adjustments such as translation and scaling of the two color components are realized through the serial communication between the VC software and BIOS. The system with the method of adding red-blue components reduces the lost of the chrominance components and makes the picture color saturation reduce to more than 95% of the original. Enhancement algorithm after optimization to reduce the amount of data fusion in the processing of video is used to reduce the fusion time and watching effect is improved. Experimental results show that the system can capture images in near distance, output red-blue 3D video and presents the nice experiences to the audience wearing red-blue glasses.
Flipped SU(5)xU(1){sub X} models from F-theory
Energy Technology Data Exchange (ETDEWEB)
Jiang Jing [Department of Physics, University of Wisconsin, Madison, WI 53706 (United States); Li Tianjun, E-mail: tjli@physics.rutgers.ed [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Key Laboratory of Frontiers in Theoretical Physics, Institute of Theoretical Physics, Chinese Academy of Sciences, Beijing 100190 (China); Nanopoulos, Dimitri V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Astroparticle Physics Group, Houston Advanced Research Center (HARC), Mitchell Campus, Woodlands, TX 77381 (United States); Academy of Athens, Division of Natural Sciences, 28 Panepistimiou Avenue, Athens 10679 (Greece); Xie Dan [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)
2010-05-01
We systematically construct flipped SU(5)xU(1){sub X} models without and with bulk vector-like particles from F-theory. To realize the decoupling scenario, we introduce sets of vector-like particles in complete SU(5)xU(1) multiplets at the TeV scale, or at the intermediate scale, or at the TeV scale and high scale. To avoid the Landau pole problem for the gauge couplings, we can only introduce five sets of vector-like particles around the TeV scale. These vector-like particles can couple to the Standard Model singlet fields, and obtain suitable masses by Higgs mechanism. We study gauge coupling unification in detail. We show that the U(1){sub X} flux contributions to the gauge couplings preserve the SU(5)xU(1){sub X} gauge coupling unification. We calculate the SU(3){sub C}xSU(2){sub L} unification scales, and the SU(5)xU(1){sub X} unification scales and unified couplings. In most of our models, the high-scale or bulk vector-like particles can be considered as string-scale threshold corrections since their masses are close to the string scale. Furthermore, we discuss the phenomenological consequences of our models. In particular, in the models with TeV-scale vector-like particles, the vector-like particles can be observed at the Large Hadron Collider, the proton decay is within the reach of the future Hyper-Kamiokande experiment, the lightest CP-even Higgs boson mass can be increased, the hybrid inflation can be naturally realized, and the correct cosmic primordial density fluctuations can be generated.
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Valuation of a remainder interest in property... § 1.642(c)-6 Valuation of a remainder interest in property transferred to a pooled income fund. (a) In... transferred property on the valuation date. The fact that the income beneficiary may not receive the last...
The analysis of the neutron flux of n_TOF (in EAR1) revealed an anomaly in the 10-30 keV neutron energy range. While the flux extracted on the basis of the $^{6}$Li(n,t)$^{4}$He and $^{10}$B(n,$\\alpha$)$^{7}$Li reactions mostly agreed with each other and with the results of FLUKA simulations of the neutron beam, the one based on the $^{235}$U(n,f) reaction was found to be systematically lower, independently of the detection system used. A possible explanation is that the $^{235}$U(n,f) crosssection in that energy region, where in principle should be known with an uncertainty of 1%, may be systematically overestimated. Such a finding, which has a negligible influence on thermal reactors, would be important for future fast critical or subcritical reactors. Furthermore, its interest is more general, since the $^{235}$U(n,f) reaction is often used at that energy to determine the neutron flux, or as reference in measurements of fission cross section of other actinides. We propose to perform a high-accuracy, high-r...
U.S. Cavalry: Still Relevant in Full Spectrum Operations
2010-05-21
major railway line 51 Jonathean Gawne, The Americans in Brittany, 1944: The Battle for Brest . ( Paris : Historie & Collections, 2002), 19. 52 Gawne. The...Jonathean. The Americans in Brittany, 1944: The Battle for Brest . Paris , FR: Historie & Collections, 2002. Gillie, Mildred H. Forging the Thunderbolt...traversed the northern coast.54 This rail line was crucial to improving Allied communication between Brest and Rennes and supporting the advance of
Analysis list: E2f4 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available E2f4 Blood,Embryonic fibroblast,Liver,Muscle,Pluripotent stem cell + mm9 http://dba...rchive.biosciencedbc.jp/kyushu-u/mm9/target/E2f4.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/E2f4....5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/E2f4.10.tsv http://dbarchive.biosciencedbc....jp/kyushu-u/mm9/colo/E2f4.Blood.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/E2f4....Embryonic_fibroblast.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/E2f4.Liver.tsv,htt
Analysis list: E2f1 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available E2f1 Blood,Liver + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/E2f1.1....tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/E2f1.5.tsv http://dbarchive.biosciencedbc.jp/kyus...hu-u/mm9/target/E2f1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/E2f1.Blood.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/E2f1.Liver.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Blood.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Liver.gml ...
^2H(^18F,p)^19F Study at 6 MeV/u
Kozub, R. L.; Nesaraja, C. D.; Moazen, B. H.; Scott, J. P.; Bardayan, D. W.; Blackmon, J. C.; Gross, C. J.; Shapira, D.; Smith, M. S.; Batchelder, J. C.; Brune, C. R.; Champagne, A. E.; Sahin, L.; Cizewski, J. A.; Thomas, J. S.; Davinson, T.; Woods, P. J.; Greife, U.; Jewett, C.; Livesay, R. J.; Ma, Z.; Parker, P. D.
2003-04-01
The degree to which the (p,α) and (p,γ) reactions destroy ^18F at temperatures ˜1-4 x 10^8 K is important for understanding the synthesis of nuclei in nova explosions and for using ^18F as a monitor of nova mechanisms in gamma ray astronomy. The reactions are dominated by low-lying proton resonances near the ^18F+p threshold (E_x=6.411 MeV excitation energy in ^19Ne). To gain further information about these resonances, we have used the inverse ^18F(d,p)^19F neutron transfer reaction at the Holifield Radioactive Ion Beam Facility to selectively populate corresponding mirror states in ^19F. Proton angular distributions were measured for states in ^19F in the excitation energy range 0-9 MeV. Results and implications for the ^18F+p reactions and nuclear structure will be presented. ^1Supported by DOE. ^2ORNL is managed by UT-Battelle, LLC, for the USDOE.
Vanham, D; Hoekstra, A Y; Wada, Y; Bouraoui, F; de Roo, A; Mekonnen, M M; van de Bund, W J; Batelaan, O; Pavelic, P; Bastiaanssen, W G M; Kummu, M; Rockström, J; Liu, J; Bisselink, B; Ronco, P; Pistocchi, A; Bidoglio, G
2018-02-01
Target 6.4 of the recently adopted Sustainable Development Goals (SDGs) deals with the reduction of water scarcity. To monitor progress towards this target, two indicators are used: Indicator 6.4.1 measuring water use efficiency and 6.4.2 measuring the level of water stress (WS). This paper aims to identify whether the currently proposed indicator 6.4.2 considers the different elements that need to be accounted for in a WS indicator. WS indicators compare water use with water availability. We identify seven essential elements: 1) both gross and net water abstraction (or withdrawal) provide important information to understand WS; 2) WS indicators need to incorporate environmental flow requirements (EFR); 3) temporal and 4) spatial disaggregation is required in a WS assessment; 5) both renewable surface water and groundwater resources, including their interaction, need to be accounted for as renewable water availability; 6) alternative available water resources need to be accounted for as well, like fossil groundwater and desalinated water; 7) WS indicators need to account for water storage in reservoirs, water recycling and managed aquifer recharge. Indicator 6.4.2 considers many of these elements, but there is need for improvement. It is recommended that WS is measured based on net abstraction as well, in addition to currently only measuring WS based on gross abstraction. It does incorporate EFR. Temporal and spatial disaggregation is indeed defined as a goal in more advanced monitoring levels, in which it is also called for a differentiation between surface and groundwater resources. However, regarding element 6 and 7 there are some shortcomings for which we provide recommendations. In addition, indicator 6.4.2 is only one indicator, which monitors blue WS, but does not give information on green or green-blue water scarcity or on water quality. Within the SDG indicator framework, some of these topics are covered with other indicators. Copyright © 2017 The Authors
Organometallic chemistry of the f-elements: toward new development: cyanide ligand of f-elements
International Nuclear Information System (INIS)
Herve, Alexandre
2014-01-01
The cyanide ligand is one of the most widely used ligands in coordination chemistry of d-transition metals. The low number of cyanide complexes of lanthanides and actinides incited us to develop this field for reactivity and theoretical aspects, and also for their potentially interesting physicochemical properties. In this Ph.D., we investigated the reactivity of [An(Cot) 2 ] (An = Th, U ; Cot = C 8 H 8 2- ) and [M f (N*) 3 ] q+ (q = 0, 1; M f = Ce, U ; N* = -N(SiMe 3 ) 2 ) precursors toward the cyanide ion. The first chapter is dedicated to the synthesis and characterization of trivalent f-elements cyanide complexes [M f (N*) 3 (CN)][M], [M f (N*) 3 (CN) 2 ][M] 2 et [M f (N*) 2 (CN) 3 ][M] 2 and the cyanido-bridged binuclear compounds [{M f (N*) 3 } 2 (μ-CN)][M] (M = NR 4 , K(18-C-6)). Crystals of the bis(cyanido) uranium and cerium complexes are not isostructural since the data revealed distinct coordination modes of the CN group, through the C or N atom to the U 3+ or Ce 3+ metal center, respectively. In chapter 2, the novel silyl-amide uranium(IV) precursor [U(N*) 3 ][BPh 4 ] has been isolated, and proved to be useful for the synthesis of the cationic species [{U(N*) 3 } 2 (μ-CN)][BPh 4 ] and the neutral monocyanide [M f (N*) 3 (CN)] and anionic bis(cyanide) [M f (N*) 3 (CN) 2 ][M] derivatives. Here again, the X-ray data reveal the uncommon N coordination mode of the CN group to the U(IV) center. This global differentiation has been analyzed using density functional theory calculations. The observed preferential coordination of the cyanide ion in Ce(III)-NC, U(III)-CN and U(IV)-NC is corroborated by energetic considerations and by the comparison of DFT optimized geometries with the true crystal structures. Finally, the recent discovery of the first bent 'uranocene' species, eg [U(Cot) 2 (CN)] - , led us to compare the reactivity of the actinocenes [An(Cot) 2 ] (Th, U) in order to understand the effect of the metal electron configuration
International Nuclear Information System (INIS)
Clark, D.L.; Batista, E.R.; Boland, K.S.
2010-01-01
We have employed Cl K-edge XAS and multiple levels of sophisticated electronic structure calculations on a series of simple octahedral light actinide (Th, U, Np, Pu) chloride salts, AnCl 6 n- in order to assess the relative roles of the valence 5f and 6d orbitals in chemical bonding. Chlorine K-edge X-ray absorption spectroscopy on AnCl 6 n- (An = Th, U, Np, Pu) systems indicates the presence of covalent interactions between both Cl 3p and An 5f and 6d orbitals, with the relative contributions changing across the series. Electronic structure calculations indicate the predominant covalent interactions are expected to occur through An-Cl bonding via t 1u and t 2u interactions with the An 5f orbitals, and through t 2g and e g interactions with An 6d orbitals. For the Cl K-edge data therefore, we expect bound state transitions from Cl 1s → e g (σ), t 2g (π), and t 1u (σ + π) orbitals. Qualitatively, the Cl K-edge data fulfills these expectations
A Full Overhead Cost Model for the U.S. Coast Guard Yard, Curtis Bay, Maryland.
1982-06-01
80.0 STORAGE SHED B 43 A 35000.50 700.00 B 50 I IMPROVE SHINGLES 1750.43 40.70 B 75 I RELOCTE FLAMB STOR 22432.18 1246.23 81.0 FLAMABLE STORAGE B 43 A...35000.50 700.00 B 45 I UNKWN IMPRVMNT 50.48 1.04 B 50 I IMPROVE SHINGLES 1750.43 40.70 B 75 I RELOCTE FLAMB STOR 22432.18 1246.22 85.0 STORAGE SHED B
International Nuclear Information System (INIS)
Berg, M.S. van den.
1995-01-01
Thermodynamic parameters and transport coefficients have been calculated for a multicomponent reacting U-C-F gas mixture in the steady flow gaseous core fission reactor. Element abundances are consistent with thermodynamic equilibrium between the gas mixture and a cooled solid graphite wall at 2500 K. Results are presented for various pressures, a fluorine potential of 5.6 and temperatures between 2500 and 7000 K. As a result of dissociation processes of uranium and carbon fluoride compounds, ''effective'' values of thermodynamic parameters and transport coefficients show anomalous behaviour with respect to so-called ''frozen'' values. The chemical reaction energy of the U-C-F gas mixture has been calculated as the driving-force behind the process of fuel redistribution to attain criticality conditions inside a functioning reactor. (author)
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Valuation of a remainder interest in property..., Trusts, and Beneficiaries § 1.642(c)-6T Valuation of a remainder interest in property transferred to a...) through (c). (d) Valuation. The present value of the remainder interest in property transferred to a...
2013-02-28
..., Environmental Protection and Performance Assessment Directorate, Division of Waste Management and Environmental... CONTACT: Harry Felsher, Office of Federal and State Materials and Environmental Management Programs, U.S... Technical Evaluation Report (TER) for the F-Area Tank Farm Facility in October 2011, as part of the NRC...
Hublin, Jean-Jacques; Talamo, Sahra; Julien, Michèle; David, Francine; Connet, Nelly; Bodu, Pierre; Vandermeersch, Bernard; Richards, Michael P.
2012-01-01
The transition from the Middle Paleolithic (MP) to Upper Paleolithic (UP) is marked by the replacement of late Neandertals by modern humans in Europe between 50,000 and 40,000 y ago. Châtelperronian (CP) artifact assemblages found in central France and northern Spain date to this time period. So far, it is the only such assemblage type that has yielded Neandertal remains directly associated with UP style artifacts. CP assemblages also include body ornaments, otherwise virtually unknown in the Neandertal world. However, it has been argued that instead of the CP being manufactured by Neandertals, site formation processes and layer admixture resulted in the chance association of Neanderthal remains, CP assemblages, and body ornaments. Here, we report a series of accelerator mass spectrometry radiocarbon dates on ultrafiltered bone collagen extracted from 40 well-preserved bone fragments from the late Mousterian, CP, and Protoaurignacian layers at the Grotte du Renne site (at Arcy-sur-Cure, France). Our radiocarbon results are inconsistent with the admixture hypothesis. Further, we report a direct date on the Neandertal CP skeleton from Saint-Césaire (France). This date corroborates the assignment of CP assemblages to the latest Neandertals of western Europe. Importantly, our results establish that the production of body ornaments in the CP postdates the arrival of modern humans in neighboring regions of Europe. This new behavior could therefore have been the result of cultural diffusion from modern to Neandertal groups. PMID:23112183
Hublin, Jean-Jacques; Talamo, Sahra; Julien, Michèle; David, Francine; Connet, Nelly; Bodu, Pierre; Vandermeersch, Bernard; Richards, Michael P
2012-11-13
The transition from the Middle Paleolithic (MP) to Upper Paleolithic (UP) is marked by the replacement of late Neandertals by modern humans in Europe between 50,000 and 40,000 y ago. Châtelperronian (CP) artifact assemblages found in central France and northern Spain date to this time period. So far, it is the only such assemblage type that has yielded Neandertal remains directly associated with UP style artifacts. CP assemblages also include body ornaments, otherwise virtually unknown in the Neandertal world. However, it has been argued that instead of the CP being manufactured by Neandertals, site formation processes and layer admixture resulted in the chance association of Neanderthal remains, CP assemblages, and body ornaments. Here, we report a series of accelerator mass spectrometry radiocarbon dates on ultrafiltered bone collagen extracted from 40 well-preserved bone fragments from the late Mousterian, CP, and Protoaurignacian layers at the Grotte du Renne site (at Arcy-sur-Cure, France). Our radiocarbon results are inconsistent with the admixture hypothesis. Further, we report a direct date on the Neandertal CP skeleton from Saint-Césaire (France). This date corroborates the assignment of CP assemblages to the latest Neandertals of western Europe. Importantly, our results establish that the production of body ornaments in the CP postdates the arrival of modern humans in neighboring regions of Europe. This new behavior could therefore have been the result of cultural diffusion from modern to Neandertal groups.
Directory of Open Access Journals (Sweden)
Bojan Goja
2014-12-01
Full Text Available U franjevačkom samostanu Sv. Duje u Kraju na otoku Pašmanu čuva se inkunabula „O državi Božjoj“ (De Civitate Dei Sv. Aurelija Augustina koju je 1475. godine u Veneciji tiskao Nicolas Jenson. Inkunabula je na f. 17 (kako je naknadno označena paginacija grafitnom olovkom, tj. stranici incipita – liber primus kao i na više drugih stranica ukrašena lijepim višebojnim iluminacijama renesansnih stilskih karakteristika izrađenih temperom, zlatnim listićima, zlatnim prahom, sepijom, tintom i akvarelom. Iluminacije f. 17 sastoje se od dva fitomorfna inicijala, dekorativnog okvira i slobodnih figurativnih prizora tj. minijatura, dok su pojedine druge stranice ukrašene fitomorfnim i brojnim inicijala tipa littera notabilior visine dva retka izrađenima u crvenoj ili plavoj boji. Dekorativni ornamentirani okvir zaključen trolistima ispunjava gornju i lijevu marginu početne stranice. Osnovu dekoracije čini traka sastavljena od pet tankih linija koja se spiralno povija i tvori kružnice koje su ispunjene cvjetovima, listovima i bobicama u plavoj i zelenoj boji i boji ciklame te stiliziranim zlatnim cvjetovima čička (lat. Arctium lappa; pojedini autori nazivaju ove ukrasne motive bottoni dorati ili gold dots. U gornjem lijevom uglu okvira naslikan je češljugar. Na mjestu gdje započinje tekst lijevog stupca naslikan je unutar pravokutnog polja na zlatnoj pozadini inicijal „I“ sastavljen od fitomorfnih motiva plave, zelene i boje ciklame s osjenčanjima u različitim nijansama. Unutar dekorativnog okvira, na sredini visine inicijala, nalazi se medaljon unutar kojeg je naslikano poprsje Sv. Aurelija Augustina. Dekorativni ornamentirani okvir koji ispunjava gornju marginu ukrašen je na isti način kao i onaj uz desnu ali skromnije. Ime tiskara dodatno je naznačeno tako da je sa gornje i donje strane okvira ukrašeno sa po jednim stiliziranim zlatnim cvijetom čička sa gornje i češljugovine (lat. Dipsacus fullonum sa donje strane
Study of 234U(n,f) Resonances Measured at the CERN n_TOF Facility
Leal-Cidoncha, E; Paradela, C; Tarrío, D; Leong, L S; Audouin, L; Tassan-Got, L; Praena, J; Berthier, B; Ferrant, L; Isaev, S; Le Naour, C; Stephan, C; Trubert, D; Abbondanno, U; Aerts, G; Álvarez, H; Álvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Badurek, G; Baumann, P; Bečvář, F; Berthoumieux, E; Calviño, F; Calviani, M; Cano-Ott, D; Capote, R; Carrapiço, C; Cennini, P.; Chepel, V; Chiaveri, E.; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S.; Dillmann, I; Domingo-Pardo, C; Dridi, W; Eleftheriadis, C; Embid-Segura, M; Ferrari, A.; Ferreira-Marques, R; Fujii, K; Furman, W; Gonçalves, I; González-Romero, E; Gramegna, F; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A.; Igashira, M; Jericha, E; Kadi, Y.; Käppeler, F; Karadimos, D; Kerveno, M; Koehler, P; Kossionides, E; Krtička, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Martínez, T; Massimi, C; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O'Brien, S; Oshima, M; Pancin, J; Papadopoulos, C; Pavlik, A; Pavlopoulos, P.; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Pretel, C; Quesada, J; Rauscher, T.; Reifarth, R; Rubbia, C.; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L.; Savvidis, I; Tagliente, G; Tain, J L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A.; Villamarin, D; Vincente, M C; Vlachoudis, V.; Vlastou, R; Voss, F; Walter, S; Wiescher, M; Wisshak, K
2014-01-01
We present the analysis of the resolved resonance region for the U-234(n,f) cross section data measured at the CERN n\\_TOF facility. The resonance parameters in the energy range from 1 eV to 1500 eV have been obtained with the SAMMY code by using as initial parameters for the fit the resonance parameters of the JENDL-3.3 evaluation. In addition, the statistical analysis has been accomplished, partly with the SAMDIST code, in order to study the level spacing and the Mehta-Dyson correlation.
Modak, P; Verma, Ashok K
2016-03-28
Pressure induced structural sequences and their mechanism for light actinide (Th-U) mononitrides were studied as a function of 5f-electron number using first-principles total energy and electronic structure calculations. Zero pressure lattice constants, bulk module and C11 elastic module vary systematically with 5f-electron number implying its direct role on crystal binding. There is a critical 5f-electron number below which the system makes B1-B2 and above it B1-R3̄m-B2 structural sequence under pressure. Also, the B1-B2 transition pressure increases with increasing 5f-electron number whereas an opposite trend is obtained for the B1-R3̄m transition pressure. The ascending of N p anti-bonding states through the Fermi level at high pressure is responsible for the structural instability of the system. Above the critical 5f-electron number in the system a narrow 5f-band occurs very close to the Fermi level which allows the system to lower its symmetry via band Jahn-Teller type lattice distortion and the system undergoes a B1-R3̄m phase transition. However, below the critical 5f-electron number this mechanism is not favorable due to a lack of sufficient 5f-state occupancy and thus the system undergoes a B1-B2 phase transition like other ionic solids.
Dicty_cDB: Contig-U16581-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 915_913( CP000915 |pid:none) Francisella tularensis subsp. me... 174 1e-41 AP008232_642( AP008232 |pid:none) Sodalis glossini...( FM992690 |pid:none) Candida dubliniensis CD36 chromo... 227 9e-58 (Q9Y7F0) RecName: Full=Peroxiredoxin TSA...9( CP000148 |pid:none) Geobacter metallireducens GS-15... 199 3e-49 AY842247_1( AY842247 |pid:none) Leishmania amazonensi...2e-48 AE001363_758( AE001363 |pid:none) Chlamydophila pneumoniae CWL029,... 196 2e-48 CP001071_1298( CP001071 |pid:none) Akkermansi...none) Helicobacter pylori isolate HP52 a... 169 3e-40 CU468135_2542( CU468135 |pid:none) Erwinia tasmaniensi
Measurements of the {sup 235}U(n,f) cross section in the 3 to 30 MeV neutron energy region
Energy Technology Data Exchange (ETDEWEB)
Carlson, A.D.; Wasson, O.A. [National Institute of Standards and Technology, Gaithersburg, MD (United States); Lisowski, P.W. [Los Alamos National Lab., NM (United States)] [and others
1991-12-31
To improve the accuracy of the {sup 235}U(n,f) cross section, measurements have been made of this standard cross section at the target 4 facility at Los Alamos National Laboratory (LANL). The data were obtained at the 20-meter flight path of that facility. The fission reaction rate was determined with a fast parallel plate ionization chamber and the neutron fluence was measured with an annular proton recoil telescope. The measurements provide the shape of the {sup 235}U(n,f) cross section relative to the hydrogen scattering cross section for neutron energies from about 3 to 30 MeV neutron energy. The data have been normalized to the very accurately known value near 14 MeV. The results are in good agreement with the ENDF/B-VI evaluation up to about 15 MeV neutron energy. Above this energy differences as large as 5% are observed.
F4U production by electrolytic reduction
International Nuclear Information System (INIS)
Esteban Duque, A.; Gispert Benach, M.; Hernandez Arroyo, F.; Montes Ponce de Leon, M.; Rojas de Diego, J. L.
1974-01-01
As a part of the nuclear fuel cycle program developed at the Spanish Atomic Energy Commission it has been studied the electrolytic reduction of U-VI to U-IV. The effect of the materials, electrolyte concentration, pH, current density, cell size and laboratory scale production is studied. The Pilot Plant and the production data are also described. (Author) 18 refs
Localization in f-shell metals
International Nuclear Information System (INIS)
Harrison, W.A.
1984-01-01
Anderson's theory of local moments is applied to the f-shell metals with the use of parameters for the electronic structure given earlier. A criterion for localization (abrupt in this theory) of Z/sub f/ levels per atom is that the resonance width be less than 2U sin 2 (πZ/sub f//14), with U the intra-atomic repulsion associated with s-f transfer. Americium and the heavier actinides satisfy this criterion, as do all the rare earths except cerium; plutonium is borderline. The traditional term ''localized state'' is used here though ''correlated state'' would be more appropriate. For the cases considered the localized states are found to have net spin (or moment) but that is not a necessary condition. They are found to contribute to the f-band pressure on the crystal, but reduced by a factor of about W/sub f//3U, equal to 0.09 for americium, where W/sub f/ is the itinerant f-band width. The localized f levels may themselves be thought to form bands, but with reduced width, and they may even have Fermi surface, though that was not found for the systems considered. A comparison of this state with band ferromagnetism is made. An approximate calculation of the total energy of the localized and delocalized states as a function of volume correctly predicted the large volume and localization for americium
Surrogate measurement of the 238Pu(n,f) cross section
International Nuclear Information System (INIS)
Ressler, J. J.; Burke, J. T.; Escher, J. E.; Bernstein, L. A.; Bleuel, D. L.; Casperson, R. J.; Gostic, J.; Henderson, R.; Scielzo, N. D.; Thompson, I. J.; Wiedeking, M.; Angell, C. T.; Goldblum, B. L.; Munson, J.; Basunia, M. S.; Phair, L. W.; Beausang, C. W.; Hughes, R. O.; Hatarik, R.; Ross, T. J.
2011-01-01
The neutron-induced fission cross section of 238 Pu was determined using the surrogate ratio method. The (n,f) cross section over an equivalent neutron energy range 5-20 MeV was deduced from inelastic α-induced fission reactions on 239 Pu, with 235 U(α,α ' f) and 236 U(α,α ' f) used as references. These reference reactions reflect 234 U(n,f) and 235 U(n,f) yields, respectively. The deduced 238 Pu(n,f) cross section agrees well with standard data libraries up to ∼10 MeV, although larger values are seen at higher energies. The difference at higher energies is less than 20%.
Band structures of 4f and 5f materials studied by angle-resolved photoelectron spectroscopy.
Fujimori, Shin-ichi
2016-04-20
Recent remarkable progress in angle-resolved photoelectron spectroscopy (ARPES) has enabled the direct observation of the band structures of 4f and 5f materials. In particular, ARPES with various light sources such as lasers (hν ~ 7 eV) or high-energy synchrotron radiations (hν >/~ 400 eV) has shed light on the bulk band structures of strongly correlated materials with energy scales of a few millielectronvolts to several electronvolts. The purpose of this paper is to summarize the behaviors of 4f and 5f band structures of various rare-earth and actinide materials observed by modern ARPES techniques, and understand how they can be described using various theoretical frameworks. For 4f-electron materials, ARPES studies of CeMIn5(M = Rh, Ir, and Co) and YbRh2Si2 with various incident photon energies are summarized. We demonstrate that their 4f electronic structures are essentially described within the framework of the periodic Anderson model, and that the band-structure calculation based on the local density approximation cannot explain their low-energy electronic structures. Meanwhile, electronic structures of 5f materials exhibit wide varieties ranging from itinerant to localized states. For itinerant U5f compounds such as UFeGa5, their electronic structures can be well-described by the band-structure calculation assuming that all U5f electrons are itinerant. In contrast, the band structures of localized U5f compounds such as UPd3 and UO2 are essentially explained by the localized model that treats U5f electrons as localized core states. In regards to heavy fermion U-based compounds such as the hidden-order compound URu2Si2, their electronic structures exhibit complex behaviors. Their overall band structures are generally well-explained by the band-structure calculation, whereas the states in the vicinity of EF show some deviations due to electron correlation effects. Furthermore, the electronic structures of URu2Si2 in the paramagnetic and hidden-order phases are
Analysis of U-47700, a Novel Synthetic Opioid, in Human Urine by LC-MS-MS and LC-QToF.
Fleming, Steven W; Cooley, Justin C; Johnson, Leonard; Frazee, C Clinton; Domanski, Kristina; Kleinschmidt, Kurt; Garg, Uttam
2017-04-01
The illicit drug market has rapidly evolved from synthetic cannabinoids to cathinone derivatives and now a new emerging threat of synthetic opioids. These compounds were mostly developed by pharmaceutical companies during drug discovery. The new psychoactive substances are not routinely covered in drug screening and may go undetected. Recently fentanyl analogous, AH-7921, MT-45 and now U-47700 have been encountered in clinical and forensic casework. U-47700 is gaining popularity on drug user forms as a legal alternative to heroin. It is a µ-receptor agonist that is part of the trans-1-2-diamine opioid analgesic drug class developed by The Upjohn Company in an attempt to develop a non-addicting analgesic. A LC-MS-MS method was developed and validated to detect and quantify U-47700. Additional analysis was conducted with an LC-QToF to identify the presence of the parent drug and metabolites. A total of four cases have been evaluated by the LC-MS-MS methodology which has an analytical range of 1-1,250 ng/mL and limit of detection of 1 ng/mL. The concentration of U-47700 in urine specimens ranged from below the limit of quantification to 224 ng/mL. The ToF analysis detected the presence of suspected phase I demethylated metabolites that may assist future analysis of this compound. The prevalence of designer opioids in casework highlights the importance of analysis for new psychoactive substances. Traditional opiates/opioids were not detected in the presented cases, but the available case histories revealed an opioid toxidrome. These findings suggest that U-47700 drug may cause significant morbidity and mortality within the United States as an emerging drug threat. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Vanham, D.; Hoekstra, A. Y.; Wada, Y.; Bouraoui, F.; de Roo, A.; Mekonnen, M. M.; van de Bund, W. J.; Batelaan, O.; Pavelic, P.; Bastiaanssen, Wim G M; Kummu, M.; Rockström, J.; Liu, J.; Bisselink, B.; Ronco, P.; Pistocchi, A.; Bidoglio, G.
2018-01-01
Target 6.4 of the recently adopted Sustainable Development Goals (SDGs) deals with the reduction of water scarcity. To monitor progress towards this target, two indicators are used: Indicator 6.4.1 measuring water use efficiency and 6.4.2 measuring the level of water stress (WS). This paper aims to
Dicty_cDB: Contig-U02384-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 143 ) Haemophilus ducreyi strain 35000HP complete genome. 46 1.9 1 ( FG294264 ) 1108770706308 New World Scre...wworm Larvae 9387 EST... 36 2.0 3 ( FG299783 ) 1108793347126 New World Screwworm
Higham, Thomas; Jacobi, Roger; Julien, Michèle; David, Francine; Basell, Laura; Wood, Rachel; Davies, William; Ramsey, Christopher Bronk
2010-11-23
There is extensive debate concerning the cognitive and behavioral adaptation of Neanderthals, especially in the period when the earliest anatomically modern humans dispersed into Western Europe, around 35,000-40,000 B.P. The site of the Grotte du Renne (at Arcy-sur-Cure) is of great importance because it provides the most persuasive evidence for behavioral complexity among Neanderthals. A range of ornaments and tools usually associated with modern human industries, such as the Aurignacian, were excavated from three of the Châtelperronian levels at the site, along with Neanderthal fossil remains (mainly teeth). This extremely rare occurrence has been taken to suggest that Neanderthals were the creators of these items. Whether Neanderthals independently achieved this level of behavioral complexity and whether this was culturally transmitted or mimicked via incoming modern humans has been contentious. At the heart of this discussion lies an assumption regarding the integrity of the excavated remains. One means of testing this is by radiocarbon dating; however, until recently, our ability to generate both accurate and precise results for this period has been compromised. A series of 31 accelerator mass spectrometry ultrafiltered dates on bones, antlers, artifacts, and teeth from six key archaeological levels shows an unexpected degree of variation. This suggests that some mixing of material may have occurred, which implies a more complex depositional history at the site and makes it difficult to be confident about the association of artifacts with human remains in the Châtelperronian levels.
Multiplicity and energy of neutrons from {sup 233}U(n{sub th},f) fission fragments
Energy Technology Data Exchange (ETDEWEB)
Nishio, Katsuhisa; Kimura, Itsuro; Nakagome, Yoshihiro [Kyoto Univ. (Japan)
1998-03-01
The correlation between fission fragments and prompt neutrons from the reaction {sup 233}U(n{sub th},f) was measured with improved accuracy. The results determined the neutron multiplicity and emission energy as a function of fragment mass and total kinetic energy. The average energy as a function of fragment mass followed a nearly symmetric distribution centered about the equal mass-split and formed a remarkable contrast with the saw-tooth distribution of the average neutron multiplicity. The neutron multiplicity from the specified fragment decreases linearly with total kinetic energy, and the slope of multiplicity with kinetic energy had the minimum value at about 130 u. The level density parameter versus mass determined from the neutron data showed a saw-tooth structure with the pronounced minimum at about 128 and generally followed the formula by Gilbert and Cameron, suggesting that the neutron emission process was very much affected by the shell-effect of the fission fragment. (author)
The factorized F-matrices for arbitrary U(1)(N-1) integrable vertex models
International Nuclear Information System (INIS)
Martins, M.J.; Pimenta, R.A.; Zuparic, M.
2012-01-01
We discuss the F-matrices associated to the R-matrix of a general N-state vertex model whose statistical configurations encode N-1U(1) symmetries. The factorization condition is shown for arbitrary weights being based only on the unitarity property and the Yang-Baxter relation satisfied by the R-matrix. Focusing on the N=3 case we are able to conjecture the structure of some relevant twisted monodromy matrix elements for general weights. We apply this result providing the algebraic expressions of the domain wall partition functions built up in terms of the creation and annihilation monodromy fields. For N=3 we also exhibit a R-matrix whose weights lie on a del Pezzo surface and have a rather general structure.
Electrochemical separation of uranium in the molten system LiF-NaF-KF-UF4
Korenko, M.; Straka, M.; Szatmáry, L.; Ambrová, M.; Uhlíř, J.
2013-09-01
This article is focused on the electrochemical investigation (cyclic voltammetry and related studies) of possible reduction of U4+ ions to metal uranium in the molten system LiF-NaF-KF(eut.)-UF4 that can provide basis for the electrochemical extraction of uranium from molten salts. Two-step reduction mechanism for U4+ ions involving one electron exchange in soluble/soluble U4+/U3+ system and three electrons exchange in the second step were found on the nickel working electrode. Both steps were found to be reversible and diffusion controlled. Based on cyclic voltammetry, the diffusion coefficients of uranium ions at 530 °C were found to be D(U4+) = 1.64 × 10-5 cm2 s-1 and D(U3+) 1.76 × 10-5 cm2 s-1. Usage of the nickel spiral electrode for electrorefining of uranium showed fairly good feasibility of its extraction. However some oxidant present during the process of electrorefining caused that the solid deposits contained different uranium species such as UF3, UO2 and K3UO2F5.
International Nuclear Information System (INIS)
Iizuka, Tsuyoshi; Hirata, Takafumi
2004-01-01
Using a laser-ablation-inductively coupled plasma mass spectrometer (LA-ICPMS), U-Pb age and rare earth element (REE) abundances have been determined simultaneously from a single 20 μm ablation pit of zircon. The laser ablation system utilizing 193 nm wave-length ArF excimer laser produces stable and reproducible signal intensities resulted in good precisions on measurements of element concentrations and isotopic ratios. Because of the higher energy density of the deep ultra-violet laser beam, ablation fractionation between Pb and U were reduced even with the prolonged ablation, and thus accuracy of Pb-U age was improved significantly. A chicane-type ion lens system was applied to a quadrupole-based ICPMS instrument. With the chicane ion lens, higher elemental sensitivity (4 times or light mass range and 3 times for mid to heavy mass range) and lower white background ( 238 U- 206 Pb ages for Nancy standard zircon (Nancy 91500), SHRIMP calibration standard zircon (SL13) and Antarctic zircon (PMA7) obtained in this study were 1064 ± 24 Ma, 569 ± 78 Ma and 2438 ± 101 Ma (2-sigma), respectively. Relative age differences from previous reports were 0.2%, 0.4% and 3.2% respectively, demonstrative of high reliability of the method. The REE abundances in zircon samples were calibrated using a NIST 610 glass standard reference material. The resulting REE abundance data for zircons (Nancy 91500 and SL13) show good agreement with those for literature values within the analytical precision of ∼20%. The matrix effect that may occur between the synthetic glass standard and zircon crystals is obviously smaller than the precision and thus negligible for this precision levels. The data presented here demonstrate clearly that the combination of ArF excimer laser an ICPMS equipped with the chicane ion lens has a potential to become a significant tool for zircon geochemistry. (author)
Directory of Open Access Journals (Sweden)
Hamel Olivier
2001-11-01
Full Text Available A l’époque de la mise en œuvre des grands programmes de développement des cultures pérennes, les situations politiques, économiques et structurelles étaient fondamentalement différentes de celles qui existent aujourd’hui. Ces programmes répondaient principalement à une préoccupation de développement économique des États en privilégiant l’entrée des cultures de rente agro-forestières. Sans être au centre des préoccupations, les populations locales devaient bénéficier, par contrecoup, des retombées de la santé économique des planteurs et des firmes utilisatrices. À cette époque, la forêt était perçue comme un espace infini, un bien inépuisable; les marchés étaient en pleine expansion et disposaient de mécanismes de régulation ; les capitaux privés bénéficiaient de conditions avantageuses et l’aide publique au développement progressait. Durant les 25 dernières années, et singulièrement dans les 10 dernières, tout a changé : - l’espace est fini et la forêt tropicale est réputée en voie de disparition ; - la libéralisation du commerce et des capitaux ainsi que les politiques de stabilisation macro-économique sont devenues les credo des institutions financières internationales ; - les marchés sont volatiles et dérégulés, les États se sont désengagés ; - l’aide publique au développement s’est effondrée (passant de 32 $/hab. en 1990 à 19 $ aujourd’hui ; - enfin de nouvelles préoccupations environnementales fortes (RIO 1992 encadrées par des engagements conventionnels sont apparues. Dans un tel contexte, les cultures pérennes sont à la croisée des chemins car les nombreuses plantations des années 70-80 doivent être replantées. Ce qui sous-entend des investissements lourds qui, dans la nouvelle approche économique, reposent essentiellement sur les épaules des petits planteurs, sans que la prise de risque soit partagée par l’État. Cette conjoncture d
Development of two U.H.F. band resonators for application to CO2 laser electro-optical modulation
International Nuclear Information System (INIS)
Egan, M.G.; Blanc, P.; Sexton, M.C.
1980-01-01
The purpose of this report is to describe the design and testing of two U.H.F. band resonators destined for use in the linear electro-optical modulator of the CO 2 Laser Rapid Interferometer diagnostic at present under development for the WEGA Tokamak. The resonators take the form of a re-entrant coaxial line cavity and an interdigital line filter, both of which possess the regions of high electric field necessary to activate the linear electro-optical effect
Lin, J.C.; Broecker, W.S.; Hemming, S.R.; Hajdas, I.; Anderson, Robert F.; Smith, G.I.; Kelley, M.; Bonani, G.
1998-01-01
U-Th isochron ages of tufas formed on shorelines suggest that the last pluvial event in Lake Lahontan and Searles Lake was synchronous at about 16,500 cal yr B.P. (equivalent to a radiocarbon age of between 14,000 and 13,500 yr B.P.), whereas the timing of this pluvial event determined by radiocarbon dating is on the order of 1000 yr younger. The timing of seven distinct periods of near desiccation in Searles Lake during late-glacial time has been reinvestigated for U-Th age determination by mass spectrometry. U-Th dating of evaporite layers in the interbedded mud and salt unit called the Lower Salt in Searles Lake was hampered by the uncertainty in assessing the initial 230Th/232Th of the samples. The resulting ages, corrected by a conservative range of initial 230Th/ 232Th ratios, suggest close correlation of the abrupt changes recorded in Greenland ice cores (Dansgaard-Oeschger events) and wet-dry conditions in Searles Lake between 35,000 and 24,000 Cal yr B.P. ?? 1998 University of Washington.
NASA aircraft technician Donte Warren completes placement of the first official U.S. Centennial of F
2002-01-01
NASA aircraft technician Donte Warren completes placement of the first official U.S. Centennial of Flight Commission logo on an aircraft. The honored recipient is NASA Dryden Flight Research Center's Active Aeroelastic Wing (AAW) F/A-18 research aircraft, which is poised to begin wing-warping research flights harkening back to the Wright brothers. The Centennial of Flight Commission was created by the U.S.Congress in 1999 to serve as a national and international source of information about activities to commemorate the centennial of the Wright Brothers' first powered flight on the sands of Kitty Hawk, North Carolina, on December 17, 1903. Centennial activities are scheduled for 2003 in both North Carolina and Dayton, Ohio, home of the Wrights. In addition to these celebrations, numerous historical and educational projects are anticipated on the subject of aviation and aeronautics that will be an important legacy of the centennial of powered flight.
IAEA CIELO Evaluation of Neutron-induced Reactions on 235U and 238U Targets
Capote, R.; Trkov, A.; Sin, M.; Pigni, M. T.; Pronyaev, V. G.; Balibrea, J.; Bernard, D.; Cano-Ott, D.; Danon, Y.; Daskalakis, A.; Goričanec, T.; Herman, M. W.; Kiedrowski, B.; Kopecky, S.; Mendoza, E.; Neudecker, D.; Leal, L.; Noguere, G.; Schillebeeckx, P.; Sirakov, I.; Soukhovitskii, E. S.; Stetcu, I.; Talou, P.
2018-02-01
Evaluations of nuclear reaction data for the major uranium isotopes 238U and 235U were performed within the scope of the CIELO Project on the initiative of the OECD/NEA Data Bank under Working Party on Evaluation Co-operation (WPEC) Subgroup 40 coordinated by the IAEA Nuclear Data Section. Both the mean values and covariances are evaluated from 10-5 eV up to 30 MeV. The resonance parameters of 238U and 235U were re-evaluated with the addition of newly available data to the existing experimental database. The evaluations in the fast neutron range are based on nuclear model calculations with the code EMPIRE-3.2 Malta above the resonance range up to 30 MeV. 235U(n,f), 238U(n,f), and 238U(n,γ) cross sections and 235U(nth,f) prompt fission neutron spectrum (PFNS) were evaluated within the Neutron Standards project and are representative of the experimental state-of-the-art measurements. The Standards cross sections were matched in model calculations as closely as possible to guarantee a good predictive power for cross sections of competing neutron scattering channels. 235U(n,γ) cross section includes fluctuations observed in recent experiments. 235U(n,f) PFNS for incident neutron energies from 500 keV to 20 MeV were measured at Los Alamos Chi-Nu facility and re-evaluated using all available experimental data. While respecting the measured differential data, several compensating errors in previous evaluations were identified and removed so that the performance in integral benchmarks was restored or improved. Covariance matrices for 235U and 238U cross sections, angular distributions, spectra and neutron multiplicities were evaluated using the GANDR system that combines experimental data with model uncertainties. Unrecognized systematic uncertainties were considered in the uncertainty quantification for fission and capture cross sections above the thermal range, and for neutron multiplicities. Evaluated files were extensively benchmarked to ensure good performance in
A note on monotonically star Lindelöf spaces | Song | Quaestiones ...
African Journals Online (AJOL)
A space X is monotonically star Lindelöf if one assign to for each open cover U a subspace s(U) ⊆ X, called a kernel, such that s(U) is a Lindelöf subset of X, and st(s(U); U) = X, and if V renes U then ∪ s(U) ⊆ s(V), where st(s(U); U) = ∪ {U ∈ U : U ∩ s(U) ≠ ∅}. In this paper, we investigate the relationship between ...
Sull’equazione det Du = f senza ipotesi di segno
Directory of Open Access Journals (Sweden)
Giovanni Cupini
2010-12-01
Full Text Available We consider the nonlinear problem det?u (x = f (x x ? u (x = x x ? ? where k ? 1 is an integer, is a bounded smooth domain in Rn and f ? Ck ???? satisfies Zf (x dx = meas. The positivity of f is a standard assumption in the literature. In a recent joint paper with B.Dacorogna and O.Kneuss (EPFL we prove the existence of a solution u ? Ck ???? ;Rn with no assumptions on the sign of f. Here we state this theorem together with some related results and we outline the main features of the problem.
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
LCAE, Département de Chimie, Faculté des Sciences, Université Mohammed Premier, Oujda 60000, Morocco; Institut de Physique de Rennes, UMR 625, Université de Rennes 1, Campus de Beaulieu Bat. 11 A, 263 av. Général Leclerc, 35042 Rennes Cedex, France; Department of Chemistry, University of Science ...
Adducts of UF5 with SbF5 and structure of UF5 . 2SbF5
International Nuclear Information System (INIS)
Sawodny, W.; Rediess, K.
1980-01-01
Both α-UF 5 and β-UF 5 form only a 1:2 compound UF 5 . 2SbF 5 reacting directly with SbF 5 , from which UF 5 . SbF 5 can be obtained by thermal decomposition. UF 5 . 2SbF 5 crystallizes in the monoclinic space group P2 1 /c with the following lattice constants a = 8.110(4), b = 14.129(6), c = 10.032(6) A and β = 96.97(5) 0 ; Z = 4. An X-ray study shows centrosymmetric four-membered rings of alternating UF 8 and SbF 6 polyhedra connected by other SbF 6 entities. This structure is similar to that of UOF 5 . 2SbF 5 , but the distorted pentagonal-bipyramidal coordination of the U atom found there is increased to a dodecahedral coordination by an additional U-F-Sb bridge, though with a somewaht larger UF distance. (author)
Estimation of (n,f) Cross-Sections by Measuring Reaction Probability Ratios
Energy Technology Data Exchange (ETDEWEB)
Plettner, C; Ai, H; Beausang, C W; Bernstein, L A; Ahle, L; Amro, H; Babilon, M; Burke, J T; Caggiano, J A; Casten, R F; Church, J A; Cooper, J R; Crider, B; Gurdal, G; Heinz, A; McCutchan, E A; Moody, K; Punyon, J A; Qian, J; Ressler, J J; Schiller, A; Williams, E; Younes, W
2005-04-21
Neutron-induced reaction cross-sections on unstable nuclei are inherently difficult to measure due to target activity and the low intensity of neutron beams. In an alternative approach, named the 'surrogate' technique, one measures the decay probability of the same compound nucleus produced using a stable beam on a stable target to estimate the neutron-induced reaction cross-section. As an extension of the surrogate method, in this paper they introduce a new technique of measuring the fission probabilities of two different compound nuclei as a ratio, which has the advantage of removing most of the systematic uncertainties. This method was benchmarked in this report by measuring the probability of deuteron-induced fission events in coincidence with protons, and forming the ratio P({sup 236}U(d,pf))/P({sup 238}U(d,pf)), which serves as a surrogate for the known cross-section ratio of {sup 236}U(n,f)/{sup 238}U(n,f). IN addition, the P({sup 238}U(d,d{prime}f))/P({sup 236}U(d,d{prime}f)) ratio as a surrogate for the {sup 237}U(n,f)/{sup 235}U(n,f) cross-section ratio was measured for the first time in an unprecedented range of excitation energies.
2011-01-28
... CONTACT: U.S. Navy F-35C West Coast Homebasing EIS Project Manager; Naval Facilities Engineering Command... (from January 28, 2011 through March 14, 2011). All comments will receive the same attention and... Facilities Engineering Command, Southwest (Code EV21/AK); 1220 Pacific Highway, Bldg. 1, San Diego, CA 92132...
Experimental determination of cesium saturated vapor pressure in the 483/642 deg K temperature
Energy Technology Data Exchange (ETDEWEB)
Gushchin, G I; Subbotin, V A; Khachaturov, Eh Kh [Gosudarstvennyj Komitet po Ispol' zovaniyu Atomnoj Ehnergii SSSR, Obninsk. Fiziko-Ehnergeticheskij Inst.
1975-07-01
Test results of saturated cesium vapour pressure in the temperature range of 483.13-642 deg K and pressure range of 15.77-1.389 N/m/sup 2/ by direct static method are presented. The testing system comprises a differential bellows-type pressure sensor, a thermostatic unit and a gas system with V-shaped oil manometer used for argon-assisted sensor calibration. The static sensor characteristic approaches linearity in the pressure range of 10-600 N/m/sup 2/. The greatest non-linearity is observed at low pressures (10-40 N/m/sup 2/) and does not exceed 3-4%. Sensor sensitivity is 0.39 mV/N/m/sup 2/ in this pressure range. The characteristic hysteresis is 0.5% and below. With pressures greater than 600 N/m/sup 2/, the sensor sensitivity gradually decreases by 12% while the characteristic hysteresis increases to 2-3%. A brief description of the experimental procedure is offered. The present results are compared with other authors' data.
{sup 5}He ternary fission yields of {sup 252}Cf and {sup 235}U(n,f)
Energy Technology Data Exchange (ETDEWEB)
Hwang, J. K. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Ramayya, A. V. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Hamilton, J. H. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Beyer, C. J. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Kormicki, J. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Zhang, X. Q. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Rodin, A. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation); Formichev, A. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation); Kliman, J. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation); Krupa, L. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation)] (and others)
2000-04-01
The relative {sup 4}He and {sup 5}He ternary fission yields were determined from a careful analysis of the energy distribution of {alpha} spectra from a new measurement with a {sup 252}Cf source and from published data on {sup 252}Cf and {sup 235}U(n,f). The kinetic energies of the {sup 5}He and {sup 4}He ternary particles were found to be approximately 11 and 16 MeV, respectively. {sup 5}He particles contribute 10-20 % to the total alpha yield with the remainder originating from {sup 4}He accompanied fission. (c) 2000 The American Physical Society.
International Nuclear Information System (INIS)
Davidovs'kij, V.V.
2000-01-01
The U-matrix method is applied to build the amplitude for virtual photon absorption by nuclei which satisfies unitarity. This amplitude is utilized to obtain the expression for the structure function F 24 , which is convenient to perform analytic calculations. Profile functions of nuclei with the Gauss, Woods-Saxon, and constant density distributions are considered. It is shown that effects of quark-antiquark pair rescattering in a nucleus cause the change of a power-like behavior of F 24 to a logarithmic one at small x. Numerical estimations are given
Rätten till självbestämmande : Samernas rättigheter i samband med mineralutvinning
Lindström, Emelie
2015-01-01
Idag etablerar sig flertalet gruvbolag i Sverige på marker som även är av intresse för samernaoch den rennäring som de bedriver på markerna. Denna uppsats belyser det regelverk sombehandlar de rättigheter samerna, som urbefolkning, har gentemot Sverige. Sverige har fåttskarp kritik från FN: s rasdiskrimineringskommitté (CERD) för att samernas rättigheter somurbefolkning inte skyddas tillräckligt i samband med den mineralutvinning som pågår iSápmi. Främst riktas kritiken mot att samerna inte k...
Voermans, PH; Go, KG; TerHorst, GJ; Ruiters, MHJ; Solito, E; Parente, L
1996-01-01
BRAIN tissue of rats pretreated with methylprednisolone or with the 21-aminosteroid U74389F, and that of untreated control rats, was assessed for the expression of annexin-l (Anx-1) and the transcription of its mRNA. For this purpose Anx-1 cDNA was amplified and simultaneously a T7-RNA-polymerase
No advantages in terms of safety. 'Energy in a Dialog' about the 'Final disposal site selection law'
International Nuclear Information System (INIS)
Anon.
2013-01-01
The current legislative process for the site selection law (StandAG) was topic of the DAtF event 'Energy in a Dialog' on 6 June 2013 in Berlin: 'Is the path the goal: purpose and results of the site selection law'. The President of the German Atomic Forum (DAtF), Dr. Ralf Gldner, moderated the discussion with Prof. Dr. Ortwin Renn of the University of Stuttgart and the CEO of the Gesellschaft fuer Nuklear-Service (GNS), Hannes Wimmer. The opportunities and risks of a new site search for high-level radioactive waste were the main topics. Professor Renn summarized some findings to conditions of acceptance perceived in connection with industrial projects. Dr. Wimmer said in his keynote that social acceptance for site selection for a repository must be maintained for a long time. During the ensuing discussion, a common understanding was evident on some aspects of the topic. This is especially true for a limitation of the new location search method in terms of its objective. As a realistic objective to determine a secure suitable site was considered instead of a 'best' location proposed by the new law. (orig.)
Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV
International Nuclear Information System (INIS)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1991-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233, 234, 236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for 235 U(n,f). 6 refs., 1 fig
Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV
International Nuclear Information System (INIS)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1992-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233,234,236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most of the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n, f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n, f) at 14.1 MeV which will allow us to obtain cross section values from the ratio data and our values for 235 U(n, f). (orig.)
International Nuclear Information System (INIS)
Badia; Fuchs
1983-01-01
Volcanism of the Stephanian period produced lava rich in potassium and fluorine with mineralization of U, F, Sn, W without Mo in the French Massif Central. Permian volcanism and associated magmatism are reviewed. Studied elements allow the characterization of their thermalism. These mineralizations are important for prospection [fr
76 FR 36620 - Proposed Collection; Comment Request for Form 8453-F and Form 8879-F
2011-06-22
... 1995, Public Law 104-13(44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Form 8453-F, U.S. Estate of Trust Income Tax Declaration and Signature for Electronic and Magnetic Made... Joel.Goldberger.irs.gov . SUPPLEMENTARY INFORMATION: Title: U.S. Estate of Trust Income Tax Declaration...
International Nuclear Information System (INIS)
Embarch, K.
1988-01-01
Fission product cumulative and independent yields were determined for 238-U(n,f) and 232-Th(n,f) reactions with essentially monoenergetic neutrons of 3 and 14 Mev. Fission product activities were measured by Ge(Li)γ-ray spectrometry of irradiated 238-U and 232-Th foils. These experiments allowed us to measure a great number of cumulative yields and to obtain the fission product mass distributions corresponding to the studied reactions mentioned above. The mass distributions were completely interpreted by nucleon shell effects and proton even-odd effects. The independent yield measurements are sometimes not possible using the activation technique because of the fission fragment decay data. The values which can not be measured were determined using the measured mass yields and a prediction systematic of fractional independent yield. The results allowed us to obtain the nuclear charge distributions and to estimate proton even-odd effect corresponding values. This effect decreases when the excitation energy of the fissioning nucleus increases, this shows the importance of this parameter in the viscosity study of the nuclear matter. In conclusion, the shell effects observed in the mass distributions show that the static aspect of the fission mechanism plays a great role during the fission process, and observed proton even-odd effects act for a weak nuclear viscosity. 54 refs., 27 figs., 25 tabs
Fission-fragment angular distributions and total kinetic energies for 235U(n,f) from .18 to 8.83 MeV
International Nuclear Information System (INIS)
Meadows, J.W.; Budtz-Joergensen, C.
1982-01-01
A gridded ion chamber was used to measure the fission fragment angular distribution and total kinetic energy for the 235 U(n,f) reaction from 0.18 to 8.81 MeV neutron energy. The anisotropies are in generally good agreement with earlier measurements. The average total kinetic energy is approx. 0.2 MeV greater than the thermal value at neutron energies < 2 MeV and shows a sudden decrease of approx. 0.8 MeV between 4 and 5 MeV neutron energy, well below the (n, n'f) threshold. Possible causes of this decrease are a change in the mass distribution or decreased shell effects in the heavy fragment
Donal, Erwan; Lund, Lars H; Oger, Emmanuel; Hage, Camilla; Persson, Hans; Reynaud, Amélie; Ennezat, Pierre-Vladimir; Bauer, Fabrice; Sportouch-Dukhan, Catherine; Drouet, Elodie; Daubert, Jean-Claude; Linde, Cecilia
2014-02-01
Karolinska Rennes (KaRen) is a prospective observational study to characterize heart failure patients with preserved ejection fraction (HFpEF) and to identify prognostic factors for long-term mortality and morbidity. To report characteristics and echocardiography at entry and after 4-8 weeks of follow-up. Patients were included following an acute heart failure presentation with B-type natriuretic peptide (BNP)>100 ng/L or N-terminal pro-BNP (NT-proBNP)>300 ng/L and left ventricular ejection fraction (LVEF)>45%. The mean ± SD age of 539 included patients was 77 ± 9 years and 56% were women. Patient history included hypertension (78%), atrial tachyarrhythmia (44%), prior heart failure (40%) and anemia (37%), but left bundle branch block was rare (3.8%). Median NT-proBNP was 2448 ng/L (n=438), and median BNP 429 ng/L (n=101). Overall, 101 patients did not return for the follow-up visit, including 13 patients who died (2.4%). Apart from older age (80 ± 9 vs. 76 ± 9 years; P=0.006), there were no significant differences in baseline characteristics between patients who did and did not return for follow-up. Mean LVEF was lower at entry than follow-up (56% vs. 62%; P<0.001). At follow-up, mean E/e' was 12.9 ± 6.1, left atrial volume index 49.4±17.8mL/m(2). Mean global left ventricular longitudinal strain was -14.6 ± 3.9%; LV mass index was 126.6 ± 36.2g/m(2). Patients in KaRen were old with slight female dominance and hypertension as the most prevalent etiological factor. LVEF was preserved, but with increased LV mass and depressed LV diastolic and longitudinal systolic functions. Few patients had signs of electrical dyssynchrony (ClinicalTrials.gov.- NCT00774709). Copyright © 2014 Elsevier Masson SAS. All rights reserved.
Polarized 3-folds in a codimension 10 weighted homogeneous F4 variety
Qureshi, Muhammad Imran
2017-10-01
We describe the construction of a codimension 10 weighted homogeneous variety wΣF4(μ , u) corresponding to the exceptional Lie group F4 by explicit computation of its graded ring structure. We give a formula for the Hilbert series of the generic weighted wΣF4(μ , u) in terms of representation theoretic data of F4. We also construct some families of polarized 3-folds in codimension 10 whose general member is a weighted complete intersection of some wΣF4(μ , u) .
Fermi energy 5f spectral weight variation in uranium alloys
Energy Technology Data Exchange (ETDEWEB)
Denlinger, J.D.; Clack, J.; Allen, J.W. [Univ. of Michigan, Ann Arbor, MI (United States)] [and others
1997-04-01
Uranium materials display a wide range of thermal, electrical and magnetic properties, often exotic. For more than a decade there have been efforts to use photoemission spectroscopy to develop a systematic and unified understanding of the 5f electron states giving rise to this behavior. These efforts have been hampered by a paucity of systems where changes in transport properties are accompanied by substantial spectral changes, so as to allow an attempt to correlate the two kinds of properties within some model. The authors have made resonant photoemission measurements to extract the 5f spectral weight in three systems which show varying degrees of promise of permitting such an attempt, Y{sub 1{minus}x}U{sub x}Pd{sub 3}, U(Pd{sub x}Pt{sub 1{minus}x}){sub 3} and U(Pd{sub x}Cu{sub 1{minus}x}){sub 5}. They have also measured U 4f core level spectra. The 4f spectra can be modeled with some success by the impurity Anderson model (IAM), and the 5f spectra are currently being analyzed in that framework. The IAM characterizes the 5f-electrons of a single site by an f binding energy {epsilon}{sub f}, an f Coulomb interaction and a hybridization V to conduction electrons. Latent in the model are the phenomena of 5f mixed valence and the Kondo effect.
LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE
African Journals Online (AJOL)
PC_WINDOWS
Santé Publique (ENSP) à Rennes et le Centre National de Référence des vibrions et du Choléra (CNRVC) à l'Institut Pasteur ... l'Alimentation, en France, dans le but de normaliser les protocoles d'étude et de recherche de V. cholerae et ..... Vibrio présente dans l'environnement avec les méthodes de détection habituelles.
A COMPARISON OF (PuU)C AND (PuU)O$sub 2$ FUELED FAST BREEDER REACTORS
Energy Technology Data Exchange (ETDEWEB)
Kazi, A. Halim; Rosen, Stanley
1963-11-15
BS>A conceptual evaluation is presented of a (PuU)C 500Mw(e) reactor which uses a moderate power generation of 40 kw/ft and a maximum fuel temperature of 2900 deg F, well below the 4500 deg F melting point of Pu/sub 0.2/U/sub 0.8/C. The principal design characteristics and fuel cycle costs are tabulated together with those of a (PuU)O/sub 2/ design of equal power. The comparison shows that the carbide core has significant economic and safety advantages over the oxide core. (D.L.C.)
Energy Technology Data Exchange (ETDEWEB)
Szteinsznaider, D; Naggiar, V; Netter, F [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1955-07-01
This measurements have been done while taking the value of the fission cross-sections of {sup 238}U as reference. The neutrons are produced by the reaction {sup 7}Li(p,n) in the Van de Graaff generator of Saclay. The explored domain spreads from some tenths to 2000 keV. We find: for {sup 239}Pu: {sigma}{sub f} = 2,04 {+-} 0,12 barns, cross-section constant between 150 and 2000 keV, for {sup 235}U: {sigma}{sub f} = 1,15 {+-} 0,15 barns, cross-section constant between 700 and 1000 keV, for {sup 233}U: {sigma}{sub f} = 1,92 {+-} 0,25 barns, for neutrons of 850 keV. (authors) [French] Ces mesures ont ete effectuees en prenant la valeur de la section efficace de fission de {sup 238}U comme reference. Les neutrons sont produits par la reaction {sup 7}Li(p,n) au generateur Van de Graaff de Saclay. Le domaine explore s'etend de quelques dizaines de kev a 2000 kev. Nous trouvons: pour {sup 239}Pu: {sigma}{sub f} = 2,04 {+-} 0,12 barns, section efficace constante entre 150 et 2000 kev. pour {sup 235}U: {sigma}{sub f} = 1,15 {+-} 0,15 barns, section efficace constante entre 700 et 1000 kev. pour {sup 233}U: {sigma}{sub f} = 1,92 {+-} 0,25 barns, pour des neutrons de 850 kev. (auteurs)
Bacteriochlorophyll f: properties of chlorosomes containing the “forbidden chlorophyll”
Directory of Open Access Journals (Sweden)
Kajetan Vogl
2012-08-01
Full Text Available The chlorosomes of green sulfur bacteria (GSB are mainly assembled from one of three types of bacteriochlorophylls (BChls, BChls c, d, and e. By analogy to the relationship between BChl c and BChl d (20-desmethyl-BChl c, a fourth type of BChl, BChl f (20-desmethyl-BChl e, should exist but has not yet been observed in nature. The bchU gene (bacteriochlorophyllide C-20 methyltransferase of the brown-colored green sulfur bacterium Chlorobaculum limnaeum was inactivated by conjugative transfer from Eshcerichia coli and homologous recombination of a suicide plasmid carrying a portion of the bchU. The resulting bchU mutant was greenish brown in color and synthesized BChl fF. The chlorosomes of the bchU mutant had similar size and polypeptide composition as those of the wild type (WT, but the Qy absorption band of the BChl f aggregates was blue-shifted 16 nm (705 nm vs. 721 nm for the WT. Fluorescence spectroscopy showed that energy transfer to the baseplate was much less efficient in chlorosomes containing BChl f than in WT chlorosomes containing BChl e. When cells were grown at high irradiance with tungsten or fluorescent light, the WT and bchU mutant had identical growth rates. However, the WT grew about 40% faster than the bchU mutant at low irradiance (10 μmol photons m−2 s-1. Less efficient energy transfer from BChl f aggregates to BChl a in the baseplate, the much slower growth of the strain producing BChl f relative to the WT, and competition from other phototrophs, may explain why BChl f is not observed naturally.
Directory of Open Access Journals (Sweden)
Aimee L Signarovitz
Full Text Available The need for an efficacious vaccine against Francisella tularensis is a consequence of its low infectious dose and high mortality rate if left untreated. This study sought to characterize a live attenuated subspecies novicida-based vaccine strain (U112ΔiglB in an established second rodent model of pulmonary tularemia, namely the Fischer 344 rat using two distinct routes of vaccination (intratracheal [i.t.] and oral. Attenuation was verified by comparing replication of U112ΔiglB with wild type parental strain U112 in F344 primary alveolar macrophages. U112ΔiglB exhibited an LD(50>10(7 CFU compared to the wild type (LD(50 = 5 × 10(6 CFU i.t.. Immunization with 10(7 CFU U112ΔiglB by i.t. and oral routes induced antigen-specific IFN-γ and potent humoral responses both systemically (IgG2a>IgG1 in serum and at the site of mucosal vaccination (respiratory/intestinal compartment. Importantly, vaccination with U112ΔiglB by either i.t. or oral routes provided equivalent levels of protection (50% survival in F344 rats against a subsequent pulmonary challenge with ~25 LD(50 (1.25 × 10(4 CFU of the highly human virulent strain SCHU S4. Collectively, these results provide further evidence on the utility of a mucosal vaccination platform with a defined subsp. novicida U112ΔiglB vaccine strain in conferring protective immunity against pulmonary tularemia.
PERFORMA NEUTRONIK BAHAN BAKAR LiF-BeF2-ThF4-UF4 PADA SMALL MOBILE-MOLTEN SALT REACTOR
Directory of Open Access Journals (Sweden)
S. N. Rokhman
2015-04-01
Full Text Available Telah dilakukan analisis terhadap performa neutronik bahan bakar garam lebur LiF-BeF2-ThF4-UF4 pada Small Mobile-Molten Salt Reactor (SM-MSR. Penyesuaian konfigurasi teras dan temperatur operasi harus dilakukan untuk penggunaan bahan bakar baru tersebut agar mencapai keff > 1 dan CR (conversion ratio > 1 pada fraksi 0,5% 233U, 20% 232Th, 28% Li, 51,5% Be. Setelah didapat nilai keff ≈ 1 dan CR ≈ 1, dilakukan analisis pengaruh perubahan Th terhadap Be dan Be terhadap Li yang terlihat dalam perubahan parameter keff dan CR. Setelah itu fraksi 233U divariasi antara 0,5–0,46% untuk memperoleh keff > 1 dan CR > 1. Dalam perhitungan koefisien reaktifitas temperatur (αT, temperatur teras dinaikkan sebesar +25K dan +50K., dan untuk koefisien reaktifitas void (αV, densitas bahan bakar dikurangi hingga 90%. Hasil perhitungan menunjukkan bahwa pengurangan Th terhadap Be menyebabkan penurunan nilai CR dan naiknya keff akibat berkurangnya material fertil. Sebaliknya penambahan Be terhadap Li mengakibatkan terjadi kenaikan nilai keff dan menurunkan CR, akibat laju serapan Li lebih besar dari Be. Pada 5 (lima fraksi 233U dalam rentang 0,5–0,49%, hasil perhitungan keff dan CR masing-masing bervariasi dalam rentang 1,00001 - 1,00327 dan 1,00016 - 1,00731. Untuk faktor puncak daya (PPF, hasil perhitungan memberikan nilai dalam rentang 2,4311 -2,4714. Sedangkan untuk parameter keselamatan, koefisien reaktivitas temperatur (αT dan reaktivitas void (αV masingmasing bernilai negatif dalam rentang 4,972×10-5 - 5,909×10-5 dan 2,596×10-2- 2,8287×10-2 ∆k/k/K. Dapat disimpulkan bahwa teras SM-MSR memberikan nilai negatif di kedua koefisien reaktivitas tersebut untuk setiap fraksi,, sehingga memenuhi kriteria keselamatan dan keselamatan melekat. Kata kunci: SM-MSR (small mobile-molten salt reactor, bahan bakar LiF-BeF2-ThF4-UF4, keselamatan melekat, koefisien reaktivitas temperatur, koefisien reaktivitas void The analysis of neutronic performance has
Time-related variation of volatile contents of Western Ghats volcanic formations, Deccan, India
Marzoli, Andrea; Callegaro, Sara; Baker, Don R.; De Min, Angelo; Renne, Paul R.
2016-04-01
Deccan volcanism in India covered more than 1 million square km and reached a maximum thickness of about 3 km, as presently preserved in the Western Ghats volcanic lava piles. Volcanic activity started at about 66.4 Ma (Jawhar formation) and ended at about 65.5 Ma (Mahabaleshwar unit; Renne et al., 2015). Deccan volcanism straddled the Cretaceous-Paleogene boundary (ca. 66.0 Ma) and possibly contributed to the end-Cretaceous mass extinction event through emission of gases such as SO2, CO2, Cl, F that may have triggered global climate changes. Severe pollution by volcanic gases is supported by the high S and Cl contents (up to 1400 and up to 900 ppm, respectively; Self et al., 2008) measured in a few olivine- and plagioclase-hosted melt inclusions from the Jawhar, Neral, and Thakurvadi Formations (early lava flows, ca. 66.3-66.4 ± 0.1 Ma; Renne et al., 2015) and by magmatic S contents (up to 1800 ppm; Callegaro et al., 2014) calculated from S measurements in clinopyroxenes from the Mahabaleshwar unit (ca. 65.5 ± 0.1; Schoene et al., 2015). Here, we present new analyses of S, Cl, and F, obtained by ion-probe and synchrotron light micro-fluorescence analyses on clinopyroxenes and plagioclase phenocrysts from ?al? lava flow units of the Western Ghats. The volatile contents of the host magmas have been calculated from recently published clinopyroxene/basalt partition coefficients. These new data will describe the time-related variation of volatile elements hosted and eventually emitted by Deccan lavas and shed light on their environmental impact. References: Callegaro S. et al. (2014). Geology 42, 895-898. Renne P.R. et al. (2015). Science 350, 76-78. Schoene B. et al. (2015). Science 347, 192-184. Self S. et al. (2008). Science 319, 1654-1657.
Abelian gauge symmetries in F-theory and dual theories
Song, Peng
In this dissertation, we focus on important physical and mathematical aspects, especially abelian gauge symmetries, of F-theory compactifications and its dual formulations within type IIB and heterotic string theory. F-theory is a non-perturbative formulation of type IIB string theory which enjoys important dualities with other string theories such as M-theory and E8 x E8 heterotic string theory. One of the main strengths of F-theory is its geometrization of many physical problems in the dual string theories. In particular, its study requires a lot of mathematical tools such as advanced techniques in algebraic geometry. Thus, it has also received a lot of interests among mathematicians, and is a vivid area of research within both the physics and the mathematics community. Although F-theory has been a long-standing theory, abelian gauge symmetry in Ftheory has been rarely studied, until recently. Within the mathematics community, in 2009, Grassi and Perduca first discovered the possibility of constructing elliptically fibered varieties with non-trivial toric Mordell-Weil group. In the physics community, in 2012, Morrison and Park first made a major advancement by constructing general F-theory compactifications with U(1) abelian gauge symmetry. They found that in such cases, the elliptically-fibered Calabi-Yau manifold that F-theory needs to be compactified on has its fiber being a generic elliptic curve in the blow-up of the weighted projective space P(1;1;2) at one point. Subsequent developments have been made by Cvetic, Klevers and Piragua extended the works of Morrison and Park and constructed general F-theory compactifications with U(1) x U(1) abelian gauge symmetry. They found that in the U(1) x U(1) abelian gauge symmetry case, the elliptically-fibered Calabi-Yau manifold that F-theory needs to be compactified on has its fiber being a generic elliptic curve in the del Pezzo surface dP2. In chapter 2 of this dissertation, I bring this a step further by
1982-05-19
PSYCH4ROMETRIC SUMMARY 7de639U P,4ELPS-COLLIPES/ALPE4* ŕ 73-Si1FE STA.Ow STATION NAM11 TtM5k MONTI. WIT __ SULD TEMPERATURE DEPRESION (F) TOTAL TOTAL...TEMPERATURE DEPRESION (F) TOTAL i TOTAL (F)___ 0 .1.2 34.02.2 12625.317.n 2 - 30- 31D -W&j 0.8./ A BbI-Ps., (F 5~ ~~~6 7- 19. IP 11.1213-U1 .O5-117 199~ .. 22...13-61No STATION .. . STATION NAME YEARS woAT. tA b: L 2 LU u -41AML H U S1.S. T., IWET GULN TEMPERATURE DEPRESION (F) * ITOTAL TOTAL V TAL 21.u 47.Z
Fission cross section ratios for sup 233,234,236 U relative to sup 235 U from 0. 5 to 400 MeV
Energy Technology Data Exchange (ETDEWEB)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J. (Los Alamos National Lab., NM (USA)); Carlson, A.D.; Wasson, O.A. (National Inst. of Standards and Technology, Gaithersburg, MD (USA)); Hill, N.W. (Oak Ridge National Lab., TN (USA))
1991-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of {sup 233, 234, 236}U relative to {sup 235}U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the {sup 235}U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for {sup 235}U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for {sup 235}U(n,f). 6 refs., 1 fig.
2013-09-03
... . Commenters are encouraged, but not required, to send a courtesy copy of any comments to the U.S. Department...-- businesses or other for-profits. Total Estimated Number of Respondents: 35,000. Total Estimated Number of...
Hantke, Nathan; Nielson, Kristy A; Woodard, John L; Breting, Leslie M Guidotti; Butts, Alissa; Seidenberg, Michael; Carson Smith, J; Durgerian, Sally; Lancaster, Melissa; Matthews, Monica; Sugarman, Michael A; Rao, Stephen M
2013-01-01
Previous studies suggest that task-activated functional magnetic resonance imaging (fMRI) can predict future cognitive decline among healthy older adults. The present fMRI study examined the relative sensitivity of semantic memory (SM) versus episodic memory (EM) activation tasks for predicting cognitive decline. Seventy-eight cognitively intact elders underwent neuropsychological testing at entry and after an 18-month interval, with participants classified as cognitively "Stable" or "Declining" based on ≥ 1.0 SD decline in performance. Baseline fMRI scanning involved SM (famous name discrimination) and EM (name recognition) tasks. SM and EM fMRI activation, along with Apolipoprotein E (APOE) ε4 status, served as predictors of cognitive outcome using a logistic regression analysis. Twenty-seven (34.6%) participants were classified as Declining and 51 (65.4%) as Stable. APOE ε4 status alone significantly predicted cognitive decline (R(2) = .106; C index = .642). Addition of SM activation significantly improved prediction accuracy (R(2) = .285; C index = .787), whereas the addition of EM did not (R(2) = .212; C index = .711). In combination with APOE status, SM task activation predicts future cognitive decline better than EM activation. These results have implications for use of fMRI in prevention clinical trials involving the identification of persons at-risk for age-associated memory loss and Alzheimer's disease.
6th International Conference on the History of General Relativity
Eisenstaedt, Jean; The Universe of General Relativity; GR 6
2005-01-01
This volume from the Einstein Studies Series is based largely on papers presented at the Sixth International Conference on the History of General Relativity, held in Amsterdam on June 26-29, 2002. These contributions from notable experts offer both new and historical insights on gravitation, general relativity, cosmology, unified field theory, and the history of science. Topics discussed include the prehistory of special relativity, early attempts at a relativistic theory of gravitation, the beginnings of general relativity, the problem of motion in the context of relativity, conservation laws, the axiomatization of relativity, classical and contemporary cosmology, gravitation and electromagnetism, quantum gravity, and relativity as seen through the eyes of the public and renowned relativists. Contributors: K. Brading; G. Gale; H.F.M. Goenner; J. Goldberg; S. Katzir; D. Kennefick; H. Kragh; C. Lehner; U. Majer; J. Mattingly; E.T. Newman; J.D. Norton; J. Renn; R. Rynasiewicz; J.M. Sánchez-Ron; T. Sauer; C. Sm...
Physics of F-theory compactifications without section
International Nuclear Information System (INIS)
Anderson, Lara B.; García-Etxebarria, Iñaki; Grimm, Thomas W.; Keitel, Jan
2014-01-01
We study the physics of F-theory compactifications on genus-one fibrations without section by using an M-theory dual description. The five-dimensional action obtained by considering M-theory on a Calabi-Yau threefold is compared with a six-dimensional F-theory effective action reduced on an additional circle. We propose that the six-dimensional effective action of these setups admits geometrically massive U(1) vectors with a charged hypermultiplet spectrum. The absence of a section induces NS-NS and R-R three-form fluxes in F-theory that are non-trivially supported along the circle and induce a shift-gauging of certain axions with respect to the Kaluza-Klein vector. In the five-dimensional effective theory the Kaluza-Klein vector and the massive U(1)s combine into a linear combination that is massless. This U(1) is identified with the massless U(1) corresponding to the multi-section of the Calabi-Yau threefold in M-theory. We confirm this interpretation by computing the one-loop Chern-Simons terms for the massless vectors of the five-dimensional setup by integrating out all massive states. A closed formula is found that accounts for the hypermultiplets charged under the massive U(1)s.
International Nuclear Information System (INIS)
Szteinsznaider, D.; Naggiar, V.; Netter, F.
1955-01-01
This measurements have been done while taking the value of the fission cross-sections of 238 U as reference. The neutrons are produced by the reaction 7 Li(p,n) in the Van de Graaff generator of Saclay. The explored domain spreads from some tenths to 2000 keV. We find: for 239 Pu: σ f = 2,04 ± 0,12 barns, cross-section constant between 150 and 2000 keV, for 235 U: σ f = 1,15 ± 0,15 barns, cross-section constant between 700 and 1000 keV, for 233 U: σ f = 1,92 ± 0,25 barns, for neutrons of 850 keV. (authors) [fr
U2 laulusõnade tundmine lennutab Hawaile
2006-01-01
Iiri bänd U2 algatas oma uue albumi "U2 18 Singles väljatuleku puhul internetis võistluse "Hunt The Lyric", kus fännidel on võimalus võita reis Hawaile (reisi paketis ka U2 "Vertigo" tuuri kontsert 9. dets.)
Stamatopoulos, A.; Kanellakopoulos, A.; Kalamara, A.; Diakaki, M.; Tsinganis, A.; Kokkoris, M.; Michalopoulou, V.; Axiotis, M.; Lagoyiannis, A.; Vlastou, R.
2018-01-01
The 234U neutron-induced fission cross-section has been measured at incident neutron energies of 452, 550, 651 keV and 7.5, 8.7, 10 MeV using the 7Li ( p, n) and the 2H( d, n) reactions, respectively, relative to the 235U( n, f ) and 238U( n, f ) reference reactions. The measurement was performed at the neutron beam facility of the National Center for Scientific Research "Demokritos", using a set-up based on Micromegas detectors. The active mass of the actinide samples and the corresponding impurities were determined via α-spectroscopy using a surface barrier silicon detector. The neutron spectra intercepted by the actinide samples have been thoroughly studied by coupling the NeuSDesc and MCNP5 codes, taking into account the energy and angular straggling of the primary ion beams in the neutron source targets in addition to contributions from competing reactions ( e.g. deuteron break-up) and neutron scattering in the surrounding materials. Auxiliary Monte Carlo simulations were performed making combined use of the FLUKA and GEF codes, focusing particularly on the determination of the fission fragment detection efficiency. The developed methodology and the final results are presented.
Hydrogen absorption-desorption properties of U2Ti
International Nuclear Information System (INIS)
Yamamoto, Takuya; Tanaka, Satoru; Yamawaki, Michio
1990-01-01
Hydrogen absorption-desorption properties of U 2 Ti intermetallic compound was examined over the temperature range of 298 to 973 K and at hydrogen pressures below 10 5 Pa. It absorbs hydrogen up to 7.6 atoms per F.U. (formula unit) by two step reactions and hence each desorption isotherm is separated into two plateau regions. In the first plateau, a newly-found ternary hydride is formed, where the hydrogen concentration, c H , reaches 2.4 H atoms/F.U. In the second plateau, UH 3 is formed and c H reaches 7.6 H atoms/F.U. The specimen is disintegrated into fine powder in the second plateau, while in the first plateau the ternary hydride which was identified to be UTi 2 H x (x=4.8 to 6.2) showed high durability against powdering. It is predicted that UTi 2 can be suitable material for tritium storage. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Merabiha, O.; Seddik, T. [Laboratoire de Physique Quantique et de Modélisation Mathématique, Université de Mascara, Mascara 29000 (Algeria); Khenata, R., E-mail: khenata_rabah@yahoo.fr [Laboratoire de Physique Quantique et de Modélisation Mathématique, Université de Mascara, Mascara 29000 (Algeria); Murtaza, G., E-mail: murtaza@icp.edu.pk [Materials Modeling Lab, Department of Physics, Islamia College University, Peshawar (Pakistan); Bouhemadou, A. [Laboratory for Developing New Materials and their Characterization, Department of Physics, Faculty of Science, University of Setif, 19000 Setif (Algeria); Takagiwa, Y. [Department of Advanced Materials Science, The University of Tokyo (Japan); Bin Omran, S. [Department of Physics and Astronomy, King Saud University, P.O. Box 2455, Riyadh 11451 (Saudi Arabia); Rached, D. [Magnetic Materials Laboratory, Department of Physics, Faculty of Sciences, University of Sidi Bel-Abbes, 22000 Sidi Bel-Abbes (Algeria)
2014-02-15
Highlights: • The calculated structural parameters of hexagonal U{sub 3}ZrSb{sub 5} are found in good agreement with the experimental data. • U{sub 3}ZrSb{sub 5} is found to be ferromagnetic material. • Evident effects of the Hubbard U parameter in the uranium “5f” states are noted. • Our band structure calculation show the metallic behavior of this ferromagnetic compound. • The thermodynamic properties are predicted through the quasi-harmonic Debye model. -- Abstract: Structural, magnetic, electronic and thermodynamic properties of the hexagonal U{sub 3}ZrSb{sub 5} are theoretically investigated by using the full potential linearized augmented plane wave plus local orbital’s (FP-LAPW + lo) method. The exchange–correlation potential was treated with the generalized gradient approximation GGA of Wu and Cohen. Moreover, the GGA + U approximation (where U is the Hubbard correlation terms) is employed to treat the f electrons properly. The calculated structural parameters are in good agreement with the experimental data. The magnetic study reveals that U{sub 3}ZrSb{sub 5} is a ferromagnetic material. Furthermore, we present a comparative study between the band structures, electronic structures, total and partial densities of states and local moments calculated within both GGA and GGA + U schemes. Our band structure calculations show the metallic behavior of this ferromagnetic compound. The thermodynamic properties are predicted through the quasi-harmonic Debye model, in which the lattice vibrations are taken into account. The variation of relative change in volume, heat capacities and the Debye temperature with temperature and pressure are successfully achieved.
Symmetry breaking of u(6/2j+1) supersymmetric models
International Nuclear Information System (INIS)
Baake, M.; Reinicke, P.
1985-09-01
In this paper, we present the group theory of models with broken u(6/2j+1) supersymmetry described by the chain u(6/2j+1) contains usub(B)(6) x usub(F)(2j+1) contains usub(B)(6) x spsub(F)(2j+1) contains ... contains sosub(B)(3) x susub(F)(2) contains susub(B+F)(2) which has recently been suggested for application to nuclear physics. We present all invariants that are needed for the construction of the general Hamiltonian for this model. (orig.)
International Nuclear Information System (INIS)
Al-Hamarneh, Ibrahim F.; Alkhomashi, N.; Almasoud, Fahad I.
2016-01-01
The present study addresses the soil-to-plant transfer factors (TFs) of 226 Ra, 234 U and 238 U for 13 types of vegetables and agricultural crops planted under semi-arid environment in the northwestern part of Saudi Arabia. Crop plants along with plant-growing soils were collected from selected farms, which are irrigated from the non-renewable Saq aquifer, and investigated for their radioactivity content by means of alpha spectrometry after applying a radiochemical separation procedure. Hence, TF data for plant roots, green parts (stem and leaves) and fruits were calculated and contrasted to those reported in the literature. Substantial differences were observed in the TFs of Ra and U radioisotopes among plant species. In crop fruits, eggplant exhibited the highest uptake of 226 Ra (TF value of 0.11), while beans (0.16) have the highest TF for 234 U and 238 U. The geometric mean TF values indicated that the crop roots tend to accumulate Ra and U about four to six-folds higher than fruits. The relation between TF values and soil concentrations showed a weak correlation. Activity ratios between radionuclides in crop plants indicated the preferential translocation of U in fruits than Ra even though Ra is more available for root uptake. The fruit/root (F/R) ratios obtained for the investigated plants shown that pepper had the smallest F/R ratios (0.07 ± 0.01, 0.12 ± 0.02 and 0.11 ± 0.02 for 226 Ra, 234 U and 238 U, respectively), while the highest F/R ratios were observed in potatoes (0.71 ± 0.15, 0.44 ± 0.10 and 0.40 ± 0.08 for 226 Ra, 234 U and 238 U, respectively). The TF and F/R ratios data of natural radionuclides in the study region can hopefully improve the scientific knowledge for future studies. - Highlights: • Ra and U isotopes were measured in soils and plant crops in farms in Saudi Arabia. • Ra and U activities in plant roots (R) slightly exceeded that in their fruits (F). • Ra/U activity ratios showed preferential translocation of U
Electronic structure and magnetic properties of dilute U impurities in metals
Mohanta, S. K.; Cottenier, S.; Mishra, S. N.
2016-05-01
The electronic structure and magnetic moment of dilute U impurity in metallic hosts have been calculated from first principles. The calculations have been performed within local density approximation of the density functional theory using Augmented plane wave+local orbital (APW+lo) technique, taking account of spin-orbit coupling and Coulomb correlation through LDA+U approach. We present here our results for the local density of states, magnetic moment and hyperfine field calculated for an isolated U impurity embedded in hosts with sp-, d- and f-type conduction electrons. The results of our systematic study provide a comprehensive insight on the pressure dependence of 5f local magnetism in metallic systems. The unpolarized local density of states (LDOS), analyzed within the frame work of Stoner model suggest the occurrence of local moment for U in sp-elements, noble metals and f-block hosts like La, Ce, Lu and Th. In contrast, U is predicted to be nonmagnetic in most transition metal hosts except in Sc, Ti, Y, Zr, and Hf consistent with the results obtained from spin polarized calculation. The spin and orbital magnetic moments of U computed within the frame of LDA+U formalism show a scaling behavior with lattice compression. We have also computed the spin and orbital hyperfine fields and a detail analysis has been carried out. The host dependent trends for the magnetic moment, hyperfine field and 5f occupation reflect pressure induced change of electronic structure with U valency changing from 3+ to 4+ under lattice compression. In addition, we have made a detailed analysis of the impurity induced host spin polarization suggesting qualitatively different roles of f-band electrons on moment stability. The results presented in this work would be helpful towards understanding magnetism and spin fluctuation in U based alloys.
International Nuclear Information System (INIS)
Parnham, Emily R.; Slawin, Alex M.Z.; Morris, Russell E.
2007-01-01
β-NH 4 AlF 4 has been synthesised ionothermally using 1-ethyl-3-methylimidazolium hexafluorophosphate as solvent and template provider. β-NH 4 AlF 4 crystals were produced which were suitable for single crystal X-ray diffraction analysis. A phase transition occurs between room temperature (298 K) and low temperature (93 K) data collections. At 298 K the space group=I4/mcm (no. 140), α=11.642(5), c=12.661(5) A, Z=2 (10NH 4 AlF 4 ), wR(F 2 )=0.1278, R(F)=0.0453. At 93 K the space group=P4 2 /ncm (no. 138), α=11.616(3), c=12.677(3) A, Z=2 (10NH 4 AlF 4 ), wR(F 2 )=0.1387, R(F)=0.0443. The single crystal X-ray diffraction study of β-NH 4 AlF 4 shows the presence of two different polymorphs at low and room temperature, indicative of a phase transition. The [AlF 4/2 F 2 ] - layers are undisturbed except for a small tilting of the AlF 6 octahedra in the c-axis direction. -Ionothermal synthesis, the use of an ionic liquid as the solvent in materials preparation, has been used to prepare β-NH 4 AlF 4 , and structural characterisation indicates that there are two versions of the structure, a low temperature primitive phase at 93 K and a high temperature body-centered phase at 298 K
ORF Alignment: NC_002940 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...
4TH Mediterranean Workshop and Tropical Meeting "Novel Optical Materials and Applications" NOMA 99.
1999-07-19
Qu~mard", F. Smektalaa, V. Condereb, A. Barth616myb. aLaboratoire des Verres et Cramniques, Universit6 de Rennes 1, Avenue du G6n~raI Leclerc, 35042...and Budget, Paperwork Reduction Project (0704-0188), Washington, DC 20503. 1. AGENCY USE ONLY (Leave blank) 2. REPORT DATE 3. REPORT TYPE AND DATES...insights toward a qualitative understanding of PDE’s. POLYMER CELL-WALL TYPE LIQUID CRYSTAL OPTICAL SHUTTERS AND THEIR APPLICATIONS TADAHIRO ASADA
Measurement of Coster-Kronig yields f{sub 23} for W, Pt, Pb and U
Energy Technology Data Exchange (ETDEWEB)
Gupta, Sheenu; Mittal, V K; Mittal, Raj, E-mail: sheenu85gupta@gmail.co, E-mail: vijay_52_mittal@yahoo.co, E-mail: rmsingla@yahoo.co [Nuclear Science Laboratories, Physics Department, Punjabi University, Patiala-147002 (India)
2010-12-14
The non-radiative shifting of vacancy from L{sub 2} to L{sub 3} sub-shell, Coster-Kronig yield f{sub 23}, is measured for W, Pt, Pb and U using the selective excitation technique for L{sub 2} and L{sub 3} sub-shell electrons in a compact tri-axial double-reflection geometrical setup with minimum scattered background. The setup consists of a low-power x-ray tube with Rh anode as a photon source, primary exciter for L{sub 2} and L{sub 3} sub-shells of an experimental target and the experimental target itself in one plane and a Si-PIN detector to record the emitted x-rays from the experimental target in the perpendicular plane. A separate experimental procedure has been adopted in a 90{sup 0} single-reflection setup both to determine the exciting photon flux that strikes at the experimental target and to nullify exactly the irrelevant L x-rays produced by tube photons which are scattered from the primary exciter. The procedure leads to reduction of probable errors in the measurements and authenticity of determined values.
A Realistic $U(2)$ Model of Flavor arXiv
Linster, Matthias
We propose a simple $U(2)$ model of flavor compatible with an $SU(5)$ GUT structure. All hierarchies in fermion masses and mixings arise from powers of two small parameters that control the $U(2)$ breaking. In contrast to previous $U(2)$ models this setup can be realized without supersymmetry and provides an excellent fit to all SM flavor observables including neutrinos. We also consider a variant of this model based on a $D_6 \\times U(1)_F$ flavor symmetry, which closely resembles the $U(2)$ structure, but allows for Majorana neutrino masses from the Weinberg operator. Remarkably, in this case one naturally obtains large mixing in the lepton sector from small mixing in the quark sector. The model also offers a natural option for addressing the Strong CP Problem and Dark Matter by identifying the Goldstone boson of the $U(1)_F$ factor as the QCD axion.
Energy Technology Data Exchange (ETDEWEB)
Stamatopoulos, A.; Kanellakopoulos, A.; Kalamara, A.; Kokkoris, M.; Michalopoulou, V.; Vlastou, R. [National Technical University of Athens, Department of Physics, Athens (Greece); Diakaki, M. [National Technical University of Athens, Department of Physics, Athens (Greece); European Organisation for Nuclear Research (CERN), Geneva (Switzerland); Tsinganis, A. [European Organisation for Nuclear Research (CERN), Geneva (Switzerland); Axiotis, M.; Lagoyiannis, A. [Tandem Accelerator Laboratory, Institute of Nuclear and Particle Physics, N.C.S.R. Demokritos, Athens (Greece)
2018-01-15
The {sup 234}U neutron-induced fission cross-section has been measured at incident neutron energies of 452, 550, 651 keV and 7.5, 8.7, 10 MeV using the {sup 7}Li (p, n) and the {sup 2}H(d, n) reactions, respectively, relative to the {sup 235}U(n, f) and {sup 238}U(n, f) reference reactions. The measurement was performed at the neutron beam facility of the National Center for Scientific Research ''Demokritos'', using a set-up based on Micromegas detectors. The active mass of the actinide samples and the corresponding impurities were determined via α-spectroscopy using a surface barrier silicon detector. The neutron spectra intercepted by the actinide samples have been thoroughly studied by coupling the NeuSDesc and MCNP5 codes, taking into account the energy and angular straggling of the primary ion beams in the neutron source targets in addition to contributions from competing reactions (e.g. deuteron break-up) and neutron scattering in the surrounding materials. Auxiliary Monte Carlo simulations were performed making combined use of the FLUKA and GEF codes, focusing particularly on the determination of the fission fragment detection efficiency. The developed methodology and the final results are presented. (orig.)
International Nuclear Information System (INIS)
Belaud; Leconnetable; Daspet; Tombini; Tanguy
1986-06-01
Transport of radioactive acid liquid effluents are effected on tank truck inside nuclear center of the CEA. The cylindrical packaging type B(U) f has a capacity of 4,000l, a maximum permissible activity of 110 T Bq (3x10 4 Ci) and comprises a central element for liquid effluent containment to prevent contamination of environment and peripheral elements for mechanical, biological and thermal protection. This packaging is fixed on a trailer associated with a control box. Design and equipment of the packaging are studied for a maximum safety and in accordance with regulations [fr
Optical properties of LiYF4:U3+. Infrared laser use
International Nuclear Information System (INIS)
Louis, M.
1995-01-01
In this study are proposed a complete interpretation of the optical spectra of trivalent uranium in LiYF 4 (LYF). Single crystals of uranium doped LYF were grown by Czochralski method with different concentration (0.05%-0.20%). The obtained crystals have pale green color, characteristic of tetravalent uranium. The absorption spectra show that effectively only U 4+ is present in this crystal. In order to reduce the oxidation state of the U 4+ , the pale green crystal containing 0.07% of U 4+ was exposed to gamma irradiation. The sample becomes orange brown and the absorption spectrum is characteristic of U 3+ . The irradiation technology is an efficient method to convert 100% of U 4+ in U 3+ . From the analysis of the polarized optical absorption and emission spectra the spectroscopic parameters have been determined. The Judd-Ofelt theory was applied in order to simulate the intensity of the 5 f 3 →5 f 3 transitions between Stark levels of U 3+ in LYF. Because of the large crystal field splitting of the J multiplet in the actinides a set of phenomenological intensity parameters is introduced to describe the transition probabilities between crystal field sublevels. A continuous laser emission of an actinide ion at ambient temperature has been revealed. In the last part of this thesis the fundamental aspect of the energy transfer process that takes place in laser crystal LYF codoped with an 4 f element Nd 3+ and an 5 f one U 3+ has been investigated. (author). 111 refs., 69 figs., 19 tabs
A survey of the mechanical properties of uranium alloys U-5Mo-3Nb wt.% and U-3Mo-3Nb wt.%
Energy Technology Data Exchange (ETDEWEB)
Dupont, G.
1969-04-15
In a continuing program on the development of soft and ductile uranium alloys for armament applications, two compositions were studied. These gamma extruded uranium alloys were U-5Mo-3Nb wt.% and U-3Mo-3Nb wt.%. This study was carried out to determine the influence of tempering heat treatments associated with extrusion on the ductility of these uranium alloys. The mechanical properties of both alloys were measured in the extruded condition, in the extruded and annealed condition and in the quenched and tempered condition. A maximum elongation of 13.7% in tension with a low amount of work hardening was obtained for the U-3Mo-3Nb wt.% alloy after 1 1/2 hours anneal at 1200 deg F (650 deg C) followed by a rapid cooling in water at 70 deg F (21 deg C). A maximum elongation of 17.3% with a large amount of work hardening was obtained for alloy U-5Mo-3Nb wt.% after vacuum annealing, normalizing, gamma phase solubilizing at 1500 deg F (815 deg C) and quenching in water at 700 deg F (210 deg C). The maximum ductility achieved in these two alloys by our approaches is low compared with the ductility of Armco Iron employed for the same applications in the field of ballistics.
One-step radiosynthesis of {sup 18}F-AlF-NOTA-RGD{sub 2} for tumor angiogenesis PET imaging
Energy Technology Data Exchange (ETDEWEB)
Liu, Shuanglong; Liu, Hongguang; Xu, Yingding; Cheng, Zhen [Stanford University, Molecular Imaging Program at Stanford (MIPS), Canary Center at Stanford for Cancer Early Detection, Bio-X Program, Department of Radiology, Stanford, CA (United States); Jiang, Han [Stanford University, Molecular Imaging Program at Stanford (MIPS), Canary Center at Stanford for Cancer Early Detection, Bio-X Program, Department of Radiology, Stanford, CA (United States); Institute of Nuclear Medicine and Molecular Imaging, and the Second Affiliated Hospital of Zhejiang University School of Medicine, Key Laboratory of Medical Molecular Imaging of Zhejiang Province, Department of Nuclear Medicine, Medical PET Center, Hangzhou, Zhejiang (China); Zhang, Hong [Institute of Nuclear Medicine and Molecular Imaging, and the Second Affiliated Hospital of Zhejiang University School of Medicine, Key Laboratory of Medical Molecular Imaging of Zhejiang Province, Department of Nuclear Medicine, Medical PET Center, Hangzhou, Zhejiang (China)
2011-09-15
One of the major obstacles of the clinical translation of {sup 18}F-labeled arginine-glycine-aspartic acid (RGD) peptides has been the laborious multistep radiosynthesis. In order to facilitate the application of RGD-based positron emission tomography (PET) probes in the clinical setting we investigated in this study the feasibility of using the chelation reaction between Al{sup 18}F and a macrocyclic chelator-conjugated dimeric RGD peptide as a simple one-step {sup 18}F labeling strategy for development of a PET probe for tumor angiogenesis imaging. Dimeric cyclic peptide E[c(RGDyK)]{sub 2} (RGD{sub 2}) was first conjugated with a macrocyclic chelator, 1,4,7-triazacyclononane-1,4,7-triacetic acid (NOTA), and the resulting bioconjugate NOTA-RGD{sub 2} was then radiofluorinated via Al{sup 18}F intermediate to synthesize {sup 18}F-AlF-NOTA-RGD{sub 2}. Integrin binding affinities of the peptides were assessed by a U87MG cell-based receptor binding assay using {sup 125}I-echistatin as the radioligand. The tumor targeting efficacy and in vivo profile of {sup 18}F-AlF-NOTA-RGD{sub 2} were further evaluated in a subcutaneous U87MG glioblastoma xenograft model by microPET and biodistribution. NOTA-RGD{sub 2} was successfully {sup 18}F-fluorinated with good yield within 40 min using the Al{sup 18}F intermediate. The IC{sub 50} of {sup 19}F-AlF-NOTA-RGD{sub 2} was determined to be 46 {+-} 4.4 nM. Quantitative microPET studies demonstrated that {sup 18}F-AlF-NOTA-RGD{sub 2} showed high tumor uptake, fast clearance from the body, and good tumor to normal organ ratios. NOTA-RGD{sub 2} bioconjugate has been successfully prepared and labeled with Al{sup 18}F in one single step of radiosynthesis. The favorable in vivo performance and the short radiosynthetic route of {sup 18}F-AlF-NOTA-RGD{sub 2} warrant further optimization of the probe and the radiofluorination strategy to accelerate the clinical translation of {sup 18}F-labeled RGD peptides. (orig.)
Tjernobyl och rennäringen - Lägesrapport från Sverige
Directory of Open Access Journals (Sweden)
G. Åhman
1988-06-01
Full Text Available Status report about Chernobyl and reindeer husbandry in Sweden including participants' discussion.Abstract in Swedish / Sammanfattning: Den 1 juli hojdes grånsvårdet for Cs-137 i bl a renkott från 300 till 1 500 Bq/kg. Efter hojningen av grånsvårdet friklassades nåstan alla samebyar i Norrbottens lån under sarvslakten. Samtliga fjållsamebyar i Norrbottens lån utom den sydligaste år tills vidare helt friklassade. Tre samebyar i sodra delen av Jåmtlands lån var friklassade under sarvslakten. I ovrigt omfattas all renslakt i Våsterbottens och Jåmtlands lån av kontroll betråffande Cs-137. Under juli - aug i år var cesiumhalten lågre ån vid motsvarande tidpunkt i f jol (tabell 1 och figur 1. Under juli - aug slaktades drygt 1 000 renar i skogslandet i sodra delen av Våsterbottens lån (tabell 3. Fr.o.m. andra veckan i juli godkåndes de fiesta slaktkropparna. Halveringstiden for Cs-137 i renarna, som betade i skogslandet kring inlandsbanan i sodra delen av Våsterbottenslån, har beråknats till ca en vecka. Genom tidigarelåggning av sarvslakter i Våsterbottens lån (tabell 3 och norra delen av Jåmtlands lån (tabell 5 minskades kassationen med ett par tusen slaktkroppar. Under senare delen av september steg cesiumhalten till ungefår samma nivå som i f jol. En långsiktig prognos har utarbetats betråffande halten Cs-137 i renar på naturbete. Prognosen visar att omfattande åtgårder kommer att behova vidtagas under de nårmaste 15 - 25 åren om ren-kottet från samebyarna i sodra delen av Våsterbottens lån och norra delen av Jåmtlands lån skall kunna god-kånnas som livsmedel vid ett riktvårde på 1 500 Bq Cs-137/kg kott.
Origin of Abelian gauge symmetries in heterotic/F-theory duality
International Nuclear Information System (INIS)
Cvetič, Mirjam; Grassi, Antonella; Klevers, Denis; Poretschkin, Maximilian; Song, Peng
2016-01-01
We study aspects of heterotic/F-theory duality for compactifications with Abelian gauge symmetries. We consider F-theory on general Calabi-Yau manifolds with a rank one Mordell-Weil group of rational sections. By rigorously performing the stable degeneration limit in a class of toric models, we derive both the Calabi-Yau geometry as well as the spectral cover describing the vector bundle in the heterotic dual theory. We carefully investigate the spectral cover employing the group law on the elliptic curve in the heterotic theory. We find in explicit examples that there are three different classes of heterotic duals that have U(1) factors in their low energy effective theories: split spectral covers describing bundles with S(U(m)×U(1)) structure group, spectral covers containing torsional sections that seem to give rise to bundles with SU(m)×ℤ_k structure group and bundles with purely non-Abelian structure groups having a centralizer in E_8 containing a U(1) factor. In the former two cases, it is required that the elliptic fibration on the heterotic side has a non-trivial Mordell-Weil group. While the number of geometrically massless U(1)’s is determined entirely by geometry on the F-theory side, on the heterotic side the correct number of U(1)’s is found by taking into account a Stückelberg mechanism in the lower-dimensional effective theory. In geometry, this corresponds to the condition that sections in the two half K3 surfaces that arise in the stable degeneration limit of F-theory can be glued together globally.
International Nuclear Information System (INIS)
Wu Yongyong; Zhong Pingru; Wang Gaoshan
2014-01-01
The laboratory study for decreasing the concentration of Ra, U, Mn and F ions in acid wastewater of uranium mining and metallurgy was investigated based on lime neutralization-precipitation technology. The technological flowsheet was composed of removing radium by barium chloride, manganese by air aeration and fluorin by aluminum sulfate, and the quality of the disposed effluent could be accorded with the discharge criteria defined by the state, as the neutralization conditions of pH just being 8.5. Furthermore, the lower precipitation pH value can effectively decrease sediment volume, and reduce the subsequent processing pressures. The technological methods were viable and universally applicable for uranium mining and metallurgy wastewater purification. (authors)
Structural instability and ground state of the U_2Mo compound
International Nuclear Information System (INIS)
Losada, E.L.; Garcés, J.E.
2015-01-01
This work reports on the structural instability at T = 0 °K of the U_2Mo compound in the C11_b structure under the distortion related to the C_6_6 elastic constant. The electronic properties of U_2Mo such as density of states (DOS), bands and Fermi surface (FS) are studied to understand the source of the instability. The C11_b structure can be interpreted as formed by parallel linear chains along the z-directions each one composed of successive U–Mo–U blocks. Hybridization due to electronic interactions inside the U–Mo–U blocks is slightly modified under the D_6 distortion. The change in distance between chains modifies the U–U interaction and produces a split of f-states. The distorted structure is stabilized by a decrease in energy of the hybridized states, mainly between d-Mo and f-U states, together with the f-band split. Consequently, an induced Peierls distortion is produced in U_2Mo due to the D_6 distortion. It is important to note that the results of this work indicate that the structure of the ground state of the U_2Mo compound is not the assumed C11_b structure. It is suggested for the ground state a structure with hexagonal symmetry (P6 #168), ∼0.1 mRy below the energy of the recently proposed Pmmn structure. - Highlights: • Structural instability of the C11b compound due to the D6 deformation. • Induced Peierls distortion due to the D6 deformation. • Distorted structure is stabilized by hybridization and split of f-Uranium state. • P6 (#168) suggested ground state for the U_2Mo compound.
SFM study of ion-induced hillocks on LiF exposed to thermal and optical annealing
International Nuclear Information System (INIS)
Mueller, C.; Benyagoub, A.; Lang, M.; Neumann, R.; Schwartz, K.; Toulemonde, M.; Trautmann, C.
2003-01-01
Single crystals of LiF were irradiated at 10 different temperatures from room temperature to 780 K with Pb ions of 4.1 MeV/u. The irradiated surfaces were analyzed with scanning force microscopy, which revealed ion-induced hillocks with diameters of ∼20 nm and with heights of a few nm. Above 450 K, the number of hillocks strongly decreased with irradiation temperature. No hillocks were created under irradiation at 780 K. In addition, LiF samples irradiated at room temperature with Ni (2.5 MeV/u) and U ions (11.1 MeV/u) were bleached with UV-light on part of the crystal surface. In the bleached area, the characteristic F- and F 2 -centers disappeared, whereas the mean diameter and height of the hillocks did not show any significant change
2010-01-01
... tolerances see § 51.1151. (f) Internal quality: Lots meeting the internal requirements for “U.S. Grade AA... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. Fancy. 51.1141 Section 51.1141 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...
U-Zr alloy: XPS and TEM study of surface passivation
Paukov, M.; Tkach, I.; Huber, F.; Gouder, T.; Cieslar, M.; Drozdenko, D.; Minarik, P.; Havela, L.
2018-05-01
Surface reactivity of Uranium metal is an important factor limiting its practical applications. Bcc alloys of U with various transition metals are much less reactive than pure Uranium. So as to specify the mechanism of surface protection, we have been studying the U-20 at.% Zr alloy by photoelectron spectroscopy and transmission electron microscopy. The surface was studied in as-obtained state, in various stages of surface cleaning, and during an isochronal annealing cycle. The analysis based on U-4f, Zr-3p, and O-1 s spectra shows that a Zr-rich phase segregates at the surface at temperatures exceeding 550 K, which provides a self-assembled coating. The comparison of oxygen exposure of the stoichiometric and coated surfaces shows that the coating is efficiently preventing the oxidation of uranium even at elevated temperatures. The coating can be associated with the UZr2+x phase. TEM study indicated that the coating is about 20 nm thick. For the clean state, the U-4f core-level lines of the bcc alloy are practically identical to those of α-U, revealing similar delocalization of the 5f electronic states.
A study of a few compounds with unpaired f electrons
International Nuclear Information System (INIS)
Soulie, Edgar.
1977-07-01
Ligand field theory is applied to compounds of uranium (V) (configuration f 1 ), uranium (IV) (f 2 ), and to hexagonal neodymium sesquioxide A-Nd 2 O 3 (f 3 ). The reinterpretation of the electronic absorption and paramagnetic resonance spectra of UF 6 Cs allows a determination of the spin-orbit coupling constant, the Newman intrinsic crystal field parameters, and the orbital angular momentum reduction factors, pointing to a degree of sigma covalence for the 5f orbitals. Raman diffusion and carbon 13 SMR spectra of U(NCS) 8 [N(C 2 H 5 ) 4 ] 4 dissolved in CD 3 NO 2 show that cubical coordination for uranium, known for the solid, is maintained in solution. Thermal variation of the magnetic susceptibility of this complex, quantitatively interpreted, leads to the description of the energy levels of f 2 configuration. For U(CH 3 -CO-CH-CO-CH 3 ) 4 the interpretation of the susceptibility curve results into the prediction of the susceptibility anisotropy, and the calculation of the unpaired spin density on the methin proton. Last, it was shown by proton magnetic resonance that U(CF 3 -CO-CH-CO-C 6 H 5 ) 4 behaves as a chemical shift reagent [fr
Anthropometric Survey of U.S. Army Personnel: Pilot Summary Statistics, 1988
1991-07-01
ppuilation it purports to represent. It was apparent in the mid-eighties that the Army’s ai~thropcmetric data base had serious deficiencies that...1987-1988 to correct these deficiencies . The goal of the 1988 Anthropcmetric Survey was to acquire a large body of data fzom comparably measured males...2ol w;t-h -&-2 th- -3- lying on tlhe f.i-r- tk2 .rl u.f the fcrz:firrjcr is callcultxi -a- folicý,r;: lV’RTS?-7..WrAI tElJF~j, fThEll plus - ST- U
Laboratory studies of 235U enrichment by chemical separation methods
International Nuclear Information System (INIS)
Daloisi, P.J.; Orlett, M.J.; Tracy, J.W.; Saraceno, A.J.
1976-01-01
Laboratory experiments on 235 U enrichment processes based on column redox ion exchange, electrodialysis, and gas exchange chromatography performed from August 1972 to September 1974 are summarized. Effluent from a 50 to 50 weight mixture of U +4 and U +6 (as UO 2 2+ ), at a total uranium concentration of 5 mg U per ml in 0.25N H 2 SO 4 -0.03N NaF solution, passing through a 100 cm length cation exchange column at 0.5 ml/min flow rates, was enriched in 235 U by 1.00090 +- .00012. The enriched fraction was mostly in the +6 valence form while the depleted fraction was U +4 retained on the resin. At flow rates of 2 ml/min, the enrichment factor decreases to 1.00033 +- .00003. In the electrodialysis experiments, the fraction of uranium diffusing through the membranes (mostly as +6 valence state) in 4.2 hours is enriched in 235 U by 1.00096 +- .00012. Gas exchange chromatography tests involved dynamic and static exposure of UF 6 over NaF. In dynamic tests, no significant change in isotopic abundance occurred in the initial one-half weight cut of UF 6 . The measured relative 235 U/ 238 U mole ratios were 1.00004 +- .00004 for these runs. In static runs, enrichment became evident. For the NaF(UF 6 )/sub x/-UF 6 system, there is 235 U depletion in the gas phase, with a single-stage factor of 1.00033 at 100 0 C and 1.00025 at 25 0 C after 10 days of equilibration. The single-stage or unit holdup time is impractically long for all three chemical processes
R-parity violation in F-theory
Energy Technology Data Exchange (ETDEWEB)
Romão, Miguel Crispim [Physics and Astronomy, University of Southampton,SO17 1BJ Southampton (United Kingdom); Karozas, Athanasios [Physics Department, Theory Division, Ioannina University,GR-45110 Ioannina (Greece); King, Stephen F. [Physics and Astronomy, University of Southampton,SO17 1BJ Southampton (United Kingdom); Leontaris, George K. [Physics Department, Theory Division, Ioannina University,GR-45110 Ioannina (Greece); Meadowcroft, Andrew K. [Physics and Astronomy, University of Southampton,SO17 1BJ Southampton (United Kingdom)
2016-11-14
We discuss R-parity violation (RPV) in semi-local and local F-theory constructions. We first present a detailed analysis of all possible combinations of RPV operators arising from semi-local F-theory spectral cover constructions, assuming an SU(5) GUT. We provide a classification of all possible allowed combinations of RPV operators originating from operators of the form 10⋅5̄⋅5̄, including the effect of U(1) fluxes with global restrictions. We then relax the global constraints and perform explicit computations of the bottom/tau and RPV Yukawa couplings, at an SO(12) local point of enhancement in the presence of general fluxes subject only to local flux restrictions. We compare our results to the experimental limits on each allowed RPV operator, and show that operators such as LLe{sup c}, LQd{sup c} and u{sup c}d{sup c}d{sup c} may be present separately within current bounds, possibly on the edge of observability, suggesting lepton number violation or neutron-antineutron oscillations could constrain F-theory models.
Dicty_cDB: Contig-U16008-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U16008-1 gap included 1557 5 1711154 1712676 PLUS 5 8 U16008 0 0 0 0 1 1 1 0 1 0 0 0 1 0 Show Contig...-U16008-1 Contig ID Contig-U16008-1 Contig update 2004. 6.11 Contig sequence >Contig-U16008-1 (Contig-U16008-1Q) /CSM_Contig/Contig-U16008... TAAGGTTTATGATTTTTGATTTTAGATTTTATATTTTATTTATTTTAATA AAAAAAAAAAAAAAAAA Gap gap included Contig length 1557 Ch...F LIFVHGSSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLN...SSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLNIGRTFR L
U.S. EPA, Pesticide Product Label, BROGDEX 594-F, 06/08/1984
2011-04-14
... ric •• .. t ,.1 '~'1 .. ':: 1;1 ), .'dll.)I\\S "f :.'.l1r .. ·,1 -1llut 1 .. 0 ,I fH,I~,jCX )vi) ~~"tI~C .... dX fur lu".) pp:n Hll .. 11.:> ~CI)l~n. USC b ~un~e. ut Sr~~J~x ...
11 CFR 104.20 - Reporting electioneering communications (2 U.S.C. 434(f)).
2010-01-01
... POLITICAL COMMITTEES AND OTHER PERSONS (2 U.S.C. 434) § 104.20 Reporting electioneering communications (2 U... 11 Federal Elections 1 2010-01-01 2010-01-01 false Reporting electioneering communications (2 U.S... electioneering communication is publicly distributed provided that the person making the electioneering...
Impacto de la ruptura de los progenitores en el estado de salud física de los hijos
Directory of Open Access Journals (Sweden)
José María Martinón
2017-06-01
Full Text Available El presente estudio tiene por objeto conocer el riesgo de desarrollo en los hijos de problemas en los marcadores de salud física relacionados con (inadaptación en el comportamiento asociado a la exposición a la separación de los progenitores. Se planificó un estudio transversal con un diseño orientado a la predicción del riesgo de problemas en los marcadores de salud física derivado del tipo de familia (familias intactas vs. familias con ruptura de los progenitores. El estudio se llevó a cabo en el área asistencial primaria del Complejo Hospitalario Universitario de Santiago de Compostela (España. Participaron en el estudio 467 niños y adolescentes, de los que 300 (64.2% provenían de familias con ruptura de progenitores y 167 (35.8% de familias intactas. Los datos de salud física se recogieron por medio de la entrevista estructurada Historia Estructurada de Desarrollo, del BASC. Se encontró que los hijos de progenitores separados tienen aproximadamente el doble de probabilidades de desarrollo de problemas gastrointestinales, genitourinarios, dermatológicos y neurológicos que los de familias intactas. La ruptura de los progenitores supone un factor de riesgo para la salud física de los hijos, incluyendo problemas genitourinarios, gastrointestinales, dermatológicos y neurológicos.
Flipped SU(5) times U(1) in superconformal models
Energy Technology Data Exchange (ETDEWEB)
Bailin, D.; Katechou, E.K. (Sussex Univ., Brighton (United Kingdom). School of Mathematical and Physical Sciences); Love, A. (London Univ. (United Kingdom))
1992-01-10
This paper reports that flipped SU(5) {times} U(1) models are constructed in the framework of tensoring of N = 2 superconformal minimal models quotiented by discrete symmetries. Spontaneous breaking of flipped SU(5) {times} U(1) and extra U(1) factors in the gauge group along F-flat directions of the effective potential is studied.
Ponka, Roger
2013-01-01
Au cours de ce stage effectué du 06 Novembre 2012 au 01 février 2013, à l’’Unité Mixte de Recherche Science et Technologie du Lait et de l’oeuf de l’INRA Agrocampus-Ouest de Rennes (France), nous avons déterminé la composition nutritionnelle des plats alimentaires et des produits laitiers de la région de l’Extrême-Nord du Cameroun. Ainsi, les teneurs en protéines, lipides, minéraux, acides aminés, vitamines ont été déterminées par les méthodes de référence. La table de composition des aliment...
Dicty_cDB: Contig-U09379-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U09379-1 gap included 899 2 1392012 1392912 PLUS 1 2 U09379 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09379-1 Contig ID Contig-U09379-1 Contig update 2002. 9.13 Contig sequence >Contig-U09379-1 (Contig...-U09379-1Q) /CSM_Contig/Contig-U09379-1Q.Seq.d AAAAATTTTTTAAACTAAAAAATAAAAAAAATAAATAAAAAAAAA...TTTAAAAATAATAATAAAAGTGAATATTATAATATTAT AATCTTTTTGGTATAATTGAAAAAGATCAATAATATATTAAAATTTCCAA AAAAAAAAA Gap gap included Contig...VSVCRAYATETATIENKTQIMGKMSGAQGAGFVLGPGIGFLLNFCNFTIG--- ---INNK******sn*finykl***f*kikqphfknlkiiikvniiil*sfwyn
Certification of U.S. instrumentation in Russian nuclear processing facilities
International Nuclear Information System (INIS)
Powell, D.H.; Sumner, J.N.
2000-01-01
Agreements between the United States (U.S.) and the Russian Federation (R.F.) require the down-blending of highly enriched uranium (HEU) from dismantled Russian Federation nuclear weapons. The Blend Down Monitoring System (BDMS) was jointly developed by the Los Alamos National Laboratory (LANL) and the Oak Ridge National Laboratory (ORNL) to continuously monitor the enrichments and flow rates in the HEU blending operations at the R.F. facilities. A significant requirement of the implementation of the BDMS equipment in R.F. facilities concerned the certification of the BDMS equipment for use in a Russian nuclear facility. This paper discusses the certification of the BDMS for installation in R.F. facilities, and summarizes the lessons learned from the process that can be applied to the installation of other U.S. equipment in Russian nuclear facilities
Cross sections and neutron yields for U233, U235 and Pu239 at 2200 m/sec
International Nuclear Information System (INIS)
Sjoestrand, N.G.; Story, J.S.
1960-04-01
The experimental information on the 2200 m/sec values for σ abs , σ f , α, ν and η for 233 U , 235 U and 23 been collected and discussed. The values will later be used in an evaluation of a 'best' set of data. In appendix the isotopic abundances of the uranium isotopes are discussed and also the alpha activities of the uranium isotopes and Pu-239
Structural instability and ground state of the U{sub 2}Mo compound
Energy Technology Data Exchange (ETDEWEB)
Losada, E.L., E-mail: losada@cab.cnea.gov.ar [SIM" 3, Centro Atómico Bariloche, Comisión Nacional de Energía Atómica (Argentina); Garcés, J.E. [Gerencia de Investigación y Aplicaciones Nucleares, Comisión Nacional de Energía Atómica (Argentina)
2015-11-15
This work reports on the structural instability at T = 0 °K of the U{sub 2}Mo compound in the C11{sub b} structure under the distortion related to the C{sub 66} elastic constant. The electronic properties of U{sub 2}Mo such as density of states (DOS), bands and Fermi surface (FS) are studied to understand the source of the instability. The C11{sub b} structure can be interpreted as formed by parallel linear chains along the z-directions each one composed of successive U–Mo–U blocks. Hybridization due to electronic interactions inside the U–Mo–U blocks is slightly modified under the D{sub 6} distortion. The change in distance between chains modifies the U–U interaction and produces a split of f-states. The distorted structure is stabilized by a decrease in energy of the hybridized states, mainly between d-Mo and f-U states, together with the f-band split. Consequently, an induced Peierls distortion is produced in U{sub 2}Mo due to the D{sub 6} distortion. It is important to note that the results of this work indicate that the structure of the ground state of the U{sub 2}Mo compound is not the assumed C11{sub b} structure. It is suggested for the ground state a structure with hexagonal symmetry (P6 #168), ∼0.1 mRy below the energy of the recently proposed Pmmn structure. - Highlights: • Structural instability of the C11b compound due to the D6 deformation. • Induced Peierls distortion due to the D6 deformation. • Distorted structure is stabilized by hybridization and split of f-Uranium state. • P6 (#168) suggested ground state for the U{sub 2}Mo compound.
Kasuya, T
2000-01-01
Mechanisms of the anomalous properties in the heavy fermion superconductor UBe sub 1 sub 3 and its alloys, in particular for the Th dopings, are studied in detail based on the fundamental electronic states to be consistent with all the crucial experimental results. As the reference systems for the magnetic polaron formation, Ce monopnictides, as well as USb and UTe, are mentioned. From detailed systematic studies of the dilute alloy systems, it is postulated that the 5f states in UBe sub 1 sub 3 split into the well-localized core 5f GAMMA sup 2 sub 7 singlet state and other delocalized 5f states situated around the Fermi energy forming the f-f magnetic polarons through the strong intra-atomic ferromagnetic f-f exchange interaction. The accompanied lattice polarons are also shown to play important roles. In the p-d band states, the f-f exchange interaction and the intersite p-f mixing interactions for the p-f Kondo state are of nearly equal strengths causing a rich variety of delicately balanced states. For th...
F.D.G. PET role in the localisation of primary neoplasias
International Nuclear Information System (INIS)
Audigier, C.; Billotey, C.; Deshayes, E.; Banayan, S.; Janier, M.
2009-01-01
Carcinomas of unknown primary site (C.U.P.) and para neoplastic syndromes have the common characteristic that an extensive conventional biological and imaging analysis fails in some instance to detect the primary tumour. F.D.G.-PET becomes recognized to provide interesting information in the case of 'head and neck' C.U.P. as well as in the case of neurological para neoplastic syndromes biologically well defined. When, either C.U.P. or para neoplastic syndromes, are less defined, F.D.G.-PET will not provide as much information as in the previous situation, although it can help in the etiologic diagnosis (oncologic or not) in some cases. (authors)
Indian Academy of Sciences (India)
R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22
When is f(x1,x2,... ,xn) = u1(x1) + u2(x2) +···+ un(xn)? ... (i) there exist non-zero integers p1,p2,... ,pk such that ..... probability measure for the countable collection of functions 1Ai , i = 1, 2, 3,. .... For question (B) a sufficient condition is that.
76 FR 35000 - Award of an Urgent Single-Source Grant to Heartland Alliance, Chicago, IL
2011-06-15
... Section 412 (c)(1)(A) of the Immigration and Nationality Act (INA) (8 U.S.C. 1522(c)(1)(A), as amended... refugees. Heartland Alliance will have the opportunity to receive a continuation award at the same amount...
Neutrinoless double beta decay in an SU(3)L x U(1)N model
International Nuclear Information System (INIS)
Pleitez, V.; Tonasse, M.D.
1993-01-01
A model for the electroweak interactions with SU (3) L x U(1) N gauge symmetry is considered. It is shown that, it is the conservation of F = L + B which forbids massive neutrinos and the neutrinoless double beta decay, (β β) On u. Explicit and spontaneous breaking of F imply that the neutrinos have an arbitrary mass and (β β) On u proceeds also with some contributions that do not depend explicitly on the neutrino mass. (author)
Study on Utilization of Super Grade Plutonium in Molten Salt Reactor FUJI-U3 using CITATION Code
Wulandari, Cici; Waris, Abdul; Pramuditya, Syeilendra; Asril, Pramutadi AM; Novitrian
2017-07-01
FUJI-U3 type of Molten Salt Reactor (MSR) has a unique design since it consists of three core regions in order to avoid the replacement of graphite as moderator. MSR uses floride as a nuclear fuel salt with the most popular chemical composition is LiF-BeF2-ThF4-233UF4. ThF4 and 233UF4 are the fertile and fissile materials, respectively. On the other hand, LiF and BeF2 working as both fuel and heat transfer medium. In this study, the super grade plutonium will be utilized as substitution of 233U since plutonium is easier to be obtained compared to 233U as main fuel. Neutronics calculation was performed by using PIJ and CITATION modules of SRAC 2002 code with JENDL 3.2 as nuclear data library.
Neutron induced fission cross sections for 232Th, 235,238U, 237Np, and 239Pu
International Nuclear Information System (INIS)
Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Hill, N.W.; Carlson, A.D.; Wasson, O.A.
1989-01-01
Neutron-induced fission cross section ratios for samples of 232 Th, 235,238 U, 237 Np and 239 Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence from 3 to 30 MeV. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.178 MeV. From 30 to 400 MeV cross section values were determined using the neutron fluence measured with a plastic scintillator. Cross section values of 232 Th, 235,238 U, 237 Np and 239 Pu were computed from the ratio data using the authors' values for 235 U(n,f). In addition to providing new results at high neutron energies, these data highlight several areas of deficiency in the evaluated nuclear data files and provide new information for the 235 U(n,f) standard
Dicty_cDB: Contig-U03323-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U03323-1 no gap 533 2 4820223 4820756 PLUS 2 1 U03323 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U03323-1 Contig ID Contig-U03323-1 Contig update 2001. 8.29 Contig sequence >Contig-U03323-1 (Contig...-U03323-1Q) /CSM_Contig/Contig-U03323-1Q.Seq.d ACATGTGACATTACTATTGGTAAATGTCAATGTTTAAAAAATACATGGTC ...TCAATAATGGTGGTGGTGGTGGTTTAGGT GAAACCCCCAATAGTAATAGTAATAGTGGTGAACTAGTTATCCCACCAAA ATCAAATACTACATTAAATGAAGAAACAGGTGG Gap no gap Contig... Link to clone list U03323 List of clone(s) est1= FC-IC0176F ,1,534 Translated Amino Acid sequence TCDITIGKC
International Nuclear Information System (INIS)
Weck, Philippe F.; Kim, Eunja
2016-01-01
The structure–property relationships of bulk CeO_2 and Ce_2O_3 have been investigated using AM05 and PBEsol exchange–correlation functionals within the frameworks of Hubbard-corrected density functional theory (DFT+U) and density functional perturbation theory (DFPT+U). Compared with conventional PBE+U, RPBE+U, PW91+U and LDA+U functionals, AM05+U and PBEsol+U describe experimental crystalline parameters and properties of CeO_2 and Ce_2O_3 with superior accuracy, especially when +U is chosen close to its value derived by the linear-response approach. Lastly, the present findings call for a reexamination of some of the problematic oxide materials featuring strong f- and d-electron correlation using AM05+U and PBEsol+U.
Weatherization Assistance Program Fact Sheet
Energy Technology Data Exchange (ETDEWEB)
None
2018-02-01
The U.S. Department of Energy’s (DOE) Weatherization Assistance Program reduces energy costs for low-income households by increasing the energy e ciency of their homes, while ensuring their health and safety. The Program supports 8,500 jobs and provides weatherization services to approximately 35,000 homes every year using DOE funds.
Intensity of Urban Heat Islands in Tropical and Temperate Climates
Directory of Open Access Journals (Sweden)
Margarete Cristiane de Costa Trindade Amorim
2017-12-01
Full Text Available Nowadays, most of the Earth’s population lives in urban areas. The replacement of vegetation by buildings and the general soil sealing, associated with human activity, lead to a rise in cities temperature, resulting in the formation of urban heat islands. This article aims to evaluate the intensity and the hourly maintenance of the atmospheric heat islands in two climates: one tropical (Presidente Prudente, Brazil and one temperate (Rennes, France throughout 2016. For this, air temperature and hourly averages were measured and calculated using both a HOBO datalogger (U23-002—protected under the same RS3 brand and weather stations Davis Vantage PRO 2. The daily evolution of the heat islands presented characteristics that varied according to the hours and seasons of the year. For both Rennes and Presidente Prudente, the largest magnitudes occurred overnight, being more greatly expressed in the tropical environment and during the driest months (winter in the tropical city and summer in the temperate one. The variability of synoptic conditions from one month to another also leads to a great heterogeneity of UHI intensity throughout the year.
Cross sections and neutron yields for U-233, U-235 and Pu-239 at 2200 m/sec
Energy Technology Data Exchange (ETDEWEB)
Sjoestrand, N G; Story, J S
1960-04-15
The experimental information on the 2200 m/sec values for {sigma}{sub abs}, {sigma}{sub f}, {alpha}, {nu} and {eta} for {sup 233}U , {sup 235}U and {sup 23} been collected and discussed. The values will later be used in an evaluation of a 'best' set of data. In appendix the isotopic abundances of the uranium isotopes are discussed and also the alpha activities of the uranium isotopes and Pu-239.
48 CFR 47.303-1 - F.o.b. origin.
2010-10-01
... TRANSPORTATION Transportation in Supply Contracts 47.303-1 F.o.b. origin. (a) Explanation of delivery term. F.o.b... a port area having water transportation service) or the carrier's freight station; (3) To a U.S... rules and regulations; (4) Be responsible for any loss of and/or damage to the goods— (i) Occurring...
Hervella, M; Svensson, E M; Alberdi, A; Günther, T; Izagirre, N; Munters, A R; Alonso, S; Ioana, M; Ridiche, F; Soficaru, A; Jakobsson, M; Netea, M G; de-la-Rua, C
2016-05-19
After the dispersal of modern humans (Homo sapiens) Out of Africa, hominins with a similar morphology to that of present-day humans initiated the gradual demographic expansion into Eurasia. The mitogenome (33-fold coverage) of the Peştera Muierii 1 individual (PM1) from Romania (35 ky cal BP) we present in this article corresponds fully to Homo sapiens, whilst exhibiting a mosaic of morphological features related to both modern humans and Neandertals. We have identified the PM1 mitogenome as a basal haplogroup U6*, not previously found in any ancient or present-day humans. The derived U6 haplotypes are predominantly found in present-day North-Western African populations. Concomitantly, those found in Europe have been attributed to recent gene-flow from North Africa. The presence of the basal haplogroup U6* in South East Europe (Romania) at 35 ky BP confirms a Eurasian origin of the U6 mitochondrial lineage. Consequently, we propose that the PM1 lineage is an offshoot to South East Europe that can be traced to the Early Upper Paleolithic back migration from Western Asia to North Africa, during which the U6 lineage diversified, until the emergence of the present-day U6 African lineages.
International Nuclear Information System (INIS)
Adam, J.; Chitra Bhatia; Katovskij, K.
2011-01-01
Spallation neutrons produced in a collision of 2.33 GeV deuteron beam with the large lead target are moderated by the thick graphite block surrounding the target and used to activate the radioactive samples of nat U and Th put at the three different positions, identified as holes 'a', 'b' and 'c' in the graphite block. Rates of the (n, f), (n, γ), and (n, 2n) reactions in the two samples are determined using the gamma spectrometry. Ratio of the experimental reaction rates, R(n, 2n)/R(n, f) for the 232 Th and nat U are estimated in order to understand the role of reactions of (n, xn) type in Accelerator Driven Subcritical Systems. For the Th-sample, the ratio is ∼ 54(10)% in case of hole 'a' and ∼ 95(57)% in case of hole 'b' compared to 1.73(20)% for the hole 'a' and 0.710(9)% for the hole 'b' in case of the nat U sample. Also the ratio of fission rates in uranium to thorium, nat U(n, f)/ 232 Th(n, f), is ∼ 11.2(17) in case of hole 'a' and 26.8(85) in hole 'b'. Similarly, ratio 238 U(n, 2n)/ 232 Th(n, 2n) is 0.36(4) for the hole 'a' and 0.20(10) for the hole 'b' showing that 232 Th is more prone to the (n, xn) reaction than 238 U. All the experimental reaction rates are compared with the simulated ones by generating neutron fluxes at the three holes from MCNPX 2.6c and making use of LA150 library of cross sections. The experimental and calculated rates of all the three reactions are in good agreement. The transmutation power of the set-up is estimated using the rates of (n, γ) and (n, 2n) reactions for both the samples in the three holes and compared with some of the results of the 'Energy plus Transmutation' set-up and TARC experiment
distributions for the thermal neutron induced fission of 234U
Directory of Open Access Journals (Sweden)
Al-Adili A.
2016-01-01
In addition, the analysis of thermal neutron induced fission of 234U(n,f will be discussed. Currently analysis of data is ongoing, originally taken at the ILL reactor. The experiment is of particular interest since no measurement exist of the mass and energy distributions for this system at thermal energies. One main problem encountered during analysis was the huge background of 235U(nth,f. Despite the negligible isotopic traces in the sample, the cross section difference is enormous. Solution to this parasitic background will be highlighted.
U.S. EPA, Pesticide Product Label, , 11/05/1985
2011-04-21
... u_tr01 1~ 5pr~nllft lrrJ9jtt~ or(~~lds ot Mbtll CIS.~it I ... 00 riot J~~dy lOre ttrdfl 12·~, pcurld~ {,er acre ... 1[,cl1jde tilE' ~asal ~,ortIQI, of tt.f ;~"f ere"il' P,~,~,ly ...
Energy Technology Data Exchange (ETDEWEB)
Schelter, Eric John [Los Alamos National Laboratory; Wu, Ruilian [Los Alamos National Laboratory; Scott, Brian L [Los Alamos National Laboratory; Thompson, Joe D [Los Alamos National Laboratory; Batista, Enrique R [Los Alamos National Laboratory; Morris, David E [Los Alamos National Laboratory; Kiplinger, Jaqueline L [Los Alamos National Laboratory
2008-01-01
Actinide complexes of the redox-active ligand dpp-BIAN{sup 2-} (dpp-BIAN = bis(2,6-diisopropylphenyl)acenaphthylene), An(dpp-BIAN){sub 2}(THF){sub n} (An = Th, n = 1; An = U, n = 0, 1) have been prepared. Solid-state magnetic and single-crystal X-ray data for U(dpp-BIAN){sub 2}(THF){sub n} show when n = 0, the complex exists in an f{sup 2}-{pi}*{sup 4} configuration; whereas an intramolecular electron transfer occurs for n = 1, resulting in an f{sup 3}-{pi}*{sup 3} ground configuration. The magnetic data also indicate that interconversion between the two forms of the complex is possible, limited only by the ability of THF vapor to penetrate the solid on cooling of the sample. Spectroscopic data indicate the complex exists solely in the f{sup 2}-{pi}*{sup 4} form in solution, evidenced by the appearance of only small changes in the electronic absorption spectra of the U(dpp-BIAN){sub 2} complex on titration with THF and by measurement of the solution magnetic moment m d{sub 8}-tetrahydrofuran using Evans method. Electrochemistry of the complexes is reported, with small differences observed in wave potentials between metals and in the presence of THF. These data represent the first example of a well-defined, reversible intramolecular electron transfer in an f-element complex and the second example of oxidation state change through dative interaction with a metal ion.
{sup 18}F-labeled RGD peptide: initial evaluation for imaging brain tumor angiogenesis
Energy Technology Data Exchange (ETDEWEB)
Chen Xiaoyuan; Park, Ryan; Shahinian, Anthony H.; Tohme, Michel; Khankaldyyan, Vazgen; Bozorgzadeh, Mohammed H.; Bading, James R.; Moats, Rex; Laug, Walter E.; Conti, Peter S. E-mail: pconti@usc.edu
2004-02-01
Brain tumors are highly angiogenesis dependent. The cell adhesion receptor integrin {alpha}{sub v}{beta}{sub 3} is overexpressed in glioma and activated endothelial cells and plays an important role in brain tumor growth, spread and angiogenesis. Suitably labeled {alpha}{sub v}{beta}{sub 3}-integrin antagonists may therefore be useful for imaging brain tumor associated angiogenesis. Cyclic RGD peptide c(RGDyK) was labeled with {sup 18}F via N-succinimidyl-4-[{sup 18}F]fluorobenzoate through the side-chain {epsilon}-amino group of the lysine residue. The radiotracer was evaluated in vivo for its tumor targeting efficacy and pharmacokinetics in subcutaneously implanted U87MG and orthotopically implanted U251T glioblastoma nude mouse models by means of microPET, quantitative autoradiography and direct tissue sampling. The N-4-[{sup 18}F]fluorobenzoyl-RGD ([{sup 18}F]FB-RGD) was produced in less than 2 h with 20-25% decay-corrected yields and specific activity of 230 GBq/{mu}mol at end of synthesis. The tracer showed very rapid blood clearance and both hepatobiliary and renal excretion. Tumor-to-muscle uptake ratio at 30 min was approximately 5 in the subcutaneous U87MG tumor model. MicroPET imaging with the orthotopic U251T brain tumor model revealed very high tumor-to-brain ratio, with virtually no uptake in the normal brain. Successful blocking of tumor uptake of [{sup 18}F]FB-RGD in the presence of excess amount of c(RGDyK) revealed receptor specific activity accumulation. Hence, N-4-[{sup 18}F]fluorobenzoyl labeled cyclic RGD peptide [{sup 18}F]FB-RGD is a potential tracer for imaging {alpha}{sub v}{beta}{sub 3}-integrin positive tumors in brain and other anatomic locations.
Reexamining the role of the (n ,γ f ) process in the low-energy fission of 235U and 239Pu
Lynn, J. E.; Talou, P.; Bouland, O.
2018-06-01
The (n ,γ f ) process is reviewed in light of modern nuclear reaction calculations in both slow and fast neutron-induced fission reactions on 235U and 239Pu. Observed fluctuations of the average prompt fission neutron multiplicity and average total γ -ray energy below 100-eV incident neutron energy are interpreted in this framework. The surprisingly large contribution of the M 1 transitions to the prefission γ -ray spectrum of 239Pu is explained by the dominant fission probabilities of 0+ and 2+ transition states, which can only be accessed from compound nucleus states formed by the interaction of s -wave neutrons with the target nucleus in its ground state, and decaying through M 1 transitions. The impact of an additional low-lying M 1 scissors mode in the photon strength function is analyzed. We review experimental evidence for fission fragment mass and kinetic-energy fluctuations in the resonance region and their importance in the interpretation of experimental data on prompt neutron data in this region. Finally, calculations are extended to the fast energy range where (n ,γ f ) corrections can account for up to 3% of the total fission cross section and about 20% of the capture cross section.
Directory of Open Access Journals (Sweden)
Mamadou Ciss
Full Text Available Between 1975 to 2011, aphid Relative Growth Rates (RGR were modelled as a function of mean outdoor temperature and host plant phenology. The model was applied to the grain aphid Sitobion avenae using data on aphid counts in winter wheat at two different climate regions in France (oceanic climate, Rennes (western France; continental climate, Paris. Mean observed aphid RGR was higher in Paris compared to the Rennes region. RGR increased with mean temperature, which is explained by aphid reproduction, growth and development being dependent on ambient temperature. From the stem extension to the heading stage in wheat, there was either a plateau in RGR values (Rennes or an increase with a maximum at heading (Paris due to high intrinsic rates of increase in aphids and also to aphid immigration. From the wheat flowering to the ripening stage, RGR decreased in both regions due to the low intrinsic rate of increase in aphids and high emigration rate linked to reduced nutrient quality in maturing wheat. The model validation process showed that the fitted models have more predictive power in the Paris region than in the Rennes region.
Ulanov, V A; Hoffmann, S K; Zaripov, M M
2003-01-01
Pressure and temperature variations of the spin-Hamiltonian parameters and electron paramagnetic resonance (EPR) linewidths of non-central Jahn-Teller [CuF sub 4 F sub 4] sup 6 sup - complexes in SrF sub 2 crystal were studied by continuous-wave EPR. It was found that the static spin-Hamiltonian parameters, found at T = 85 K and at normal pressure (g sub | sub | = 2.491, g sub p sub e sub r sub p sub e sub n sub d sub i sub c sub u sub l sub a sub r = 2.083, a sub p sub a sub r sub a sub l sub l sub e sub l = 360, a sub p sub e sub r sub p sub e sub n sub d sub i sub c sub u sub l sub a sub r = 26, A sub x sub ' sub ' = 96, A sub y sub ' sub ' = 99, A sub z sub ' sub ' = 403 and beta sub e sub x sub p = 17 diameter), are slightly changed with hydrostatic pressure and, at T = 85 K and P = 550 MPa, become equal to g sub | sub | = 2.489, g sub p sub e sub r sub p sub e sub n sub d sub i sub c sub u sub l sub a sub r = 2.083, a sub | sub | 348, a sub p sub e sub r sub p sub e sub n sub d sub i sub c sub u sub l s...
2001-01-01
Põhjamaades toimuva Baltimaade kultuurifestivali raames rühmituse F.F.F.F. ehtenäitus "Igapäeva leib" Porvoos kuni 30. IX, Turus 5.-28. X. Eksponeeritakse kunstnike viimasel aastal valminud töid leivaküpsetamisele viitavates ahjuvormides.
Report of Investigation: Lieutenant General John F. Mulholland U.S. Army (Redacted)
2014-06-09
unprofessional ... I’m just venting ... but you guys have pissed me the f--k off.2 One complainant stated he infonned Maj Gen Laster he believed LTG...L TG Mulh<.)lland) needed to stop as he was bein g unprofessional and remarked he was just venting but "you guys have pissed me the f--k off...course of his career. (b) (6) (b) (7)(() (b) 161 !bl (7l(CJoffered similar testimoJ1yto . testified L TG Mulholland stated the team ··had pissed me
A Stable U Isotopic Perspective on the U Budget and Global Extent of Modern Anoxia in the Ocean.
Tissot, F.; Dauphas, N.
2015-12-01
Isotopic fractionation between U4+ and U6+makes U stable isotopes potential tracers of global paleoredox conditions. In this work [1], we put the U-proxy up to a test against a highly constrained system: the modern ocean. We measured a large number of seawater samples from geographically diverse locations and found that the open ocean has a homogenous isotopic composition at δ238USW= -0.392 ± 0.005 ‰ (rel. to CRM-112a). From our measurement of rock samples (n=64) and compilations of literature data (n=380), we then estimated the U isotopic compositions of the various reservoirs involved in the modern oceanic U budget, as well as the fractionation factors associated with U incorporation into those reservoirs. Using a steady-state model, we compared the isotopic composition of the seawater predicted by the four most recent U oceanic budgets [2-5] to the modern seawater value we measured. Three of these budgets [2-4] predict a seawater isotopic composition in very good agreement with the observed δ238USW, which strengthens our confidence in the isotopic fractionation factors associated with each deposition environment and the fact that U is at steady-state in the modern ocean. The U oceanic budget of Henderson and Anderson (2003) does not reproduce the observed seawater composition because the U flux to anoxic/euxinic sediments relative to the total U flux out of the ocean is high in their model, which our analysis shows cannot be correct. The U isotopic composition of seawater is used to constrain the extent of anoxia in the modern ocean (% of seafloor covered by anoxic/euxinic sediments), which is 0.21 ± 0.09 %. This work demonstrates that stable isotopes of U can indeed trace the extent of anoxia in the modern global ocean, thereby validating the application of U isotope measurements to paleoredox reconstructions. Based on the above work, we will present the best estimate of the modern oceanic U budget. [1] Tissot F.L.H., Dauphas N. (2015) Geochim Cosmochim
International Nuclear Information System (INIS)
Pereira, J.J.C.R.
1976-08-01
The electron paramagnetic resonance (EPR) has been studied in conection with the optical absortion spectra of Uranium ions diluted in CdF 2 single crystals. Analyses of the EPR and optical absorption spectra obtained experimentally, and a comparison with known results in the isomorfic CaF 2 , SrF 2 and BaF 2 , allowed the identification of two paramagnetic centers associated with Uranium ions. These are the U(2+) ion in cubic symmetry having the triplet γ 5 as ground state, and the U(3+) ion in cubic symmetry having the dublet γ 6 as ground state. (Author) [pt
Bhatia, C.; Fallin, B. F.; Gooden, M. E.; Howell, C. R.; Kelley, J. H.; Tornow, W.; Arnold, C. W.; Bond, E.; Bredeweg, T. A.; Fowler, M. M.; Moody, W.; Rundberg, R. S.; Rusev, G. Y.; Vieira, D. J.; Wilhelmy, J. B.; Becker, J. A.; Macri, R.; Ryan, C.; Sheets, S. A.; Stoyer, M. A.; Tonchev, A. P.
2015-06-01
Using dual-fission chambers each loaded with a thick (200 -400 -mg /c m2) actinide target of 235 ,238U or 239Pu and two thin (˜10 -100 -μ g /c m2) reference foils of the same actinide, the cumulative yields of fission products ranging from 92Sr to 147Nd have been measured at En= 8.9 MeV . The 2H(d ,n ) 3He reaction provided the quasimonoenergetic neutron beam. The experimental setup and methods used to determine the fission product yield (FPY) are described, and results for typically eight high-yield fission products are presented. Our FPYs for 235U(n ,f ) , 238U(n ,f ) , and 239Pu(n ,f ) at 8.9 MeV are compared with the existing data below 8 MeV from Glendenin et al. [Phys. Rev. C 24, 2600 (1981), 10.1103/PhysRevC.24.2600], Nagy et al. [Phys. Rev. C 17, 163 (1978), 10.1103/PhysRevC.17.163], Gindler et al. [Phys. Rev. C 27, 2058 (1983), 10.1103/PhysRevC.27.2058], and those of Mac Innes et al. [Nucl. Data Sheets 112, 3135 (2011), 10.1016/j.nds.2011.11.009] and Laurec et al. [Nucl. Data Sheets 111, 2965 (2010), 10.1016/j.nds.2010.11.004] at 14.5 and 14.7 MeV, respectively. This comparison indicates a negative slope for the energy dependence of most fission product yields obtained from 235U and 239Pu , whereas for 238U the slope issue remains unsettled.
The structure of the U.S. wheat powdery mildew population (Blumeria graminis f. sp. tritici) has not been investigated, and the global evolutionary history of B. g. tritici is largely unknown. After gathering 141 single-ascoporic B. g. tritici isolates from 10 eastern U.S. locations, 34 isolates fr...
TEM characterization of irradiated U-7Mo/Mg dispersion fuel
Gan, J.; Keiser, D. D.; Miller, B. D.; Jue, J. F.; Robinson, A. B.; Madden, J.
2017-10-01
This paper presents the results of transmission electron microscopy (TEM) characterization on neutron-irradiated samples taken from the low-flux and high-flux sides of the same fuel plate with U-7Mo fuel particles dispersed in Mg matrix with aluminum alloy Al6061 as cladding material that was irradiated edge-on to the core in the Advanced Test Reactor. The corresponding local fission density and fission rate of the fuel particles and the average fuel-plate centerline temperature for the low-flux and high-flux samples are estimated to be 3.7 × 1021 f/cm3, 7.4 × 1014 f/cm3/s and 123 °C, and 5.5 × 1021 f/cm3, 11.0 × 1014 f/cm3/s and 158 °C, respectively. Complex interaction layers developed at the Al-Mg interface, consisting of Al3Mg2 and Al12Mg17 along with precipitates of MgO, Mg2Si and FeAl5.3. No interaction between Mg matrix and U-Mo fuel particle was identified. For the U-Mo fuel particles, at low fission density, small elongated bubbles wrapped around the clean areas with a fission gas bubble superlattice, which suggests that bubble coalescence is an important mechanism for converting the fission gas bubble superlattice to large bubbles. At high fission density, no bubbles or porosity were observed in the Mg matrix, and pockets of residual fission gas bubble superlattice were observed in the U-Mo fuel particle interior.
Lanthanide-doped NaScF4 nanoprobes: crystal structure, optical spectroscopy and biodetection.
Ai, Yu; Tu, Datao; Zheng, Wei; Liu, Yongsheng; Kong, Jintao; Hu, Ping; Chen, Zhuo; Huang, Mingdong; Chen, Xueyuan
2013-07-21
Trivalent lanthanide ions (Ln(3+))-doped inorganic nanoparticles (NPs) as potential luminescent bioprobes have been attracting tremendous interest because of their unique upconversion (UC) and downconversion (DC) luminescence properties. NaScF4, as an important host material, has been rarely reported and its crystal structure remains unclear. Herein, based on the single crystal X-ray diffraction, the space group of NaScF4 crystals was determined to be P31 containing multiple sites of Sc(3+) with crystallographic site symmetry of C1, which was verified by high-resolution photoluminescence spectroscopy of Eu(3+) at low temperature (10 K). Furthermore, monodisperse and size-controllable NaScF4:Ln(3+) NPs were synthesized via a facile thermal decomposition method. The biotinylated NaScF4:Er(3+)/Yb(3+) NPs were demonstrated for their applications as a heterogeneous UC luminescence bioprobe to detect avidin with a detection limit of 180 pM. After bioconjugation with amino-terminal fragment (ATF) of urokinase plasminogen activator (uPA), NaScF4:Ln(3+) NPs also exhibited specific recognition of cancer cells overexpressed with uPA receptor (uPAR, an important marker of tumor biology and metastasis), showing great potentials in tumor-targeted bioimaging.
Perera, Travis
2007-01-01
The tsunami of 26 December 2004 killed over 35,000 people in Sri Lanka, made 400,000 jobless and damaged the economy by 6.5%. The physical damage was around U.S. $1.5 billion, with reconstruction costing $2 billion. Although entrepreneurs are opportunity seekers, take risks and thrive in uncertainty, the alignment of competency and institutional…
Peculiarities of U-based Laves phases
Energy Technology Data Exchange (ETDEWEB)
Goncalves, A P; Henriques, M S; Waerenborgh, J C; Pereira, L C J; Lopes, E B; Almeida, M [Department of Chemistry, Instituto Tecnologico e Nuclear/CFMCUL, Estrada Nacional 10, 2686-953 Sacavem (Portugal); Maskova, S; Havela, L [Department of Condensed Matter Physics, Faculty of Mathematics and Physics, Charles University, Ke Karlovu 5, 12116, Prague (Czech Republic); Shick, A; Arnold, Z [Institute of Physics, Academy of Sciences of the Czech Republic, Prague 8 (Czech Republic); Berthebaud, D; Tougait, O; Noel, H, E-mail: apg@itn.pt [Sciences Chimiques de Rennes- Equipe Chimie du Solide et Materiaux. UMR CNRS 6226, Universite de Rennes 1, Avenue de General Leclerc, 35042 Rennes (France)
2010-03-15
This contribution focuses on the structural and physical properties of U-based Laves phases. It starts with the structural description of the different type of Laves phases, followed by a brief description of the factors that affect their stability. The majority of the uranium Laves phases show a weakly paramagnetic behaviour. The reason is the compact structure of the phases that leads to small a U-U spacing as well as very high coordination numbers, regarding both the uranium and the ligands sublattices, which brings a strong hybridization with non-f states. However, there are some exceptions of uranium Laves phases that do order magnetically (UFe{sub 2}, UNi{sub 2} and the recently discovered U{sub 2}Fe{sub 3}Ge compound). These exceptions are discussed in more detail in the present manuscript.
Adler Award Lecture: Fermi-Liquid Instabilities in Strongly Correlated f-Electron Materials.^*
Maple, M. Brian
1996-03-01
Strongly correlated f-electron materials are replete with novel electronic states and phenomena ; e. g. , a metallic ``heavy electron'' state with a quasiparticle effective mass of several hundred times the free electron mass, anisotropic superconductivity with an energy gap that may vanish at points or along lines on the Fermi surface, the coexistence of superconductivity and antiferromagnetism over different parts of the Fermi surface, multiple superconducting phases in the hyperspace of chemical composition, temperature, pressure, and magnetic field, and an insulating phase, in so-called ``hybridization gap semiconductors'' or ``Kondo insulators'', with a small energy gap of only a few meV. During the last several years, a new low temperature non-Fermi-liquid (NFL) state has been observed in a new class of strongly correlated f-electron materials which currently consists of certain Ce and U intermetallics into which a nonmagnetic element has been substituted.(M. B. Maple et al./) , J. Low Temp. Phys. 99 , 223 (1995). The Ce and U ions have partially-filled f-electron shells and carry magnetic dipole or electric quadrupole moments which interact with the spins and charges of the conduction electrons and can participate in magnetic or quadrupolar ordering at low temperatures. The physical properties of these materials exhibit weak power law or logarithmic divergences in temperature and suggest the existence of a critical point at T=0 K. Possible origins of the 0 K critical point include an unconventional moment compensation process, such as a multichannel Kondo effect, and fluctuations of the order parameter in the vicinity of a 0 K second order phase transition. In some systems, such as Y_1-xU_xPd 3 and U_1-xTh_xPd _2Al 3 , the NFL characteristics appear to be single ion effects since they persist to low concentrations of f-moments, whereas in other systems, such as CeCu _5.9Au _0.1 , the NFL behavior seems to be associated with interactions between the f
Väljataga, Pille
2001-01-01
Rühmituse F.F.F.F. (Berit Teeäär, Maria Valdma, Ketli Tiitsar, Kaire Rannik, Kristi Paap) esinemisest 2000. a. suvel Leedus Niida kunstnike majas. Ehteid eksponeeriti kõrvuti nende 20-kordse suurendusega fotodega.
RAF Fairford UK. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F
1990-01-01
93.0 93.0 93.0 93.0 93. GE Zoo-l 1-5.7 91.8 92.4 93.5 93.8 93.8 93.8 93.9 93. GE 1800! 15.-8 92.0 92.8 93.9 94.2 94.2 94.2 94.3 94-. GE ISO F 15,9...79.4 79 GE 1800 6.8 63.9 6b.O 71.0 75.1 77.0 78.8 79.7 8C GE ISO 7.1 66.3 68.4 73.5 77.6 79.5 81.4 82.2 82 GE 12001 7.4 68.7 7P,.8 76.0 80.2 82.1 83.9...3I001 7.5 49.9 51,.8 52.5 54.7 55.5 56.4 58.2 59- GE 30001 8.5 56.6 57.7 59.4 61.8 62.6 63.6 65.3 66 6E 27001 8.7 r7.9- 59.0 60.7 63.3 64.2 65.2 66-.9 67
Impact properties of 2 1/4 Cr--1 Mo steel after ten years EBR-II service
International Nuclear Information System (INIS)
Shields, J.A.; Server, W.L.; Sheckherd, J.W.; Longua, K.J.
1976-01-01
The material studied in this investigation was obtained from a 2 1 / 4 Cr--1 Mo steel superheated steam line which had been in service for approximately 90,000 hours. Of that 90,000 hours, approximately 40,000 hours were at a temperature of approximately 820 0 F and a pressure of 1250 psi, and 35,000 hours were at a temperature of 500 0 F and 1250 psi. The results of optical metallography and instrumented impact testing performed on the materials are presented
Origin of Abelian Gauge Symmetries in Heterotic/F-theory Duality
Cvetic, Mirjam; Klevers, Denis; Poretschkin, Maximilian; Song, Peng
2016-01-01
We study aspects of heterotic/F-theory duality for compactifications with Abelian gauge symmetries. We consider F-theory on general Calabi-Yau manifolds with a rank one Mordell-Weil group of rational sections. By rigorously performing the stable degeneration limit in a class of toric models, we derive both the Calabi-Yau geometry as well as the spectral cover describing the vector bundle in the heterotic dual theory. We carefully investigate the spectral cover employing the group law on the elliptic curve in the heterotic theory. We find in explicit examples that there are three different classes of heterotic duals that have U(1) factors in their low energy effective theories: split spectral covers describing bundles with S(U(m) x U(1)) structure group, spectral covers containing torsional sections that seem to give rise to bundles with SU(m) x Z_k structure group and bundles with purely non-Abelian structure groups having a centralizer in E_8 containing a U(1) factor. In the former two cases, it is required ...
76 FR 62500 - Proposed Collection; Comment Request for Form 1120-F
2011-10-07
... comments concerning Form 1120-F, U.S. Income Tax Return of a Foreign Corporation. DATES: Written comments... Constitution Avenue, NW., Washington, DC 20224, or at (202) 622-6665, or through the Internet at [email protected] . SUPPLEMENTARY INFORMATION: Title: U.S. Income Tax Return of a Foreign Corporation. OMB...
CHARACTERIZATION OF TANK 18F WALL AND SCALE SAMPLES
International Nuclear Information System (INIS)
Hay, Michael; Click, Damon; Diprete, C.; Diprete, David
2010-01-01
Samples from the wall of Tank 18F were obtained to determine the associated source term using a special wall sampling device. Two wall samples and a scale sample were obtained and characterized at the Savannah River National Laboratory (SRNL). All the analyses of the Tank 18F wall and scale samples met the targeted detection limits. The upper wall samples show ∼2X to 6X higher concentrations for U, Pu, and Np on an activity per surface area basis than the lower wall samples. On an activity per mass basis, the upper and lower wall samples show similar compositions for U and Pu. The Np activity is still ∼2.5X higher in the upper wall sample on a per mass basis. The scale sample contains 2-3X higher concentrations of U, Pu, and Sr-90 than the wall samples on an activity per mass basis. The plutonium isotopics differ for all three wall samples (upper, lower, and scale samples). The Pu-238 appears to increase as a proportion of total plutonium as you move up the tank wall from the lowest sample (scale sample) to the upper wall sample. The elemental composition of the scale sample appears similar to other F-Area PUREX sludge compositions. The composition of the scale sample is markedly different than the material on the floor of Tank 18F. However, the scale sample shows elevated Mg and Ca concentrations relative to typical PUREX sludge as do the floor samples.
George F. Kennan and the Division of Europe
Czech Academy of Sciences Publication Activity Database
Smetana, Vít
2013-01-01
Roč. 15, č. 4 (2013), s. 225-232 ISSN 1520-3972 Institutional support: RVO:68378114 Keywords : George F. Kennan * Cold War * U.S. foreign policy Subject RIV: AB - History Impact factor: 0.349, year: 2013
1985-09-01
CoC S~04 COMPARISON OF QUANTITY VERSUS QUALITY USING PERFORMANCE, RELIABILITY, AND LIFE CYCLE COST DATA. A CASE STUDY OF THE F-15, F-16, AND A-10...CYCLE COSTIATU.AT CAE AIR ORE HEO OG .- jAITR UIVERSITY W right.,Patterson Air Force Base, Ohio .! 5ൔ ,6 198 C.IT. U AF’IT/GSL,4/L3Q/65:S Ŗ J...COMPARISON OF QUANTITY VERSUS QUALITY USING PERFORMANCE, RELIABILITY, AND LIFE CYCLE COST DATA. A CASE STUDY OF THE F-15, F-16, AND A-10 AIRCRAFT THESIS David
Energy Technology Data Exchange (ETDEWEB)
Bourrachot, Stéphanie [Institut de Radioprotection et de Sûreté Nucléaire (IRSN), PRP-ENV/SERIS/LECO, Cadarache, Saint-Paul-lez-Durance 13115 (France); Brion, François [Institut National de l’Environnement Industriel et des Risques (INERIS), Unité d’évaluation des risques écotoxicologiques, BP2, 60550 Verneuil-en-Halatte (France); Pereira, Sandrine; Floriani, Magali; Camilleri, Virginie; Cavalié, Isabelle [Institut de Radioprotection et de Sûreté Nucléaire (IRSN), PRP-ENV/SERIS/LECO, Cadarache, Saint-Paul-lez-Durance 13115 (France); Palluel, Olivier [Institut National de l’Environnement Industriel et des Risques (INERIS), Unité d’évaluation des risques écotoxicologiques, BP2, 60550 Verneuil-en-Halatte (France); Adam-Guillermin, Christelle, E-mail: christelle.adam-guillermin@irsn.fr [Institut de Radioprotection et de Sûreté Nucléaire (IRSN), PRP-ENV/SERIS/LECO, Cadarache, Saint-Paul-lez-Durance 13115 (France)
2014-09-15
Highlights: • The effect of depleted uranium on zebrafish reproduction was studied. • An inhibition of egg production and an increase of F1 embryo mortality were observed. • Decreased circulating concentration of vitellogenin was observed in females. • Increased DNA damages were observed in parent gonads and in embryos. • U environmental concentration impairs reproduction and genetic integrity of fish. - Abstract: Despite the well-characterized occurrence of uranium (U) in the aquatic environment, very little is known about the chronic exposure of fish to low levels of U and its potential effect on reproduction. Therefore, this study was undertaken to investigate the effects of environmental concentrations of depleted U on the reproductive output of zebrafish (Danio rerio) and on survival and development of the F1 embryo-larvae following parental exposure to U. For that purpose, sexually mature male and female zebrafish were exposed to 20 and 250 μg/L of U for 14 days and allowed to reproduce in clean water during a further 14-day period. At all sampling times, whole-body vitellogenin concentrations and gonad histology were analyzed to investigate the effects of U exposure on these reproductive endpoints. In addition, accumulation of U in the gonads and its genotoxic effect on male and female gonad cells were quantified. The results showed that U strongly affected the capability of fish to reproduce and to generate viable individuals as evidenced by the inhibition of egg production and the increased rate of mortality of the F1 embryos. Interestingly, U exposure resulted in decreased circulating concentrations of vitellogenin in females. Increased concentrations of U were observed in gonads and eggs, which were most likely responsible for the genotoxic effects seen in fish gonads and in embryos exposed maternally to U. Altogether, these findings highlight the negative effect of environmentally relevant concentrations of U which alter the reproductive
International Nuclear Information System (INIS)
Bourrachot, Stéphanie; Brion, François; Pereira, Sandrine; Floriani, Magali; Camilleri, Virginie; Cavalié, Isabelle; Palluel, Olivier; Adam-Guillermin, Christelle
2014-01-01
Highlights: • The effect of depleted uranium on zebrafish reproduction was studied. • An inhibition of egg production and an increase of F1 embryo mortality were observed. • Decreased circulating concentration of vitellogenin was observed in females. • Increased DNA damages were observed in parent gonads and in embryos. • U environmental concentration impairs reproduction and genetic integrity of fish. - Abstract: Despite the well-characterized occurrence of uranium (U) in the aquatic environment, very little is known about the chronic exposure of fish to low levels of U and its potential effect on reproduction. Therefore, this study was undertaken to investigate the effects of environmental concentrations of depleted U on the reproductive output of zebrafish (Danio rerio) and on survival and development of the F1 embryo-larvae following parental exposure to U. For that purpose, sexually mature male and female zebrafish were exposed to 20 and 250 μg/L of U for 14 days and allowed to reproduce in clean water during a further 14-day period. At all sampling times, whole-body vitellogenin concentrations and gonad histology were analyzed to investigate the effects of U exposure on these reproductive endpoints. In addition, accumulation of U in the gonads and its genotoxic effect on male and female gonad cells were quantified. The results showed that U strongly affected the capability of fish to reproduce and to generate viable individuals as evidenced by the inhibition of egg production and the increased rate of mortality of the F1 embryos. Interestingly, U exposure resulted in decreased circulating concentrations of vitellogenin in females. Increased concentrations of U were observed in gonads and eggs, which were most likely responsible for the genotoxic effects seen in fish gonads and in embryos exposed maternally to U. Altogether, these findings highlight the negative effect of environmentally relevant concentrations of U which alter the reproductive
Directory of Open Access Journals (Sweden)
Elisa Caselli
2011-05-01
Full Text Available Composition du juryMonsieur. Bernard Vincent, Directeur de thèses (ÉHESS,Monsieur. Bartolomé Bennassar (Université de Toulouse le Mirail,Monsieur. Ricardo Garcia Carcel (Université Autonome de Barcelone,Madame. Claude Gauvard (Université de Paris I,Madame. Béatrice Perez (Université de Rennes II,Monsieur. Jean-Paul Zuñiga, (ÉHESSMention très honorable avec félicitation du juryThèse soutenue le 28 juin 2010RésuméÀ travers des procès judiciaires impliquant des juifs, plaidant entre eux ou...
1979-12-21
WET BULB TEMPERATURE DEPRESSIO (F) ITOTAL TOTAL 9 . 1 1 1 1 1 1 1 5 - 6 1 1 8. 1 4 2 8 2 9 3 01 2 3 1 2 4 2 _ u l b ] W e t B u l b j (F) 0 1-2 3. 4...StIeSTATIO W VUAS SNTo PAGE i 3600O-0800 lift (L. S. TO) WET BULB TEXPERATURE DEPRESSIO (F) TOTAL TOTAL () 0 1-2 3-4 5.6 7-8 -9l 1 2l-1151j71192112~324125
Evaluation of E.M.F. exposure from medical electrical equipment
Energy Technology Data Exchange (ETDEWEB)
Aniolczyk, H.; Mamrot, P.; Politanski, P. [Nofer Institute of Occupational Medicine, Lodz (Poland)
2006-07-01
he medical electric and electronic equipment, including electro surgical devices, short- and microwave diathermy units, and magnetic resonance imaging (MRI) systems, belong to the most hazardous sources of electromagnetic emissions. The electromagnetic emissions can interfere with emissions from other medical equipment located in the same facility (e.g. operation rooms) thus having impact on their work, but more importantly, they can be dangerous to patients, medical personnel operating them and other persons. In the present project, an assessment of E.M.F. intensity was performed for more than 2 000 electro surgical devices (330 khz, 440 khz and 1.76 MHz frequency ranges), 1 200 diathermy units and 45 MRI 0.2 - 1.5 T systems. E.M.F. exposure of medical staff was assessed based on respective national hygienic standards. The actual exposure levels were found to exceed the admissible values in Poland. The recorded E.M.F. intensities were compared with relevant Who and U E recommendations (e.g. I.C.N.I.R.P. guidelines, 1998, Directive 2004/40/E.C.). The findings revealed that for 18% of the devices examined, the E.M.F. was higher than the E.M.F. intensity values recommended by U E. (authors)
Evaluation of E.M.F. exposure from medical electrical equipment
International Nuclear Information System (INIS)
Aniolczyk, H.; Mamrot, P.; Politanski, P.
2006-01-01
he medical electric and electronic equipment, including electro surgical devices, short- and microwave diathermy units, and magnetic resonance imaging (MRI) systems, belong to the most hazardous sources of electromagnetic emissions. The electromagnetic emissions can interfere with emissions from other medical equipment located in the same facility (e.g. operation rooms) thus having impact on their work, but more importantly, they can be dangerous to patients, medical personnel operating them and other persons. In the present project, an assessment of E.M.F. intensity was performed for more than 2 000 electro surgical devices (330 khz, 440 khz and 1.76 MHz frequency ranges), 1 200 diathermy units and 45 MRI 0.2 - 1.5 T systems. E.M.F. exposure of medical staff was assessed based on respective national hygienic standards. The actual exposure levels were found to exceed the admissible values in Poland. The recorded E.M.F. intensities were compared with relevant Who and U E recommendations (e.g. I.C.N.I.R.P. guidelines, 1998, Directive 2004/40/E.C.). The findings revealed that for 18% of the devices examined, the E.M.F. was higher than the E.M.F. intensity values recommended by U E. (authors)
File list: Oth.EmF.20.Smarca5.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.EmF.20.Smarca5.AllCell mm9 TFs and others Smarca5 Embryonic fibroblast SRX10220...84 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.EmF.20.Smarca5.AllCell.bed ...
26 CFR 1.665(f)-1A - Undistributed capital gain.
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Undistributed capital gain. 1.665(f)-1A Section... Beginning on Or After January 1, 1969 § 1.665(f)-1A Undistributed capital gain. (a) Domestic trusts. (1) The term undistributed capital gain means (in the case of a trust other than a foreign trust created by a U...
Advanced Concepts of Naval Engineering Maintenance Training. Volume 2. Appendix F
1976-05-01
maintenance instruction, the Hagan Automatic Boiler Control (ABC) course. These job requirements also included the tasks, skills, and knowledges for all...Pressure 1 3/4 NAVTRAEQÜIPCEN 74-C-0151-1 TABLE OF CONTENTS VOLUME II OF II APPENDIX F Page Hagan Automatic Boiler Controls Systems (FAS) 6...a c a ■* w ■H u 0 M « s? u ’• B n J-riH 3 o c 0 hhO a a o -i •H -I 0 -H 9J ■ a a oi « C -a u <rl « vi) •a - 8 ai >> u u
Cyanide metallocenes of trivalent f-elements
International Nuclear Information System (INIS)
Maynadie, J.; Berthet, J.C.; Thuery, P.; Ephritikhine, M.
2007-01-01
Addition of N n Bu 4 CN to (C 5 Me 5 ) 2 UI(py), (C 5 Me 5 ) 2 CeI, or (C 5 Me 5 ) 2 M(OTf) (M = U, Ce) in acetonitrile led to the precipitation of the neutral mono-cyanide species [(C 5 Me 5 ) 2 M(μ-CN)] n [M = U (1), Ce (2)], which likely have an oligomeric structure, as shown by the tri-meric cyanide-bridged complex [(C 5 Me 5 ) 2 Ce(μ-CN)(CN t Bu)] 3 (3) obtained by addition of excess t BuNC into a suspension of 2 in acetonitrile. The structure of the U(III,IV) mixed valence compound [{(C 5 Me 5 ) 2 U} 2 (μ-CN){(μ-CN) 2 Na(thf)} 2 ] ∞ (4), which crystallized from a thf solution of (C 5 Me 5 ) 2 UI(py) in the presence of excess NaCN, reveals a unique example of an f-element-(μ-CN)-M interaction (M = main group or d transition metal). The anionic poly-cyanides [(C 5 Me 5 ) 2 M(CN) 3 ][N n Bu 4 ] 2 [M = U (5), Ce (6)] were synthesized by treatment of 1 and 2 with 2 equiv or an excess of N n Bu 4 CN in acetonitrile; they were also prepared in a one-pot procedure by stepwise addition of 1 equiv of KCN and 2 equiv of N n Bu 4 CN to the parent iodides in acetonitrile. The bent metallocenes 5 and 6 are unique low-valent molecular poly-cyanide compounds of an f-element that have been structurally identified, while 5 is the first fully characterized actinide(III) cyanide. Comparison of the crystal structures of 5 and 6 shows that the M-C(C 5 Me 5 ) and M-C(CN) distances are 0.02-0.03 Angstroms shorter for M = U than for M Ce, while the ionic radius of uranium(III) is 0.02 Angstroms larger than that of cerium(III). (authors)
Technology Transfer Under the F-15I Program
National Research Council Canada - National Science Library
Young, Shelton
1997-01-01
.... The Government of Israel and the U.S. Air Force signed a letter of offer and acceptance in 1994, and amended it in February 1996, for the purchase of 25 F-15I aircraft, support items, and associated services...
2013-09-05
DefenseNews.com, January 6, 2011; Tony Capaccio, “China’s J-20 Stealth Fighter Meant to Counter F-22, F-35, U.S. Navy Says,” Bloomberg.com, January 6, 2011; David... Robbins , a Pentagon spokeswoman, said Tuesday. Hagel will factor the recommendations into the Pentagon’s 2015 budget guidance.... Throughout the SCMR...to pay off. 186 Tony Capaccio, “Navy Lacks Targets To Test U.S. Defenses Against China Missile
Measurement of quadriceps endurance by fNIRS
Erdem, Devrim; Şayli, Ömer; Karahan, Mustafa; Akin, A.
2006-02-01
In this paper, the changes in muscle deoxygenation trends during a sustained isometric quadriceps (chair squat/half squat) endurance exercise were evaluated among twelve male subjects and the relationship between muscle oxygenation and endurance times was investigated by means of functional near-infrared spectroscopy (fNIRS). Neuromuscular activation and predictions of muscle performance decrements during extended fatiguing task was investigated by means of surface electromyography (sEMG). The results of the study showed that in the subjects who maintained exercise longer than five minutes (group 1), mean Hb recovery time (33 [sec.]) was 37.4% less than the others (group 2, 52.7 [sec.]). Also mean HbO II decline amplitude (2.53 [a.u.] in group 1 and 2.07 [a.u.] in group 2) and oxy decline amplitude (8.4 [a.u.] in group 1 and 3.04 [a.u.] in group 2) in the beginning of squat exercise are found to be 22.6% and 176.9% bigger in these group. For the EMG parameters, mean slope of MNF and MDF decline are found to be 57.5% and 42.2% bigger in magnitude in group 2 which indicates higher degree of decrement in mean and median frequencies although their mean squat duration time is less. This indicates higher index of fatigue for this group. It is concluded that training leads to altered oxygenation and oxygen extraction capability in the exercising muscle and investigated fNIRS parameters could be used for endurance evaluation.
File list: Oth.EmF.10.Ddit3.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.EmF.10.Ddit3.AllCell mm9 TFs and others Ddit3 Embryonic fibroblast SRX119350,SR...X119351 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.EmF.10.Ddit3.AllCell.bed ...
File list: Oth.EmF.50.Ddit3.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.EmF.50.Ddit3.AllCell mm9 TFs and others Ddit3 Embryonic fibroblast SRX119350,SR...X119351 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.EmF.50.Ddit3.AllCell.bed ...
International Nuclear Information System (INIS)
Linhares, P.S.
1987-01-01
Results for major, minor and trace elements obtained by twelve laboratories for the standards rocks, Granite (GB-1) and Basalte (BB-1), of the Geochemistry Department of Geociences Institute-U-F.Ba are presented. At present status of the study it is possible to approach the most probably correct value (usable value) for the concentration of each of the major and minor elements. (author) [pt
International Nuclear Information System (INIS)
Simutkin, V.D.
2008-01-01
Conceptual analysis of accelerator-driven systems assumes extensive use of nuclear data on neutron-induced reactions at intermediate energies. In particular, information about the fission fragment yields from the 238 U(n,f) and 232 Th(n,f) reactions is of particular interest at neutron energies from 10 to 200 MeV. However, there is a lack of such data for both 238 U and 232 Th. Up to now, the intermediate energy measurements have been performed for 238 U only, and there are no data for the 232 Th(n,f) reaction. The aim of the work is to provide such data. Fission fragment mass distributions for the 232 Th(n,f) and 238 U(n,f) reactions have been measured for the incident neutron energies 32.8 MeV, 45.3 MeV and 59.9 MeV. The experiments have been performed at the neutron beam facility of the Universite Catholique de Louvain, Belgium. A multi-section Frisch-gridded ionization chamber has been used as a fission fragment detector. The data obtained have been interpreted in terms of the multimodal random neck-rupture model (MMRNRM). (authors)
New approach to high energy SU/sub 2L/ /times/ U1 radiative corrections
International Nuclear Information System (INIS)
Ward, B.F.L.
1988-07-01
We present a new approach to SU/sub 2L/ /times/ U 1 radiative corrections at high energies. Our approach is based on the infrared summation methods of Yennie, Frautschi and Suura, taken together with the Weinberg-'t Hooft renormalization group equation. Specific processes which have been realized via explicit Monte Carlo algorithms are e + e/sup /minus// → f/bar f/' + n(γ), f = μ, /tau/, d, s, u, c, b or t and e + e/sup /minus// → e + e/sup /minus// + n(γ), where n(γ), denotes multiple photo emission on an event-by-event basis. Exemplary Monte Carlo data are presented. 16 refs., 4 figs
Preclinical evaluation of an {sup 18}F-trifluoroborate methionine derivative for glioma imaging
Energy Technology Data Exchange (ETDEWEB)
Yang, Xiangyu [Medical School of Southeast University, Jiangsu Key Laboratory of Molecular Imaging and Functional Imaging, Department of Radiology, Zhongda Hospital, Nanjing (China); National Institutes of Health (NIH), Laboratory of Molecular Imaging and Nanomedicine, National Institute of Biomedical Imaging and Bioengineering, Bethesda, MD (United States); Liu, Zhibo; Zhang, Huimin; Li, Zhu; Niu, Gang; Chen, Xiaoyuan [National Institutes of Health (NIH), Laboratory of Molecular Imaging and Nanomedicine, National Institute of Biomedical Imaging and Bioengineering, Bethesda, MD (United States); Munasinghe, Jeeva P. [NIH, Mouse Imaging Facility, National Institute of Neurological Disorders and Stroke, Bethesda, MD (United States); Teng, Gaojun [Medical School of Southeast University, Jiangsu Key Laboratory of Molecular Imaging and Functional Imaging, Department of Radiology, Zhongda Hospital, Nanjing (China)
2018-04-15
{sup 11}C-methionine (MET) is one of the most commonly used amino acid tracers for PET imaging of brain tumors. In this study, we report an {sup 18}F-labeled boron-derived methionine analogue, denoted as {sup 18}F-B-MET, as a potential substitute of {sup 11}C-MET for glioma PET imaging. {sup 19}F-B-MET was synthesized from readily available chemicals according to our previous publication. For kit development, {sup 19}F-B-MET was aliquoted in quantities of 10 nmol for on-demand one-step labeling. The {sup 18}F-labeling was performed by {sup 18}F-{sup 19}F isotope exchange, and quality control was performed by both HPLC and radio-TLC. Uptake of the tracer was determined in GL26, C6 and U87 tumor cells. PET imaging and the biodistribution assay were performed on mice bearing subcutaneous or orthotopic C6 and U87 tumor xenografts. Starting with 740-1110 MBq {sup 18}F-fluoride, >370 MBq of {sup 18}F-B-MET was obtained in 25 min (n = 5) with >99% purity and high specific activity (>37 GBq/μmol). {sup 18}F-B-MET demonstrated excellent in vitro stability with <1% decomposition after incubation with plasma for 2 h. In vitro cell uptake assay showed that {sup 18}F-B-MET accumulated in tumor cells in a time dependent manner and could be competitively inhibited by natural methionine and other L-type transporter transported amino acids. In vivo biodistribution and imaging studies showed high tumor accumulation (2.99 ± 0.23 %ID/g, n = 6) compared with low uptake of brain (0.262 ± 0.05 %ID/g, n = 6) at 60 min after injection in a subcutaneous C6 tumor model. Orthotropic C6 and U87 tumors were clearly visualized with high tumor to brain ratios at 60 min post-injection, corroborating with tumor L-type amino acid transporter 1 (LAT-1) expression levels. {sup 18}F-B-MET was radiolabeled with high yield in a one-step labeling process, showed excellent pharmacokinetic properties in vivo, with high tumor-to-brain contrast. (orig.)
File list: Pol.EmF.05.RNA_Polymerase_II.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Pol.EmF.05.RNA_Polymerase_II.AllCell mm9 RNA polymerase RNA Polymerase II Embryonic...RX143288 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.EmF.05.RNA_Polymerase_II.AllCell.bed ...
Hybridization and magnetism in U(Ru, Rh)X, X=Al, Ga
Sechovsky, V.; Havela, L.; Boer, de F.R.; Veenhuizen, P.A.; Sugiyama, K.; Kuroda, T.; Sugiura, T.; Ono, M.; Date, M.; Yamagishi, A.
1992-01-01
Results of magnetic studies of pseudoternary U(Ru, Rh)Al and U(Ru, Rh)Ga systems are presented. Reduction of the 5f-4d hybridization with increasing Rh content is reflected in a gradual transition from paramagnetic (spin fluctuation) behaviour of URuX to ferromagnetism in URhX. The huge uniaxial
International Dynamics of U.S. National Defense Acquisition and Budgetary Policy
2012-04-30
2010, Winter). Russian defense industry: Feet of clay . Security Index, 1(90), 31–46. Kan, S. (2002). CRS report for Congress—Taiwan: Major U.S...military (pp. 1–44). Carlisle, PA: U.S. Army Strategic Studies Institute. Le Roy, F. (2002, May). Mirages over the Andes: Peru , France, the United States
File list: Oth.EmF.10.Rbfox2.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.EmF.10.Rbfox2.AllCell mm9 TFs and others Rbfox2 Embryonic fibroblast SRX551545,...SRX551553,SRX551551,SRX551546 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.EmF.10.Rbfox2.AllCell.bed ...
File list: Oth.EmF.20.Rbfox2.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.EmF.20.Rbfox2.AllCell mm9 TFs and others Rbfox2 Embryonic fibroblast SRX551545,...SRX551553,SRX551551,SRX551546 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.EmF.20.Rbfox2.AllCell.bed ...
Molten salt e.m.f. cell measurements on U-Ga alloys
International Nuclear Information System (INIS)
Prabhakara Reddy, B.; Kandan, R.; Nagarajan, K.; Vasudeva Rao, P.R.
2000-01-01
The Gibbs free energy of formation of intermetallic compounds, UGa 3 , UGa 2 and U 2 Ga 3 were determined by using high temperature molten salt galvanic cell measurements in the temperature range of 644-988 K, 751-947 K and 800-950 K, respectively. (author)
International Nuclear Information System (INIS)
McLarty, Kristin; Moran, Matthew D.; Scollard, Deborah A.; Chan, Conrad; Sabha, Nesrin; Mukherjee, Joydeep; Guha, Abhijit; McLaurin, JoAnne; Nitz, Mark; Houle, Sylvain; Wilson, Alan A.; Reilly, Raymond M.; Vasdev, Neil
2011-01-01
Introduction: The aim of the study was to evaluate the uptake of [ 18 F]-1-deoxy-1-fluoro-scyllo-inositol ([ 18 F]-scyllo-inositol) in human breast cancer (BC) and glioma xenografts, as well as in inflammatory tissue, in immunocompromised mice. Studies of [ 18 F]-2-fluoro-2-deoxy-D-glucose ([ 18 F]-FDG) under the same conditions were also performed. Methods: Radiosynthesis of [ 18 F]-scyllo-inositol was automated using a commercial synthesis module. Tumour, inflammation and normal tissue uptakes were evaluated by biodistribution studies and positron emission tomography (PET) imaging using [ 18 F]-scyllo-inositol and [ 18 F]-FDG in mice bearing subcutaneous MDA-MB-231, MCF-7 and MDA-MB-361 human BC xenografts, intracranial U-87 MG glioma xenografts and turpentine-induced inflammation. Results: The radiosynthesis of [ 18 F]-scyllo-inositol was automated with good radiochemical yields (24.6%±3.3%, uncorrected for decay, 65±2 min, n=5) and high specific activities (≥195 GBq/μmol at end of synthesis). Uptake of [ 18 F]-scyllo-inositol was greatest in MDA-MB-231 BC tumours and was comparable to that of [ 18 F]-FDG (4.6±0.5 vs. 5.5±2.1 %ID/g, respectively; P=.40), but was marginally lower in MDA-MB-361 and MCF-7 xenografts. Uptake of [ 18 F]-scyllo-inositol in inflammation was lower than [ 18 F]-FDG. While uptake of [ 18 F]-scyllo-inositol in intracranial U-87 MG xenografts was significantly lower than [ 18 F]-FDG, the tumour-to-brain ratio was significantly higher (10.6±2.5 vs. 2.1±0.6; P=.001). Conclusions: Consistent with biodistribution studies, uptake of [ 18 F]-scyllo-inositol was successfully visualized by PET imaging in human BC and glioma xenografts, with lower accumulation in inflammatory tissue than [ 18 F]-FDG. The tumour-to-brain ratio of [ 18 F]-scyllo-inositol was also significantly higher than that of [ 18 F]-FDG for visualizing intracranial glioma xenografts in NOD SCID mice, giving a better contrast. -- Graphical Abstract: Display Omitted
Mid-Infrared Fiber Lasers (Les fibres laser infrarouge moyen)
2010-09-01
Marcel Poulain, Université de Rennes / Le Verre Fluoré, France Fluoride Fiber Sources: Problems and Prospects Prof. Marcel Poulain from Rennes...currently valid OMB control number. PLEASE DO NOT RETURN YOUR FORM TO THE ABOVE ADDRESS. 1. REPORT DATE (DD-MM-YYYY) 2. REPORT TYPE 3. DATES...Les fibres laser infrarouge moyen (RTO-MP-SET-171) Synthèse Les sources laser en infrarouge moyen sont nécessaires aux systèmes actifs de
CSIR Research Space (South Africa)
De Lange, Willem J
2012-05-01
Full Text Available (priorities, 132 values and objectives) in the context of the problem; the outputs can guide decision-makers to 133 identify a preferred course of action (Mamphweli and Meyer, 2009, Strager and Rosenberger, 134 2006, Hobbs et al., 1992, Belton and Stewart..., A. (1993) People?s self development: Perspectives on participatory action research., London, UK., 604 Zed Publications. 605 RENN, O. (2006) Participatory processes for designing environmental policies. Land Use Policy, 23, 34-43. 606 RENN, O...
Boltzmann und das Ende des mechanistischen Weltbildes
Renn, Jürgen
2007-01-01
Der Wissenschaftshistoriker und Physiker Jürgen Renn untersucht die Rolle des österreichischen Physikers und Philosophen Ludwig Boltzmann (18441906) bei der Entwicklung der modernen Physik. Boltzmann war einer der letzen Vertreter des mechanistischen Weltbildes und stand somit am Ende eines Zeitalters. Renn porträtiert den Wissenschaftler aber als einen Pionier der modernen Physik, dessen Beschäftigung mit den inneren Spannungen der klassischen Physik ihn visionär zukünftige Fragestellungen aufgreifen ließ. So befasste sich Boltzmann etwa mit den Grenzproblemen zwischen Mechanik und Thermodynamik, die ihn zur Entwicklung immer raffinierterer Instrumente der statistischen Physik antrieb, die schließlich zu Schlüsselinstrumenten der modernen Physik wurden. Boltzmanns Werk steht somit am Übergang vom mechanistischen Weltbild zur Relativitäts- und Quantentheorie. Der Aussage des viel bekannteren Physikers Albert Einstein, dass Fantasie wichtiger sei als Wissen, hält Jürgen Renn im Hinblick auf Leben ...
Langerak, C.J.
1985-01-01
<u>The pathogenesis of Fusarium oxysporum f. sp. narcissiu>
Basal plates and roots of narcissus were infected by Fusarium oxysporum Schlecht f. sp. narcissi (Cooke & Massee) Snyder &1982-05-06
BUS MKS Fucioa Diagram ~ALAOAR *RSAU TT E E 0E U D*iQ MKSXQ16 Microinstruction Word 1 ~ ~5 .6 a7 . 6 1 1,I 1,. 151li "" SP*D ACCA CONTROL JASNTJ EX...result CALLSF 4F FA Call with ID in register GETSID 4F F9 Get re-time ID of function Data Forwarding FWD 4F F6 Forward integer DFWD 4F F5 Forward
Cry1F resistance in fall armyworm Spodoptera frugiperda: single gene versus pyramided Bt maize.
Huang, Fangneng; Qureshi, Jawwad A; Meagher, Robert L; Reisig, Dominic D; Head, Graham P; Andow, David A; Ni, Xinzi; Kerns, David; Buntin, G David; Niu, Ying; Yang, Fei; Dangal, Vikash
2014-01-01
Evolution of insect resistance to transgenic crops containing Bacillus thuringiensis (Bt) genes is a serious threat to the sustainability of this technology. However, field resistance related to the reduced efficacy of Bt maize has not been documented in any lepidopteran pest in the mainland U.S. after 18 years of intensive Bt maize planting. Here we report compelling evidence of field resistance in the fall armyworm, Spodoptera frugiperda (J.E. Smith), to Cry1F maize (TC 3507) in the southeastern region of the U.S. An F2 screen showed a surprisingly high (0.293) Cry1F resistance allele frequency in a population collected in 2011 from non-Bt maize in south Florida. Field populations from non-Bt maize in 2012-2013 exhibited 18.8-fold to >85.4-fold resistance to purified Cry1F protein and those collected from unexpectedly damaged Bt maize plants at several locations in Florida and North Carolina had >85.4-fold resistance. In addition, reduced efficacy and control failure of Cry1F maize against natural populations of S. frugiperda were documented in field trials using Cry1F-based and pyramided Bt maize products in south Florida. The Cry1F-resistant S. frugiperda also showed a low level of cross-resistance to Cry1A.105 and related maize products, but not to Cry2Ab2 or Vip3A. The occurrence of Cry1F resistance in the U.S. mainland populations of S. frugiperda likely represents migration of insects from Puerto Rico, indicating the great challenges faced in achieving effective resistance management for long-distance migratory pests like S. frugiperda.
File list: InP.EmF.50.Input_control.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.EmF.50.Input_control.AllCell mm9 Input control Input control Embryonic fibrobla...363,SRX115361 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.EmF.50.Input_control.AllCell.bed ...
File list: InP.EmF.05.Input_control.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.EmF.05.Input_control.AllCell mm9 Input control Input control Embryonic fibrobla...367,SRX115361 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.EmF.05.Input_control.AllCell.bed ...
File list: InP.EmF.20.Input_control.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available InP.EmF.20.Input_control.AllCell mm9 Input control Input control Embryonic fibrobla...367,SRX115361 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.EmF.20.Input_control.AllCell.bed ...
File list: Oth.EmF.05.Epitope_tags.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.EmF.05.Epitope_tags.AllCell mm9 TFs and others Epitope tags Embryonic fibroblas...RX542102,SRX204644,SRX204643,SRX255462,SRX255460 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.EmF.05.Epitope_tags.AllCell.bed ...
File list: Oth.EmF.50.Epitope_tags.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.EmF.50.Epitope_tags.AllCell mm9 TFs and others Epitope tags Embryonic fibroblas...RX255460,SRX204644,SRX542102,SRX204643,SRX204642 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.EmF.50.Epitope_tags.AllCell.bed ...
Cost-based optimizations of power density and target-blanket modularity for 232Th/233U-based ADEP
International Nuclear Information System (INIS)
Krakowski, R.A.
1995-01-01
A cost-based parametric systems model is developed for an Accelerator-Driven Energy Production (ADEP) system based on a 232 Th/ 233 U fuel cycle and a molten-salt (LiF/BeF 2 /ThF 3 ) fluid-fuel primary system. Simplified neutron-balance, accelerator, reactor-core, chemical-processing, and balance-of-plant models are combined parametrically with a simplified costing model. The main focus of this model is to examine trade offs related to fission power density, reactor-core modularity, 233 U breeding rate, and fission product transmutation capacity
Anomalous decay f1(1285 )→π+π-γ in the Nambu-Jona-Lasinio model
Osipov, A. A.; Volkov, M. K.
2018-04-01
Using the Nambu-Jona-Lasinio model with the U (2 )×U (2 ) chiral symmetric effective four-quark interactions, we derive the amplitude of the radiative decay f1(1285 )→π+π-γ , find the decay width Γ (f1→π+π-γ )=346 keV and obtain the spectral dipion effective mass distribution. It is shown that in contrast to the majority of theoretical estimates (which consider the a1(1260 ) meson exchange as the dominant one), the most relevant contribution to this process is the ρ0-resonance exchange related with the triangle f1ρ0γ anomaly. The spectral function is obtained to be confronted with the future empirical data.
Bioaccumulation of uranium 234U and 238U in marine birds
International Nuclear Information System (INIS)
Borylo, A.; Skwarzec, B.
2010-01-01
In the paper was presented results of our study about uranium 234 U and 238 U radioactivity in the marine birds samples, collected in the Polish area of the southern Baltic Sea. We chose 11 species of sea birds: three species permanently residing at southern Baltic, four species of wintering birds and three species of migrating birds. The obtained results indicated that uranium is very irregularly distributed in organs and tissues of marine birds. The highest uranium content is characterized in liver, rest of viscera and feathers, the smallest in skin and muscles. The uranium concentration was higher for carnivorous species (long-tailed duck (C. hyemalis), common eider (S. mollissima), lower for species eating fish (great cormorant (P. carbo), common guillemot (U. aalge), red-throated diver (G. stellata) and razorbill (A. tarda)), but the biggest amounts for herbivorous species [tufted duck (A. fuligula) and eurasian coot (F. atra)]. About 63-67% of uranium, which was located in feathers of two species of marine birds: razorbill (A. tarda) and long-tailed duck (C. hymealis), was apparently adsorbed, which suggests that uranium adsorption on the feathers may be an important transfer from air to water. (author)
On the standard model group in F-theory
International Nuclear Information System (INIS)
Choi, Kang-Sin
2014-01-01
We analyze the standard model gauge group SU(3) x SU(2) x U(1) constructed in F-theory. The non-Abelian part SU(3) x SU(2) is described by a surface singularity of Kodaira type. Blow-up analysis shows that the non-Abelian part is distinguished from the naive product of SU(3) and SU(2), but that it should be a rank three group along the chain of E n groups, because it has non-generic gauge symmetry enhancement structure responsible for desirablematter curves. The Abelian part U(1) is constructed from a globally valid two-form with the desired gauge quantum numbers, using a similar method to the decomposition (factorization) method of the spectral cover. This technique makes use of an extra section in the elliptic fiber of the Calabi-Yau manifold, on which F-theory is compactified. Conventional gauge coupling unification of SU(5) is achieved, without requiring a threshold correction from the flux along the hypercharge direction. (orig.)
F.F.F.F. armastab mõtestada ennast / Reet Varblane
Varblane, Reet, 1952-
2002-01-01
Rühmituse F.F.F.F. (Kristi Paap, Kaire Rannik, Berit Teeäär, Ketli Tiitsar, Maria Valdma) näitus "Meie igapäevane leib" 9. novembrini Hansapanga galeriis ja näitus "Pentagramm" 26. X-1. XII Tarbekunstimuuseumis
Concentration and Quantification of Somatic and F+ Coliphages from Recreational Waters
U.S. Environmental Protection Agency — Dataset describes performance of a culture-based method to concentrate and quantify somatic and F+ coliphages. This dataset is associated with the following...
Human Parvovirus B19 NS1 Protein Aggravates Liver Injury in NZB/W F1 Mice
Tsai, Chun-Chou; Chiu, Chun-Ching; Hsu, Jeng-Dong; Hsu, Huai-Sheng; Tzang, Bor-Show; Hsu, Tsai-Ching
2013-01-01
Human parvovirus B19 (B19) has been associated with a variety of diseases. However, the influence of B19 viral proteins on hepatic injury in SLE is still obscure. To elucidate the effects of B19 viral proteins on livers in SLE, recombinant B19 NS1, VP1u or VP2 proteins were injected subcutaneously into NZB/W F1 mice, respectively. Significant expressions of inducible nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2) were detected in NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Markedly hepatocyte disarray and lymphocyte infiltration were observed in livers from NZB/WF 1 mice receiving B19 NS1 as compared to those mice receiving PBS. Additionally, significant increases of Tumor Necrosis Factor –α (TNF-α), TNF-α receptor, IκB kinase –α (IKK-α), nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor (IκB) and nuclear factor-kappa B (NF-κB) were detected in livers from NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Accordingly, significant increases of matrix metalloproteinase-9 (MMP9) and U-plasminogen activator (uPA) were also detected in livers from NZB/W F1 mice receiving B19 NS1 as compared to those mice receiving PBS. Contrarily, no significant variation on livers from NZB/W F1 mice receiving B19 VP1u or VP2 was observed as compared to those mice receiving PBS. These findings firstly demonstrated the aggravated effects of B19 NS1 but not VP1u or VP2 protein on hepatic injury and provide a clue in understanding the role of B19 NS1 on hepatic injury in SLE. PMID:23555760
Family symmetries in F-theory GUTs
King, S F; Ross, G G
2010-01-01
We discuss F-theory SU(5) GUTs in which some or all of the quark and lepton families are assigned to different curves and family symmetry enforces a leading order rank one structure of the Yukawa matrices. We consider two possibilities for the suppression of baryon and lepton number violation. The first is based on Flipped SU(5) with gauge group SU(5)\\times U(1)_\\chi \\times SU(4)_{\\perp} in which U(1)_{\\chi} plays the role of a generalised matter parity. We present an example which, after imposing a Z_2 monodromy, has a U(1)_{\\perp}^2 family symmetry. Even in the absence of flux, spontaneous breaking of the family symmetry leads to viable quark, charged lepton and neutrino masses and mixing. The second possibility has an R-parity associated with the symmetry of the underlying compactification manifold and the flux. We construct an example of a model with viable masses and mixing angles based on the gauge group SU(5)\\times SU(5)_{\\perp} with a U(1)_{\\perp}^3 family symmetry after imposing a Z_2 monodromy.
Neutron induced fission of U isotopes up to 100 MeV
International Nuclear Information System (INIS)
Lestone, J.P.; Gavron, A.
1993-01-01
We have developed a statistical model description of the neutron induced fission of U isotopes using densities of intrinsic states and spin cut off parameters obtained directly from appropriate Nilsson model single particle levels. The first chance fission cross sections are well reproduced when the rotational contributions to the nuclear level densities are taken into account. In order to fit the U(n,f) cross sections above the threshold of second chance fission, we need to: (1) assume that the triaxial level density enhancement is washed out at an excitation energy of ∼7 MeV above the triaxial barriers with a width of ∼1 MeV, implying a γ deformation for the first barriers of 10 degree < γ < 20 degree; and (2) include pre-equilibrium particle emission in the calculations. Above an incoming neutron kinetic energy of ∼17 MeV our statistical model U(n,f) cross sections increasingly overestimate the experimental data when so called ''good'' optical model potentials are used to calculate the compound nucleus formation cross sections. This is not surprising since at these high energies little data exists on the scattering of neutrons to help guide the choice of optical model parameters. A satisfactory reproduction of all the available U(n,f) cross sections above 17 MeV is obtained by a simple scaling of our calculated compound nucleus formation cross sections. This scaling factor falls from 1.0 at 17 MeV to 0.82 at 100 MeV
Energy Technology Data Exchange (ETDEWEB)
Simutkin, V.D. [Uppsala University, P.O Box 525, SE-751 20 Uppsala (Sweden)
2008-07-01
Conceptual analysis of accelerator-driven systems assumes extensive use of nuclear data on neutron-induced reactions at intermediate energies. In particular, information about the fission fragment yields from the {sup 238}U(n,f) and {sup 232}Th(n,f) reactions is of particular interest at neutron energies from 10 to 200 MeV. However, there is a lack of such data for both {sup 238}U and {sup 232}Th. Up to now, the intermediate energy measurements have been performed for {sup 238}U only, and there are no data for the {sup 232}Th(n,f) reaction. The aim of the work is to provide such data. Fission fragment mass distributions for the {sup 232}Th(n,f) and {sup 238}U(n,f) reactions have been measured for the incident neutron energies 32.8 MeV, 45.3 MeV and 59.9 MeV. The experiments have been performed at the neutron beam facility of the Universite Catholique de Louvain, Belgium. A multi-section Frisch-gridded ionization chamber has been used as a fission fragment detector. The data obtained have been interpreted in terms of the multimodal random neck-rupture model (MMRNRM). (authors)
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. F F Sun. Articles written in Bulletin of Materials Science. Volume 37 Issue 1 February 2014 pp 71-76. Study of electroless copper plating on ABS resin surface modified by heterocyclic organosilane self-assembled film · H N Zhang J Wang F F Sun D Liu H Y Wang F Wang.
Investigation into the MgF2-NiF2, CaF2-NiF2, SrF2-NiF2 systems
International Nuclear Information System (INIS)
Ikrami, D.D.; Petrov, S.V.; Fedorov, P.P.; Ol'khovaya, L.A.; Luginina, A.A.; AN SSSR, Moscow. Inst. Fizicheskikh Problem; AN SSSR, Moscow. Inst. Kristallografii)
1984-01-01
Using the methods of differential thermal and X-ray phase analyses the systems MgF 2 -NiF 2 , CaF 2 -NiF 2 , SrF 2 -NiF 2 have been studied. In the system SrF 2 -NiF 2 the only orthorhombic compounds SrNiF 4 (a=14.43; b=3.93; c=5.66 (+-0.01 A)) is formed. SrNiF 4 density constitutes: dsub(X-ray)=4.60+-0.01 g/cm 3 , dsub(exp.)=4.60+-0.03 g/cm 3 . Refraction indices are as follows SrNiF 4 :Ng=1.500; Nsub(m)=1.497; Nsub(p)=1.479. SrNiF 4 magnetic ordering temperature Tsub(N) approximately 100 K
File list: Oth.EmF.05.Taf7l.AllCell [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Oth.EmF.05.Taf7l.AllCell mm9 TFs and others Taf7l Embryonic fibroblast SRX202798,SR...X202799 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.EmF.05.Taf7l.AllCell.bed ...
International Nuclear Information System (INIS)
Barklay, Chadwick D.; Miller, Roger G.; Pugh, Barry K.; Howell, Edwin I.
1997-01-01
Over the last 30 years, radioisotopes have provided heat from which electrical power is generated. For space missions, the isotope of choice has generally been 238 PuO 2 , its long half-life making it ideal for supplying power to remote satellites and spacecraft like the Voyager, Pioneer, and Viking missions, as well as the recently launched Galileo and Ulysses missions, and the presently planned Cassini mission. Electric power for future space missions will be provided by either radioisotopic thermoelectric generators (RTG), radioisotope thermophotovoltaic systems (RTPV), alkali metal thermal to electrical conversion (AMTEC) systems, radioisotope Stirling systems, or a combination of these. The type of electrical power system has yet to be specified for the 'Pluto Express' mission. However, the current plan does incorporate the use of Russian launch platforms for the spacecraft. The implied tasks associated with this plan require obtaining international certification for the transport of the radioisotopic power system, and resolving any logistical issues associated with the actual shipment of the selected radioisotopic power system. This paper presents a conceptual summary of the logistical considerations associated with shipping the selected radioisotopic power system using the USA/9904/B(U)F-85, Radioisotope Thermoelectric Generator Transportation System (RTGTS)
Uncertainty assessing of measure result of tungsten in U3O8 by ICP-AES
International Nuclear Information System (INIS)
Du Guirong; Nie Jie; Tang Lilei
2011-01-01
According as the determining method and the assessing criterion,the uncertainty assessing of measure result of tungsten in U 3 O 8 by ICP-AES is researched. With the assessment of each component in detail, the result shows that u rel (sc)> u rel (c)> u rel (F)> u rel (m) by uncertainty contribution. Other uncertainty is random, calculated by repetition. u rel (sc) is contributed to uncertainty mainly. So the general uncertainty is reduced with strict operation to reduce u rel (sc). (authors)
Gauge fluxes in F-theory compactifications
Energy Technology Data Exchange (ETDEWEB)
Lin, Ling
2016-07-13
In this thesis, we study the geometry and physics of gauge fluxes in F-theory compactifications to four dimensions. Motivated by the phenomenological requirement of chiral matter in realistic model building scenarios, we develop methods for a systematic analysis of primary vertical G{sub 4}-fluxes on torus-fibred Calabi-Yau fourfolds. In particular, we extend the well-known description of fluxes on elliptic fibrations with sections to the more general set-up of genus-one fibrations with multi-sections. The latter are known to give rise to discrete abelian symmetries in F-theory. We test our proposal for constructing fluxes in such geometries on an explicit model with SU(5) x Z{sub 2} symmetry, which is connected to an ordinary elliptic fibration with SU(5) x U(1) symmetry by a conifold transition. With our methods we systematically verify anomaly cancellation and tadpole matching in both models. Along the way, we find a novel way of understanding anomaly cancellation in 4D F-theory in purely geometric terms. This observation is further strengthened by a similar analysis of an SU(3) x SU(2) x U(1){sup 2} model. The obvious connection of this particular model with the Standard Model is then investigated in a more phenomenologically motivated survey. There, we will first provide possible matchings of the geometric spectrum with the Standard Model states, which highlights the role of the additional U(1) factor as a selection rule. In a second step, we then utilise our novel methods on flux computations to set up a search algorithm for semi-realistic chiral spectra in our Standard- Model-like fibrations over specific base manifolds B. As a demonstration, we scan over three choices P{sup 3}, Bl{sub 1}P{sup 3} and Bl{sub 2}P{sup 3} for the base. As a result we find a consistent flux that gives the chiral Standard Model spectrum with a vector-like triplet exotic, which may be lifted by a Higgs mechanism.
2010-02-25
...: Stephen F. Austin State University, Nacogdoches, TX AGENCY: National Park Service, Interior. ACTION... Act (NAGPRA), 25 U.S.C. 3005, of the intent to repatriate cultural items in the control of Stephen F... of Oklahoma, which was under contract with Stephen F. Austin State University. In 1957, 15 cultural...
International Nuclear Information System (INIS)
Demoin, Dustin Wayne; Shindo, Masahiro; Zhang, Hanwen; Edwards, Kimberly J.; Serganova, Inna; Pillarsetty, Naga Vara Kishore; Lewis, Jason S.; Blasberg, Ronald G.
2016-01-01
Introduction: Chemokine receptor-4 (CXCR4, fusin, CD184) is expressed on several tissues involved in immune regulation and is upregulated in many diseases including malignant gliomas. A radiolabeled small molecule that readily crosses the blood–brain barrier can aid in identifying CXCR4-expressing gliomas and monitoring CXCR4-targeted therapy. In the current work, we have synthesized and evaluated an [ 18 F]-labeled small molecule based on a pyrimidine–pyridine amine for its ability to target CXCR4. Experimental: The nonradioactive standards and the nitro precursor used in this study were prepared using established methods. An HPLC method was developed to separate the nitro-precursor from the nonradioactive standard and radioactive product. The nitro-precursor was radiolabeled with 18 F under inert, anhydrous conditions using the [ 18 F]-kryptofix 2.2.2 complex to form the desired N-(4-(((6-[ 18 F]fluoropyridin-2-yl)amino)methyl)benzyl)pyrimidin-2-amine ([ 18 F]-3). The purified radiolabeled compound was used in serum stability, partition coefficient, cellular uptake, and in vivo cancer targeting studies. Results: [ 18 F]-3 was synthesized in 4–10% decay-corrected yield (to start of synthesis). [ 18 F]-3 (t R ≈ 27 min) was separated from the precursor (t R ≈ 30 min) using a pentafluorophenyl column with an isocratic solvent system. [ 18 F]-3 displayed acceptable serum stability over 2 h. The amount of [ 18 F]-3 bound to the plasma proteins was determined to be > 97%. The partition coefficient (LogD 7.4 ) is 1.4 ± 0.5. Competitive in vitro inhibition indicated 3 does not inhibit uptake of 67 Ga-pentixafor. Cell culture media incubation and ex vivo urine analysis indicate rapid metabolism of [ 18 F]-3 into hydrophilic metabolites. Thus, in vitro uptake of [ 18 F]-3 in CXCR4 overexpressing U87 cells (U87 CXCR4) and U87 WT indicated no specific binding. In vivo studies in mice bearing U87 CXCR4 and U87 WT tumors on the left and right shoulders were carried
Energy Technology Data Exchange (ETDEWEB)
McLarty, Kristin; Moran, Matthew D. [Department of Psychiatry, University of Toronto, Toronto, ON, M5T 1R8 (Canada); PET Centre, Centre for Addiction and Mental Health, Toronto, ON, M5T 1R8 (Canada); Scollard, Deborah A.; Chan, Conrad [Department of Pharmaceutical Sciences, University of Toronto, Toronto, ON, M5S 3M2 (Canada); Sabha, Nesrin; Mukherjee, Joydeep; Guha, Abhijit [Arthur and Sonia Labatt Brain Tumour Research Centre, Hospital for Sick Children, University of Toronto, ON, M5G 1X8 (Canada); McLaurin, JoAnne [Centre for Research in Neurodegenerative Diseases, University of Toronto, Toronto, ON, M5S 3H2 (Canada); Nitz, Mark [Department of Chemistry, University of Toronto, Toronto, ON, M5S 3H6 (Canada); Houle, Sylvain; Wilson, Alan A. [Department of Psychiatry, University of Toronto, Toronto, ON, M5T 1R8 (Canada); PET Centre, Centre for Addiction and Mental Health, Toronto, ON, M5T 1R8 (Canada); Reilly, Raymond M., E-mail: raymond.reilly@utoronto.ca [Department of Pharmaceutical Sciences, University of Toronto, Toronto, ON, M5S 3M2 (Canada); Toronto General Research Institute, University Health Network, Toronto, ON, M5G 2M9 (Canada); Department of Medical Imaging, University of Toronto, Toronto, ON, M5S 3M2 (Canada); Vasdev, Neil, E-mail: neil.vasdev@utoronto.ca [Department of Psychiatry, University of Toronto, Toronto, ON, M5T 1R8 (Canada); PET Centre, Centre for Addiction and Mental Health, Toronto, ON, M5T 1R8 (Canada)
2011-10-15
Introduction: The aim of the study was to evaluate the uptake of [{sup 18}F]-1-deoxy-1-fluoro-scyllo-inositol ([{sup 18}F]-scyllo-inositol) in human breast cancer (BC) and glioma xenografts, as well as in inflammatory tissue, in immunocompromised mice. Studies of [{sup 18}F]-2-fluoro-2-deoxy-D-glucose ([{sup 18}F]-FDG) under the same conditions were also performed. Methods: Radiosynthesis of [{sup 18}F]-scyllo-inositol was automated using a commercial synthesis module. Tumour, inflammation and normal tissue uptakes were evaluated by biodistribution studies and positron emission tomography (PET) imaging using [{sup 18}F]-scyllo-inositol and [{sup 18}F]-FDG in mice bearing subcutaneous MDA-MB-231, MCF-7 and MDA-MB-361 human BC xenografts, intracranial U-87 MG glioma xenografts and turpentine-induced inflammation. Results: The radiosynthesis of [{sup 18}F]-scyllo-inositol was automated with good radiochemical yields (24.6%{+-}3.3%, uncorrected for decay, 65{+-}2 min, n=5) and high specific activities ({>=}195 GBq/{mu}mol at end of synthesis). Uptake of [{sup 18}F]-scyllo-inositol was greatest in MDA-MB-231 BC tumours and was comparable to that of [{sup 18}F]-FDG (4.6{+-}0.5 vs. 5.5{+-}2.1 %ID/g, respectively; P=.40), but was marginally lower in MDA-MB-361 and MCF-7 xenografts. Uptake of [{sup 18}F]-scyllo-inositol in inflammation was lower than [{sup 18}F]-FDG. While uptake of [{sup 18}F]-scyllo-inositol in intracranial U-87 MG xenografts was significantly lower than [{sup 18}F]-FDG, the tumour-to-brain ratio was significantly higher (10.6{+-}2.5 vs. 2.1{+-}0.6; P=.001). Conclusions: Consistent with biodistribution studies, uptake of [{sup 18}F]-scyllo-inositol was successfully visualized by PET imaging in human BC and glioma xenografts, with lower accumulation in inflammatory tissue than [{sup 18}F]-FDG. The tumour-to-brain ratio of [{sup 18}F]-scyllo-inositol was also significantly higher than that of [{sup 18}F]-FDG for visualizing intracranial glioma xenografts in
Thermal conductivity of fresh and irradiated U-Mo fuels
Huber, Tanja K.; Breitkreutz, Harald; Burkes, Douglas E.; Casella, Amanda J.; Casella, Andrew M.; Elgeti, Stefan; Reiter, Christian; Robinson, Adam. B.; Smith, Frances. N.; Wachs, Daniel. M.; Petry, Winfried
2018-05-01
The thermal conductivity of fresh and irradiated U-Mo dispersion and monolithic fuel has been investigated experimentally and compared to theoretical models. During in-pile irradiation, thermal conductivity of fresh dispersion fuel at a temperature of 150 °C decreased from 59 W/m·K to 18 W/m·K at a burn-up of 4.9·1021 f/cc and further to 9 W/m·K at a burn-up of 6.1·1021 f/cc. Fresh monolithic fuel has a considerably lower thermal conductivity of 15 W/m·K at a temperature of 150 °C and consequently its decrease during in-pile irradiation is less steep than for dispersion fuel. For a burn-up of 3.5·1021 f/cc of monolithic fuel, a thermal conductivity of 11 W/m·K at a temperature of 150 °C has been measured by Burkes et al. (2015). The difference of decrease for both fuels originates from effects in the matrix that occur during irradiation, like for dispersion fuel the gradual disappearance of the Al matrix with increased burn-up and the subsequent growth of an interaction layer (IDL) between the U-Mo fuel particle and Al matrix and subsequent matrix hardening. The growth of fission gas bubbles and the decomposition of the U-Mo crystal lattice also affect both dispersion and monolithic fuel.
U.S. EPA, Pesticide Product Label, SECURITY INDOOR INSECT FOGGER, 09/19/1988
2011-04-21
... ri Dc! (' .. t .r t .. --. 1 • ;"":t· i. t .. ," }1I t ~- !; I . .. jill • ~-, t} t , , (. ~ u I ", ;-cCur I' !. - ll.'J71pr't f1rlfr'n(:f inc ~ r~· r ".tf' 'I, rune! t." ! ,( I ; C):: • I •• ' : ' ...
Simple calculation of hybridization effects in UTX and U2T2X compounds
International Nuclear Information System (INIS)
Prokes, K.; Brueck, E.; Nakotte, H.; De Chatel, P.F.; De Boer, F.R.
1995-01-01
The band widths of several UTX and U 2 T 2 X compounds (T: transition metal, X: p-metal) are evaluated by means of a tight-binding method. The magnetism in both groups of compounds is governed by the hybridization between U f-states and transition-metal d-states. Comparing the sum of all hybridization effects, we find approximately the same hybridization effects in both groups of compounds. We also observe a decrease of the band width with increasing atomic number Z within a transition-metal series. By comparing the band width with the theoretical critical energies for the f 3 and f 2 configurations, it is in some cases possible to predict whether the ground state is magnetically ordered or not. ((orig.))
Levels in 223Th populated by α decay of 227U
Kalaninová, Z.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Kindler, B.; Laatiaoui, M.; Lommel, B.; Maurer, J.
2015-07-01
Levels in 223Th populated by the α decay of 227U were investigated using α -γ decay spectroscopy. The 227U isotope was produced in the fusion-evaporation reaction 22Ne +208Pb at the velocity filter separator for heavy-ion reaction products at Gesellschaft für Schwerionenforschung in Darmstadt (Germany). Several new excited levels and γ transitions were identified in 223Th . An improved α -decay scheme of 227U was suggested. The experimental α -decay energy spectrum of 227U was compared with the Monte Carlo simulation performed using the toolkit geant4.
Evaluation of neutron-induced reactions in 48Ti and 238U
International Nuclear Information System (INIS)
Carlson, B.V.; Fiorentino, J.; Frederico, T.; Isidro Filho, M.P.; Mastroleo, R.C.; Rego, R.A.
1984-05-01
Preliminary results of the evaluation of neutron-induced reactions in 48 Ti and 238 U are presented. Calculated cross sections for the reactions (n,γ), (n,n'), (n, 2n) and (n,p) as well as for (n,f) in 238 U are given. Comparisons with available experimental data are made and possible changes in the parameters are discussed. (Author) [pt
International Nuclear Information System (INIS)
Tuveson, M.
1980-01-01
The side-effects of Kontrast-U myelography, a special X-ray method of examination of the lumbar part of the spine using a Swedish manufactured contrast medium called Kontrast-U, are reported. The legal proceedings against the drug company are described. (C.F.)
1972-01-17
V6 10 T U779Z 68i, s4,2 0*0 9 43 9o,3 9295 91,e 9,1 7 ’,!) 92bo ci’O S700 U. (0. (’ I. # S) .6 4 r, ś 13,60 f, IU O 7 L 77*2 Bj.7 d 3 il 87s. 10.3...kI#? 67.7 67*7 60#3 bb,5 609S 6b.6 tbH,6 69.1 69.0 2 Boo ’Loh.: UFO b".0 00. 71l I I f1 74? 12 7. 1490 73#6 7306 73.6 73.Y 74o9 74,3 14,88 S700 (:Jet f
International Nuclear Information System (INIS)
Caldeira, A.D.
1987-05-01
The theoretical and adjusted Watt spectrum representations for 235 U are used as weighting functions to calculate K eff and θ f 28 /θ f 25 for the benchmark Godiva. The results obtained show that the values of K eff and θ f 28 /θ f 25 are not affected by spectrum form change. (author) [pt
The Shanghai Cooperation Organization: Should the U.S. be Concerned?
2013-03-01
Cooperation Organization and the Central Asian States, Thesis for Master of Arts in China-U.S. Relations (University of Hawaii at Hilo , December 2007...Clinton reinforced U.S. desires to coordinate with the SCO (among other Asian regional institutions) at a January 2010 conference in Hawaii . 101F102...Hillary Rodham Clinton, Hillary Rodham, “Remarks on Regional Architecture in Asia: Principles and Priorities,” Hawaii , Department of State, January 12
2009-09-15
basketball (24 percent), weightlifting (19 percent), PT (18 percent), and football (14 percent). Injury Prevention Report No. 12-HF-0C7F-10, 1 Jan... INJURY PREVENTION REPORT NO. 12-HF-0C7F-10 U.S. ARMY DEPLOYMENT INJURY SURVEILLANCE SUMMARY CALENDAR YEAR 2008 1 JANUARY 2008–31...2008 – 31 December 2008 4. TITLE AND SUBTITLE U.S. Army Deployment Injury Surveillance Summary 2008 5a. CONTRACT NUMBER n/a 5b. GRANT NUMBER
Directory of Open Access Journals (Sweden)
Ali Meftah
2017-06-01
Full Text Available In an attempt to improve U II analysis, the lowest configurations of both parities have been interpreted by means of the Racah-Slater parametric method, using Cowan codes. In the odd parity, including the ground state, 253 levels of the interacting configurations 5 f 3 7 s 2 + 5 f 3 6 d 7 s + 5 f 3 6 d 2 + 5 f 4 7 p + 5 f 5 are interpreted by 24 free parameters and 64 constrained ones, with a root mean square (rms deviation of 60 cm − 1 . In the even parity, the four known configurations 5 f 4 7 s , 5 f 4 6 d , 5 f 2 6 d 2 7 s , 5 f 2 6 d 7 s 2 and the unknown 5 f 2 6 d 3 form a basis for interpreting 125 levels with a rms deviation of 84 cm − 1 . Due to perturbations, the theoretical description of the higher configurations 5 f 3 7 s 7 p + 5 f 3 6 d 7 p remains unsatisfactory. The known and predicted levels of U II are used for a determination of the partition function. The parametric study led us to a re-investigation of high resolution ultraviolet spectrum of uranium recorded at the Meudon Observatory in the late eighties, of which the analysis was unachieved. In the course of the present study, a number of 451 lines of U II has been classified in the region 2344 –2955 Å. One new level has been established as 5 f 3 6 d 7 p ( 4 I 6 K ( J = 5.5 at 39113.98 ± 0.1 cm − 1 .
U.S. Infrastructure : funding trends and Federal agencies investment estimates
2001-07-01
This is the statement of Peter F. Guerrero, Director, Physical Infrastructure Issues before the Subcommittee on Transportation and Infrastructure, Committee on Environment and Public Works, U.S. Senate regarding public infrastructure. The testimony d...
Energy Technology Data Exchange (ETDEWEB)
Fraysse, G; Prosdocimi, A; Netter, F; Samour, C [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1965-07-01
Improved techniques of fast detection have been applied for determining the fission cross-sections of {sup 235}U and {sup 239}Pu with reference to the absorption cross-section of Boron. Monochromatic neutron beams of 0.0322 eV, 0.0626 eV and 0.275 eV have been employed. Use has been made of a Xe-filled gaseous scintillator and of a low-geometry solid state ion chamber. Both measured alpha and fission rates. The results at the reference energy of 0.0253 eV are: ({sigma}{sub F}){sub 0} {sup 235}U = 588 {+-} 10 barns ({sigma}{sub F}){sub 0} {sup 239}Pu = 738 {+-} 7 barns. (authors) [French] Des techniques avancees de comptage rapide ont ete mise en oeuvre pour determiner la section efficace de fission de {sup 235}U et de {sup 239}Pu par rapport a celle d'absorption du bore. Des faisceaux de neutrons monochromatiques de 0,0322 eV, 0,0626 eV et 0,275 eV ont ete employes. Les detecteurs utilises sont un scintillateur gazeux rempli de xenon et une chambre d'ionisation a etat solide a basse geometrie. Les deux ont mesure les taux des desintegrations alpha et des fissions. Les resultats a l'energie de reference de 0,0253 eV sont: ({sigma}{sub F}){sub 0} {sup 235}U = 588 {+-} 10 barns ({sigma}{sub F}){sub 0} {sup 239}Pu = 738 {+-} 7 barns. (auteurs)
26 CFR 1.904(f)-2T - Recapture of overall foreign losses (temporary).
2010-04-01
... $500 balance in the general category overall foreign loss account or $300 foreign source income in the... in the general category is recharacterized as U.S. source income. The balance in Y's general category..., see § 1.904(f)-2(a) and (b). (c) Section 904(f)(1) recapture—(1) In general. In a year in which a...
Distribution of nutrients in fluvial sediment of the Itajai-Açu river, Blumenau, SC, Brazil
Directory of Open Access Journals (Sweden)
Joseane Susin
2010-04-01
Full Text Available This study verified the occurrence of nitrogen (Ntotal, NH4+, NO3- e NO2- and phosphorus (Ptotal in fluvial sediments of the Itajaí-Açu River, on the river's course in the urban area of Blumenau city. At the eight sites where the samples were collected, the total nitrogen presented values below those recommended in the CONAMA nº 344/2004 Resolution for sediments which is 4,800.00 µg g-1, with values of 350.00 µg g-1 to 2,100.00 µg g-1. The total phosphorus also presented values below the one recommended by the CONAMA nº 344/2004 Resolution for sediments which is 2,000.00 µg g-1. The values found for total phosphorus varied from 61.50 µg g-1 to 378.00 µg g-1, and were determined as the addition of the organic and the inorganic phosphorus. As for the summation of the NH4+, NO3- and NO2- ions at the eight sites where the sample were collected, it can be observed a greater quantity of these ions in any collecting site and in the other sites the values were low. The content values for the NO2- ions for the studied eight sites were low when compared to the values observed for the NH4+ ion.
International Nuclear Information System (INIS)
Cayton, R.H.; Novo-Gradac, K.J.; Bursten, B.E.
1991-01-01
The electronic structures of a series of dinuclear uranium(V) complexes have been investigated using Xα-SW molecular orbital calculations including quasirelativistic corrections. Complexes of the formula U 2 H 10 and U 2 (OH) 10 were used to model the metal-ligand σ and π interactions, respectively, in the known species U 2 (O-i-Pr) 10 . Two basic geometries were investigated: a vertex-sharing bioctahedron with only terminal ligands (D 4h symmetry) and an edge-sharing bioctahedron containing two bridging ligands (D 2h symmetry). The latter geometry, which is that of U 2 (O-i-Pr) 10 , was also examined at U-U bonding and nonbonding distances. The calculations indicate that the U-U interactions are significantly perturbed when H is replaced by OH, owing to strong donation from the OH pπ orbitals into selected U 5f orbitals. The result is a lack of any appreciable U-U interaction for U 2 (OH) 10 in either the D 4h or D 2h geometry. In addition, the overall OH π donation to the U 5f levels is enhanced in the D 2h geometry. The electronic structure of a hypothetical U(V) dimer, Cp 2 U 2 O 4 , was also examined in both bridged and unsupported geometries. The unbridged geometry, like that for U 2 (OH) 10 , suffered from a destabilization of the U-U σ orbital due to ligand π donation and revealed no net U-U bonding. However, the geometry exhibiting two bridging oxo ligands maintains the U-U σ-bonding MO as its lowest energy U 5f orbital. 21 refs., 8 figs., 8 tabs
International Nuclear Information System (INIS)
Dubessy, J.; Nguyen-Trung, C.; Cathelineau, M.; Cuney, M.; Leroy, J.; Poty, B.; Ramboz, C.; Charoy, B.; Weisbrod, A.
1987-01-01
In uranium deposits, fO 2 and fS 2 of mineralizing fluids are higher than values fixed by the pyrite-hematite-magnetite triple point, as shown by uraninite-hematite and/or pyrite mineral association. The stability of quartz-K feldspar-muscovite paragenesis in the wall-rocks of hydrothermal U deposits indicates weakly acid pH. By contrast, in the Sn-W occurrences from the French Southern Massif Central, the fO 2 of mineralizing fluids is between Ni-NiO and Q-F-M buffers as shown by fluid inclusions. The pH of these fluids is weakly acid to weakly basic. Sn-W mineralizing fluids from Cornwall are by contrast purely aqueous and acid. Experimental data on UO 2 , SnO 2 , FeWO 4 , CaWO 4 solubility and metal species in fluids show that fO 2 > H-M are required for uranium transport whereas fO 2 ≤ Ni-NiO favours Sn transport. The fluid oxidation state has no direct influence on the transport and deposition of tungsten. The fO 2 control on the hydrothermal transport properties of these three metals is related on the one hand to the fluid and rock composition, and on the other hand to the minimal 320 0 C temperature required for homogeneous equilibria in the C-O-H system to control the oxidation state at low values. At high temperatures, Sn, Fe and Ca chloride complexes are more stable than carbonate and phosphate uranium complexes. All these results show that temperature and fO 2 account for the opposite behaviour of uranium and tin-tungsten in hydrothermal systems between 300 0 to 500 0 C
International Nuclear Information System (INIS)
Vives, F.
1998-01-01
The 238 U(n,f) reaction has been studied at various incident neutrons energies from 1,2 at 5,8 MeV. The author shows that the vibrational resonances presence in the cross section threshold area and the protons parity effect, lead to variations in the fission fragments properties. The mass, the total kinetic energy (TKE) and the fragments angular distribution have been obtained thanks a ionisation double chamber use. Mass function changes in the mass and kinetic energy distributions and their respectively contributions to the TKE variations, have also been studied. The two-dimension distributions adjustments mass-TKE have been compared to the theoretical calculus, compiled with the multi-modal random neck-rupture model: two solutions are possible. Meanwhile, only one leads to significant physical interpretation in terms of layers effects. (A.L.B.)
f(R) gravity, torsion and non-metricity
International Nuclear Information System (INIS)
Sotiriou, Thomas P
2009-01-01
For both f(R) theories of gravity with an independent symmetric connection (no torsion), usually referred to as Palatini f(R) gravity theories, and for f(R) theories of gravity with torsion but no non-metricity, called U4 theories, it has been shown that the independent connection can actually be eliminated algebraically, as long as this connection does not couple to matter. Remarkably, the outcome in both cases is the same theory, which is dynamically equivalent with an ω 0 = -3/2 Brans-Dicke theory. It is shown here that even for the most general case of an independent connection with both non-metricity and torsion, one arrives at exactly the same theory as in the more restricted cases. This generalizes the previous results and explains why assuming that either the torsion or the non-metricity vanishing ultimately leads to the same theory. It also demonstrates that f(R) actions cannot support an independent connection which carries dynamical degrees of freedom, irrespective of how general this connection is, at least as long as there is no connection-matter coupling. (fast track communication)
Energy Technology Data Exchange (ETDEWEB)
Berthelot, C.; Vervueren, L.; Le Jeune, J.J.; Couturier, O. [Centre Hospitalier Universitaire, Service de Medecine Nucleaire, 49 - Angers (France); Truchan-Graczyk, M.; Genevieve, F.; Ifrah, N. [Centre Hospitalier Universitaire, Service d' Hematologie, 49 - Angers (France); Poirier, A.L. [BEC, centre Paul-Papin, 49 -Angers (France); Artur-Guillemette, P. [Centre Hospitalier Universitaire, Service de Radiologie, 49 - Angers (France)
2009-09-15
Purpose: There is no data in the literature concerning the utility of 2-[{sup 18}F]fluoro-2-deoxy-d-glucose positron emission tomography (F.D.G.-PET) in chronic lymphocytic leukaemia (C.L.L.), except for the diagnosis of Richter's transformations. The purpose of this study was to assess the potential role of F.D.G.-PET in C.L.L. stages A and B. Materials and methods Thirty-five patients (61 {+-} 9 years; 11 women, 24 men; 8 B and 27 A) have benefited of a F.D.G.-PET scan at baseline, for example, before an eventual treatment. F.D.G.-PET scans were analyzed visually and the maximum values of the Standardised Uptake Value (S.U.V.{sub max}) were measured in the main lymph nodes areas. The ability of F.D.G.-PET to differentiate stages A and B patients was evaluated by Student's tests and Receiver Operating Characteristics (R.O.C.) analysis. Results All patients with a normal F.D.G.-PET (n = 18) were stages A. The remaining 17 patients (9 A and 8 B) showed hyper metabolisms in nodal areas above (n = 17) and below (n = 9) the diaphragm, and no visceral involvement. The lymph nodes hyper metabolisms were always bilateral, and of low intensity (= mediastinum; 9 A), or of higher intensity (= liver, 8 B). The S.U.V.{sub max} of stage B (n = 8) were significantly higher than those of the 27 stages A, in all lymph nodes areas except in mediastinum. The highest intensity of F.D.G. uptake was observed in axillary area in stages B patients (S.U.V.max = 2.74 {+-} 1.03). An axillary S.U.V.{sub max} of 1.33 is the most suitable value for the discrimination between stages A and B patients (R.O.C.; AUC = 0.968; sensitivity 1.00; specificity 0.91). Conclusion Lymph nodes hyper metabolisms are constant in the B stage, and more intense than in stage A. These anomalies are always bilateral, unlike what is observed in Richter's transformation. The intensity of axillary lymph nodes F.D.G. uptake can distinguish C.L.L. stages A and B. (authors)
Program package for multicanonical simulations of U(1) lattice gauge theory-Second version
Bazavov, Alexei; Berg, Bernd A.
2013-03-01
A new version STMCMUCA_V1_1 of our program package is available. It eliminates compatibility problems of our Fortran 77 code, originally developed for the g77 compiler, with Fortran 90 and 95 compilers. New version program summaryProgram title: STMC_U1MUCA_v1_1 Catalogue identifier: AEET_v1_1 Licensing provisions: Standard CPC license, http://cpc.cs.qub.ac.uk/licence/licence.html Programming language: Fortran 77 compatible with Fortran 90 and 95 Computers: Any capable of compiling and executing Fortran code Operating systems: Any capable of compiling and executing Fortran code RAM: 10 MB and up depending on lattice size used No. of lines in distributed program, including test data, etc.: 15059 No. of bytes in distributed program, including test data, etc.: 215733 Keywords: Markov chain Monte Carlo, multicanonical, Wang-Landau recursion, Fortran, lattice gauge theory, U(1) gauge group, phase transitions of continuous systems Classification: 11.5 Catalogue identifier of previous version: AEET_v1_0 Journal Reference of previous version: Computer Physics Communications 180 (2009) 2339-2347 Does the new version supersede the previous version?: Yes Nature of problem: Efficient Markov chain Monte Carlo simulation of U(1) lattice gauge theory (or other continuous systems) close to its phase transition. Measurements and analysis of the action per plaquette, the specific heat, Polyakov loops and their structure factors. Solution method: Multicanonical simulations with an initial Wang-Landau recursion to determine suitable weight factors. Reweighting to physical values using logarithmic coding and calculating jackknife error bars. Reasons for the new version: The previous version was developed for the g77 compiler Fortran 77 version. Compiler errors were encountered with Fortran 90 and Fortran 95 compilers (specified below). Summary of revisions: epsilon=one/10**10 is replaced by epsilon/10.0D10 in the parameter statements of the subroutines u1_bmha.f, u1_mucabmha.f, u1wl_backup.f
Thermal reactions of uranium metal, UO 2, U 3O 8, UF 4, and UO 2F 2 with NF 3 to produce UF 6
McNamara, Bruce; Scheele, Randall; Kozelisky, Anne; Edwards, Matthew
2009-11-01
This paper demonstrates that NF 3 fluorinates uranium metal, UO 2, UF 4, UO 3, U 3O 8, and UO 2F 2·2H 2O to produce the volatile UF 6 at temperatures between 100 and 550 °C. Thermogravimetric and differential thermal analysis reaction profiles are described that reflect changes in the uranium fluorination/oxidation state, physiochemical effects, and instances of discrete chemical speciation. Large differences in the onset temperatures for each system investigated implicate changes in mode of the NF 3 gas-solid surface interaction. These studies also demonstrate that NF 3 is a potential replacement fluorinating agent in the existing nuclear fuel cycle and in actinide volatility reprocessing.
Letter Report on Relative Aerial Combat of the F-84E Versus the F-86A capability
1951-01-30
o_ 600 ssoo > 4 o _ _ _ 6dLi 00 CL L-L 40000 0 S0 1 iso gure 2- 6 - z oo .. 600 s_.O ••• J oo:0 O:S 0:0 0:qs O:0 0:I 1 Ld.ELFRTO "WME 4• s. . 5P.84...LEGEND F-86A ------ F-84E. 0 ALTIrlUDE , 5• 5I--- I ,OH ATT DE. 0J A I ISO zoo ?50 300 350 400 4S0 IAS - MPI- SECRET inclosure Figu.re 4...242, AFMC 01-275, & AFMC 02-005). 2. Please direct further questions to Lezora U. Nobles, AFMC CSO/SCOC, DSN 787- 8583 . L E RA LU. N OB LE S AFMC STINFO
IlOTI-OPERATION AL INSTRtJCTION .f\\.I... SYSTEMS MODEL
African Journals Online (AJOL)
Navy and. R. F. Mager's. Criteria. Referenced. Instruction. Model for Analysis. Design and ... Naval educational pol icy of the U.S Navy and of .... skills or abilities which are required as the entry .... development provides for a self correcting, self.
Lisstorp, Mattias; Steinberger, Paul
2012-01-01
Syftet med uppsatsen är att undersöka hur omsättning och rörelseresultat har samband med företagets kapitalstruktur. Resultaten jämförs med befintlig teori för att verifiera de teoretiska ansatserna. Regressionsanalys av tidsserier för 32 svenska börsnoterade företag med mer än 20 miljarder svenska kronor i omsättning 2010 har använts vid den här undersökningen. Data från åren 2004 till 2010 till varje företag är tagen från databasen ”Affärsdata” och undersöks genom regressionsanalys. Först u...
Possible viscosity effects in neutron-induced fission of 232Th and 238U
International Nuclear Information System (INIS)
Gindler, J.E.; Glendenin, L.E.; Wilkins, B.D.
1979-01-01
Fission yields induced in the 238 U(n,f) and 232 Th(n,f) reactions were determined as a function of incident neutron energy (E/sub n/). The ratio of 115 Cd-to- 140 Ba yields as a function of E/sub n/ is analyzed by means of the equation Y 1 /Y 2 = exp[2(a 1 (E/sub n/+E 1 )/sup 1/2/ -2(a 2 (E/sub n/+E 2 )/sup 1/2/] to give values of a/sub i/, the level density parameter, and E/sub i/, the excitation energy for E/sub n/=0. The energies E/sub i/ are interpreted on the basis of the liquid drop model with shell and pairing corrections. Values are deduced for the energy dissipated by viscosity effects in the descent from the saddle point to the point where masses are fixed in the fissioning nucleus. These values are 1.7 MeV for 232 Th(n,f) and 4.8 MeV for 238 U(n,f). These values are consistent with the experimental observation that anti ν/sub p/ is approx. 0.6 neutron greater for 239 U fission than for 233 Th fission and that strong odd--even (nucleon pairing) effects are found in the fragment total kinetic energy distribution for 230 Th fission but not for 234 U fission. The low dissipation energy values together with the low values of pre-scission kinetic energy deduced by Guet, et al., [Nucl. Phys. A134 (1971)1] indicate a shorter path from the saddle point of the fissioning nucleus to scission than is generally assumed in theoretical calculations. 31 references
238U photonuclear studies with 5-10 MeV photons
International Nuclear Information System (INIS)
Hawkes, N.P.
1986-02-01
The 238 U photofission and photoneutron cross sections, and the mean number -ν of prompt neutrons per fission, have been measured between 5 and 10 MeV. The experiment was carried out using bremsstrahlung from the electron linear accelerator HELIOS at Harwell. Neutrons from (γ,f) and (γ,n) reactions on 238 U were detected, and neutron multiplicity distributions recorded. Photoneutron events were separated from photofission events by means of their different multiplicities. (author)
Development of F2 two-step fluorination process for non-aqueous reprocessing
International Nuclear Information System (INIS)
1976-02-01
To establish the F 2 two-step fluorination for stable and high recoveries of plutonium, the fluorination process has been studied with the simulated fuel to a FBR containing UO 2 - PuO 2 and non-radioactive fission products in the 2''phi fluid-bed. The process principle was demonstrated and the effect of FPs on fluorination of U and Pu and the possibility of reducing the Pu loss could be clarified. The feasibility of separating PuF 6 from UF 6 onto UO 2 F 2 by adsorption, was also indicated. (auth.)
Energy Technology Data Exchange (ETDEWEB)
Blumenhagen, Ralph; /Munich, Max Planck Inst.; Grimm, Thomas W.; /Bonn U.; Jurke, Benjamin; /Munich, Max Planck Inst.; Weigand, Timo; /SLAC
2010-08-26
We construct global F-theory GUT models on del Pezzo surfaces in compact Calabi-Yau fourfolds realized as complete intersections of two hypersurface constraints. The intersections of the GUT brane and the flavour branes as well as the gauge flux are described by the spectral cover construction. We consider a split S[U(4) x U(1){sub X}] spectral cover, which allows for the phenomenologically relevant Yukawa couplings and GUT breaking to the MSSM via hypercharge flux while preventing dimension-4 proton decay. General expressions for the massless spectrum, consistency conditions and a new method for the computation of curvature-induced tadpoles are presented. We also provide a geometric toolkit for further model searches in the framework of toric geometry. Finally, an explicit global model with three chiral generations and all required Yukawa couplings is defined on a Calabi-Yau fourfold which is fibered over the del Pezzo transition of the Fano threefold P{sup 4}.
International Nuclear Information System (INIS)
Blumenhagen, Ralph; Grimm, Thomas W.; Jurke, Benjamin; Weigand, Timo
2010-01-01
We construct global F-theory GUT models on del Pezzo surfaces in compact Calabi-Yau fourfolds realized as complete intersections of two hypersurface constraints. The intersections of the GUT brane and the flavour branes as well as the gauge flux are described by the spectral cover construction. We consider a split S[U(4)xU(1) X ] spectral cover, which allows for the phenomenologically relevant Yukawa couplings and GUT breaking to the MSSM via hypercharge flux while preventing dimension-4 proton decay. General expressions for the massless spectrum, consistency conditions and a new method for the computation of curvature-induced tadpoles are presented. We also provide a geometric toolkit for further model searches in the framework of toric geometry. Finally, an explicit global model with three chiral generations and all required Yukawa couplings is defined on a Calabi-Yau fourfold which is fibered over the del Pezzo transition of the Fano threefold P 4 [4].
Energy Technology Data Exchange (ETDEWEB)
Seed, John A.; Gregson, Matthew; Chilton, Nicholas F.; Wooles, Ashley J.; Liddle, Stephen T. [School of Chemistry, The University of Manchester (United Kingdom); Tuna, Floriana; McInnes, Eric J.L. [School of Chemistry and Photon Science Institute, The University of Manchester (United Kingdom)
2017-09-11
Neutral mesoionic carbenes (MICs) have emerged as an important class of carbene, however they are found in the free form or ligated to only a few d-block ions. Unprecedented f-block MIC complexes [M(N''){sub 3}{CN(Me)C(Me)N(Me)CH}] (M=U, Y, La, Nd; N''=N(SiMe{sub 3}){sub 2}) are reported. These complexes were prepared by a formal 1,4-proton migration reaction when the metal triamides [M(N''){sub 3}] were treated with the N-heterocyclic olefin H{sub 2}C=C(NMeCH){sub 2}, which constitutes a new, general way to prepare MIC complexes. Quantum chemical calculations on the 5f{sup 3} uranium(III) complex suggest the presence of a U=C donor-acceptor bond, composed of a MIC→U σ-component and a U(5f)→MIC(2p) π-back-bond, but for the d{sup 0}f{sup 0} Y and La and 4f{sup 3} Nd congeners only MIC→M σ-bonding is found. Considering the generally negligible π-acidity of MICs, this is surprising and highlights that greater consideration should possibly be given to recognizing MICs as potential π-acid ligands when coordinated to strongly reducing metals. (copyright 2017 The Authors. Published by Wiley-VCH Verlag GmbH and Co. KGaA.)
U.S. EPA, Pesticide Product Label, FOOD PLANT FOGGING INSECTICIDE, 01/30/1990
2011-04-14
... w.lter. food, 01" fet:,1 hy ')lur.J,:!C 01 ,li· ••• u"> •• I. ... (his proJuct c. .• Z",.. IfitJ~f'!f.1.~. I)n thi') label" •• o 6""(l'r .' ... IJlIIC'i ,111 ri'1lks of J\\t~ ')lo.SI~I~ or'. ...
Geomorphodiversity derived by a GIS-based geomorphological map: case study the Czech Republic
Czech Academy of Sciences Publication Activity Database
Demek, J.; Kirchner, Karel; Mackovčin, P.; Slavík, P.
2011-01-01
Roč. 55, č. 4 (2011), s. 415-436 ISSN 0372-8854 Institutional research plan: CEZ:AV0Z30860518 Keywords : geomorphodiversity * GIS geomorphological data base * GIS-geomorphological map * Czech Republic Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.642, year: 2011 http://www.ingentaconnect.com/content/schweiz/zfg/2011/00000055/00000004/art00001?token=004d10697e442f2067217d763b442c233e46533f34687627504541676249266d656cbe1a808f2
Break the Kill Chain, not the Budget: How to Avoid U.S. Strategic Retrenchment
2016-06-10
hour per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and...completing and reviewing this collection of information. Send comments regarding this burden estimate or any other aspect of this collection of...Division built aircraft such as the F-80 Shooting Star, F-104 Starfighter, U-2 Dragon Lady, SR-71 Blackbird , and F-117 Nighthawk that all slipped
Structure of tris(trimethylsilylcyclopentadienyl)uranium(III), [(CH3)3SiC5H43U
International Nuclear Information System (INIS)
Brennan, J.; Andersen, R.A.; Zalkin, A.
1986-02-01
Crystals of [(CH 3 ) 3 SiC 5 H 4 ] 3 U are orthorhombic, Pbca, with a = 22.630(8), b = 29.177(10) and c = 8.428(3) A at 23 0 C. For Z = 8 the calculated density is 1.551 g/cm 3 . The structure was refined by full-matrix least-squares to a conventional R factor of 0.041 [2251 data, F 2 > 2 sigma(F 2 )]. The uranium atom is bonded to the three cyclopentadienyl rings in a pentahapto fashion and is in the plane of the ring centroids. The U to ring distances are 2.54, 2.47 and 2.51 A, and the average U-C distance is 2.78 +- 0.04 A. 7 refs., 1 fig., 3 tabs
Salts purification and redox potential measurement for the molten LiF-ThF4-UF4 mixture
International Nuclear Information System (INIS)
Afonichkin, V.; Bovet, A.; Shishkin, V.
2010-01-01
The 'dry' techniques of producing and clearing of some metals fluorides, their mixtures and cakes of a given composition obtained without usage gaseous HF for experiments under the Project ISTC No. 3749 are developed. The products of synthesizing and purification of oxygen-containing compounds, are studied by methods X-ray diffraction analysis, gravimetry or IR spectrometry. The experimental studies confirmed that solid NH 4 HF 2 can be efficiently used instead of an unsafe and corrosive HF gas for removal of oxygen-containing impurities from metal fluorides and for conversion of uranium and thorium dioxides to anhydrous tetra-fluorides. These processes do not require expensive equipment and special measures of safety. The electrochemical behavior of UF 4 solutions in a melt 77 LiF-23ThF 4 (mole%) was studied by cyclic voltammetry. Formal analysis of the obtained dependencies showed that in our experimental conditions the recharge U(IV) to U(III) is qualitatively consistent with voltammetric criteria and can be classified as reversible. However, the results of mathematical processing of voltammograms show that the basic calculated characteristics of this reaction differ from the theoretical values corresponding one-electron process controlled by the diffusion rate. This indicates quasi-reversibility of the studied reaction. (authors)
Directory of Open Access Journals (Sweden)
Sophie Lalanne
2008-06-01
Full Text Available Ouvrages générauxLaqueur Thomas, La fabrique du sexe. Essai sur le corps et le genre en Occident, trad. fr., Paris, Gallimard, 1992.Feher Michel, Naddaff Ramona, Tazi Nadia, Fragments for a History of the Human Body, 3 volumes, New York, Zone Books, 1989.Le Corps dans l’AntiquitéBodiou Lydie, Frère Dominique, Mehl Véronique dir., L’expression des corps. Gestes, attitudes, regards dans l’iconographie antique, Rennes, Presses Universitaires de Rennes, 2006.Bonnard Jean-Baptiste, Le complexe de ...
On the fission probability for 235U, 239Pu and 241Pu
International Nuclear Information System (INIS)
Benzi, V.; Maino, G.; Menapace, E.
1978-01-01
An evaluation of the GAMMAsub(n)/GAMMAsub(f) ratio for the 236 U, 240 Pu and 242 Pu compound nuclei is carried out. First chance and second chance fission cross sections are estimated from the ''evaporation'' model; particularly, a largely increasing trend was found for the first chance fission cross section above the (n,n'f) process threshold. The GAMMAsub(n)/GAMMAsub(f) ratios for the analyzed nuclei show a bump-like structure, that seems to be in agreement with the theoretical predictions reported in literature
International Nuclear Information System (INIS)
Huang, Ho-Lien; Chiang, Li-Wu; Chen, Jia-Rong; Yang, Wen K.; Jeng, Kee-Ching; Chen, Jenn-Tzong; Duh, Ting-Shien; Lin, Wuu-Jyh; Farn, Shiou-Shiow; Chiang, Chi-Shiun; Huang, Chia-Wen; Lin, Kun-I; Yu, Chung-Shan
2012-01-01
As one of the most intensively studied probes for imaging of the cellular proliferation, [ 18 F]FLT was investigated whether the targeting specificity of thymidine kinase 1 (TK1) dependency could be enhanced through a synergistic effect mediated by herpes simplex type 1 virus (HSV1) tk gene in terms of the TK1 or TK2 expression. 5-[ 123 I]Iodo arabinosyl uridine ([ 123 I]IaraU) was prepared in a radiochemical yield of 8% and specific activity of 21 GBq/μmol, respectively. Inhibition of the cellular uptake of these two tracers was compared by using the arabinosyl uridine analogs such as 5-iodo, 5-fluoro and 5-(E)-iodovinyl arabinosyl uridine along with 2′-fluoro-5-iodo arabinosyl uridine (FIAU). Due to potential instability of the iodo group, accumulation index of 1.6 for [ 123 I]IaraU by HSV1-TK vs. control cells could virtually be achieved at 1.5 h, but dropped to 0.2 compared to 2.0 for [ 18 F]FLT at 5 h. The results from competitive inhibition by these nucleosides against the accumulation of [ 18 F]FLT implied that FLT exerted a mixed TK1- and TK2-dependent inhibition with HSV1-tk gene transfection because of the shifting of thymidine kinase status. Taken together, the combination of [ 18 F]FLT and HSV1-TK provides a synergistic imaging potency.
Huang, Ho-Lien; Chiang, Li-Wu; Chen, Jia-Rong; Yang, Wen K; Jeng, Kee-Ching; Chen, Jenn-Tzong; Duh, Ting-Shien; Lin, Wuu-Jyh; Farn, Shiou-Shiow; Chiang, Chi-Shiun; Huang, Chia-Wen; Lin, Kun-I; Yu, Chung-Shan
2012-04-01
As one of the most intensively studied probes for imaging of the cellular proliferation, [(18)F]FLT was investigated whether the targeting specificity of thymidine kinase 1 (TK1) dependency could be enhanced through a synergistic effect mediated by herpes simplex type 1 virus (HSV1) tk gene in terms of the TK1 or TK2 expression. 5-[(123)I]Iodo arabinosyl uridine ([(123)I]IaraU) was prepared in a radiochemical yield of 8% and specific activity of 21 GBq/μmol, respectively. Inhibition of the cellular uptake of these two tracers was compared by using the arabinosyl uridine analogs such as 5-iodo, 5-fluoro and 5-(E)-iodovinyl arabinosyl uridine along with 2'-fluoro-5-iodo arabinosyl uridine (FIAU). Due to potential instability of the iodo group, accumulation index of 1.6 for [(123)I]IaraU by HSV1-TK vs. control cells could virtually be achieved at 1.5 h, but dropped to 0.2 compared to 2.0 for [(18)F]FLT at 5 h. The results from competitive inhibition by these nucleosides against the accumulation of [(18)F]FLT implied that FLT exerted a mixed TK1- and TK2-dependent inhibition with HSV1-tk gene transfection because of the shifting of thymidine kinase status. Taken together, the combination of [(18)F]FLT and HSV1-TK provides a synergistic imaging potency. Copyright © 2012 Elsevier Inc. All rights reserved.
The valence state of uranium in K{sub 6}Cu{sub 12}U{sub 2}S{sub 15}
Energy Technology Data Exchange (ETDEWEB)
Schilder, H; Speldrich, M; Lueken, H; Sutorik, A C; Kanatzidis, M G
2004-07-14
The paramagnetic behaviour of K{sub 6}Cu{sub 12}U{sub 2}S{sub 15} has been analysed, regarding copper as diamagnetic (Cu{sup +}), sulfur as mixed-valent S{sup 2-}/S{sup -} with magnetically silent delocalized S{sup -} holes in the valence band, and the actinide as either U{sup 5+}[5f{sup 1}] or U{sup 4+}[5f{sup 2}] in trigonally distorted octahedral surrounding (pseudosymmetry 3-bar) of sulfur. Fitting procedures have been carried out, accounting for spin-orbit coupling, ligand-field potential (parameters B{sup k}{sub q}), interelectronic repulsion (for U{sup 4+}[5f{sup 2}]), cooperative magnetic effects (molecular field parameter {lambda}), and applied magnetic field. Keeping the ratios B{sup 4}{sub 3}/B{sup 4}{sub 0}, B{sup 6}{sub 3}/B{sup 6}{sub 0}, B{sup 6}{sub 6}/B{sup 6}{sub 0} on their point charge electrostatic values with respect to the sulfur ligands, the three axial parameters B{sup k}{sub 0} (k=2,4,6) and {lambda} were refined. Agreement between measured and calculated susceptibility data was obtained for U{sup 5+} with B{sup k}{sub 0} values expected for octahedral surrounding and {lambda}<0 speaking for antiferromagnetic interactions. The U{sup 4+} model does yield a fit of comparable quality, but gives B{sup k}{sub 0} values that are unreasonable with respect to sign and magnitude. To conclude, on the basis of the magnetic properties the title compound is a 5f{sup 1} system corresponding to the elements formal charges (K{sup +}){sub 6}(Cu{sup +}){sub 12}(U{sup 5+}){sub 2}(S{sup 2-}){sub 13}(S{sup -}){sub 2}.
International Nuclear Information System (INIS)
Qin Shaojin; Yu Lu.
1996-03-01
The critical exponent of the momentum distribution near k F , 3k F and 5k F are studied numerically for one-dimensional U → ∞ Hubbard model, using finite size systems and extrapolating them to the thermodynamic limit. Results at k F agree with earlier calculations, while at 3k F exponents less than 1 are obtained for finite size systems with extrapolation to 1 (regular behaviour) in the thermodynamic limit, in contrast to earlier analytic prediction 9/8. The distribution is regular at 5k F even for finite systems. The singularity near 3k F is interpreted as due to low energy excitations near 3k F in finite systems. (author). 18 refs, 4 figs, 1 tab
Physical attributes of anisotropic compact stars in f(R, G) gravity
Energy Technology Data Exchange (ETDEWEB)
Shamir, M.F.; Zia, Saeeda [National University of Computer and Emerging Sciences, Department of Sciences and Humanities, Lahore (Pakistan)
2017-07-15
Modified gravity is one of the potential candidates to explain the accelerated expansion of the universe. Current study highlights the materialization of anisotropic compact stars in the context of f(R, G) theory of gravity. In particular, to gain insight in the physical behavior of three stars namely, Her X1, SAX J 1808-3658 and 4U 1820-30, energy density, and radial and tangential pressures are calculated. The f(R, G) gravity model is split into a Starobinsky like f(R) model and a power law f(G) model. The main feature of the work is a 3-dimensional graphical analysis in which, anisotropic measurements, energy conditions and stability attributes of these stars are discussed. It is shown that all three stars behave as usual for positive values of the f(G) model parameter n. (orig.)
snerti lEhissip tion flux me surements over south f y of feng l during ...
Indian Academy of Sciences (India)
his p per des ri es me surement of irEse p r meters nd estim tion of sensi le nd l tent he t fluxes y the snerti lEhissip tion99 te hnique over south f y of feng lF he d t were olle ted on. y g r u ny during fyfwi E ilot ruise during the period PQrd y to er IWWV to IPth xovem er. IWWV over south f y of feng lF he fluxes re estim ...
F-theory on all toric hypersurface fibrations and its Higgs branches
Energy Technology Data Exchange (ETDEWEB)
Klevers, Denis [Department of Physics and Astronomy, University of Pennsylvania,Philadelphia, PA 19104-6396 (United States); Theory Group, Physics Department, CERN,CH-1211, Geneva 23 (Switzerland); Peña, Damián Kaloni Mayorga; Oehlmann, Paul-Konstantin [Bethe Center for Theoretical Physics, Physikalisches Institut der Universität Bonn,Nussallee 12, 53115 Bonn (Germany); Piragua, Hernan [Department of Physics and Astronomy, University of Pennsylvania,Philadelphia, PA 19104-6396 (United States); Reuter, Jonas [Bethe Center for Theoretical Physics, Physikalisches Institut der Universität Bonn,Nussallee 12, 53115 Bonn (Germany)
2015-01-27
We consider F-theory compactifications on genus-one fibered Calabi-Yau manifolds with their fibers realized as hypersurfaces in the toric varieties associated to the 16 reflexive 2D polyhedra. We present a base-independent analysis of the codimension one, two and three singularities of these fibrations. We use these geometric results to determine the gauge groups, matter representations, 6D matter multiplicities and 4D Yukawa couplings of the corresponding effective theories. All these theories have a non-trivial gauge group and matter content. We explore the network of Higgsings relating these theories. Such Higgsings geometrically correspond to extremal transitions induced by blow-ups in the 2D toric varieties. We recover the 6D effective theories of all 16 toric hypersurface fibrations by repeatedly Higgsing the theories that exhibit Mordell-Weil torsion. We find that the three Calabi-Yau manifolds without section, whose fibers are given by the toric hypersurfaces in ℙ{sup 2}, ℙ{sup 1}×ℙ{sup 1} and the recently studied ℙ{sup 2}(1,1,2), yield F-theory realizations of SUGRA theories with discrete gauge groups ℤ{sub 3}, ℤ{sub 2} and ℤ{sub 4}. This opens up a whole new arena for model building with discrete global symmetries in F-theory. In these three manifolds, we also find codimension two I{sub 2}-fibers supporting matter charged only under these discrete gauge groups. Their 6D matter multiplicities are computed employing ideal techniques and the associated Jacobian fibrations. We also show that the Jacobian of the biquadric fibration has one rational section, yielding one U(1)-gauge field in F-theory. Furthermore, the elliptically fibered Calabi-Yau manifold based on dP{sub 1} has a U(1)-gauge field induced by a non-toric rational section. In this model, we find the first F-theory realization of matter with U(1)-charge q=3.
Congressional Authority to Limit U.S. Military Operations in Iraq
2007-07-11
consist of “one major, four captains, sixteen first lieutenants, twelve second lieutenants, forty-eight sergeants, forty-eight corporals , thirty-two...after-the-fact financing . In 1994, for example, President Clinton based his authority to order the participation of U.S. forces in NATO actions in...1973). 97 Fleming v. Mohawk Wrecking & Lumber Co., 331 U.S. 111, 116 (1947). See also Berk v. Laird 317 F. Supp. 715, 727-728 (D.C.N.Y. 1970
Frusawa, Hiroshi
2018-06-01
We have formulated the dielectrophoretic force exerted on micro/nanoparticles upon the application of frequency-modulated (FM) electric fields. By adjusting the frequency range of an FM wave to cover the crossover frequency f X in the real part of the Clausius-Mossotti factor, our theory predicts the reversal of the dielectrophoretic force each time the instantaneous frequency periodically traverses f X . In fact, we observed periodic U-turns of vesicles, leukemia cells, and red blood cells that undergo FM wave dielectrophoresis (FM-DEP). It is also suggested by our theory that the video tracking of the U-turns due to FM-DEP is available for the agile and accurate measurement of f X . The FM-DEP method requires a short duration, less than 30 s, while applying the FM wave to observe several U-turns, and the agility in measuring f X is of much use for not only salty cell suspensions but also nanoparticles because the electric-field-induced solvent flow is suppressed as much as possible. The accuracy of f X has been verified using two types of experiment. First, we measured the attractive force exerted on a single vesicle experiencing alternating-current dielectrophoresis (AC-DEP) at various frequencies of sinusoidal electric fields. The frequency dependence of the dielectrophoretic force yields f X as a characteristic frequency at which the force vanishes. Comparing the AC-DEP result of f X with that obtained from the FM-DEP method, both results of f X were found to coincide with each other. Second, we investigated the conductivity dependencies of f X for three kinds of cell by changing the surrounding electrolytes. From the experimental results, we evaluated simultaneously both of the cytoplasmic conductivities and the membrane capacitances using an elaborate theory on the single-shell model of biological cells. While the cytoplasmic conductivities, similar for these cells, were slightly lower than the range of previous reports, the membrane capacitances obtained
7 CFR Appendix to Subpart F of... - Unknown Title
2010-01-01
... and Human Nutrition Research and Extension Program. 7 U.S.C. 3171 et seq. 30. Animal Health and... 7 Agriculture 1 2010-01-01 2010-01-01 false Appendix to Subpart F of Part 15a Agriculture Office of the Secretary of Agriculture EDUCATION PROGRAMS OR ACTIVITIES RECEIVING OR BENEFITTING FROM...
Directory of Open Access Journals (Sweden)
Ning Guo
Full Text Available With favorable pharmacokinetics and binding affinity for α(vβ(3 integrin, (18F-labeled dimeric cyclic RGD peptide ([(18F]FPPRGD2 has been intensively used as a PET imaging probe for lesion detection and therapy response monitoring. A recently introduced kit formulation method, which uses an (18F-fluoride-aluminum complex labeled RGD tracer ([(18F]AlF-NOTA-PRGD2, provides a strategy for simplifying the labeling procedure to facilitate clinical translation. Meanwhile, an easy-to-prepare (68Ga-labeled NOTA-PRGD2 has also been reported to have promising properties for imaging integrin α(vβ(3. The purpose of this study is to quantitatively compare the pharmacokinetic parameters of [(18F]FPPRGD2, [(18F]AlF-NOTA-PRGD2, and [(68Ga]Ga-NOTA-PRGD2. U87MG tumor-bearing mice underwent 60-min dynamic PET scans following the injection of three tracers. Kinetic parameters were calculated using Logan graphical analysis with reference tissue. Parametric maps were generated using voxel-level modeling. All three compounds showed high binding potential (Bp(ND = k(3/k(4 in tumor voxels. [(18F]AlF-NOTA-PRGD2 showed comparable Bp(ND value (3.75±0.65 with those of [(18F]FPPRGD2 (3.39±0.84 and [(68Ga]Ga-NOTA-PRGD2 (3.09±0.21 (p>0.05. Little difference was found in volume of distribution (V(T among these three RGD tracers in tumor, liver and muscle. Parametric maps showed similar kinetic parameters for all three tracers. We also demonstrated that the impact of non-specific binding could be eliminated in the kinetic analysis. Consequently, kinetic parameter estimation showed more comparable results among groups than static image analysis. In conclusion, [(18F]AlF-NOTA-PRGD2 and [(68Ga]Ga-NOTA-PRGD2 have comparable pharmacokinetics and quantitative parameters compared to those of [(18F]FPPRGD2. Despite the apparent difference in tumor uptake (%ID/g determined from static images and clearance pattern, the actual specific binding component extrapolated from kinetic
U.S. EPA, Pesticide Product Label, , 09/28/1983
2011-04-14
... lind HI"knti,·.,~ l~'\\ &1 Dtpf'mcd. I.,r t1, l'" ,tj .... ,ii{ ... Ul#-'~~U I), CtI.,If ... ~1 c' .... Q. '"fJ 0.''"'1.-(.01,1 .ntcI •• rod#' II(..JI ettec1lwe ';au",,1 SIa;."flo)(oec .. ...
Directory of Open Access Journals (Sweden)
Hanna Björg Sigurjónsdóttir
2009-12-01
Full Text Available Abstract in English is unavailable.Samningur Sameinuðu þjóðanna um réttindi fatlaðs fólks var undirritaður af Íslandi í mars 2007, en með undirrituninni skuldbinda íslensk stjórnvöld sig til að gera ekkert sem gengur gegn efni samningsins. Um allan heim er nú litið til þessa samnings sem leiðarljóss í málefnum fatlaðs fólks og þjóðir heims, Ísland þar með talið, eru nú óðum að staðfesta samninginn og aðlaga lagaumhverfi sitt að honum. Eitt af lykilatriðunum við yfirfærslu málefna fatlaðra til sveitarfélaganna er kynning á þessum nýja samningi og mannréttindaáherslum sem þar er að finna, en þekking á innihaldi samningsins er nauðsynleg forsenda þess að jafnrétti og mannréttindi fatlaðs fólks hér á landi verði tryggð. Þessi grein fjallar um einn hóp fatlaðs fólks, foreldra með þroskahömlun, og rétt þeirra til fjölskyldulífs sem dæmi um breyttan skilning á stöðu fatlaðs fólks í samfélaginu og þá þjónustu sem það á rétt á. Rakið er hvernig réttur foreldra til samvista við börn sín hefur þróast á undanförnum áratugum í mannréttindasáttmálum og dómsúrskurðum. Niðurstöður sýna að ef foreldrar með þroskahömlun eiga að njóta þeirrar réttarverndar sem samræmist markmiðum stjórnarskrár íslenska lýðveldisins, mannréttindasáttmála Evrópu um friðhelgi fjölskyldulífs og samnings Sameinuðu þjóðanna um réttindi fatlaðs fólks er ljóst að þörf er á verulegu átaki og viðhorfsbreytingum innan stofnana ríkis og sveitarfélaga, sem hafa með höndum málefni fatlaðs fólks, barnaverndar og félagslegs stuðnings, svo og dómskerfisins alls, til að tryggja að foreldrar með þroskahömlun standi jafnfætis öðrum foreldrum.
International Nuclear Information System (INIS)
Wohlfarth, H.
1977-01-01
In this paper measurements of mass- and ioncharge distributions of the lower mass 235 U(nsub(th),f)-fission products, performed with the 'Lohengrin' recoil spectrometer of the Institut Lane-Langevin at Grenoble, are reported. The uranium targets used led to an energy loss of the fission fragments of only 1 to 2 MeV, so their energy was well defined. The mass abundance have been measured for the following fragment energies: E = 83.6, 88.5, 93.4, 98.3, 103.1, 108.0, 112.0 MeV. The energy integrated mass distributions were compared with recent data collections of fission yields. For nearly all masses the abundancies agree well within the limits of error. So these maesurements can be used as an independent source of data. (orig./RW) [de
1981-01-15
PSYCHROMETRIC SUMMARY ICS S. T.) [ WET SILS TESPERATURE DEPRESSIOS (F) TOTAL I TOTAL , 0 1.2 3-, -6 7-5 -u a 10 12112 141S. 117igi.l,-20121-.12.222324 l25...VZ T ! ’Nt CA 72 -79 OCT SlAleof STATION UAXJ TEMs M" PAGL 2 18002-2000O New0ti 1.1 T WET BULB TEMPERATURE DEPRESSIO (F) TOTAL TOTAL *(F) 0 1.2 3-4 1
U-topia em O Continente de Gustavo Scheffer
Directory of Open Access Journals (Sweden)
Nils Goran Skare
2011-04-01
Full Text Available Este artigo busca discutir a espacialidade cinematográfica e, para tanto, analisa o curta-metragem O Continente do cineasta paranaense Gustavo Scheffer, à luz da psicanálise lacaniana. São apresentados o conceito de nó borromeano; de metáfora, metonímia, significante fálico e significante-mestre; e de narrativa, ideologia e reificação. Descobre-se no filme uma cena fantasmática ligada à u-topia, relação que é tese deste artigo. Por fim, esboça-se uma tipologia das u-topias cinematográficas.
International Nuclear Information System (INIS)
Gomes, R.P.; Lordello, A.R.; Abrao, A.
1977-01-01
A comparative study of the efficiency of some spectrochemical carriers (AgCl, In 2 O 3 , Ga 2 O 3 , NaF, LiF and SrF 2 ) is presented for the quantitative spectrographic analysis of Ag, Al, B, Bi, Cd, Cr, Cu, Fe, Mg, Mn, Mo, Ni, P, Pb, Si, Sn, V and Zn in uranium and its compounds. The volatility behaviour of the eighteen elements was verified by means of the moving plate technique for each of the mentioned carriers. The final aim was the selection of the carriers for the determination of trace amounts of the impurities. The best results were obtained with 4% In 2 O 3 , 6% AgCl and 6% NaF in a U 3 O 8 matrix. The sensitivities for some elements were extended to fractions of p.p.m. The precision, accuracy and acceptability of the method were calculated for all elements. The total error values are approximately in the range of 16-45% [pt
Yuan, Hong; Frank, Jonathan E; Merrill, Joseph R; Hillesheim, Daniel A; Khachaturian, Mark H; Anzellotti, Atilio I
2016-01-01
The hypoxia PET tracer, 1-[18F]fluoro-3-(2-nitro-1Himidazol- 1-yl)-propan-2-ol ([18F]FMISO) is the first radiotracer developed for hypoxia PET imaging and has shown promising for cancer diagnosis and prognosis. However, access to [18F]FMISO radiotracer is limited due to the needed cyclotron and radiochemistry expertise. The study aimed to develop the automated production method on the [18F]FMISO radiotracer with the novel fully automated platform of the BG75 system and validate its usage on animal tumor models. [18F]FMISO was produced with the dose synthesis cartridge automatically on the BG75 system. Validation of [18F]FMISO hypoxia imaging functionality was conducted on two tumor mouse models (FaDu/U87 tumor). The distribution of [18F]FMISO within tumor was further validated by the standard hypoxia marker EF5. The average radiochemical purity was (99±1) % and the average pH was 5.5±0.2 with other quality attributes passing standard criteria (n=12). Overall biodistribution for [18F]FMISO in both tumor models was consistent with reported studies where bladder and large intestines presented highest activity at 90 min post injection. High spatial correlation was found between [18F]FMISO autoradiography and EF5 hypoxia staining, indicating high hypoxia specificity of [18MF]FMISO. This study shows that qualified [18F]FMISO can be efficiently produced on the BG75 system in an automated "dose-on-demand" mode using single dose disposable cards. The possibilities of having a low-cost, automated system manufacturing ([18F]Fluoride production + synthesis + QC) different radiotracers will greatly enhance the potential for PET technology to reach new geographical areas and underserved patient populations. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
4f and 5f trivalent ions complexation by diamides and uses in solvent extraction
International Nuclear Information System (INIS)
Huber, H.
1984-06-01
Extractive properties of N,N'-tetraalkylmalonamides were investigated in view to separate the actinides contained in highly radioactive wastes. N,N'-dimethyldioctylmalonamide (DMDOMA) was selected. It extracts trivalent actinide and lanthanide from concentrated nitric acid. Mineral acids extraction was studied, especially HNO 3 extraction. The distribution of HNO 3 can be interpreted by assuming that in the organic phase three main species are present: HNO 3 (DMDOMA) 2 , HNO 3 DMDOMA, (HNO 3 ) 2 DMDOMA. 5f and 4f trivalent ions are extracted according to the mechanism: M 3+ + 3NO 3 - + 4DMDOMA in equilibrium with [M(DMDOMA) 2 (NO 3 ) 3 ].(DMDOMA) 2 . The extraction of important ions like U(VI), Np(V), Pu(IV), Pu(VI), Zr(IV) and Fe(III) was investigated. The results showed that DMDOMA behave line the carbamoylmethylenephosphonates and could be an interesting alternative to these organophosphorus extractants [fr
Computing the Kummer function $U(a,b,z)$ for small values of the arguments
A. Gil (Amparo); J. Segura (Javier); N.M. Temme (Nico)
2015-01-01
textabstractWe describe methods for computing the Kummer function $U(a,b,z)$ for small values of $z$, with special attention to small values of $b$. For these values of $b$ the connection formula that represents $U(a,b,z)$ as a linear combination of two ${}_1F_1$-functions needs a limiting
Smoking Cessation Classes and Their Effectiveness in the Federal Bureau of Prisons
1999-05-15
and mortality attributed to tobacco products. Health Effects ofTobacco Multiple journal articles. books and other references are in agreement that... books , and special reports have shown that from 2500 to 5100 nonsmokers may have died because of ETS (U.S Dept. Of Health And Human Services, 1996...ETS causes an estimated 35,000 to 40,000 deaths from heart disease in people who are not current smokers. Secondhand smoke causes other respiratory
International Nuclear Information System (INIS)
Rodovsky, T. J.
1999-01-01
This document is the removal action workplan (RAW) for the 105-DR and 105-F Reactor Buildings and ancillary facilities. These buildings and facilities are located in the 100-D/DR and 100-F Areas of the Hanford Site in Benton County, Washington, which is owned and operated by the U.S. Department of Energy (DOE). The 100 Areas (including 100-D/DR and 100-F Areas) of the Hanford Site were placed on the U.S. Environmental Protection Agency's (EPA) National Priorities List under the Comprehensive Environmental Response, Compensation,and Liability Act of 1980 (CERCLA). DOE has determined that hazardous substances in the 105-DR and 105-F Reactor Buildings and four ancillary facilities present a potential threat to human health or the environment DOE has also determined that a non-time critical removal action is warranted at these facilities
International Nuclear Information System (INIS)
Sahoo, J.; Shadangi, N.; Nayak, P.
2015-01-01
Here an attempt is made to explore the variation of magnetic susceptibility with temperature for different values of the position of f-level (d) and electron–phonon interaction (EPI) strength (r) in some U and Ce based heavy Fermion (HF) systems within Periodic Anderson Model (PAM) in the presence of a static magnetic field B and interaction of phonons with electrons of hybridization band. Since magnetic susceptibility χ is related to the f-electron occupation n ±σ f , the expression for the latter is analytically derived through f–f correlation function following the Green function technique of Zubarev. The numerical analysis of χ as a function of temperature ‘T’ is done for different values of d and r. The results show a good agreement with the experiments for some U and Ce based HFs. An explanation for the existence of a critical value of d w.r.t. E F for switching of nature of χ∼T from U to Ce based HF systems is provided. Our calculated value of the temperature T χmax corresponding to the peak position of χ for small values of hybridization constant γ=0.002 and 0.0036 coincides with the experimental value of 19 K for UPt 3 and 35 K for UPd 2 Al 3 reported by Frings et al. and Geibel et al. respectively. - Highlights: • Variation of magnetic susceptibility χ with temperature T is studied for some HF systems. • Periodic Anderson Model in presence of magnetic field and electron–phonon interaction is used for numerical evaluation. • The existence of a critical value of the position of f-level(d) is proposed for distinction between χ∼T behavior of U and Ce based HF systems. • Results obtained are in good agreement with the experimental observations for some Ce and U based HF systems. • Theoretically evaluated temperature corresponding to the peak value of χ matches with the experimental results of UPt 3 and UPd 2 Al 3
Collectivités locales et responsabilité sociale des organisations : quelle impulsion ?
Directory of Open Access Journals (Sweden)
Catherine Bodet
2010-11-01
Full Text Available L'expérimentation du Bilan Sociétal, mise en place par Rennes Métropole dans des associations rennaises, montre comment s'organisent, se pilotent et se financent des initiatives en matière d'évaluation, dans le cadre de l'orientation d'une politique de développement durable et de responsabilité sociale territoriale. Les collectivités locales visent à favoriser de nouvelles formes de contractualisation entre les différents acteurs dans l'optique d'une co-construction d'une politique de développement durable territoriale. Cette expérimentation donne des pistes pour imaginer de nouveaux outils d'évaluation dans le cadre d'une économie plurielle.This paper presents the Bilan Sociétal experimentation in Rennes associations, realised by Rennes Métropole. It shows that local communities try to favour new forms of contracting between actors in the framework of the sustainable development and local social responsibility policies orientation. It shows however that this experimentation gives tracks to imagine new evaluation tools in a plural economy.
Zheng Wen Chen; Wu Shao Yi; Tang Sheng
2003-01-01
The EPR parameters (g factors g sub p sub a sub r sub a sub l sub l sub e sub l , g sub p sub e sub r sub p sub e sub n sub d sub i sub c sub u sub l sub a sub r sub t sub o and hyperfine structure constants A sub p sub a sub r sub a sub l sub l sub e sub l , A sub p sub e sub r sub p sub e sub n sub d sub i sub c sub u sub l sub a sub r sub t sub o) of a tetragonal (C sub 4 sub v) Sm sup 3 sup + center in CaF sub 2 and SrF sub 2 crystals are calculated by considering the crystal-field J-mixing among the ground sup 6 H sub 5 sub / sub 2 , the first excited sup 6 H sub 7 sub / sub 2 and second excited sup 6 H sub 9 sub / sub 2 state multiplets. In the calculations the free-ion and crystal-field parameters of the tetragonal Sm sup 3 sup + -F sup - center obtained from polarized laser-selective excitation spectroscopy are used. The calculated results suggest that the tetragonal Sm sup 3 sup + -F sup - center is the Sm sup 3 sup + center found by later EPR measurements. The g factors g sub p sub a sub r sub a sub...
U.S. Army War College Library Communicative Skills: A Selected Bibliography.
1987-10-01
D-Ai87 489 US ARMY MAR COLLEGE LIBRARY COMMUNICATIVE SKILLS: A i/l SELECTED BIBLIOGRAPHY(U) ARMY WAR COIL CARLISLE BARRACKS PA OCT 87 UNCLASSIFIED F...PERIOD COVERED U.S. Army War College Library Bibliography Communicative Skills A Seecte Bibiogrphy6. PERFORMING ORG. REPORT NUMBER 7. AUTHOR(&) S...BIBLIOGRAPHY as an invitation for you to enjoy the wealth of materials readily available in our library that will help you improve your communicative skills. It
Internal radiation dosimetry of F-18-5-fluorouracil
International Nuclear Information System (INIS)
Shani, J.; Schlesinger, T.; Wolf, W.
1980-01-01
The projected internal radiations dose to different human organs per millicurie of injected F-18-5-Fluorouracil is calculated from rat distribution studies and human urinary excretion data. The calculations assume a similar distribution of labelled drug in humans as in rats, inasmuch as preliminary human distribution studies appeared to validate the use of the rat model for human dosimetry calculations. (U.K.)
2011-12-23
... such records that fully and correctly disclose all transactions in their business (21 U.S.C. 642... of Agriculture (USDA) prohibits discrimination in all its programs and activities on the basis of race, color, national origin, gender, religion, age, disability, political beliefs, sexual orientation...
Söylemez, Haluk; Yıldırım, Kadir; Utangac, Mehmet Mazhar; Aydoğan, Tahsin Batuhan; Ezer, Mehmet; Atar, Murat
2016-06-01
To investigate the effectivity of 4.5F ultrathin ureteroscope (UT-URS) without any need for active or passive dilation in the treatment of adult patient population in whom ureteral orifices cannot be engaged using conventional URS. Among a total of 512 adult patients who had undergone URS between April 2012 and November 2015 in our department for diagnostic or therapeutic purposes, 43 (8.4%) patients required ureteral dilation because we could not engage ureteral orifice. In adult patients in whom we could not engage ureteral orifice with 7.5F and 8F semirigid URS, we tried to complete the operation using 4.5F UT-URS without resorting to dilation. Age and gender of the patients, indication for operation, stone size, location, operative times, laterality of stone(s), stone-free rates, length of hospital stay, and complications were recorded. Mean age of the patients was 34.5 ± 11.2 (21-66) years. The patients had undergone operations for ureteral stone (n = 39), unexplained hydronephrosis (n = 2), and ureteral stenosis (n = 2). Mean stone size was 8.2 ± 2.3 (4-18) mm. Mean operative time was 64.2 ± 13.5 minutes. In 37 of 39 patients, a complete stone-free rate (94.8%) was achieved. Mean length of hospital stay was 8.9 ± 5.8 hours. It has been demonstrated that in an adult patient population in whom ureteral orifices cannot be engaged using conventional URS, ureteral access could be achieved with 4.5F UT-URS without any need for dilation. At the same time, use of 4.5F UT-URS resulted in an acceptable treatment success and lower complication rates in most of these patients without the need for a second session.
Advantages of CaF2 over ZnS in an α-particle scintillation detector
International Nuclear Information System (INIS)
Sabol, B.; Schery, S.D.
1981-01-01
Results are reported for using a europium-activated calcium fluoride (CaF 2 ) scintillation crystal as a α-particle detector in a two-filter monitor of atmospheric radon. CaF 2 detectors are cheaper and can cover a larger surface area than the higher-resolution solid-state detectors. Compared to ZnS scintillators, the energy resolution for CaF 2 is improved from 3.0 MeV to 1.1 MeV for 4.7 MeV α-particles; however the light output from CaF 2 is considerably lower. It is concluded that a thin CaF 2 crystal is a cost-effective method of improving energy and time resolutions for the two-filter monitor. (U.K.)
Energy Technology Data Exchange (ETDEWEB)
Kricka, T; Pliestic, S [Agronomski fakultet, Zavod za poljoprivrednu tehnologiju, skladistenje i transport, Zagreb (Croatia)
1997-12-31
The most important agricultural crop in the world, besides wheat and rice is corn. In the last 10 years, Republic of Croatia has produced about 2000000 tons of corn. Most of that is used for food and feed and for seed production and it is 1000000 tons in quantity. This quantity demands between 35000 to 40000 tons of oil. For the reason, this paper describes the possibilities of the substitution of oil with corn biomass after harvesting. (author). 3 tabs., 13 refs.
Schwer, Beate; Kruchten, Joshua; Shuman, Stewart
2016-01-01
A seven-subunit Sm protein ring forms a core scaffold of the U1, U2, U4, and U5 snRNPs that direct pre-mRNA splicing. Using human snRNP structures to guide mutagenesis in Saccharomyces cerevisiae, we gained new insights into structure–function relationships of the SmG, SmE, and SmF subunits. An alanine scan of 19 conserved amino acids of these three proteins, comprising the Sm RNA binding sites or inter-subunit interfaces, revealed that, with the exception of Arg74 in SmF, none are essential for yeast growth. Yet, for SmG, SmE, and SmF, as for many components of the yeast spliceosome, the effects of perturbing protein–RNA and protein–protein interactions are masked by built-in functional redundancies of the splicing machine. For example, tests for genetic interactions with non-Sm splicing factors showed that many benign mutations of SmG, SmE, and SmF (and of SmB and SmD3) were synthetically lethal with null alleles of U2 snRNP subunits Lea1 and Msl1. Tests of pairwise combinations of SmG, SmE, SmF, SmB, and SmD3 alleles highlighted the inherent redundancies within the Sm ring, whereby simultaneous mutations of the RNA binding sites of any two of the Sm subunits are lethal. Our results suggest that six intact RNA binding sites in the Sm ring suffice for function but five sites may not. PMID:27417296
1971-10-28
1 OP1470-- WET BULS TEMPERATURE DEPRESSIO -4 F’ OA" , 0F 1-2 3- 5-6 7-8 9. 10 11- 12 13- 14 1.- 16 17. : 19 20 21- - --s , 5 . D - 88/ 87 log 2 86...PSYCHROMETRIC SUMMARY AIR AEATE E SERVICE/AC 34199 SIEGEN5uRG GERMANY GUNNERY RAhGE e87C Sp’ AA :- E 1 - wET eULB TE-PERATuRE DEPRESSIO -- F- C - 3 5. 6
Kwangju, K-57, Korea. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.
1974-03-06
JtTHER I 5fU -17 o CLSS HOURS (L S T. SPEED Mi..EAN (KNTS) 1 -3 4 6 7. 10 11 16 17 - 21 22 - 27 28 33 34 - 40 41 47 48- 55 56 % WIND DIR. S _ _ PEED E .3...the summary consists of a bivariate percentage frequency distribution of wet-bulb depression in 17 classes spread horizontally; by 2-degree intervals...AC 4)25f. K4{bNC() ILIA K-57 3-59,A 4 .72 ALL N STATION NAME YEARS., PArF I ~R ALL-- T5 L .T. WET BULB TEMPERATURE DEPRESSION (F) I_ TOTAL TOTAL (F
Directory of Open Access Journals (Sweden)
Vanessa de Cássia Teixeira da Silva
2016-01-01
Full Text Available This work reports endoglucanase and beta-glucosidase production by the thermophilic fungus Myceliophthora heterothallica in solid-state (SSC and submerged (SmC cultivation. Wheat bran and sugarcane bagasse were used for SSC and cardboard for SmC. Highest endoglucanase production in SSC occurred after 192 hours: 1,170.6 ± 0.8 U/g, and in SmC after 168 hours: 2,642 ± 561 U/g. The endoglucanases and beta-glucosidases produced by both cultivation systems showed slight differences concerning their optimal pH and temperature. The number of endoglucanases was also different: six isoforms in SSC and ten in SmC. Endoglucanase activity remained above 50% after incubation between pH 3.0 and 9.0 for 24 h for both cultivation systems. The effect of several chemicals displayed variation between SSC and SmC isoenzymes. Manganese activated the enzymes from SmC but inhibited those from SSC. For β-glucosidases, maximum production on SmC was 244 ± 48 U/g after 168 hours using cardboard as carbon source. In SSC maximum production reached 10.9 ± 0.3 U/g after 240 h with 1 : 1 wheat bran and sugarcane bagasse. Manganese exerted a significant activation on SSC β-glucosidases, and glucose inhibited the enzymes from both cultivation systems. FeCl3 exerted the strongest inhibition for endoglucanases and β-glucosidases.
Mixed Mediation of Supersymmetry Breaking in Models with Anomalous U(1) Gauge Symmetry
International Nuclear Information System (INIS)
Choi, Kiwoon
2010-01-01
There can be various built-in sources of supersymmetry breaking in models with anomalous U(1) gauge symmetry, e.g. the U(1) D-term, the F-components of the modulus superfield required for the Green-Schwarz anomaly cancellation mechanism and the chiral matter superfields required to cancel the Fayet-Iliopoulos term, and finally the supergravity auxiliary component which can be parameterized by the F-component of chiral compensator. The relative strength between these supersymmetry breaking sources depends crucially on the characteristics of D-flat direction and also on how the D-flat direction is stabilized at a vacuum with nearly vanishing cosmological constant. We examine the possible pattern of the mediation of supersymmetry breaking in models with anomalous U(1) gauge symmetry, and find that various different mixed mediation scenarios can be realized, including the mirage mediation which corresponds to a mixed modulus-anomaly mediation, D-term domination giving a split sparticle spectrum, and also a mixed gauge-D-term mediation scenario.
Flores, Leo G; Yeh, Hsin-Hsien; Soghomonyan, Suren; Young, Daniel; Bankson, James; Hu, Qianghua; Alauddin, Mian; Huff, Vicki; Gelovani, Juri G
2013-04-01
The understanding of the role of genetic alterations in Wilms tumor development could be greatly advanced using a genetically engineered mouse models that can replicate the development and progression of this disease in human patients and can be monitored using non-invasive structural and molecular imaging optimized for renal tumors. Repetitive dual-contrast computed tomography (CT; intravenous and intraperitoneal contrast), T2-weighted magnetic resonance imaging (MRI), and delayed 2-deoxy-2-[(18)F]fluoro-D-glucose ((18)F-FDG) positron emission tomography (PET) were utilized for characterization of Igf2 biallelic expression/Wt1 knockout mouse model of Wilms tumor. For CT imaging, Ioversol 678 mg/ml in 200 μl was administered i.p. followed by 100 μl injected intravenously at 20 and 15 min prior to imaging, respectively. Static PET imaging studies were acquired at 1, 2, and 3 h after i.v. administration of (18)F-FDG (400 μCi). Coronal and sagittal T1-weighted images (TE/TR 8.5/620 ms) were acquired before and immediately after i.v. injection of 0.4 ml/kg gadopentetate dimeglumine followed by T2-weighted images (TE/TR 60/300 ms). Tumor tissue samples were characterized by histopathology and immunohistochemistry for Glut1, FASN, Ki67, and CD34. In addition, six Wt1-Igf2 mice were treated with a mitogen-activated protein kinase (MEK) inhibitor U0126 (50 μmol/kg i.p.) every 4 days for 6 weeks. (18)F-FDG PET/CT imaging was repeated at different days after initiation of therapy with U0126. The percent change of initial tumor volume and SUV was compared to non-treated historic control animals. Overall, the best tumor-to-adjacent kidney contrast as well as soft tissue contrast for other abdominal organs was achieved using T2-weighted MRI. Delayed (18)F-FDG PET (3-h post (18)F-FDG administration) and dual-contrast CT (intravenous and intraperitoneal contrast) provided a more accurate anatomic and metabolic characterization of Wilms tumors in Wt1-Igf2 mice
1981-08-19
GLOCAL CLIMATOLO0Y BRANCH USAFETAC SURFACE WINDS A14 4EATHFk SERVICE/MAC PERCENTAGE FREQUENCY OF WIND DIRECTION AND SPEED (FROM HOURLY OBSERVATIONS) " ;F...930 F £ USAFETAC 0-8.S (OL.A) PSEVWOUS EDITIONS 0 THIs PONM AS O Nso~ITI - V--. .1 I j GLOCAL CLIMATOLOGY BRANCH uS AFETAC SURFACE WINDS ATR W EATHER
Maximilien Brice
2011-01-01
30 August 2011 - Médecins sans frontières International President U. K Karunakara signing the guest book with Head of International Relations F. Pauss and Adviser for Life Sciences M. Dosanjh; visiting CMS underground experimental area with Collaboration Spokesperson G. Tonelli.
Lifescience Database Archive (English)
Full Text Available F0_XENLA MGC116435 protein OS=Xenopus laevis GN=MG... 96 1e-18 tr|Q6AZL1|Q6AZL1_XENTR Finkel-Biskis-Reilly m... (Fragment) OS=Mus musculus GN... 95 3e-18 tr|Q642K5|Q642K5_MOUSE Finkel-Biskis-Reilly murine sarcoma virus...... 95 3e-18 tr|Q5BJN7|Q5BJN7_RAT Finkel-Biskis-Reilly murine sarcoma virus (... 95 3e-18 tr|Q3THB2|Q3THB2_MO...Ubiquitin-like/S30 ribosomal fusion prote... 95 3e-18 tr|Q3SZG2|Q3SZG2_BOVIN Finkel-Biskis-Reilly murine sar
Ion conductivities of ZrF4-BaF2-CsF glasses
International Nuclear Information System (INIS)
Kawamoto, Yoji; Nohara, Ichiro
1987-01-01
The glass-forming region in the ZrF 4 -BaF 2 -CsF glass system has been determined and the ac conductivity and the transport number of fluoride ions have been measured. The conductivities of compounds β-Cs 2 ZrF 6 , α-SrZrF 6 , α-BaZrF 6 , β-BaZrF 6 and α-PbZrF 6 have also been measured. These results and a previous study of ZrF 4 -BaF 2 -MF n (M: the groups I-IV metals) glasses revealed the following: (1) the ZrF 4 -BaF 2 -CsF glasses are exclusively fluoride-ion conductors; (2) the ionic conductivities of ZrF 4 -based glasses are predominantly determined by the activation energies for conduction; (3) the activation energy for conduction decreases with an increase in the average polarizability of glass-constituting cations; (4) a decrease in average Zr-F bond length and a lowering of the average F coordination number of Zr are presumed to increase the activation energy for conduction. Principles of developing ZrF 4 -based glasses with higher conductivities have also been proposed. (Auth.)
Electronic spectra of DyF studied by four-component relativistic configuration interaction methods
Energy Technology Data Exchange (ETDEWEB)
Yamamoto, Shigeyoshi, E-mail: syamamot@lets.chukyo-u.ac.jp [School of International Liberal Studies, Chukyo University, 101-2 Yagoto-Honmachi, Showa-ku, Nagoya 466-8666 (Japan); Tatewaki, Hiroshi [Institute of Advanced Studies in Artificial Intelligence, Chukyo University, Toyota 470-0393 (Japan); Graduate School of Natural Sciences, Nagoya City University, Aichi 467-8501 (Japan)
2015-03-07
The electronic states of the DyF molecule below 3.0 eV are studied using 4-component relativistic CI methods. Spinors generated by the average-of-configuration Hartree-Fock method with the Dirac-Coulomb Hamiltonian were used in CI calculations by the KRCI (Kramers-restricted configuration interaction) program. The CI reference space was generated by distributing 11 electrons among the 11 Kramers pairs composed mainly of Dy [4f], [6s], [6p] atomic spinors, and double excitations are allowed from this space to the virtual molecular spinors. The CI calculations indicate that the ground state has the dominant configuration (4f{sup 9})(6s{sup 2})(Ω = 7.5). Above this ground state, 4 low-lying excited states (Ω = 8.5, 7.5, 7.5, 7.5) are found with dominant configurations (4f{sup 10})(6s). These results are consistent with the experimental studies of McCarthy et al. Above these 5 states, 2 states were observed at T{sub 0} = 2.39 eV, 2.52 eV by McCarthy et al. and were named as [19.3]8.5 and [20.3]8.5. McCarthy et al. proposed that both states have dominant configurations (4f{sup 9})(6s)(6p), but these configurations are not consistent with the large R{sub e}’s (∼3.9 a.u.) estimated from the observed rotational constants. The present CI calculations provide near-degenerate states of (4f{sup 10})(6p{sub 3/2,1/2}), (4f{sup 10})(6p{sub 3/2,3/2}), and (4f{sup 9})(6s)(6p{sub 3/2,1/2}) at around 3 eV. The former two states have larger R{sub e} (3.88 a.u.) than the third, so that it is reasonable to assign (4f{sup 10})(6p{sub 3/2,1/2}) to [19.3]8.5 and (4f{sup 10})(6p{sub 3/2,3/2}) to [20.3]8.5.
Energy Technology Data Exchange (ETDEWEB)
Jeffries, J R; Moore, K T; Butch, N P; Maple, M B
2010-05-19
We examine the degree of 5f electron localization in URu{sub 2}Si{sub 2} using spin-orbit sum rule analysis of the U N{sub 4,5} (4d {yields} 5f) edge. When compared to {alpha}-U metal, US, USe, and UTe, which have increasing localization of the 5f states, we find that the 5f states of URu{sub 2}Si{sub 2} are more localized, although not entirely. Spin-orbit analysis shows that intermediate coupling is the correct angular momentum coupling mechanism for URu{sub 2}Si{sub 2} when the 5f electron count is between 2.6 and 2.8. These results have direct ramifications for theoretical assessment of the hidden order state of URu{sub 2}Si{sub 2}, where the degree of localization of the 5f electrons and their contribution to the Fermi surface are critical.
Electronic structure of C28, Pa at sign C28, and U at sign C28
International Nuclear Information System (INIS)
Zhao, K.; Pitzer, R.M.
1996-01-01
Electronic structure calculations, including relativistic core potentials and the spin-orbit interaction, have been carried out on the C 28 , Pa at sign C 28 , and U at sign C 28 species. Excitation energies, spin-orbit splittings, the electron affinity, and the ionization potential are computed for C 28 . The ground state of C 28 is described well by the Hartree-Fock wave functions, but other states are not. The computed electron affinity and ionization potential are similar to those of C 60 . Strong metal-cage binding is found for Pa at sign C 28 and U at sign C 28 , similar to that in U(C 8 H 8 ) 2 . The ground electronic states depend on the order of the lowest-energy cage π * and metal 5f orbitals, with (π * ) 1 and (π * ) 1 (5f) 1 found to be the ground electronic configurations for the two complexes. U at sign C 28 is found to be diamagnetic. 30 refs., 1 fig., 13 tabs
Directory of Open Access Journals (Sweden)
Luis Gabriel Rangel Caballero
2015-12-01
Full Text Available Introducción: La actividad física es un factor determinante de la salud relacionado con el estilo de vida y su práctica regular está asociada con disminución de enfermedades crónicas. Objetivos: Describir la cantidad de actividad física en los diferentes dominios (ocupacional, desplazamiento y tiempo libre, y establecer el índice de masa corporal y el porcentaje de grasa corporal de los estudiantes. Metodología: Estudio analítico, corte transversal realizado en estudiantes de pregrado de una facultad de cultura física, deporte y recreación. La actividad física fue determinada mediante Cuestionario Mundial de Actividad Física. Se evaluó la actividad física en los dominios ocupacional, desplazamiento y tiempo libre. Resultados: El 21.0% presentó sobrepeso y 3.6% obesidad, según índice de masa corporal. El 12.6% presentó exceso de grasa total corporal. El 98.8% de los estudiantes es activo físicamente y cumple con las recomendaciones de la Organización Mundial de la Salud sobre actividad física para la salud. El análisis estratificado del exceso de peso, actividad física y conducta sedentaria por semestre académico, evidencia mayor porcentaje sobrepeso u obesidad en los estudiantes que cursaban de sexto a décimo semestre. Conclusiones: La mayoría de estudiantes analizados son físicamente activos. Los estudiantes que se encontraban cursando la segunda mitad de la carrera presentan mayores porcentajes de exceso de peso. Evaluar el nivel de actividad física en estudiantes de cultura física resulta importante dado que representan un grupo de futuros profesionales enfocados hacia la promoción de estilos de vida saludables relacionados con adecuados niveles de actividad física.
13.-20. VI võtab ehtekunstnike rühmitus F.F.F.F....
2004-01-01
Rühmitus F.F.F.F. (Ketli Tiitsar, Kristi Paap, Kaire Rannik, Berit Teeäär, Maria Valdma) võtab osa Bostonis toimuvast rahvusvahelisest ehtekunstinäitusest ja konverentsist "ContacT 2004", juhendab Massachusetts College of Art üliõpilastele ja kunstnikele korraldatud workshop'i "SWOP". Bakalar Gallerys esineb rühmitus näitusega "Igapäevaleib", osalejate individuaalset loomingut eksponeerib galerii Mobilia
Directory of Open Access Journals (Sweden)
Hayrettin Onur KUCUKOSMANOGLU
2015-09-01
Full Text Available The purpose of the research is to assert whether Department of Music Education Student's communication skills levels differ by determined variables. In the research, “ Communication skills Scale”, which had been developed as a data collection tool by Ersanlı and Balcı in 1998, has been used. The sample group of the research is composed of 127 students of the Department of Music Education in N.E.U. A.K.E.F. In the result of the research,female, under 20 years old and undergraduate 2nd and 3th grade students "communication skills" level is higher than male, older than 21 years old and 4th grade students. Results of the research have been argued comparing with previous studies; and, accordingly some suggestions have been put forward.
Prediction of situational awareness in F-15 pilots.
Carretta, T R; Perry, D C; Ree, M J
1996-01-01
Situational awareness (SA) is a skill often deemed essential to pilot performance in both combat and noncombat flying. A study was conducted to determine if SA in U.S. Air Force F-15 pilots could be predicted. The participants were 171 active duty F-15 A/C pilots who completed a test battery representative of various psychological constructs proposed or demonstrated to be valid for the prediction of performance in a wide variety of military and civilian jobs. These predictors encompassed measures of cognitive ability, psychomotor ability, and personality. Supervisor and peer ratings of SA were collected. Supervisors and peers showed substantial agreement on the SA ratings of the pilots. The first unrotated principle component extracted from the supervisor and peer ratings accounted for 92.5% of the variability of ratings. The unrotated first principal component served as the SA criterion. Flying experience measured in number of F-15 hours was the best predictor of SA. After controlling for the effects of F-15 flying hours, the measures of general cognitive ability based on working memory, spatial reasoning, and divided attention were found to be predictive of SA. Psychomotor and personality measures were not predictive. With additional F-15 flying hours it is expected that pilots would improve their ratings of SA.
Thermal performance study of a box type solar cooker: evaluation of second figure of merit, F2
International Nuclear Information System (INIS)
Subudh Kumar
2006-01-01
The thermal performance of a box type solar cooker can be evaluated through the determination of two figures of merit-F 1 and F 2 . The F 1 is defined as the ratio of optical efficiency factor (η o ) the overall heat loss coefficient (U L ) and F 2 relates to the effectiveness of heat exchange between cooker interiors and contents of the pots. The values of F 1 and F 2 can be found experimentally from the stagnation (no-load) and load (water) tests respectively. The sensible heating curve (a plot between pot water temperature and time) from the load test is used for determination of F 2 . An accurate determination of F 2 is necessary for making the correct and reliable assessment of solar cooker performance. In the present work, the thermal analysis has been carried out to simulate the sensible heating curves for different loads of water in the commercially available, fibre body double-glazed box type solar cooker (size 0.245 m 2 ) by using the heat balance equation. The comparison between the simulated and experimental sensible heating curves is presented. The close agreement in the results shows that the simulated heating curve can be employed for predicting the thermal performance (or F 2 ) of the solar cooker. The F 2 for different loads of water in the solar cooker have been obtained using the computer simulation, while considering the variable overall heat loss coefficient U L (a function of pot water temperature). The results indicate that F 2 increases linearly up to a load of 1.5 kg. Thereafter, the increase in the value of F 2 decreases gradually with the load
Shock Compression Response of Calcium Fluoride (CaF2)
Root, Seth
2017-06-01
The fluorite crystal structure is a textbook lattice that is observed for many systems, such as CaF2, Mg2 Si, and CeO2. Specifically, CaF2 is a useful material for studying the fluorite system because it is readily available as a single crystal. Under static compression, CaF2 is known to have at least three solid phases: fluorite, cotunnite, and a Ni2 In phase. Along the Hugoniot CaF2 undergoes a fluorite to cotunnite phase transition, however, at higher shock pressures it is unknown whether CaF2 undergoes another solid phase transition or melts directly from the cotunnite phase. In this work, we conducted planar shock compression experiments on CaF2 using Sandia's Z-machine and a two-stage light gun up to 900 GPa. In addition, we use density functional theory (DFT) based quantum molecular dynamics (QMD) simulations to provide insight into the CaF2 state along the Hugoniot. In collaboration with: Michael Desjarlais, Ray Lemke, Patricia Kalita, Scott Alexander, Sandia National Laboratories. Sandia National Laboratories is a multi-mission laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL850.
2010-01-05
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1654] Approval for Expansion of Subzone 22F, Abbott Molecular, Inc. (Pharmaceutical and Molecular Diagnostic Products), Chicago, IL, Area Pursuant to its authority under the Foreign-Trade Zones Act of June 18, 1934, as amended (19 U.S.C. 81a-81u...
International Nuclear Information System (INIS)
Lu, Deyu; Liu, Ping
2014-01-01
The density functional theory (DFT)+U method has been widely employed in theoretical studies on various ceria systems to correct the delocalization bias in local and semi-local DFT functionals with moderate computational cost. We present a systematic and quantitative study, aiming to gain better understanding of the dependence of Hubbard U on the local atomic arrangement. To rationalize the Hubbard U of Ce 4f, we employed the first principles linear response method to compute Hubbard U for Ce in ceria clusters, bulks, and surfaces. We found that the Hubbard U varies in a wide range from 4.3 eV to 6.7 eV, and exhibits a strong correlation with the Ce coordination number and Ce–O bond lengths, rather than the Ce 4f valence state. The variation of the Hubbard U can be explained by the changes in the strength of local screening due to O → Ce intersite transitions
International Nuclear Information System (INIS)
Kim, Yong-il; Kim, Yong Joong; Paeng, Jin Chul; Cheon, Gi Jeong; Lee, Dong Soo; Chung, June-Key; Kang, Keon Wook
2017-01-01
18 F-Fluorodeoxyglucose (FDG) positron emission tomography (PET)/computed tomography (CT) has been investigated as a method to predict pancreatic cancer recurrence after pancreatic surgery. We evaluated the recently introduced heterogeneity indices of 18 F-FDG PET/CT used for predicting pancreatic cancer recurrence after surgery and compared them with current clinicopathologic and 18 F-FDG PET/CT parameters. A total of 93 pancreatic ductal adenocarcinoma patients (M:F = 60:33, mean age = 64.2 ± 9.1 years) who underwent preoperative 18 F-FDG PET/CT following pancreatic surgery were retrospectively enrolled. The standardized uptake values (SUVs) and tumor-to-background ratios (TBR) were measured on each 18 F-FDG PET/CT, as metabolic parameters. Metabolic tumor volume (MTV) and total lesion glycolysis (TLG) were examined as volumetric parameters. The coefficient of variance (heterogeneity index-1; SUVmean divided by the standard deviation) and linear regression slopes (heterogeneity index-2) of the MTV, according to SUV thresholds of 2.0, 2.5 and 3.0, were evaluated as heterogeneity indices. Predictive values of clinicopathologic and 18 F-FDG PET/CT parameters and heterogeneity indices were compared in terms of pancreatic cancer recurrence. Seventy patients (75.3%) showed recurrence after pancreatic cancer surgery (mean recurrence = 9.4 ± 8.4 months). Comparing the recurrence and no recurrence patients, all of the 18 F-FDG PET/CT parameters and heterogeneity indices demonstrated significant differences. In univariate Cox-regression analyses, MTV (P = 0.013), TLG (P = 0.007), and heterogeneity index-2 (P = 0.027) were significant. Among the clinicopathologic parameters, CA19-9 (P = 0.025) and venous invasion (P = 0.002) were selected as significant parameters. In multivariate Cox-regression analyses, MTV (P = 0.005), TLG (P = 0.004), and heterogeneity index-2 (P = 0.016) with venous invasion (P < 0.001, 0.001, and 0.001, respectively) demonstrated significant results
Grosbois, C; Schäfer, J; Bril, H; Blanc, G; Bossy, A
2009-03-01
The Upper Isle River (SW France) drains the second most productive gold-mining district of France. A high resolution survey during one hydrological year of As, Cl(-), Cr, Fe, Mn, Mo, SO(4)(2-), Th and U dissolved concentrations in surface water aimed to better understand pathways of trace element export to the river system downstream from the mining district. Dissolved concentrations of As (up to 35000 ng/L) and Mo (up to 292 ng/L) were about 3-fold higher than the regional dissolved background and showed a negative logarithmic relation with discharge. Dissolved concentrations of Cr (up to 483 ng/L), Th (up to 48 ng/L) and U (up to 184 ng/L) increased with discharge. Geochemical relationships between molar ratios in surface water, geochemical background as well as rain- and groundwater data were combined. The contrasting behavior of distinct element groups was explained by a scenario involving three seasonal components: (i) The high flow component is poorly concentrated in As and Mo but highly concentrated in Cr, Th, U. This has been attributed to diffuse sources such as water-soil interactions, atmospheric inputs, bedrock and bed sediment weathering. Although this component probably also includes a contribution by weathering of sulfide veins, this signal is masked by dilution. (ii) One low flow component presents high SO(4)(2-), Fe, As and Mo and moderate Cr, Th and U concentrations. This component has been attributed to point sources such as mine gallery effluents, mining waste weathering and groundwater inputs from natural and/or mining-induced sulfide oxidation in the ore deposit. (iii) A second low flow component showing high As plus Mo concentrations associated with very low SO(4)(2-), Fe, Cr, Th and U concentrations, probably reflects trace element scavenging by ferric oxyhydroxide formation in the adjacent aquifer. This is supported by the decrease of Fe, Cr, Th and U in surface waters. Flux estimates suggest contrasting element-specific impacts on annual
Statistical model analysis of fast-neutron-induced fission of U isotopes
International Nuclear Information System (INIS)
Lestone, J.P.; Gavron, A.
1994-01-01
We have obtained the first experimental evidence of the washing out of the collective level density enhancement associated with the amma deformation of the triaxial first barrier in the U isotope cross sections at neutron energies up to ∼20 MeV, with a statistical model which uses level densities obtained from Nilsson model singles particle levels, we find that it is necessary to (1) wash out the triaxial level density enhancement at an excitation energy of ∼7 MeV above the triaxial barriers with a width of ∼1 MeV, and (2) incorporate the effects of preequilibrium emission. These results imply a γ deformation of the first barriers in the range 10 degree--20 degree. Above an incoming neutron energy of ∼20 MeV where insufficient data exist to constrain optical model potentials, our statistical model U(n,f) cross sections increasingly overestimate the experimental data. A satisfactory reproduction of all the available U(n,f) cross sections above ∼20 MeV is obtained by scaling our calculated compound nucleus formation cross sections. This scaling factor falls from 1.0 at ∼20 MeV to 0.82 at 100 MeV
U.S. Counterterrorism in Sub-Saharan Africa: Understanding Costs, Cultures, and Conflicts
2008-09-01
NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) U.S. Army War...College,Strategic Studies Institute,122 Forbes Avenue,Carlisle,PA,17013-5244 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY...the Indian Ocean, the vestigial problems which remain in southern Africa, and the expanding drug traffic problems.”3 Similarly, the U.S. State
Energy Technology Data Exchange (ETDEWEB)
University of California, Berkeley; Lukens, Wayne W.; Edelstein, Norman M.; Magnani, Nicola; Hayton, Trevor W.; Fortier, Skye; Seaman, Lani A.
2013-06-20
f Orbital bonding in actinide and lanthanide complexes is critical to their behavior in a variety of areas from separations to magnetic properties. Octahedral f1 hexahalide complexes have been extensively used to study f orbital bonding due to their simple electronic structure and extensive spectroscopic characterization. The recent expansion of this family to include alkyl, alkoxide, amide, and ketimide ligands presents the opportunity to extend this study to a wider variety of ligands. To better understand f orbital bonding in these complexes, the existing molecular orbital (MO) model was refined to include the effect of covalency on spin orbit coupling in addition to its effect on orbital angular momentum (orbital reduction). The new MO model as well as the existing MO model and the crystal field (CF) model were applied to the octahedral f1 complexes to determine the covalency and strengths of the ? and ? bonds formed by the f orbitals. When covalency is significant, MO models more precisely determined the strengths of the bonds derived from the f orbitals; however, when covalency was small, the CF model was better than either MO model. The covalency determined using the new MO model is in better agreement with both experiment and theory than that predicted by the existing MO model. The results emphasize the role played by the orbital energy in determining the strength and covalency of bonds formed by the f orbitals.
Schwer, Beate; Kruchten, Joshua; Shuman, Stewart
2016-09-01
A seven-subunit Sm protein ring forms a core scaffold of the U1, U2, U4, and U5 snRNPs that direct pre-mRNA splicing. Using human snRNP structures to guide mutagenesis in Saccharomyces cerevisiae, we gained new insights into structure-function relationships of the SmG, SmE, and SmF subunits. An alanine scan of 19 conserved amino acids of these three proteins, comprising the Sm RNA binding sites or inter-subunit interfaces, revealed that, with the exception of Arg74 in SmF, none are essential for yeast growth. Yet, for SmG, SmE, and SmF, as for many components of the yeast spliceosome, the effects of perturbing protein-RNA and protein-protein interactions are masked by built-in functional redundancies of the splicing machine. For example, tests for genetic interactions with non-Sm splicing factors showed that many benign mutations of SmG, SmE, and SmF (and of SmB and SmD3) were synthetically lethal with null alleles of U2 snRNP subunits Lea1 and Msl1. Tests of pairwise combinations of SmG, SmE, SmF, SmB, and SmD3 alleles highlighted the inherent redundancies within the Sm ring, whereby simultaneous mutations of the RNA binding sites of any two of the Sm subunits are lethal. Our results suggest that six intact RNA binding sites in the Sm ring suffice for function but five sites may not. © 2016 Schwer et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.
Electronic Stopping Power in LiF from First Principles
International Nuclear Information System (INIS)
Pruneda, J. M.; Sanchez-Portal, D.; Arnau, A.; Juaristi, J. I.; Artacho, Emilio
2007-01-01
Using time-dependent density-functional theory we calculate from first principles the rate of energy transfer from a moving proton or antiproton to the electrons of an insulating material, LiF. The behavior of the electronic stopping power versus projectile velocity displays an effective threshold velocity of ∼0.2 a.u. for the proton, consistent with recent experimental observations, and also for the antiproton. The calculated proton/antiproton stopping-power ratio is ∼2.4 at velocities slightly above the threshold (v∼0.4 a.u.), as compared to the experimental value of 2.1. The projectile energy loss mechanism is observed to be extremely local
Non-perturbative selection rules in F-theory
Energy Technology Data Exchange (ETDEWEB)
Martucci, Luca [Dipartimento di Fisica e Astronomia ‘Galileo Galilei’, Università di Padova, and I.N.F.N. Sezione di Padova, via Marzolo 8, Padova, I-35131 (Italy); Weigand, Timo [Institut für Theoretische Physik, Ruprecht-Karls-Universität, Philosophenweg 19, Heidelberg, 69120 (Germany)
2015-09-29
We discuss the structure of charged matter couplings in 4-dimensional F-theory compactifications. Charged matter is known to arise from M2-branes wrapping fibral curves on an elliptic or genus-one fibration Y. If a set of fibral curves satisfies a homological relation in the fibre homology, a coupling involving the states can arise without exponential volume suppression due to a splitting and joining of the M2-branes. If the fibral curves only sum to zero in the integral homology of the full fibration, no such coupling is possible. In this case an M2-instanton wrapping a 3-chain bounded by the fibral matter curves can induce a D-term which is volume suppressed. We elucidate the consequences of this pattern for the appearance of massive U(1) symmetries in F-theory and analyse the structure of discrete selection rules in the coupling sector. The weakly coupled analogue of said M2-instantons is worked out to be given by D1-F1 instantons. The generation of an exponentially suppressed F-term requires the formation of half-BPS bound states of M2 and M5-instantons. This effect and its description in terms of fluxed M5-instantons is discussed in a companion paper.
Photochemistry and reactions of OH- defects and F centers in alkali halides
International Nuclear Information System (INIS)
Morato, S.P.; Luety, F.
1978-01-01
Aditively colored KCl:OH - crystals showed under a combined UV and VIS irradiation, a nearly complete and irreversible destruction of all F centers and visible absorption in the crystal. Only upon heating the crystal above 650 0 C the F center coloration becomes partially restored. The photodissociation of the OH - (under UV light) together with the photoionization of the F center (under VIS light) produces a not effects where all the F centers are converted into U centers. These photoreactions produces high contrast visible images that are completely stable under light at RT. Besides the optical information storage aspect of this effect these photoreaction s can also be used for controlled production of Usub(A) centers if the crystal also contains a foreign metallic impurity such a Na + ion [pt
Near-degeneracy in Excited Vibrational States of 207PbF
Mawhorter, Richard; Nguyen, Alexander; Kim, Yongrak; Biekert, Andreas; Sears, Trevor; Grabow, Jens-Uwe; Kudashov, A. D.; Skripnikov, L. V.; Titov, A. V.; Petrov, A. N.
2017-04-01
High-resolution Fourier transform microwave (FTMW) spectroscopy studies of 207PbF have demonstrated the near-degeneracy of two levels of opposite parity. These have attracted attention for the study of parity violation effects and the variation of fundamental constants using 207PbF. Further theoretical work has improved our detailed understanding of both 207PbF and 208PbF, and furthermore recently indicated that the finely split +/- parity levels grow monotonically closer for higher vibrational states. Our experimental results for v = 0-3 confirm this, and are in excellent agreement with our extended theoretical calculations up to v = 4; both will be presented. TJS acknowledges support from Contract No. DE-SC0012704 with the U.S. Department of Energy, Office of Science, supported by its Division of Chemical Sciences, Geosciences and Biosciences within the Office of Basic Energy Sciences., as do RM, AB, YK, & AN from Pomona College & J-UG from the Deutsche Forschungsgemeinschaft (DFG).
Radionuclide inventories for the F- and H-area seepage basin groundwater plumes
Energy Technology Data Exchange (ETDEWEB)
Hiergesell, Robert A [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Kubilius, Walter P. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2016-05-01
Within the General Separations Areas (GSA) at the Savannah River Site (SRS), significant inventories of radionuclides exist within two major groundwater contamination plumes that are emanating from the F- and H-Area seepage basins. These radionuclides are moving slowly with groundwater migration, albeit more slowly due to interaction with the soil and aquifer matrix material. The purpose of this investigation is to quantify the activity of radionuclides associated with the pore water component of the groundwater plumes. The scope of this effort included evaluation of all groundwater sample analyses obtained from the wells that have been established by the Environmental Compliance & Area Completion Projects (EC&ACP) Department at SRS to monitor groundwater contamination emanating from the F- and H-Area Seepage Basins. Using this data, generalized groundwater plume maps for the radionuclides that occur in elevated concentrations (Am-241, Cm-243/244, Cs-137, I-129, Ni-63, Ra-226/228, Sr-90, Tc-99, U-233/234, U-235 and U-238) were generated and utilized to calculate both the volume of contaminated groundwater and the representative concentration of each radionuclide associated with different plume concentration zones.
International Nuclear Information System (INIS)
Cai Hancheng; Li Zibo; Conti, Peter S.
2011-01-01
Introduction: We and others have previously reported a four-step radiosynthesis of a series of 2'-deoxy-2'-[ 18 F]fluoro-5-substituted-1-β-D-arabinofuranosyluracil derivatives including [ 18 F]FAU, [ 18 F]FEAU, [ 18 F]FFAU, [ 18 F]FCAU, [ 18 F]FBAU and [ 18 F]FIAU as thymidine derivatives for tumor proliferation and/or reporter gene expression imaging with positron emission tomography (PET). Although the radiosynthesis has been proven to be reproducible and efficient, this complicated multistep reaction is difficult to incorporate into an automated cGMP-compliant radiosynthesis module for routine production. Recently, we have developed a simple and efficient one-pot method for routine production of [ 18 F]FMAU. In this study, we studied the feasibility of radiosynthesizing [ 18 F]FAU, [ 18 F]FEAU, [ 18 F]FFAU, [ 18 F]FCAU, [ 18 F]FBAU and [ 18 F]FIAU using this newly developed method. Methods: Similar to the radiosynthesis of [ 18 F]FMAU, 5-substituted 2'-[ 18 F]fluoro-2'-deoxy-arabinofuranosyluracil derivatives ([ 18 F]FAU, [ 18 F]FEAU, [ 18 F]FFAU, [ 18 F]FCAU, [ 18 F]FBAU and [ 18 F]FIAU) were synthesized in one-pot radiosynthesis module in the presence of Friedel-Crafts catalyst TMSOTf and HMDS. Results: This one-pot radiosynthesis method could be used to produce [ 18 F]FAU, [ 18 F]FEAU, [ 18 F]FFAU, [ 18 F]FCAU, [ 18 F]FBAU and [ 18 F]FIAU. The overall radiochemical yields of these tracers varied from 4.1%±0.8% to 10.1%±1.9% (decay-corrected, n=4). The overall reaction time was reduced from 210 min to 150 min from the end of bombardment, and the radiochemical purity was >99%. Conclusions: The improved radiosyntheses of [ 18 F]FAU, [ 18 F]FEAU, [ 18 F]FFAU, [ 18 F]FCAU, [ 18 F]FBAU and [ 18 F]FIAU have been achieved with reasonable yields and high purity using a multistep one-pot method. The synthetic time has been reduced, and the reaction procedures have been significantly simplified. The success of this approach may make PET tracers [ 18 F]FAU, [ 18 F
F{sub 4}U production by electrolytic reduction; Obtencion de UF{sub 4} por reduccion electrolitica
Energy Technology Data Exchange (ETDEWEB)
Esteban Duque, A; Gispert Benach, M; Hernandez Arroyo, F; Montes Ponce de Leon, M.; Rojas de Diego, J L
1974-07-01
As a part of the nuclear fuel cycle program developed at the Spanish Atomic Energy Commission it has been studied the electrolytic reduction of U-VI to U-IV. The effect of the materials, electrolyte concentration, pH, current density, cell size and laboratory scale production is studied. The Pilot Plant and the production data are also described. (Author) 18 refs.
Nanomedicine in the development of drugs for poverty-related diseases
CSIR Research Space (South Africa)
Hayeshi, R
2012-01-01
Full Text Available . Swai Council for Scientific and Industrial Research, Polymers and Composites, P O Box 395, Pretoria 0001, South Africa e-mail: RHayeshi@csir.co.za K. Chibale et al. (eds.), Drug Discovery in Africa, DOI 10.1007/978-3-642-28175-4_17,# Springer... tumors LDE225 Solid tumors Deferasirox NTDT2 Deferasirox Hered. Hematochrom. Panobinostatc Hemat. tumors Everolimus Solid tumors INC424f Myelofibrosis INC424f Polycythemia Vera** Panobinostatc Hodgkin?s lymphoma Midostaurin AML3...
Gerken, Michael; Dixon, David A; Schrobilgen, Gary J
2002-01-28
The fluoride ion donor properties of OsO(3)F(2) have been investigated. The salts [OsO(3)F][AsF(6)], [OsO(3)F][HF](2)[AsF(6)], mu-F(OsO(3)F)(2)[AsF(6)], [OsO(3)F][HF](2)[SbF(6)], and [OsO(3)F][HF][SbF(6)] have been prepared by reaction of OsO(3)F(2) with AsF(5) and SbF(5) in HF solvent and have been characterized in the solid state by Raman spectroscopy. The single-crystal X-ray diffraction studies of [OsO(3)F][AsF(6)] (P2(1)/n, a = 7.0001(11) A, c = 8.8629(13) A, beta = 92.270(7) degrees, Z = 4, and R(1) = 0.0401 at -126 degrees C), [OsO(3)F][SbF(6)] (P2(1)/c, a = 5.4772(14) A, b = 10.115(3) A, c = 12.234(3) A, beta = 99.321(5) degrees, Z = 4, and R(1) = 0.0325 at -173 degrees C), [OsO(3)F][HF](2)[AsF(6)] (P2(1)/n, a = 5.1491(9) A, b = 8.129(2) A, c = 19.636(7) A, beta = 95.099(7) degrees, Z = 4, and R(1) = 0.0348 at -117 degrees C), and [OsO(3)F][HF][SbF(6)] (Pc, a = 5.244(4) A, b = 9.646(6) A, c = 15.269(10) A, beta = 97.154(13) degrees, Z = 4, and R(1) = 0.0558 at -133 degrees C) have shown that the OsO(3)F(+) cations exhibit strong contacts to the anions and HF solvent molecules giving rise to cyclic, dimeric structures in which the osmium atoms have coordination numbers of 6. The reaction of OsO(3)F(2) with neat SbF(5) yielded [OsO(3)F][Sb(3)F(16)], which has been characterized by (19)F NMR spectroscopy in SbF(5) and SO(2)ClF solvents and by Raman spectroscopy and single-crystal X-ray diffraction in the solid state (P4(1)m, a = 10.076(6) A, c = 7.585(8) A, Z = 2, and R(1) = 0.0858 at -113 degrees C). The weak fluoride ion basicity of the Sb(3)F(16)(-) anion resulted in an OsO(3)F(+) cation (C(3)(v) point symmetry) that is well isolated from the anion and in which the osmium is four-coordinate. The geometrical parameters and vibrational frequencies of OsO(3)F(+), ReO(3)F, mu-F(OsO(3)F)(2)(+), (FO(3)Os--FPnF(5))(2), and (FO(3)Os--(HF)(2)--FPnF(5))(2) (Pn = As, Sb) have been calculated using density functional theory methods.
Anthropometry of Women of the U.S. Army--1977. Report Number 3. Bivariate Frequency Tables
1977-07-01
U4 (\\ 4. 4 (I ’ a -1 Or L - l CLJ U. L. C.)~V * . -4 W- (V (N 4 ’ ( .4~-. U., (- L4+ + LU. B S- AV ILBL UOYu rr~ 4.4 4~4 4~) 4- - flJ 41.4 -J 4...0 4 ^* 04L I I 4 x v0 -- 4.44- . 4- 4. . 4- 4. 4 411 I~tfl \\Jr4(A 0 N~LI S 19 Id -4 o ,4 UNN6 A NI t4 . I P.. A 4N ,j td t’- 4 (v. LA In .4 10...J %. td 0A I.- 0 - 40 CI (TIU LA m r N?)MLA 4 0% x > co ~ r" (M -4- ) 4 (A Li * F4 ~ LA v4 *LA %D M (%J V 4 D I.- Id . - MV -4 (Ii " CA V) X F
Advances and Best Practices in Airborne Gravimetry from the U.S. GRAV-D Project
Diehl, Theresa; Childers, Vicki; Preaux, Sandra; Holmes, Simon; Weil, Carly
2013-04-01
The Gravity for the Redefinition of the American Vertical Datum (GRAV-D) project, an official policy of the U.S. National Geodetic Survey as of 2007, is working to survey the entire U.S. and its holdings with high-altitude airborne gravimetry. The goal of the project is to provide a consistent, high-quality gravity dataset that will become the cornerstone of a new gravimetric geoid and national vertical datum in 2022. Over the last five years, the GRAV-D project has surveyed more than 25% of the country, accomplishing almost 500 flights on six different aircraft platforms and producing more than 3.7 Million square km of data thus far. This wealth of experience has led to advances in the collection, processing, and evaluation of high-altitude (20,000 - 35,000 ft) airborne gravity data. This presentation will highlight the most important practical and theoretical advances of the GRAV-D project, giving an introduction to each. Examples of innovation include: 1. Use of navigation grade inertial measurement unit data and precise lever arm measurements for positioning; 2. New quality control tests and software for near real-time analysis of data in the field; 3. Increased accuracy of gravity post-processing by reexamining assumptions and simplifications that were inconsistent with a goal of 1 mGal precision; and 4. Better final data evaluation through crossovers, additional statistics, and inclusion of airborne data into harmonic models that use EGM08 as a base model. The increases in data quality that resulted from implementation of the above advances (and others) will be shown with a case study of the GRAV-D 2008 southern Alaska survey near Anchorage, over Cook Inlet. The case study's statistics and comparisons to global models illustrate the impact that these advances have had on the final airborne gravity data quality. Finally, the presentation will summarize the best practices identified by the project from its last five years of experience.
Energy Technology Data Exchange (ETDEWEB)
Kim, Yong-il [CHA University, Department of Nuclear Medicine, CHA Bundang Medical Center, Seongnam (Korea, Republic of); Seoul National University Hospital, Department of Nuclear Medicine, Seoul (Korea, Republic of); Kim, Yong Joong [Veterans Health Service Medical Center, Seoul (Korea, Republic of); Paeng, Jin Chul; Cheon, Gi Jeong; Lee, Dong Soo [Seoul National University Hospital, Department of Nuclear Medicine, Seoul (Korea, Republic of); Chung, June-Key [Seoul National University Hospital, Department of Nuclear Medicine, Seoul (Korea, Republic of); Seoul National University, Cancer Research Institute, Seoul (Korea, Republic of); Kang, Keon Wook [Seoul National University Hospital, Department of Nuclear Medicine, Seoul (Korea, Republic of); Seoul National University, Cancer Research Institute, Seoul (Korea, Republic of); Seoul National University College of Medicine, Department of Biomedical Sciences, Seoul (Korea, Republic of); Seoul National University College of Medicine, Department of Nuclear Medicine, Seoul (Korea, Republic of)
2017-11-15
{sup 18}F-Fluorodeoxyglucose (FDG) positron emission tomography (PET)/computed tomography (CT) has been investigated as a method to predict pancreatic cancer recurrence after pancreatic surgery. We evaluated the recently introduced heterogeneity indices of {sup 18}F-FDG PET/CT used for predicting pancreatic cancer recurrence after surgery and compared them with current clinicopathologic and {sup 18}F-FDG PET/CT parameters. A total of 93 pancreatic ductal adenocarcinoma patients (M:F = 60:33, mean age = 64.2 ± 9.1 years) who underwent preoperative {sup 18}F-FDG PET/CT following pancreatic surgery were retrospectively enrolled. The standardized uptake values (SUVs) and tumor-to-background ratios (TBR) were measured on each {sup 18}F-FDG PET/CT, as metabolic parameters. Metabolic tumor volume (MTV) and total lesion glycolysis (TLG) were examined as volumetric parameters. The coefficient of variance (heterogeneity index-1; SUVmean divided by the standard deviation) and linear regression slopes (heterogeneity index-2) of the MTV, according to SUV thresholds of 2.0, 2.5 and 3.0, were evaluated as heterogeneity indices. Predictive values of clinicopathologic and {sup 18}F-FDG PET/CT parameters and heterogeneity indices were compared in terms of pancreatic cancer recurrence. Seventy patients (75.3%) showed recurrence after pancreatic cancer surgery (mean recurrence = 9.4 ± 8.4 months). Comparing the recurrence and no recurrence patients, all of the {sup 18}F-FDG PET/CT parameters and heterogeneity indices demonstrated significant differences. In univariate Cox-regression analyses, MTV (P = 0.013), TLG (P = 0.007), and heterogeneity index-2 (P = 0.027) were significant. Among the clinicopathologic parameters, CA19-9 (P = 0.025) and venous invasion (P = 0.002) were selected as significant parameters. In multivariate Cox-regression analyses, MTV (P = 0.005), TLG (P = 0.004), and heterogeneity index-2 (P = 0.016) with venous invasion (P < 0.001, 0.001, and 0
New perspectives for undoped CaF2 scintillator as a threshold activation neutron detector
Sibczynski, Pawel; Dziedzic, Andrzej; Grodzicki, Krystian; Iwanowska-Hanke, Joanna; Moszyński, Marek; Swiderski, Lukasz; Syntfeld-Każuch, Agnieszka; Wolski, Dariusz; Carrel, Frédérick; Grabowski, Amélie; Hamel, Matthieu; Laine, Frederic; Sari, Adrien; Iovene, Alessandro; Tintori, Carlo; Fontana, Cristiano; Pino, Felix
2018-01-01
In this paper we present the prompt photofission neutron detection performance of undoped CaF2 scintillator using Threshold Activation Detection (TAD). The study is carried out in the frame of C-BORD Horizon 2020 project, during which an efficient toolbox for high volume freight non-intrusive inspection (NII) is under development. Technologies for radiation monitoring are the part of the project. Particularly, detection of various radiological threats on country borders plays an important significant role in Homeland Security applications. Detection of illegal transfer of Special Nuclear Material (SNM) - 235U, 233U and 239Pu - is particular due to the potential use for production of nuclear weapon as well as radiological dispersal device (RDD) V known also as a "dirty bomb". This technique relies on activation of 19F nuclei in the scintillator medium by fast neutrons and registration of high-energy β particles and γ-rays from the decay of reaction products. The radiation from SNM is detected after irradiation in order to avoid detector blinding. Despite the low 19F(n,α)16N or 19F(n,p)19O reaction cross-section, the method could be a good solution for detection of shielded nuclear material. Results obtained with the CaF2 detector were compared with the previous study done for BaF2 and 3He detector. These experimental results were obtained using 252Cf source and 9 MeV Varian Linatron M9 linear accelerator (LINAC). Finally, performance of the prompt neutron detection system based on CaF2 will be validated at Rotterdam Seaport during field trails in 2018.
New perspectives for undoped CaF2 scintillator as a threshold activation neutron detector
Directory of Open Access Journals (Sweden)
Sibczynski Pawel
2018-01-01
Full Text Available In this paper we present the prompt photofission neutron detection performance of undoped CaF2 scintillator using Threshold Activation Detection (TAD. The study is carried out in the frame of C-BORD Horizon 2020 project, during which an efficient toolbox for high volume freight non-intrusive inspection (NII is under development. Technologies for radiation monitoring are the part of the project. Particularly, detection of various radiological threats on country borders plays an important significant role in Homeland Security applications. Detection of illegal transfer of Special Nuclear Material (SNM - 235U, 233U and 239Pu - is particular due to the potential use for production of nuclear weapon as well as radiological dispersal device (RDD V known also as a “dirty bomb”. This technique relies on activation of 19F nuclei in the scintillator medium by fast neutrons and registration of high-energy β particles and γ-rays from the decay of reaction products. The radiation from SNM is detected after irradiation in order to avoid detector blinding. Despite the low 19F(n,α16N or 19F(n,p19O reaction cross-section, the method could be a good solution for detection of shielded nuclear material. Results obtained with the CaF2 detector were compared with the previous study done for BaF2 and 3He detector. These experimental results were obtained using 252Cf source and 9 MeV Varian Linatron M9 linear accelerator (LINAC. Finally, performance of the prompt neutron detection system based on CaF2 will be validated at Rotterdam Seaport during field trails in 2018.
Methyl isobutyl ketone (MIBK) induction of α2u-globulin nephropathy in male, but not female rats
International Nuclear Information System (INIS)
Borghoff, S.J.; Hard, G.C.; Berdasco, N.M.; Gingell, R.; Green, S.M.; Gulledge, W.
2009-01-01
Male F-344 rats were administered corn oil (vehicle control), d-limonene (positive control, 300 mg/kg), or MIBK (1000 mg/kg) and female F-344 rats corn oil (vehicle control) or MIBK for 10 consecutive days by oral gavage. Approximately 24 h after the final dose the kidneys were excised and the left kidney prepared and evaluated for histological changes including protein (hyaline) droplet accumulation, immunohistochemical staining for α2u-globulin (α2u), and proliferating cell nuclear antigen (PCNA) to quantitate renal cell proliferation. The right kidney was prepared for quantitation of total protein and α2u using an ELISA. MIBK elicited an increase in protein droplets, accumulation of α2u, and renal cell proliferation in male, but not female rats, responses characteristic of α2u-mediated nephropathy. MIBK produced identical histopathological changes in the male rat kidney when compared to d-limonene, an acknowledged inducer of α2u-nephropathy except that the grade of severity tended to be slightly lower with MIBK. MIBK did not induce any effects in female rats. Therefore, renal histopathology, along with the other measures of α2u accumulation, provides additional weight of evidence to support the inclusion of MIBK in the category of chemicals exerting renal effects through a α2u-nephropathy-mediated mode-of-action
International Nuclear Information System (INIS)
Ahner, W.
1993-07-01
The technical part of this thesis describes the construction, the properties, and the experience from the application of an intelligent software trigger for the experiments on the production of positive kaons at the kaon spectrometer. The software trigger was applied in several beam-times. An essiential improvement in the yield of the registrated kaons was reached. The realization ensued by the application of standard components and represents a flexible and cost-efficient solution. The physical part of this thesis deals with the measurement of the double-differential cross section for positive kaons, positive pions, and protons in the system Ne+NaF at 1.0 GeV/u beam energy in the laboratory-angle range ofΘ lab =44 ±4 . the beam energy of 1.0 GeV/u lies below the threshold energy for the production of positive kaons in the collision of two free nucleons of E beam threshold =1.58 GeV. The momentum spectra of kaons and pions in the laboratory-momentum range from 270 MeV/c to 1140 MeV/c can be well described by a Boltzmann distribution in the c. m. system. The steepness parameter of the Boltzmann distributions amount to 64 MeV for kaons and 58 MeV for pions. The momentum-integrates cross section were determined from the extrapolation of the fitted Boltzmann distributions to: (dσ/dΩ lab ) ΔΩ lab K + =58.6±9.2 μb/sr and (dσ/dΩ lab ) ΔΩ lab π + =169±17 mb/sr. The total cross sections were calculated under the assumption of the isotropy in the c. m. system from the fitted distributions: σ 0 K + =335±52 μb and σ 0 π + =939±96 mb. The mass dependence of the meson production cross sections in the symmetrc collisional system Ne+NaF was studied and compared with the results of the study of the heavy collisional system Au+Au
Directory of Open Access Journals (Sweden)
Jeanette E Bröms
Full Text Available The Gram-negative bacterium Francisella tularensis causes tularemia, a disease which requires bacterial escape from phagosomes of infected macrophages. Once in the cytosol, the bacterium rapidly multiplies, inhibits activation of the inflammasome and ultimately causes death of the host cell. Of importance for these processes is a 33-kb gene cluster, the Francisella pathogenicity island (FPI, which is believed to encode a type VI secretion system (T6SS. In this study, we analyzed the role of the FPI-encoded proteins VgrG and DotU, which are conserved components of type VI secretion (T6S clusters. We demonstrate that in F. tularensis LVS, VgrG was shown to form multimers, consistent with its suggested role as a trimeric membrane puncturing device in T6SSs, while the inner membrane protein DotU was shown to stabilize PdpB/IcmF, another T6SS core component. Upon infection of J774 cells, both ΔvgrG and ΔdotU mutants did not escape from phagosomes, and subsequently, did not multiply or cause cytopathogenicity. They also showed impaired activation of the inflammasome and marked attenuation in the mouse model. Moreover, all of the DotU-dependent functions investigated here required the presence of three residues that are essentially conserved among all DotU homologues. Thus, in agreement with a core function in T6S clusters, VgrG and DotU play key roles for modulation of the intracellular host response as well as for the virulence of F. tularensis.
International Nuclear Information System (INIS)
Troc, Robert
2007-01-01
The mixed valence (MV) phenomenon has been observed so far in a large number of various compounds but containing only lanthanides. These properties are usually associated with the mixing of the localised f-state and the band states. The usual valence state for magnetic uranium intermetallics is the trivalent state 5f 3 or hybridised 5f 2 6d 1 , both are nearly degenerate in energy and can compete for a stability of the compound. In some cases a gain in an energy minimum may be achieved by very fast fluctuating between these two states with a time of 10 -14 s, which does not allow to yield the ordered state even if the exchange interactions (favourite the U-U distances) would be able for that. The latter cases seem to concern the described here intermetallics: one ternary compound based on Co, UCoGa 5 , and the two uranium ternary compounds based on Ru, namely U 2 Ru 2 Sn and U 2 RuGa 8 which all crystallize in a tetragonal unit cell. All these compounds show a maximum in their temperature dependences of the magnetic susceptibility measured along and perpendicular to the c-axis. Such a behaviour, which is reminiscent of a number of Ce (Sm, Eu) and Yb compounds for which χ(T) has in the past been considered by Sales and Wohlleben (SW) by applying their ICF model or by Lawrance et al. following their scaling procedure. It turned out that these phenomenological models can also be applied to the considered here two Ru-based uranium ternaries from which some reliable energy parameters could be found. In order to further support the mixing valence scenario for the first such cases in uranium compounds presented here, the transport and thermodynamic properties are also discussed. However, some of the most important results confirming the MV state, e.g., in U 2 RuGa 8 , has recently been achieved from the inelastic neutron scattering performed in the Rutherford Appleton Laboratory on the ISIS facility. From these measurements a characteristic gap of 60 meV has been
Energy Technology Data Exchange (ETDEWEB)
Nakamura, Gerson Hiroshi de Godoy
2013-07-01
Investigations of the binary systems LiF-BiF{sub 3} and NaF-BiF{sub 3} were performed with the objective of clarifying the thermal behavior and phase equilibria of these systems and their intermediary phases, an important requisite for high-quality crystal growth. Several samples in the entire range of compositions (0 to 100 mol% BiF{sub 3}) of both systems were subjected to experiments of differential thermal analysis (DTA) and thermogravimetry (TG), and also of differential scanning calorimetry (DSC). A few specific compositions were selected for X-ray diffraction to supplement the experimental data. Due to the high vulnerability of BiF{sub 3} to oxygen contamination, its volatility and propensity to destroy metal parts upon heating, it was necessary to determine the optimal conditions for thermal analysis before investigating the systems themselves. Phase relations in the system LiF-BiF{sub 3} were completely clarified and a phase diagram was calculated and evaluated via the commercial software Factsage. The diagram itself consists in a simple peritectic system in which the only intermediary compound, LiBiF{sub 4}, decomposes into LiF and a liquid phase. The NaF-BiF{sub 3} system could not be completely elucidated and the phase relations in the NaF poor side (> 50% BiF{sub 3}) are still unknown. In the NaF rich side, however, the possible peritectoid decomposition of the compound NaBiF{sub 4} was identified. In both systems X-ray diffraction yielded crystal structures discrepant with the literature for the intermediary phases, LiBiF{sub 4}, NaBiF{sub 4} and a solid solution of NaF and BiF{sub 3} called {sup I.} The observed structures remain unknown and explanations for the discrepancies were proposed. (author)
Development of F.T. Raman Spectroscopy
1989-06-19
Virginia, 22217 5000, U.S.A*.ELMNNO NONOACSINN. End of Year Report on the contract 2 PERSONAL AU7I40R(S) P.J. Hda and M. Fl cm 3a TYPE OF REPORT 13b. TIME...to do, have .- considerable progress. The area in which we have .ated involves the zeolites. We have sorbed pyridine tc .- of -eolites ( acidic and...react-ion using F.T. Raman methods and then to eX.plore rmechaniszzs, types of acid sites involved and the role o.: temperature. -:olla-’-rators
Panel drafts position on U.S. science budget
The AGU panel charged with writing the Union position on the U.S. fiscal 1993 budget met at AGU Headquarters on February 27 to draft their statement and hear from representatives of federal science agencies. The panel's position statement is expected to be completed by the end of March, pending approval by the AGU Council.AGU has drafted positions on the U.S. science budget since 1990. This year's panel includes Terry E. Tullis (chair), Brown University; H. Frank Eden, General Electric Astro Space; Thomas E. Pyle, Joint Oceanographic Institutions, Inc.; Thomas Potemra, Johns Hopkins Applied Physics Laboratory; David W. Simpson, Incorporated Research Institutions for Seismology; Steven W. Squyres, Cornell University; and Eric F. Wood, Princeton University.
The efficiency of 18F-FDG PET for glioma grading: a Meta-analysis
International Nuclear Information System (INIS)
Zhang Xiaochun; Wang Xiaoming; Jia Sulan
2011-01-01
Objective: To systematically review the efficiency of 18 F-FDG PET in glioma grading by using Meta-analysis. Methods: Retrieval in PubMed and China National Knowledge Infrastructure (CNKI) was performed. Relevant papers concerning with glioma diagnoses with 18 F- FDG PET were selected. Paper quality was evaluated according to the standard of diagnostic test recommended by Cochrane Workshop. The data of glioma malignancy degree defined as semi-quantitatively and qualitatively were extracted from the papers. Meta-analysis was conducted with the Meta-Disc software to calculate pooled weighted sensitivity and specificity with 95% confidence interval (CI). Summary receiver operating characteristic (SROC) curve was performed and the areas under the curve (AUC) were calculated. Results: Seven hundred and fifty-three patients from 17 papers (16 in English, 1 in Chinese) were included. Two hundred and seventy-two patients from 11 papers were using semi-quantitative (tumor to cortex ratio, T/C; tumor to white matter ratio, T/W) method and 481 patients from 9 papers were using qualitative method (visual observation, some of the papers had 2 or more methods). After heterogeneity test was done, different effect models were selected. The pooled weighted sensitivity, specificity and diagnostic odds ratio (DOR) with 95% CI for T/C group was 0.952 (95% CI: 0.903-0.980), 0.409 (95% CI: 0.318-0.504) and 11. 746 (95% CI: 5.368-25.702) respectively. The pooled weighted sensitivity, specificity and DOR with 95% CI for T/W group was 0. 857 (95% CI: 0.768-0.922), 0.538 (95% CI: 0.431-0.642) and 22. 066 (95% CI:7.077-68.800) respectively. The pooled weighted sensitivity, specificity and diagnostic odds ratio (DOR) with 95% CI for qualitative method was 0.810 (95% CI: 0.757-0.855), 0.870 (95% CI: 0.819-0.911) and 15.282 (95% CI: 3.716-62.851) respectively. The AUC for T/C group, T/W group and qualitative method was 0.8604, 0.8373 and 0.8724 respectively. Conclusions: Grading glioma by 18 F
19 CFR 12.104f - Temporary disposition of materials and articles.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Temporary disposition of materials and articles... SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Cultural Property § 12.104f Temporary... museum or other cultural or scientific institution in the U.S. if he finds that sufficient safeguards...
Thermal analysis and phase diagrams of the LiF BiF3 e NaF BiF3 systems
International Nuclear Information System (INIS)
Nakamura, Gerson Hiroshi de Godoy
2013-01-01
Investigations of the binary systems LiF-BiF 3 and NaF-BiF 3 were performed with the objective of clarifying the thermal behavior and phase equilibria of these systems and their intermediary phases, an important requisite for high-quality crystal growth. Several samples in the entire range of compositions (0 to 100 mol% BiF 3 ) of both systems were subjected to experiments of differential thermal analysis (DTA) and thermogravimetry (TG), and also of differential scanning calorimetry (DSC). A few specific compositions were selected for X-ray diffraction to supplement the experimental data. Due to the high vulnerability of BiF 3 to oxygen contamination, its volatility and propensity to destroy metal parts upon heating, it was necessary to determine the optimal conditions for thermal analysis before investigating the systems themselves. Phase relations in the system LiF-BiF 3 were completely clarified and a phase diagram was calculated and evaluated via the commercial software Factsage. The diagram itself consists in a simple peritectic system in which the only intermediary compound, LiBiF 4 , decomposes into LiF and a liquid phase. The NaF-BiF 3 system could not be completely elucidated and the phase relations in the NaF poor side (> 50% BiF 3 ) are still unknown. In the NaF rich side, however, the possible peritectoid decomposition of the compound NaBiF 4 was identified. In both systems X-ray diffraction yielded crystal structures discrepant with the literature for the intermediary phases, LiBiF 4 , NaBiF 4 and a solid solution of NaF and BiF 3 called I. The observed structures remain unknown and explanations for the discrepancies were proposed. (author)
Emissions from small-scale burns of simulated deployed U.S. military waste.
Woodall, Brian D; Yamamoto, Dirk P; Gullett, Brian K; Touati, Abderrahmane
2012-10-16
U.S. military forces have historically relied on open burning as an expedient method of volume reduction and treatment of solid waste during the conflicts in Afghanistan and Iraq. This study is the first effort to characterize a broad range of pollutants and their emission factors during the burning of military waste and the effects that recycling efforts, namely removing plastics, might have on emissions. Piles of simulated military waste were constructed, burned, and emissions sampled at the U.S. Environmental Protection Agency (EPA) Open Burn Testing Facility (OBTF), Research Triangle Park, NC. Three tests contained polyethylene terephthalate (PET #1 or PET) plastic water bottles and four did not. Emission factors for polycyclic aromatic hydrocarbons (PAHs), volatile organic compounds (VOCs), particulate matter (PM(10), PM(2.5)), polychlorinated and polybrominated dioxins/furans (PCDD/F and PBDD/F), and criteria pollutants were determined and are contained within. The average PCDD/F emission factors were 270 ng-toxic equivalency (TEQ) per kg carbon burned (ng-TEQ/kg Cb), ranging from 35 to 780 ng-TEQ/kg Cb. Limited testing suggests that targeted removal of plastic water bottles has no apparent effect on reducing pollutants and may even promote increased emissions.
Bond lengths and bond strengths in compounds of the 5f elements
International Nuclear Information System (INIS)
Zachariasen, W.H.
1975-01-01
The variation of bond length (D) with bond strength (S) in normal valence compounds of 3d, 4d, 5d-4f, and 6d-5f elements can be represented approximately as D(S)=D(0.5) F(S), where D(0.5) is a characteristic constant for a given bond and F(S) an empirical function which is the same for all bonds. A bond strength Ssub(ij)=ssub(ji) is assigned to the bond between atoms i and j such that Σsub(j) Ssub(ij)=vsub(i) and Σsub(i) Ssub(ij)=vsub(j), where vsub(i) and vsub(j) are the normal valences of the two atoms. The function F(S) decreases monotonically with increasing S, and is normalized to unity at S=0.5, so that the constant D(0.5) has the physical meaning of being the bond length adjusted to S=0.5. The method described above was used to interpret and systematize the experimental results on bond lengths in oxides, halides, and oxyhalides of the 5f elements. (U.S.)
Discharge pumped F/sub 2/ laser at 1580 A
Energy Technology Data Exchange (ETDEWEB)
Pummer, H; Hohla, K; Diegelmann, M; Reilly, J P
1979-01-01
By pumping mixtures of F/sub 2/ and He in a fast uv-preionized discharge laser emission at 1578 A, probably stemming from the /sup 3/PI/sub 2g/ ..-->.. /sup 3/PI/sub 2u/ transition in molecular fluorine have been obtained. Observed energy is 8.5 mJ in pulses of 15 ns half-width. First experimental results on laser performance and scalability are given.
Dicty_cDB: Contig-U16177-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available M01F05_RP Sugar Beet germination cDNA library Be... 54 1e-04 2 ( EG012316 ) STDB003A10u STDB Solanum tuberos...hytophthor... 52 0.048 1 ( CF858202 ) psMY010iA08r Agriculture Canada Phytophthora soja... 52 0.048 1 ( CF85...8120 ) psMY008iH11r Agriculture Canada Phytophthora soja... 52 0.048 1 ( CF857916 ) psMY006iB06r Agriculture...01618 ) MM10_C09 Young roots probed with 3 week old root ... 54 5e-05 2 ( EG552289 ) MM04F20_RP Sugar Beet germination cDNA library... Be... 54 5e-05 2 ( EG552173 ) MM04F20_XP Sugar Beet germination cDNA library
Sensitivity analysis of U238 cross sections in fast nuclear systems-SENSEAV-R computer code
International Nuclear Information System (INIS)
Amorim, E.S. de; D'Oliveira, A.B.; Oliveira, E.C. de
1981-01-01
For many performance parameters of reactors the tabulated ratio calculation/experiment indicate that some potential problems may exist either in the cross section data or in the calculation models used to investigate the critical experimental data. A first step toward drawing a more definite conclusion is to perform a selective analysis of sensitivity profiles and covariance data files for the cross section data used in the calculation. Many works in the current literature show that some of these uncertainties come from uncertainties in 238 U(n,γ), 238 U(n,f) 239 Pu(n,f). Perturbation methods were developed to analyze the effects of finite changes in a large number of cross sections and summarize the investigation by a group dependent sensitivity coefficient. As an application, the results of this investigation indicates that improvements should be done only on the medium and low energy ranges of 238 U(n,γ) based on an analysis of cost and economic benefits. (Author) [pt
Energy Technology Data Exchange (ETDEWEB)
Lu, Deyu, E-mail: dlu@bnl.gov, E-mail: pingliu3@bnl.gov; Liu, Ping, E-mail: dlu@bnl.gov, E-mail: pingliu3@bnl.gov [Center for Functional Nanomaterials, Brookhaven National Laboratory, Upton, New York 11973 (United States)
2014-02-28
The density functional theory (DFT)+U method has been widely employed in theoretical studies on various ceria systems to correct the delocalization bias in local and semi-local DFT functionals with moderate computational cost. We present a systematic and quantitative study, aiming to gain better understanding of the dependence of Hubbard U on the local atomic arrangement. To rationalize the Hubbard U of Ce 4f, we employed the first principles linear response method to compute Hubbard U for Ce in ceria clusters, bulks, and surfaces. We found that the Hubbard U varies in a wide range from 4.3 eV to 6.7 eV, and exhibits a strong correlation with the Ce coordination number and Ce–O bond lengths, rather than the Ce 4f valence state. The variation of the Hubbard U can be explained by the changes in the strength of local screening due to O → Ce intersite transitions.
Electron loss from 1.4 MEV/u U4,6,10+ ions colliding with Ne, N2 and Ar targets
International Nuclear Information System (INIS)
DuBois, R.D.; Santos, A.C.F.; Stoehlker, T.
2004-07-01
Absolute, total, single, and multiple electron loss cross sections are measured for 1.4 MeV/u U 4,6,10+ ions colliding with neon and argon atoms and nitrogen molecules. It is found that the cross sections all have the same dependence on the number of electrons lost and that multiplying the cross sections by the initial number of electrons in the 6s, 6p, and 5f shells yields good agreement between the different projectiles. By combining the present data with previous measurements made at the same velocity, it is shown that the scaled cross sections slowly decrease in magnitude for incoming charge states between 1 and 10 whereas the cross sections for higher charge state ions fall off much more rapidly. (orig.)
Hughes, Michael J; Mercier, Hélène P A; Schrobilgen, Gary J
2010-04-05
Stoichiometric amounts of XeF(6) and (OsO(3)F(2))(infinity) react at 25-50 degrees C to form salts of the known XeF(5)(+) and Xe(2)F(11)(+) cations, namely, [XeF(5)][mu-F(OsO(3)F(2))(2)], [XeF(5)][OsO(3)F(3)], and [Xe(2)F(11)][OsO(3)F(3)]. Although XeF(6) is oxophilic toward a number of transition metal and main-group oxides and oxide fluorides, fluoride/oxide metathesis was not observed. The series provides the first examples of noble-gas cations that are stabilized by metal oxide fluoride anions and the first example of a mu-F(OsO(3)F(2))(2)(-) salt. Both [XeF(5)][mu-F(OsO(3)F(2))(2)] and [Xe(2)F(11)][OsO(3)F(3)] are orange solids at room temperature. The [XeF(5)][OsO(3)F(3)] salt is an orange liquid at room temperature that solidifies at 5-0 degrees C. When the salts are heated at 50 degrees C under 1 atm of N(2) for more than 2 h, significant XeF(6) loss occurs. The X-ray crystal structures (-173 degrees C) show that the salts exist as discrete ion pairs and that the osmium coordination spheres in OsO(3)F(3)(-) and mu-F(OsO(3)F(2))(2)(-) are pseudo-octahedral OsO(3)F(3)-units having facial arrangements of oxygen and fluorine atoms. The mu-F(OsO(3)F(2))(2)(-) anion is comprised of two symmetry-related OsO(3)F(2)-groups that are fluorine-bridged to one another. Ion pairing results from secondary bonding interactions between the fluorine/oxygen atoms of the anions and the xenon atom of the cation, with the Xe...F/O contacts occurring opposite the axial fluorine and from beneath the equatorial XeF(4)-planes of the XeF(5)(+) and Xe(2)F(11)(+) cations so as to avoid the free valence electron lone pairs of the xenon atoms. The xenon atoms of [XeF(5)][mu-F(OsO(3)F(2))(2)] and [Xe(2)F(11)][OsO(3)F(3)] are nine-coordinate and the xenon atom of [XeF(5)][OsO(3)F(3)] is eight-coordinate. Quantum-chemical calculations at SVWN and B3LYP levels of theory were used to obtain the gas-phase geometries, vibrational frequencies, and NBO bond orders, valencies, and NPA charges of
Energy Technology Data Exchange (ETDEWEB)
Boucher, R; Barthelemy, P [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires
1964-07-01
The data concerning the U-Pu, U-Pu-Mo and U-Pu-Nb are recalled. The results obtained with U-Pu-Ti and U-Pu-Zr alloys containing 15-20 per cent Pu and 10 wt. per cent ternary element are reported. The transformation temperatures, the expansion coefficients, the nature of phases, the thermal cycling behaviour have been determined. A list of the principal properties of these different alloys is presented and the possibilities of their use as fast reactor's fuel element are considered. The U-Pu-Ti alloys seem to be quite promising: easiness of fabrication, large thermal stability, excellent behaviour in air, small quantity of zeta phase, temperature of solidus superior to 1100 deg. C. (authors) [French] On rappelle brievement les connaissances acquises sur les alliages U-Pu, U-Pu-Mo et U-Pu-Nb. On presente les resultats obtenus avec les alliages U-Pu-Ti et U-Pu-Zr pour des teneurs de 15 a 20 pour cent de plutonium et 10 pour cent en poids d'element ternaire. On a determine les temperatures de transformation, les coefficients de dilatation, la nature des phases, la conductibilite thermique a 20 deg. C, la tenue au cyclage thermique et diverses autres proprietes. Un tableau resume les principales proprietes des divers alliages. On considere les possibilites d'emploi de ces alliages comme combustibles de reacteur rapide. Les alliages U-Pu-Ti paraissent particulierement interessants: facilite d'elaboration, stabilite thermique etendue, tenue dans l'air excellente, faible quantite de la phase U-Pu zeta, temperature de fusion commencante superieure a 1100 deg. C. (auteurs)
Discrete structures in F-theory compactifications
Energy Technology Data Exchange (ETDEWEB)
Till, Oskar
2016-05-04
In this thesis we study global properties of F-theory compactifications on elliptically and genus-one fibered Calabi-Yau varieties. This is motivated by phenomenological considerations as well as by the need for a deeper understanding of the set of consistent F-theory vacua. The global geometric features arise from discrete and arithmetic structures in the torus fiber and can be studied in detail for fibrations over generic bases. In the case of elliptic fibrations we study the role of the torsion subgroup of the Mordell-Weil group of sections in four dimensional compactifications. We show how the existence of a torsional section restricts the admissible matter representations in the theory. This is shown to be equivalent to inducing a non-trivial fundamental group of the gauge group. Compactifying F-theory on genus-one fibrations with multisections gives rise to discrete selection rules. In field theory the discrete symmetry is a broken U(1) symmetry. In the geometry the higgsing corresponds to a conifold transition. We explain in detail the origin of the discrete symmetry from two different M-theory phases and put the result into the context of torsion homology. Finally we systematically construct consistent gauge fluxes on genus-one fibrations and show that these induce an anomaly free chiral spectrum.
Residual Z{sub 2} symmetries and leptonic mixing patterns from finite discrete subgroups of U(3)
Energy Technology Data Exchange (ETDEWEB)
Joshipura, Anjan S. [Physical Research Laboratory,Navarangpura, Ahmedabad 380 009 (India); Patel, Ketan M. [Indian Institute of Science Education and Research, Mohali,Knowledge City, Sector 81, S A S Nagar, Manauli 140 306 (India)
2017-01-30
We study embedding of non-commuting Z{sub 2} and Z{sub m}, m≥3 symmetries in discrete subgroups (DSG) of U(3) and analytically work out the mixing patterns implied by the assumption that Z{sub 2} and Z{sub m} describe the residual symmetries of the neutrino and the charged lepton mass matrices respectively. Both Z{sub 2} and Z{sub m} are assumed to be subgroups of a larger discrete symmetry group G{sub f} possessing three dimensional faithful irreducible representation. The residual symmetries predict the magnitude of a column of the leptonic mixing matrix U{sub PMNS} which are studied here assuming G{sub f} as the DSG of SU(3) designated as type C and D and large number of DSG of U(3) which are not in SU(3). These include the known group series Σ(3n{sup 3}), T{sub n}(m), Δ(3n{sup 2},m), Δ(6n{sup 2},m) and Δ{sup ′}(6n{sup 2},j,k). It is shown that the predictions for a column of |U{sub PMNS}| in these group series and the C and D types of groups are all contained in the predictions of the Δ(6N{sup 2}) groups for some integer N. The Δ(6N{sup 2}) groups therefore represent a sufficient set of G{sub f} to obtain predictions of the residual symmetries Z{sub 2} and Z{sub m}.
Formation of the U.S. Air Force Aviator Post Traumatic Stress Disorder Study Group
2016-11-15
Wood, III, John Heaton, Mark Hubner, Nicole Rhodes 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION... Questionnaire -9 PIQ performance intelligence quotient PTSD post-traumatic stress disorder RPA remotely piloted aircraft USAF U.S. Air Force VIQ verbal intelligence quotient ...Human Performance Wing U.S. Air Force School of Aerospace Medicine Aerospace Medicine Department 2510 Fifth St., Bldg. 840 Wright-Patterson AFB, OH
Roselli, Marianna; Finamore, Alberto; Hynönen, Ulla; Palva, Airi; Mengheri, Elena
2016-09-29
The role of Lactobacillus cell wall components in the protection against pathogen infection in the gut is still largely unexplored. We have previously shown that L. amylovorus DSM 16698 T is able to reduce the enterotoxigenic F4 + Escherichia coli (ETEC) adhesion and prevent the pathogen-induced membrane barrier disruption through the regulation of IL-10 and IL-8 expression in intestinal cells. We have also demonstrated that L. amylovorus DSM 16698 T protects host cells through the inhibition of NF-kB signaling. In the present study, we investigated the role of L. amylovorus DSM 16698 T cell wall components in the protection against F4 + ETEC infection using the intestinal Caco-2 cell line. Purified cell wall fragments (CWF) from L. amylovorus DSM 16698 T were used either as such (uncoated, U-CWF) or coated with S-layer proteins (S-CWF). Differentiated Caco-2/TC7 cells on Transwell filters were infected with F4 + ETEC, treated with S-CWF or U-CWF, co-treated with S-CWF or U-CWF and F4 + ETEC for 2.5 h, or pre-treated with S-CWF or U-CWF for 1 h before F4 + ETEC addition. Tight junction (TJ) and adherens junction (AJ) proteins were analyzed by immunofluorescence and Western blot. Membrane permeability was determined by phenol red passage. Phosphorylated p65-NF-kB was measured by Western blot. We showed that both the pre-treatment with S-CWF and the co- treatment of S-CWF with the pathogen protected the cells from F4 + ETEC induced TJ and AJ injury, increased membrane permeability and activation of NF-kB expression. Moreover, the U-CWF pre-treatment, but not the co-treatment with F4 + ETEC, inhibited membrane damage and prevented NF-kB activation. The results indicate that the various components of L. amylovorus DSM 16698 T cell wall may counteract the damage caused by F4 + ETEC through different mechanisms. S-layer proteins are essential for maintaining membrane barrier function and for mounting an anti-inflammatory response against F4 + ETEC infection. U-CWF are
Seroprevalence of Epstein-Barr virus infection in U.S. children ages 6-19, 2003-2010.
Directory of Open Access Journals (Sweden)
Jennifer Beam Dowd
Full Text Available BACKGROUND: Epstein-Barr virus (EBV is a common herpesvirus linked to infectious mononucleosis and multiple cancers. There are no national estimates of EBV seroprevalence in the United States. Our objective was to estimate the overall prevalence and sociodemographic predictors of EBV among U.S. children and adolescents aged 6-19. METHODS: We calculated prevalence estimates and prevalence ratios for EBV seroprevalence using data from the 2003-2010 U.S. National Health and Nutrition Examination Survey (NHANES for children aged 6-19 (n = 8417. Poisson regression was used to calculate multivariable-adjusted prevalence ratios across subgroup categories (sex, race/ethnicity, parental education, household income, household size, foreign-born, BMI, and household smoking. FINDINGS: Overall EBV seroprevalence was 66.5% (95% CI 64.3%-68.7%.. Seroprevalence increased with age, ranging from 54.1% (95% CI 50.2%-57.9% for 6-8 year olds to 82.9% (95% CI 80.0%-85.9% for 18-19 year olds. Females had slightly higher seroprevalence (68.9%, 95% CI 66.3%-71.6% compared to males (64.2%, 95% CI 61.7%-66.8%. Seroprevalence was substantially higher for Mexican-Americans (85.4%, 95% CI 83.1%-87.8% and Non-Hispanic Blacks (83.1%, 95% CI 81.1%-85.1% than Non-Hispanic Whites (56.9%, 95% CI 54.1%-59.8%. Large differences were also seen by family income, with children in the lowest income quartile having 81.0% (95% CI 77.6%-84.5% seroprevalence compared to 53.9% (95% CI 50.5%-57.3% in the highest income quartile, with similar results for parental education level. These results were not explained by household size, BMI, or parental smoking. Among those who were seropositive, EBV antibody titers were significantly higher for females, Non-Hispanic Blacks and Mexican-Americans, with no association found for socioeconomic factors. CONCLUSIONS: In the first nationally representative U.S. estimates, we found substantial socioeconomic and race/ethnic differences in the
Lanthanide 4f-electron binding energies and the nephelauxetic effect in wide band gap compounds
International Nuclear Information System (INIS)
Dorenbos, Pieter
2013-01-01
Employing data from luminescence spectroscopy, the inter 4f-electron Coulomb repulsion energy U(6, A) in Eu 2+/3+ impurities together with the 5d-centroid energy shift ϵ c (1,3+,A) in Ce 3+ impurities in 40 different fluoride, chloride, bromide, iodide, oxide, sulfide, and nitride compounds has been determined. This work demonstrates that the chemical environment A affects the two energies in a similar fashion; a fashion that follows the anion nephelauxetic sequence F, O, Cl, Br, N, I, S, Se. One may then calculate U(6, A) from well established and accurate ϵ c (1,3+,A) values which are then used as input to the chemical shift model proposed in Dorenbos (2012) [19]. As output it provides the chemical shift of 4f-electron binding energy and therewith the 4f-electron binding energy relative to the vacuum energy. In addition this method provides a tool to routinely establish the binding energy of electrons at the top of the valence band (work function) and the bottom of the conduction band (electron affinity) throughout the entire family of inorganic compounds. How the electronic structure of the compound and lanthanide impurities therein change with type of compound and type of lanthanide is demonstrated. -- Highlights: ► A relationship between 5d centroid shift and 4f-electron Coulomb repulsion energy is established. ► Information on the absolute 4f-electron binding energy of lanthanides in 40 compounds is provided. ► A new tool to determine absolute binding energies of electrons in valence and conduction bands is demonstrated
TRENDS IN U.S. WHEAT-BASED FOOD CONSUMPTION: NUTRITION, CONVENIENCE, AND ETHNIC FOODS
Moutou, Christele; Brester, Gary W.
1998-01-01
This study identifies U.S. consumers' use of food nutrition labels on wheat-based foods; consumer attitudes toward the importance of taste, price, and nutrition in choosing wheat-based snack foods; and consumer knowledge of Middle-Eastern wheat-based foods. A survey of U.S. primary grocery shoppers indicated that most respondents believed it was important that their diets contained wheat-based food products. A majority of respondents indicated that fat content was the most important item on f...
U.S. Naval Academy Officials Did Not Adhere to Contracting and Gift Policies
2011-11-07
Report No. DODIG-2012-017 November 7, 2011 U.S. Naval Academy Officials Did Not Adhere to Contracting and Gift Policies...Contracting and Gift Policies 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK...HERITAGE AND HISTORY COMMAND SUBJECT: U.S. Naval Academy Officials Did Not Adhere to Contracting and Gift Policies (Report No. DODIG-2012-017) We are
Supersymmetric codimension-two branes and U(1)R mediation in 6D gauged supergravity
International Nuclear Information System (INIS)
Lee, Hyun Min
2008-01-01
We construct a consistent supersymmetric action for brane chiral and vector multiplets in a six-dimensional chiral gauged supergravity. A nonzero brane tension can be accommodated by allowing for a brane-localized Fayet-Iliopoulos term proportional to the brane tension. When the brane chiral multiplet is charged under the bulk U(1) R , we obtain a nontrivial coupling to the extra component of the U(1) R gauge field strength and a singular scalar self-interaction term. Dimensionally reducing to 4D on a football supersymmetric solution, we discuss the implication of such interactions for obtaining the U(1) R D-term in the 4D effective supergravity. By assuming the bulk gaugino condensates and nonzero brane F- and/or D-term for the uplifting potential, we have all the moduli stabilized with a vanishing cosmological constant. The brane scalar with nonzero R charge then gets a soft mass of order the gravitino mass. The overall sign of the soft mass squared depends on the sign of the R charge as well as whether the brane F- or D-term dominates.
Hidden selection rules, M5-instantons and fluxes in F-theory
Energy Technology Data Exchange (ETDEWEB)
Martucci, Luca [Dipartimento di Fisica e Astronomia ‘Galileo Galilei’, Università di Padova, & I.N.F.N. Sezione di Padova, via Marzolo 8, I-35131 Padova (Italy); Weigand, Timo [Institut für Theoretische Physik, Ruprecht-Karls-Universität, Philosophenweg 19, 69120 Heidelberg (Germany)
2015-10-21
We introduce a new approach to investigate the selection rules governing the contributions of fluxed M5-instantons to the F-theory four-dimensional effective action, with emphasis on the generation of charged matter F-terms. The structure of such couplings is unraveled by exploiting the perturbative and non-perturbative homological relations, introduced in our companion paper http://dx.doi.org/10.1007/JHEP09(2015)198, which encode the interplay between the self-dual 3-form flux on the M5-brane, the background 4-form flux and certain fibral curves. The latter are wrapped by time-like M2-branes representing matter insertions in the instanton path integral. In particular, we clarify how fluxed M5-instantons detect the presence of geometrically massive U(1)s which are responsible for ‘hidden’ selection rules. We discuss how for non-generic embeddings the M5-instanton can probe ‘locally massless’ U(1) symmetries if the rank of its Mordell-Weil group is enhanced compared to that of the bulk. As a phenomenological off-spring we propose a new type of non-perturbative corrections to Yukawa couplings which may change the rank of the Yukawa matrix. Along the way, we also gain new insights into the structure of massive U(1) gauge fluxes in the stable degeneration limit.
Obleschuk, Leslie C.
This lesson is based on the John F. Kennedy National Historic Site (Massachusetts), the birthplace of President John F. Kennedy. The lesson can be used as a biographical study, an introduction to the Kennedy presidency and the turbulent sixties, or as part of a unit on post-World War II U.S. history. Primary and secondary sources are included for…
Evaluation of [18F]-ATRi as PET tracer for in vivo imaging of ATR in mouse models of brain cancer
International Nuclear Information System (INIS)
Carlucci, Giuseppe; Carney, Brandon; Sadique, Ahmad; Vansteene, Axel; Tang, Jun; Reiner, Thomas
2017-01-01
Rationale: Ataxia telangiectasia and Rad3-related (ATR) threonine serine kinase is one of the key elements in orchestrating the DNA damage response (DDR). As such, inhibition of ATR can amplify the effects of chemo- and radiation-therapy, and several ATR inhibitors (ATRi) have already undergone clinical testing in cancer. For more accurate patient selection, monitoring and staging, real-time in vivo imaging of ATR could be invaluable; the development of appropriate imaging agents has remained a major challenge. Methods: 3-amino-N-(4-[ 18 F]phenyl)-6-(4-(methylsulfonyl)phenyl) pyrazine-2-carboxamide ([ 18 F]-ATRi), a close analogue of Ve-821, (a clinical ATRi candidate), was readily accomplished similarly to already established synthetic procedures. Structurally, 18 F was introduced at the 4-position of the aromatic ring of Ve-821 for generating a labeled ATR inhibitor. In vitro experiments were conducted in U251 MG glioblastoma cell lines and ex vivo biodistribution were performed in subcutaneous U251 MG xenograft bearing athymic nude mice following microPET imaging. Results: [ 18 F]-ATRi has a similar pharmacokinetic profile to that of Ve-821. Using an U251 MG glioblastoma mouse model, we evaluated the in vivo binding efficiency of [ 18 F]-ATRi. Blood and tumor showed a statistically significant difference between mice injected with only the probe or following blocking experiment with Ve-821 (1.48 ± 0.40%ID/g vs. 0.46 ± 0.12%ID/g in tumor and 1.85 ± 0.47%ID/g vs. 0.84 ± 0.3%ID/g in blood respectively). Conclusions: [ 18 F]-ATRi represents the first 18 F positron emission tomography (PET) ATR imaging agent, and is designed on a low nanomolar and clinically relevant ATR inhibitor.
Screening of nuclear structure function F2A(x,Q2) at small x values
International Nuclear Information System (INIS)
Davidovs'kij, V.V.
1999-01-01
The U-matrix method have been applied to build an amplitude for virtual photon absorption by nuclei which satisfies unitarity.This amplitude have been utilised to obtain the expression for the structure function F 2A ,which is convenient to perform analytical calculations with.Profile functions of nuclei with Gauss,Woods-Saxon and constant density distribution have been considered.It is shown that effects of quark-antiquark pair rescattering in nucleus cause the screening of F 2A and the change of power-like behaviour of F 2A to logarithmic one at small x. Numerical estimations are given
Influence of multidrug resistance on 18F-FCH cellular uptake in a glioblastoma model
International Nuclear Information System (INIS)
Vanpouille, Claire; Jeune, Nathalie le; Clotagatide, Anthony; Dubois, Francis; Kryza, David; Janier, Marc; Perek, Nathalie
2009-01-01
Multidrug resistance, aggressiveness and accelerated choline metabolism are hallmarks of malignancy and have motivated the development of new PET tracers like 18 F-FCH, an analogue of choline. Our aim was to study the relationship of multidrug resistance of cultured glioma cell lines and 18 F-FCH tracer uptake. We used an in vitro multidrug-resistant (MDR) glioma model composed of sensitive parental U87MG and derived resistant cells U87MG-CIS and U87MG-DOX. Aggressiveness, choline metabolism and transport were studied, particularly the expression of choline kinase (CK) and high-affinity choline transporter (CHT1). FCH transport studies were assessed in our glioblastoma model. As expected, the resistant cell lines express P-glycoprotein (Pgp), multidrug resistance-associated protein isoform 1 (MRP1) and elevated glutathione (GSH) content and are also more mobile and more invasive than the sensitive U87MG cells. Our results show an overexpression of CK and CHT1 in the resistant cell lines compared to the sensitive cell lines. We found an increased uptake of FCH (in % of uptake per 200,000 cells) in the resistant cells compared to the sensitive ones (U87MG: 0.89±0.14; U87MG-CIS: 1.27±0.18; U87MG-DOX: 1.33±0.13) in line with accelerated choline metabolism and aggressive phenotype. FCH uptake is not influenced by the two ATP-dependant efflux pumps: Pgp and MRP1. FCH would be an interesting probe for glioma imaging which would not be effluxed from the resistant cells by the classic MDR ABC transporters. Our results clearly show that FCH uptake reflects accelerated choline metabolism and is related to tumour aggressiveness and drug resistance. (orig.)
On hypercharge flux and exotics in F-theory GUTs
Dudas, Emilian; 10.1007
2010-01-01
We study SU(5) Grand Unified Theories within a local framework in F-theory with multiple extra U(1) symmetries arising from a small monodromy group. The use of hypercharge flux for doublet-triplet splitting implies massless exotics in the spectrum that are protected from obtaining a mass by the U(1) symmetries. We find that lifting the exotics by giving vacuum expectation values to some GUT singlets spontaneously breaks all the U(1) symmetries which implies that proton decay operators are induced. If we impose an additional R-parity symmetry by hand we find all the exotics can be lifted while proton decay operators are still forbidden. These models can retain the gauge coupling unification accuracy of the MSSM at 1-loop. For models where the generations are distributed across multiple curves we also present a motivation for the quark-lepton mass splittings at the GUT scale based on a Froggatt-Nielsen approach to flavour.
Directory of Open Access Journals (Sweden)
Issam Sellika
2016-10-01
Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d
Use of alpha spectrometry for analysis of U-isotopes in some granite samples
International Nuclear Information System (INIS)
El-Galy, M.M.; Desouky, O.A.; Khattab, M.R.; Issa, F.A.
2011-01-01
The present study aims to use the α-spectrometry, at NMA. A radiochemical technique for analysis of U-isotopes was carried out for some granite samples from Gabal Gattar and El Missikat localities and also for some reference soil samples of IAEA. Several steps of sample preparation, radiochemical separation, and source preparation were performed before analysis. The concerned sample was leached by HNO 3 , HF and H 2 O 2 acids after ashing. The ashed sample was spiked with uranium tracer ( 232 U) for chemical yield and activity calculation. Then uranium was extracted from the matrix elements with trioctylphosphine oxide (TOPO) and stripped with 1 M NH 4 F/0.1 M HCl solution. The uranium fraction was purified by co-precipitation with LaF 3 to ensure complete removal of thorium and traces of resolution degrading elements. This was followed by a final clean-up step using an anion exchange. The pure uranium fraction was electrodeposited on a stainless steel disc from HCl/oxalate solution. The obtained results from the soil reference samples indicate general similarities between the techniques of α-spectrometers of NMA, EAEA and IAEA for analysis of U-isotopes. The U-isotopes in the granite samples of high radioactivity levels need more attempts after dilution process to be in the limit detection of α-spectrometry. (author)
International Nuclear Information System (INIS)
Andreev, A.V.; Koyama, K.; Mushnikov, N.V.; Sechovsky, V.; Shiokawa, Y.; Satoh, I.; Watanabe, K.
2007-01-01
Substitution of Y for U in the itinerant 5f-electron metamagnet, UCoAl, transforms the system to a ferromagnetic state. Application of external hydrostatic pressure above 0.3 GPa suppresses the ferromagnetism and restores the 'UCoAl-type' metamagnetism back. However, the metamagnetic transition becomes of the second order instead of the first order one in parent UCoAl. This is attributed to enhancement of fluctuations of the U magnetic moment upon dilution of the U sublattice
Casteel, William J.; Dixon, David A.; Mercier, Hélène P. A.; Schrobilgen, Gary J.
1996-07-17
Osmium dioxide tetrafluoride, cis-OsO(2)F(4), reacts with the strong fluoride ion acceptors AsF(5) and SbF(5) in anhydrous HF and SbF(5) solutions to form orange salts. Raman spectra are consistent with the formation of the fluorine-bridged diosmium cation F(cis-OsO(2)F(3))(2)(+), as the AsF(6)(-) and Sb(2)F(11)(-) salts, respectively. The (19)F NMR spectra of the salts in HF solution are exchange-averaged singlets occurring at higher frequency than those of the fluorine environments of cis-OsO(2)F(4). The F(cis-OsO(2)F(3))(2)(+)Sb(2)F(11)(-) salt crystallizes in the orthorhombic space group Imma. At -107 degrees C, a = 12.838(3) Å, b = 10.667(2) Å, c = 11.323(2) Å, V = 1550.7(8) Å(3), and Z = 4. Refinement converged with R = 0.0469 [R(w) = 0.0500]. The crystal structure consists of discrete fluorine-bridged F(cis-OsO(2)F(3))(2)(+) and Sb(2)F(11)(-) ions in which the fluorine bridge of the F(cis-OsO(2)F(3))(2)(+) cation is trans to an oxygen atom (Os-O 1.676 Å) of each OsO(2)F(3) group. The angle at the bridge is 155.2(8) degrees with a bridging Os---F(b) distance of 2.086(3) Å. Two terminal fluorine atoms (Os-F 1.821 Å) are cis to the two oxygen atoms (Os-O 1.750 Å), and two terminal fluorine atoms of the OsO(2)F(3) group are trans to one another (1.813 Å). The OsO(2)F(3)(+) cation was characterized by (19)F NMR and by Raman spectroscopy in neat SbF(5) solution but was not isolable in the solid state. The NMR and Raman spectroscopic findings are consistent with a trigonal bipyramidal cation in which the oxygen atoms and a fluorine atom occupy the equatorial plane and two fluorine atoms are in axial positions. Density functional theory calculations show that the crystallographic structure of F(cis-OsO(2)F(3))(2)(+) is the energy-minimized structure and the energy-minimized structures of the OsO(2)F(3)(+) cation and ReO(2)F(3) are trigonal bipyramidal having C(2)(v)() point symmetry. Attempts to prepare the OsOF(5)(+) cation by oxidative fluorination of cis
Ab initio study of the diatomic fluorides FeF, CoF, NiF, and CuF.
Koukounas, Constantine; Mavridis, Aristides
2008-11-06
The late-3d transition-metal diatomic fluorides MF = FeF, CoF, NiF, and CuF have been studied using variational multireference (MRCI) and coupled-cluster [RCCSD(T)] methods, combined with large to very large basis sets. We examined a total of 35 (2S+1)|Lambda| states, constructing as well 29 full potential energy curves through the MRCI method. All examined states are ionic, diabatically correlating to M(+)+F(-)((1)S). Notwithstanding the "eccentric" character of the 3d transition metals and the difficulties to accurately be described with all-electron ab initio methods, our results are, in general, in very good agreement with available experimental numbers.
Gavillet, P.
2002-01-01
Inclusive production of two $(K\\bar K\\pi)^0$ states in the mass region 1.22--1.56 GeV in $Z$ decay at LEP I has been observed by the DELPHI Collaboration. The measured masses and widths are $1274\\pm4$ and $29\\pm12$ MeV for the first peak and $1426\\pm4$ and $51\\pm14$ MeV for the second. A partial-wave analysis has been performed on the $(K\\bar K\\pi)^0$ spectrum in this mass range; the first peak is consistent with the quantum numbers $I^G(J^{PC})=0^+(0^{-+}/1^{++})$ and the second with $I^G(J^{PC})=0^+(1^{++})$. These measurements, as well as their total hadronic production rates per hadronic $Z$ decay, are consistent with the mesons of the type $n\\bar n$, where $n=\\{u,d\\}$. They are very likely to be the $f_1(1285)$ and the $f_1(1420)$, respectively.
Feasibility study of LiF-BeF2 and chloride salts as blanket coolants for fusion power reactors
International Nuclear Information System (INIS)
Imamura, Y.
1977-09-01
The feasibility of using molten salts, in particular, nonberyllium-bearing chloride salts, as blanket coolants for Tokamak fusion reactors has been examined for the nucleonic and thermal/hydraulic aspects. It is concluded that the chloride salts, i.e., LiCl--KCl, LiCl--PbCl 2 and LiCl--SnCl 2 , can be used as the blanket coolant for a static lithium metal blanket provided that large blanket thickness can be tolerated, along with the use of U-238 for neutron multiplication in the cases of LiCl--KCl or LiCl--SnCl 2 cooled blankets. However, to make the appraisal complete, the tritium recovery and corrosion problems must be examined extensively, based on data not yet at hand. As for LiF--BeF 2 , it is observed that although the salt mixture can be used for a single fluid blanket with satisfactory nuclear performance, careful attention should be paid to the cooling capability
Elastic-constant systematics in f.c.c. metals, including lanthanides-actinides
Energy Technology Data Exchange (ETDEWEB)
Ledbetter, Hassel [Mechanical Engineering Department, University of Colorado, Boulder, Colorado 80309 (United States); Migliori, Albert [Los Alamos National Laboratory (E536), Los Alamos, New Mexico 87545 (United States)
2008-01-15
For f.c.c. metals, using Blackman's diagram of dimensionless elastic-constant ratios, we consider the systematics of physical properties and interatomic bonding. We focus especially on the lanthanides-actinides La, Ce, Yb, Th, U, Pu, those for which we know some monocrystal elastic constants. Their behavior differs from the other f.c.c. metals, and all except La show a negative Cauchy pressure, contrary to most f.c.c. metals, which show a positive Cauchy pressure. Among the lanthanides-actinides, {delta}-Pu stands apart, consistent with its many odd physical properties. Based on elastic-constant correlations, we suggest that {delta}-Pu possesses a strong s-electron interatomic-bonding component together with a covalent component. Elastically, {delta}-Pu shows properties similar to Yb. (copyright 2008 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Chiral phase transition of QCD with N{sub f}=2+1 flavors from holography
Energy Technology Data Exchange (ETDEWEB)
Li, Danning [Department of Physics, Jinan University,Guangzhou 510632 (China); Huang, Mei [Institute of High Energy Physics, Chinese Academy of Sciences,Beijing 100049 (China); University of Chinese Academy of Sciences,Beijing 100049 (China); Theoretical Physics Center for Science Facilities, Chinese Academy of Sciences,Beijing 100049 (China)
2017-02-08
Chiral phase transition for three-flavor N{sub f}=2+1 QCD with m{sub u}=m{sub d}≠m{sub s} is investigated in a modified soft-wall holographic QCD model. Solving temperature dependent chiral condensates from equations of motion of the modified soft-wall model, we extract the quark mass dependence of the order of chiral phase transition in the case of N{sub f}=2+1, and the result is in agreement with the “Columbia Plot”, which is summarized from lattice simulations and other non-perturbative methods. First order phase transition is observed around the three flavor chiral limit m{sub u/d}=0,m{sub s}=0, while at sufficient large quark masses it turns to be a crossover phase transition. The first order and crossover regions are separated by a second order phase transition line. The second order line is divided into two parts by the m{sub u/d}=m{sub s} line, and the m{sub s} dependence of the transition temperature in these two parts are totally contrast, which might indicate that the two parts are governed by different universality classes.
Atmospheric histories and growth trends of C4F10, C5F12, C6F14, C7F16 and C8F18
Directory of Open Access Journals (Sweden)
R. F. Weiss
2012-05-01
Full Text Available Atmospheric observations and trends are presented for the high molecular weight perfluorocarbons (PFCs: decafluorobutane (C4F10, dodecafluoropentane (C5F12, tetradecafluorohexane (C6F14, hexadecafluoroheptane (C7F16 and octadecafluorooctane (C8F18. Their atmospheric histories are based on measurements of 36 Northern Hemisphere and 46 Southern Hemisphere archived air samples collected between 1973 to 2011 using the Advanced Global Atmospheric Gases Experiment (AGAGE "Medusa" preconcentration gas chromatography-mass spectrometry systems. A new calibration scale was prepared for each PFC, with estimated accuracies of 6.8% for C4F10, 7.8% for C5F12, 4.0% for C6F14, 6.6% for C7F16 and 7.9% for C8F18. Based on our observations the 2011 globally averaged dry air mole fractions of these heavy PFCs are: 0.17 parts-per-trillion (ppt, i.e., parts per 1012 for C4F10, 0.12 ppt for C5F12, 0.27 ppt for C6F14, 0.12 ppt for C7F16 and 0.09 ppt for C8F18. These atmospheric mole fractions combine to contribute to a global average radiative forcing of 0.35 mW m−2, which is 6% of the total anthropogenic PFC radiative forcing (Montzka and Reimann, 2011; Oram et al., 2012. The growth rates of the heavy perfluorocarbons were largest in the late 1990s peaking at 6.2 parts per quadrillion (ppq, i.e., parts per 1015 per year (yr for C4F10, at 5.0 ppq yr−1 for C5F12 and 16.6 ppq yr−1 for C6F14 and in the early 1990s for C7F16 at 4.7 ppq yr−1 and in the mid 1990s for C8F18 at 4.8 ppq yr−1. The 2011 globally averaged mean atmospheric growth rates of these PFCs are subsequently lower at 2.2 ppq yr−1 for C4F10, 1.4 ppq yr−1 for C5F12, 5.0 ppq yr−1 for C6F14, 3.4 ppq yr−1 for C7F16 and 0.9 ppq yr−1 for C8F18. The more recent slowdown in the growth rates suggests that emissions are declining as compared to the 1980s and 1990s.
The ratio (fBs/fB)/(fDs/fD) and its implications for B-bar B mixing
International Nuclear Information System (INIS)
Grinstein, B.
1993-01-01
We observe that quantities like (f Bs /f B )/(f Ds /f D ) are predicted to be unity both by heavy quark and by light quark flavor symmetries. Hence, the deviation from the symmetry prediction must be simultaneously small in both symmetry breaking parameters, i.e., order of the ratio of light to heavy quark masses. We estimate the size of the correction. We observe that the ratio of (ΔM/Γ) for B s- bar Bs to B-bar B mixing can be expressed in terms of the measurable ratio f Ds /f D with good precision. We comment on applications of these ideas to other processes
Measurement of thermal neutron cross section for {sup 241}Am(n,f) reaction
Energy Technology Data Exchange (ETDEWEB)
Kobayashi, Katsuhei; Yamamoto, Shuji; Fujita, Yoshiaki [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst.; Miyoshi, Mitsuharu; Kimura, Itsuro; Kanno, Ikuo; Shinohara, Nobuo
1997-03-01
Making use of a standard neutron spectrum field with a pure Maxwellian distribution, the thermal neutron cross section for the {sup 241}Am(n,f) reaction has been measured relative to the reference value of 586.2b for the {sup 235U}(n,f) reaction. For the present measurement, electrodeposited layers of {sup 241}Am and {sup 235}U have been employed as back-to-back type double fission chambers. The present result at neutron energy of 0.0253 eV is 3.15 {+-} 0.097b. The ENDF/B-VI data is in good agreement with the present value, while the JENDL-3.2 data is lower by 4.2%. The evaluated data in JEF-2.2 and by Mughabghab are higher by 0.9% and 1.6%, respectively than the present result. The ratios of the earlier experimental data to the present value are distributed between 0.89 and 1.02. (author)
Rogachev, Andrey Yu.; Miao, Mao-sheng; Merino, Gabriel; Hoffmann, Roald
2015-01-01
D5h star-like CsF5, formally isoelectronic with known XeF5− ion, is computed to be a local minimum on the potential energy surface of CsF5, surrounded by reasonably large activation energies for its exothermic decomposition to CsF+2 F2, or to CsF3 (three isomeric forms)+F2, or for rearrangement to a significantly more stable isomer, a classical Cs+ complex of F5−. Similarly the CsF2+ ion is computed to be metastable in two isomeric forms. In the more symmetrical structures of these molecules there is definite involvement in bonding of the formally core 5p levels of Cs.
Rogachev, Andrey Yu.
2015-06-03
D5h star-like CsF5, formally isoelectronic with known XeF5− ion, is computed to be a local minimum on the potential energy surface of CsF5, surrounded by reasonably large activation energies for its exothermic decomposition to CsF+2 F2, or to CsF3 (three isomeric forms)+F2, or for rearrangement to a significantly more stable isomer, a classical Cs+ complex of F5−. Similarly the CsF2+ ion is computed to be metastable in two isomeric forms. In the more symmetrical structures of these molecules there is definite involvement in bonding of the formally core 5p levels of Cs.
Delayed neutron yield from fast neutron induced fission of 238U
International Nuclear Information System (INIS)
Piksaikin, V.M.; Kazakov, L.E.; Isaev, S.G.; Roshchenko, V.A.; Goverdovski, A.A.; Tertytchnyi, R.G.
2002-01-01
The measurements of the total delayed neutron yield from fast neutron induced fission of 238 U were made. The experimental method based on the periodic irradiation of the fissionable sample by neutrons from a suitable nuclear reaction had been employed. The preliminary results on the energy dependence of the total delayed neutron yield from fission of 238 U are obtained. According to the comparison of experimental data with our prediction based on correlation properties of delayed neutron characteristics, it is concluded that the value of the total delayed neutron yield near the threshold of (n,f) reaction is not a constant. (author)
Phenomenological implications of the flipped SU(5) x U(1) superstring model
Energy Technology Data Exchange (ETDEWEB)
Tamvakis, K. (Physics Dept., Univ. of Ioannina (Greece))
1991-07-01
We study in detail gauge symmetry breaking in the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSO(6) superstring model, solving the D and F-flatness conditions and taking into account quartic and quintic superpotential terms. We find that, to this order, the model describes two massive generations of quarks and leptons as well as a massless generation expected to receive naturally suppressed masses from higher order non-renormalizable terms. D and F-flatness restricts the number of massless isodoublets to four. We solve the coupled renormalization group equations for the gauge and Yukawa couplings in the two-loop approximation and obtain the top-quark mass as a function of two parameters of the model which could be chosen to be ratios of singlet v.e.v's associated with the surplus (U(1)){sup 4} breaking. We obtain a heavy top-quark with 150GeV {<=} m{sub 1} < 200GeV, for most part of the parameter space, while lower values are possible only in a very small extermal region. We also compute the allowed range of unification parameters (M{sub x}, sin{sup 2} {theta}{sub w}, {alpha}{sub 3}(M{sub w})) in the presence of a heavy top quark. (orig.).
The novel superacid systems HSO3F-Nb(SO3F)5 and HSO3F-Ta(SO3F)5
International Nuclear Information System (INIS)
Cicha, W.V.; Aubke, F.
1989-01-01
The in situ oxidation of niobium and tantalum in HSO 3 F by bis(fluorosulfuryl) peroxide, S 2 O 6 F 2 , results in the formation of solvated Lewis acids M(SO 3 F) 5 , M = Nb or Ta. Both solutes behave as moderately strong, monoprotonic acids, based on electrical conductivity measurements over the concentration range 0-0.05 m and on conductometric titrations against KSO 3 F. These measurements suggest a general order of acidity, Au(SO 3 F) 3 > Ta(SO 3 F) 5 ≥ SbF 5 > Nb(SO 3 F) 5 > NbF 5 , all giving rise to monoprotonic acids. Supporting evidence comes from 1 H, 19 F, and 93 Nb NMR spectroscopy and the successful isolation and characterization of complexes of the type Cs n [M(SO 3 F) 5+n ], with M = Nb or Ta and n = 1 or 2, from these solutions
Dynamic polarisation of nuclei
International Nuclear Information System (INIS)
Borghini, M.; Abragam, A.
1961-01-01
In magnetic fields of about 13000 gauss, at a temperature of 1.5 deg. K, in samples of about 2 mm 3 , we have obtained by the 'solid effect' (application of a magnetic field at an appropriate frequency around 35000 MHz), nuclear polarizations /I of a few percent: 19 per cent for hydrogen nuclei in single crystals of La 2 Mg 3 (NO 3 ) 12 , 24H 2 O; 5 per cent for hydrogen nuclei in polystyrene; 6 per cent for fluorine nuclei in single crystals of LiF. (author) [fr
2016-03-01
standard practice is to deflate costs to constant dollars (the dependent variable in the analogous regression) using a previously determined price ...I N S T I T U T E F O R D E F E N S E A N A L Y S E S IDA Document D-5489 March 2016 The Role of Inflation and Price Escalation Adjustments in...DFARS 252.227-7013 (a)(16) [Jun 2013]. The Role of Inflation and Price Escalation Adjustments in Properly Estimating Program Costs: F-35 Case Study
Nuclear instrumentation in VENUS-F
Wagemans, J.; Borms, L.; Kochetkov, A.; Krása, A.; Van Grieken, C.; Vittiglio, G.
2018-01-01
VENUS-F is a fast zero power reactor with 30 wt% U fuel and Pb/Bi as a coolant simulator. Depending on the experimental configuration, various neutron spectra (fast, epithermal, and thermal islands) are present. This paper gives a review of the nuclear instrumentation that is applied for reactor control and in a large variety of physics experiments. Activation foils and fission chambers are used to measure spatial neutron flux profiles, spectrum indices, reactivity effects (with positive period and compensation method or the MSM method) and kinetic parameters (with the Rossi-alpha method). Fission chamber calibrations are performed in the standard irradiation fields of the BR1 reactor (prompt fission neutron spectrum and Maxwellian thermal neutron spectrum).
Dicty_cDB: Contig-U10389-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available oxylase-lik... 46 2e-05 2 ( BI742499 ) kt51f12.y4 Strongyloides ratti L1 pAMP1 v3 Chiape... 48 4e-05 2 ( CD147...0014 Schistosoma manso... 46 4e-05 3 ( CD147604 ) ML1-0007T-V110-D04-U.B ML1-0007 Schistosoma manso... 46 4e
The 235U Prompt Fission Neutron Spectrum in the BR1 Reactor at SCK•CEN
Wagemans, Jan; Malambu, Edouard; Borms, Luc; Fiorito, Luca
2016-02-01
The BR1 research reactor at SCK•CEN has a spherical cavity in the graphite above the reactor core. In this cavity an accurately characterised Maxwellian thermal neutron field is present. Different converters can be loaded in the cavity in order to obtain other types of neutron (and gamma) irradiation fields. Inside the so-called MARK III converter a fast 235U(n,f) prompt fission neutron field can be obtained. With the support of MCNP calculations, irradiations in MARK III can be directly related to the pure 235U(n,f) prompt fission neutron spectrum. For this purpose MARK III spectrum averaged cross sections for the most relevant fluence dosimetry reactions have been determined. A calibration factor for absolute measurements has been determined applying activation dosimetry following ISO/IEC 17025 standards.
The 235U Prompt Fission Neutron Spectrum in the BR1 Reactor at SCK•CEN
Directory of Open Access Journals (Sweden)
Wagemans Jan
2016-01-01
Full Text Available The BR1 research reactor at SCK•CEN has a spherical cavity in the graphite above the reactor core. In this cavity an accurately characterised Maxwellian thermal neutron field is present. Different converters can be loaded in the cavity in order to obtain other types of neutron (and gamma irradiation fields. Inside the so-called MARK III converter a fast 235U(n,f prompt fission neutron field can be obtained. With the support of MCNP calculations, irradiations in MARK III can be directly related to the pure 235U(n,f prompt fission neutron spectrum. For this purpose MARK III spectrum averaged cross sections for the most relevant fluence dosimetry reactions have been determined. A calibration factor for absolute measurements has been determined applying activation dosimetry following ISO/IEC 17025 standards.
Isotope shift of 234U, 236U, 238U in U I
International Nuclear Information System (INIS)
Gagne, J.M.; Nguyen Van, S.; Saint-Dizier, J.P.; Pianarosa, P.
1976-01-01
New and very accurate data of isotope shifts and relative isotope shifts in 234 U, 236 U, 238 U are presented. The invariance of the relative isotope shift, for the transitions we have investigated, supports the hypothesis that the so called specific mass effect is negligible in uranium
Spencer, Liam P; Yang, Ping; Minasian, Stefan G; Jilek, Robert E; Batista, Enrique R; Boland, Kevin S; Boncella, James M; Conradson, Steven D; Clark, David L; Hayton, Trevor W; Kozimor, Stosh A; Martin, Richard L; MacInnes, Molly M; Olson, Angela C; Scott, Brian L; Shuh, David K; Wilkerson, Marianne P
2013-02-13
Synthetic routes to salts containing uranium bis-imido tetrahalide anions [U(NR)(2)X(4)](2-) (X = Cl(-), Br(-)) and non-coordinating NEt(4)(+) and PPh(4)(+) countercations are reported. In general, these compounds can be prepared from U(NR)(2)I(2)(THF)(x) (x = 2 and R = (t)Bu, Ph; x = 3 and R = Me) upon addition of excess halide. In addition to providing stable coordination complexes with Cl(-), the [U(NMe)(2)](2+) cation also reacts with Br(-) to form stable [NEt(4)](2)[U(NMe)(2)Br(4)] complexes. These materials were used as a platform to compare electronic structure and bonding in [U(NR)(2)](2+) with [UO(2)](2+). Specifically, Cl K-edge X-ray absorption spectroscopy (XAS) and both ground-state and time-dependent hybrid density functional theory (DFT and TDDFT) were used to probe U-Cl bonding interactions in [PPh(4)](2)[U(N(t)Bu)(2)Cl(4)] and [PPh(4)](2)[UO(2)Cl(4)]. The DFT and XAS results show the total amount of Cl 3p character mixed with the U 5f orbitals was roughly 7-10% per U-Cl bond for both compounds, which shows that moving from oxo to imido has little effect on orbital mixing between the U 5f and equatorial Cl 3p orbitals. The results are presented in the context of recent Cl K-edge XAS and DFT studies on other hexavalent uranium chloride systems with fewer oxo or imido ligands.
Electronic structure of the actinide-Rh3 systems and the 5f localization in UPd3
DEFF Research Database (Denmark)
Eriksson, Olle; Johansson, Börje; Brooks, M. S. S.
1989-01-01
We present electronic-structure calculations for the isostructural (AuCu3-structure) series of intermetallic compounds ARh3 (A=Ac, Th, Pa, U, Np, Pu, Am, and Cm). The calculations were performed using both the scalar relativistic and the fully relativistic linear muffin-tin orbital (LMTO) method........ The localization of the 5f electrons in UPd3 as opposed to the itinerant 5f behavior for the earlier compounds (UMo3, UTc3 , URu3, and URh3) is explained in terms of the variation of the hybridization between 5f and ligand 4d states through the series....
Combined 18F-NaF and 18F-FDG PET/CT in the Evaluation of Sarcoma Patients.
Jackson, Tatianie; Mosci, Camila; von Eyben, Rie; Mittra, Erik; Ganjoo, Kristen; Biswal, Sandip; Gambhir, Sanjiv Sam; Iagaru, Andrei
2015-09-01
The combined administration of F-NaF and F-FDG in a single PET/CT scan has the potential to improve patient convenience and cancer detection. Here we report the use of this approach for patients with sarcomas. This is a retrospective review of 21 patients (12 men, 9 women; age, 19-66 years) with biopsy-proven sarcomas who had separate F-NaF PET/CT, F-FDG PET/CT, and combined F-NaF/F-FDG PET/CT scans for evaluation of malignancy. Two board-certified nuclear medicine physicians and 1 board-certified musculoskeletal radiologist were randomly assigned to review the scans. Results were analyzed for sensitivity and specificity, using linear regression and receiver operating characteristics. A total of 13 patients had metastatic disease on F-NaF PET/CT, F-FDG PET/CT, and combined F-NaF/F-FDG PET/CT. Skeletal disease was more extensive on the F-NaF PET/CT scan than on the F-FDG PET/CT in 3 patients, whereas in 1 patient, F-FDG PET/CT showed skeletal disease and the F-NaF PET/CT was negative. Extraskeletal lesions were detected on both F-FDG and combined F-NaF/F-FDG PET/CT in 20 patients, with 1 discordant finding in the lung. The combined F-NaF/F-FDG PET/CT scan allows for accurate evaluation of sarcoma patients. Further evaluation of this proposed imaging modality is warranted to identify the most suitable clinical scenarios, including initial treatment strategy and evaluation of response to therapy.
XPS study of U, UNi5, UCu5 and UNisub(0.5)Cusub(4.5)
International Nuclear Information System (INIS)
Grohs, H.; Hoechst, H.; Steiner, P.; Huefner, S.; Buschow, K.H.J.
1980-01-01
Core and valence band spectra of U metal and the intermetallic compounds UNi 5 , UCu 5 and UNisub(0.5)Cusub(4.5) have been measured by X-ray excited photoelectron spectroscopy (XPS). The data indicate that in UNi 5 the configuration is 5f 3 , and in UCu 5 and UNisub(0.5)Cusub(4.5) a mixed valence configuration with fewer 5f electrons than in UNi 5 is present. (author)
Poverty, disability and welfare Fátækt,fötlun og velferð
Directory of Open Access Journals (Sweden)
James G. Rice
2011-12-01
ð fyrirliggjandi gögn sýni að fatlað fólk sé líklegra en ófatlað til að vera fátækt hafa fáar rannsóknir beinst að samspili fötlunar og fátæktar. Markmið rannsóknanna sem hér er greint frá var að afla þekkingar á félagslegum og fjárhagslegum aðstæðum fatlaðs fólks og öryrkja með áherslu á að öðlast skilning á daglegri reynslu og sjónarhorni fólksins sjálfs. Beitt var eigindlegum aðferðum, einstaklingsviðtölum og rýnihópaviðtölum. Þátttakendur voru alls um 80, fjölbreyttur hópur með tilliti til aldurs, skerðingar, fjölskylduaðstæðna, búsetu, menntunar og fleiri þátta. Niðurstöður sýna að þátttakendur bjuggu við þröngan kost, margir áttu erfitt með að uppfylla brýnustu þarfir sínar og fjölskyldunnar og börðust við að falla ekki í fátækt. Fólk sýndi mikla útsjónarsemi við að lifa af á örorkubótum. Þrátt fyrir það var erfitt eða ómögulegt fyrir flesta að leggja fyrir til að eiga varasjóð en það er lykilatriði til að takast á við óvænt áföll og útgjöld. Þegar í harðbakka sló leituðu þátttakendur aðstoðar í félagslegu tengslaneti sínu, oftast til fjölskyldu, og ljóst er að gagnkvæm stuðningstengsl gátu skipt miklu um afkomu fólks. Þær erfiðu fjárhagslegu og félagslegu aðstæður sem flestir bjuggu við sköpuðu álag, kvíða og streitu sem höfðu neikvæð áhrif á líðan og heilsufar. Mikilvægt er að aðgerðir stjórnvalda til að sporna við fátækt byggist á þekkingu á aðstæðum fólks og þeim flóknu ferlum sem eru að verki þar sem fátækt og fötlun mætast.
Directory of Open Access Journals (Sweden)
Angela N Brooks
Full Text Available Although recurrent somatic mutations in the splicing factor U2AF1 (also known as U2AF35 have been identified in multiple cancer types, the effects of these mutations on the cancer transcriptome have yet to be fully elucidated. Here, we identified splicing alterations associated with U2AF1 mutations across distinct cancers using DNA and RNA sequencing data from The Cancer Genome Atlas (TCGA. Using RNA-Seq data from 182 lung adenocarcinomas and 167 acute myeloid leukemias (AML, in which U2AF1 is somatically mutated in 3-4% of cases, we identified 131 and 369 splicing alterations, respectively, that were significantly associated with U2AF1 mutation. Of these, 30 splicing alterations were statistically significant in both lung adenocarcinoma and AML, including three genes in the Cancer Gene Census, CTNNB1, CHCHD7, and PICALM. Cell line experiments expressing U2AF1 S34F in HeLa cells and in 293T cells provide further support that these altered splicing events are caused by U2AF1 mutation. Consistent with the function of U2AF1 in 3' splice site recognition, we found that S34F/Y mutations cause preferences for CAG over UAG 3' splice site sequences. This report demonstrates consistent effects of U2AF1 mutation on splicing in distinct cancer cell types.
Directory of Open Access Journals (Sweden)
Ali ARSLAN
2015-07-01
Full Text Available The Prophet (p b u h is an ideal sample for Muslims in all areas of life as well as in sport. In terms of our subject, for the animals which will be used for a race som e principles must be considered. It is forbidden to mistreat animals and to say them bad words. It is necessary to take pity on animals. Therefore, to fight animals in the races and to make them target, is prohibited by the Prophet ( p b u h because of the ir rights as a living being.
McInnes, B.; Danišík, M.; Evans, N.; McDonald, B.; Becker, T.; Vermeesch, P.
2015-12-01
We present a new laser-based technique for rapid, quantitative and automated in situ microanalysis of U, Th, Sm, Pb and He for applications in geochronology, thermochronometry and geochemistry (Evans et al., 2015). This novel capability permits a detailed interrogation of the time-temperature history of rocks containing apatite, zircon and other accessory phases by providing both (U-Th-Sm)/He and U-Pb ages (+trace element analysis) on single crystals. In situ laser microanalysis offers several advantages over conventional bulk crystal methods in terms of safety, cost, productivity and spatial resolution. We developed and integrated a suite of analytical instruments including a 193 nm ArF excimer laser system (RESOlution M-50A-LR), a quadrupole ICP-MS (Agilent 7700s), an Alphachron helium mass spectrometry system and swappable flow-through and ultra-high vacuum analytical chambers. The analytical protocols include the following steps: mounting/polishing in PFA Teflon using methods similar to those adopted for fission track etching; laser He extraction and analysis using a 2 s ablation at 5 Hz and 2-3 J/cm2fluence; He pit volume measurement using atomic force microscopy, and U-Th-Sm-Pb (plus optional trace element) analysis using traditional laser ablation methods. The major analytical challenges for apatite include the low U, Th and He contents relative to zircon and the elevated common Pb content. On the other hand, apatite typically has less extreme and less complex zoning of parent isotopes (primarily U and Th). A freeware application has been developed for determining (U-Th-Sm)/He ages from the raw analytical data and Iolite software was used for U-Pb age and trace element determination. In situ double-dating has successfully replicated conventional U-Pb and (U-Th)/He age variations in xenocrystic zircon from the diamondiferous Ellendale lamproite pipe, Western Australia and increased zircon analytical throughput by a factor of 50 over conventional methods
Bridging the gap between quantum Monte Carlo and F12-methods
International Nuclear Information System (INIS)
Chinnamsetty, Sambasiva Rao; Luo, Hongjun; Hackbusch, Wolfgang; Flad, Heinz-Jürgen; Uschmajew, André
2012-01-01
Graphical abstract: Tensor product approximation of pair-correlation functions: τ(x,y)≈∑ κ=1 κ u k (1) (x 1 ,y 1 )u k (2) (x 2 ,y 2 )u k (3) (x 3 ,y 3 ) Pair-correlation function τ(x,y)∣ ∣x·y∣=∣x∣∣y∣ of the He atom and corresponding tensor product approximation errors. Display Omitted - Abstract: Tensor product approximation of pair-correlation functions opens a new route from quantum Monte Carlo (QMC) to explicitly correlated F12 methods. Thereby one benefits from stochastic optimization techniques used in QMC to get optimal pair-correlation functions which typically recover more than 85% of the total correlation energy. Our approach incorporates, in particular, core and core-valence correlation which are poorly described by homogeneous and isotropic ansatz functions usually applied in F12 calculations. We demonstrate the performance of the tensor product approximation by applications to atoms and small molecules. It turns out that the canonical tensor format is especially suitable for the efficient computation of two- and three-electron integrals required by explicitly correlated methods. The algorithm uses a decomposition of three-electron integrals, originally introduced by Boys and Handy and further elaborated by Ten-no in his 3d numerical quadrature scheme, which enables efficient computations in the tensor format. Furthermore, our method includes the adaptive wavelet approximation of tensor components where convergence rates are given in the framework of best N-term approximation theory.
Kuldkepp, Mart, 1983-
2015-01-01
Arvustus: Auf Wache für die Nation : Erinnerungen der Weltkriegsagent Juozas Gabrys berichtet (1911-1918). Hrsg. von Eberhard Demm und Christina Nikolajew. Verlag Peter Land. Frankfurt am Main u.a. 2013
Measurement of gamma-ray multiplicity spectra and the alpha value for {sup 235}U resonances
Energy Technology Data Exchange (ETDEWEB)
Grigor` ev, Yu V [Institute of Physics and Power Engineering, Obninsk (Russian Federation); Georgiev, G P; Stanchik, Kh [Joint Inst. for Nuclear Research, Dubna (Russian Federation)
1997-06-01
Gamma spectra from 1 to 12 multiplicity were measured on th 500 m flight path of the IBR-30 reactor using a 16-section 32 L NaI(Tl) crystal scintillation detector able to hold 2 metallic samples of 90% {sup 235}U and 10% {sup 238}U 0.00137 atoms/b and 0.00411 atoms/b thick. Multiplicity spectra were obtained for resolved resonances in the E = 1-150 eV energy region. They were used to determine the value of {alpha} = {sigma}{sub {gamma}}/{sigma}{sub f} for 165 resonances of {sup 235}U. (author). 6 refs, 7 figs, 1 tab.
11 CFR 112.1 - Requests for advisory opinions (2 U.S.C. 437f(a)(1)).
2010-01-01
... situation, or regarding the activities of third parties, do not qualify as advisory opinion requests. (c... Election Commission, Office of General Counsel, 999 E Street, NW., Washington, DC 20463. (f) Upon receipt...
F-door spaces and F-submaximal spaces
Directory of Open Access Journals (Sweden)
Lobna Dridi
2013-04-01
Full Text Available Submaximal spaces and door spaces play an enigmatic role in topology. In this paper, reinforcing this role, we are concerned with reaching two main goals: The first one is to characterize topological spaces X such that F(X is a submaximal space (resp., door space for some covariant functor Ff rom the category Top to itself. T0, and FH functors are completely studied. Secondly, our interest is directed towards the characterization of maps f given by a flow (X, f in the category Set, such that (X,P(f is submaximal (resp., door where P(f is a topology on X whose closed sets are exactly the f-invariant sets.
Guo, Jinxia; Guo, Ning; Lang, Lixin; Kiesewetter, Dale O; Xie, Qingguo; Li, Quanzheng; Eden, Henry S; Niu, Gang; Chen, Xiaoyuan
2014-01-01
A single dynamic PET acquisition using multiple tracers administered closely in time could provide valuable complementary information about a tumor's status under quasiconstant conditions. This study aimed to investigate the utility of dual-tracer dynamic PET imaging with (18)F-alfatide II ((18)F-AlF-NOTA-E[PEG4-c(RGDfk)]2) and (18)F-FDG for parametric monitoring of tumor responses to therapy. We administered doxorubicin to one group of athymic nude mice with U87MG tumors and paclitaxel protein-bound particles to another group of mice with MDA-MB-435 tumors. To monitor therapeutic responses, we performed dual-tracer dynamic imaging, in sessions that lasted 90 min, starting with injection via the tail vein catheters with (18)F-alfatide II, followed 40 min later by (18)F-FDG. To achieve signal separation of the 2 tracers, we fit a 3-compartment reversible model to the time-activity curve of (18)F-alfatide II for the 40 min before (18)F-FDG injection and then extrapolated to 90 min. The (18)F-FDG tumor time-activity curve was isolated from the 90-min dual-tracer tumor time-activity curve by subtracting the fitted (18)F-alfatide II tumor time-activity curve. With separated tumor time-activity curves, the (18)F-alfatide II binding potential (Bp = k3/k4) and volume of distribution (VD) and (18)F-FDG influx rate ((K1 × k3)/(k2 + k3)) based on the Patlak method were calculated to validate the signal recovery in a comparison with 60-min single-tracer imaging and to monitor therapeutic response. The transport and binding rate parameters K1-k3 of (18)F-alfatide II, calculated from the first 40 min of the dual-tracer dynamic scan, as well as Bp and VD correlated well with the parameters from the 60-min single-tracer scan (R(2) > 0.95). Compared with the results of single-tracer PET imaging, (18)F-FDG tumor uptake and influx were recovered well from dual-tracer imaging. On doxorubicin treatment, whereas no significant changes in static tracer uptake values of (18)F-alfatide II
Ford F250 Dedicated CNG Pickup
International Nuclear Information System (INIS)
Eudy, Leslie
1999-01-01
The U.S. Department of Energy (DOE) is encouraging the use of alternative fuels and alternative fuel vehicles (AFVs). To support this activity, DOE has directed the National Renewable Energy Laboratory (NREL) to conduct projects to evaluate the performance and acceptability of light-duty AFVs. In this study, we tested a pair of 1998 Ford F-250 pickups: one dedicated compressed natural gas (CNG) model and a gasoline model as closely matched as possible. Each vehicle was run through a series of tests to evaluate acceleration, fuel economy, braking, and cold-start capabilities, as well as more subjective performance indicators such as handling, climate control, and noise
Energy Technology Data Exchange (ETDEWEB)
Lell, R. M.; McKnight, R. D; Schaefer, R. W.; Nuclear Engineering Division
2010-09-30
Over a period of 30 years, more than a hundred Zero Power Reactor (ZPR) critical assemblies were constructed at Argonne National Laboratory. The ZPR facilities, ZPR-3, ZPR-6, ZPR-9 and ZPPR, were all fast critical assembly facilities. The ZPR critical assemblies were constructed to support fast reactor development, but data from some of these assemblies are also well suited for nuclear data validation and to form the basis for criticality safety benchmarks. A number of the Argonne ZPR/ZPPR critical assemblies have been evaluated as ICSBEP and IRPhEP benchmarks. Of the three classes of ZPR assemblies, engineering mockups, engineering benchmarks and physics benchmarks, the last group tends to be most useful for criticality safety. Because physics benchmarks were designed to test fast reactor physics data and methods, they were as simple as possible in geometry and composition. The principal fissile species was {sup 235}U or {sup 239}Pu. Fuel enrichments ranged from 9% to 95%. Often there were only one or two main core diluent materials, such as aluminum, graphite, iron, sodium or stainless steel. The cores were reflected (and insulated from room return effects) by one or two layers of materials such as depleted uranium, lead or stainless steel. Despite their more complex nature, a small number of assemblies from the other two classes would make useful criticality safety benchmarks because they have features related to criticality safety issues, such as reflection by soil-like material. ZPR-3 Assembly 6 consisted of six phases, A through F. In each phase a critical configuration was constructed to simulate a very simple shape such as a slab, cylinder or sphere that could be analyzed with the limited analytical tools available in the 1950s. In each case the configuration consisted of a core region of metal plates surrounded by a thick depleted uranium metal reflector. The average compositions of the core configurations were essentially identical in phases A - F. ZPR-3
International Nuclear Information System (INIS)
Freitas, P.P.; Plaskett, T.S.; Moreira, J.M.; Amaral, V.S.
1988-01-01
We describe the competing magnetic, localization, and phonon effects on the transport properties of amorphous magnetic U/sub x/T/sub 1-//sub x/ films, with T = Fe, Ni, Gd, Tb, and Yb. Amorphous U/sub x/Fe/sub 1-//sub x/ films change from collinear to random ferromagnetism as x increases, and the temperature dependence of the resistivity denotes the competing effects of spin-flip and non-spin-flip exchange scattering processes. The resistivity has a minimum at T/sub f/ rising sharply below this temperature. The sign of the magnetic resistivity and the magnetoresistance indicates >0, while the anisotropic magnetoresistance indicates a local exchange gap. Amorphous U/sub x/Gd/sub 1-//sub x/ and a-U/sub x/Tb/sub 1-//sub x/ are, respectively, spin glasses and random anisotropy dominated systems. The resistivity increases smoothly through T/sub f/ and has a slight upturn at low temperatures that we associate with weak localization. The magnetoresistance is negative in both systems and the anisotropic magnetoresistance is null, although the applied field induces anisotropic behavior in the Tb containing films (asperomagnets). All samples show quadratic and positive field dependence of magnetoresistance well inside the paramagnetic regime, and a linear regime below T/sub f/. At low temperatures and in the a-U/sub x/Gd/sub 1-//sub x/ films, negative (H)/sup 1/2/ and H 2 regimes occur and are associated with weak localization processes dominated by the inelastic mean free path
A status report of the QCDSF N{sub f}=2+1 project
Energy Technology Data Exchange (ETDEWEB)
Goeckeler, Meinulf [Regensburg Univ. (Germany). Inst. fuer Theoretische Physik; Horsley, Roger [Edinburgh Univ. (United Kingdom). School of Physics; Nakamura, Yoshifumi [DESY, Zeuthen (DE). John von Neumann Institute NIC] (and others)
2007-12-20
We report about on-going simulations of N{sub f}=2+1 lattice QCD. We use a tadpole improved Symanzik gauge action and stout link smeared Wilson fermions with a clover term. We employ the Hasenbusch trick for the degenerate u- and d-quarks, and the RHMC algorithm for the simulation of the strange quark. (orig.)
Wiesbaden AB, Germany, Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F
1972-08-16
temperatures, extreme maximum and miinimum temperatures, psychrometric sunmmary of wet-bulb temperature depression versusI dry-bulb temperature._means...14 5.1 033 MA us3 s , 33 *,~76, ~ ____ 6 5 410-0 U~i 4 6 it" 4! - 4 0 4 fl? 2 . a354,,-S 35W 11-44*0 - 3 5i f 4F1 5fu 7. 1,i 2 62M e a * _ 601_...body of the -ummary consists of a bivariate percentage frequeucy distribution of wet-bulb depression in 17 classes anread horisontally; by 2-degree
Homestead AFB, Florida Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.
1984-09-01
TEMPERATURE DEPRESION (P) _ TOTAL. TOTAL IF) 0 1.2 3-4 1 5- 7.6 19-10 11-1 12 -14 IS- 10 17 -i8 It-20121-22 23-24 2S.3627. S 294-01 hJ3-02W.U- o,,m61b Wo...I 1ll91 T.pWIT SULIS TIMPURATURN DEPRESION (F) TOTAL TOTAL (F) 0 1.2 3.-4 15.6 7. - 0- 0 132Oi $.16212223-24 25 2 S 2 . 2- .31 .AdW11. My O 11S.IbfvWS
Energy Technology Data Exchange (ETDEWEB)
Christl, Marcus, E-mail: mchristl@ethz.ch [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Casacuberta, Nuria; Lachner, Johannes; Maxeiner, Sascha; Vockenhuber, Christof; Synal, Hans-Arno [Laboratory of Ion Beam Physics, ETH Zurich, 8093 Zurich (Switzerland); Goroncy, Ingo; Herrmann, Jürgen [Bundesamt für Seeschifffahrt und Hydrographie, Hamburg (Germany); Daraoui, Abdelouahed; Walther, Clemens; Michel, Rolf [Institut für Radioökologie und Strahlenschutz, Leibniz Universität Hannover (Germany)
2015-10-15
Compact, low energy accelerator mass spectrometry (AMS) has evolved over the past years as one of the most sensitive, selective, and robust techniques for the analysis of heavy and long lived radionuclides. In this study, we will first focus on the analytical capabilities of the compact AMS system TANDY, mainly for {sup 236}U analyses, and then present a new dual tracer approach, that combines {sup 129}I and {sup 236}U. The measured {sup 129}I/{sup 236}U ratios of samples collected in the North Sea in 2009 are in reasonable agreement with the expectations from documented or estimated releases from the two major nuclear reprocessing plants located at Sellafield (GB) and La Hague (F), suggesting that the {sup 129}I/{sup 236}U ratio can be used as a water mass tag in the North Atlantic region. However, our results indicate that, in contrast to {sup 129}I, additional contributions of bomb produced {sup 236}U cannot be neglected in the North Sea region. This complicates the simple and straight forward use of the {sup 129}I/{sup 236}U ratio as a quantitative tool for the calculation of transport times of North Sea water in the Arctic Ocean.
Diagnosing neuroleukemiosis: Is there a role for 18F-FDG-PET/CT?
Sabaté-Llobera, A; Cortés-Romera, M; Gamundí-Grimalt, E; Sánchez-Fernández, J J; Rodríguez-Bel, L; Gámez-Cenzano, C
An imaging case is presented on a patient referred to our department for an 18 F-FDG-PET/CT, as a paraneoplastic syndrome was suspected due to his clinical situation. He had a history of acute myeloid leukemia (AML) treated two years earlier, with sustained complete remission to date. 18 F-FDG-PET/CT findings revealed hypermetabolism in almost all nerve roots, suggesting meningeal spread, consistent with the subsequent MRI findings. Cerebrospinal fluid (CSF) findings confirmed a leptomeningeal reactivation of AML. Although not many studies have evaluated the role of 18 F-FDG-PET/CT in leukemia, it is a noninvasive tool for detecting extramedullary sites of disease and a good imaging alternative for those patients on whom an MRI cannot be performed. Copyright © 2017 Elsevier España, S.L.U. y SEMNIM. All rights reserved.
International Nuclear Information System (INIS)
Gollnick, P.D.
1986-01-01
19 F NMR was used to study E. coli tRNA 1 /sup Val/, tRNA/sub f//sup Met/, and tRNA/sub m//Met/, in which 5-fluorouracil (FUra) has replaced uracil and uracil-derived minor bases. 19 F NMR spectra of these tRNAs resolve resonances from nearly all the incorporated FUra residues. Each of the three tRNAs can be resolved into two isoaccepting species, termed forms A and B, whose 19 F spectra differ in the shift of one 19 F peak from ca. 4.5 ppm in form B, upfield to -15 ppm in form A. Because the two isoacceptors of each tRNA differ only at one position, the peaks at 4.5 ppm in the spectra of (FUra)tRNA 1 /sup Val/ and (FUra)tRNA/sub m//sup Met/; are assigned to FUra 17 and Fura 20 respectively. Bisulfate modification and pH dependence indicate that 19 F signals in the central region of the spectrum of (FUra)tRNA 1 /sup Val/ correspond to fluorouracils in non-base-paired regions. Photoreaction with psoralen indicates upfield 19 F signals arise from residues in helical environments. Removal of magnesium or addition of NaCl produces major, reversible changes in the 19 F spectrum of fluorinated tRNAs. Studies of manganese and spermine binding to (FUra)tRNA 1 /sup Val/ allow localization of several resonances in the 18 F spectrum to regions near putative binding sites for these ions. Binding of the codon G/sub p/U/sub p/A causes an upfield shift of a 19 F resonance at 3.9 ppm in the spectrum of (FUra)tRNA 1 /sup Val/. G/sub p/U/sub p/A/sub p/A, which is complementary to the anticodon and 5'-adjacent FUra 33, shifts an additional 19 F peak at 4.5 ppm. 1 H NMR and RNase H digestion studies show that the oligonucleotides bind to the anticodon
Exacerbating effects of human parvovirus B19 NS1 on liver fibrosis in NZB/W F1 mice.
Directory of Open Access Journals (Sweden)
Tsai-Ching Hsu
Full Text Available Systemic lupus erythematosus (SLE is an autoimmune disorder with unknown etiology that impacts various organs including liver. Recently, human parvovirus B19 (B19 is recognized to exacerbate SLE. However, the effects of B19 on liver in SLE are still unclear. Herein we aimed to investigate the effects of B19 on liver in NZB/W F1 mice by injecting subcutaneously with PBS, recombinant B19 NS1, VP1u or VP2, respectively. Our experimental results revealed that B19 NS1 protein significantly enhanced the TGF-β/Smad fibrotic signaling by increasing the expressions of TGF-β, Smad2/3, phosphorylated Smad2/3, Smad4 and Sp1. The consequent fibrosis-related proteins, PAI-1 and α-SMA, were also significantly induced in livers of NZB/W F1 mice receiving B19 NS1 protein. Accordingly, markedly increased collagen deposition was also observed in livers of NZB/W F1 mice receiving B19 NS1 protein. However, no significant difference was observed in livers of NZB/W F1 mice receiving B19 VP1u or VP2 as compared to the controls. These findings indicate that B19 NS1 plays a crucial role in exacerbating liver fibrosis in NZB/W F1 mice through enhancing the TGF-â/Smad fibrotic signaling.
Exacerbating Effects of Human Parvovirus B19 NS1 on Liver Fibrosis in NZB/W F1 Mice
Hsu, Tsai-Ching; Tsai, Chun-Chou; Chiu, Chun-Ching; Hsu, Jeng-Dong; Tzang, Bor-Show
2013-01-01
Systemic lupus erythematosus (SLE) is an autoimmune disorder with unknown etiology that impacts various organs including liver. Recently, human parvovirus B19 (B19) is recognized to exacerbate SLE. However, the effects of B19 on liver in SLE are still unclear. Herein we aimed to investigate the effects of B19 on liver in NZB/W F1 mice by injecting subcutaneously with PBS, recombinant B19 NS1, VP1u or VP2, respectively. Our experimental results revealed that B19 NS1 protein significantly enhanced the TGF-β/Smad fibrotic signaling by increasing the expressions of TGF-β, Smad2/3, phosphorylated Smad2/3, Smad4 and Sp1. The consequent fibrosis-related proteins, PAI-1 and α-SMA, were also significantly induced in livers of NZB/W F1 mice receiving B19 NS1 protein. Accordingly, markedly increased collagen deposition was also observed in livers of NZB/W F1 mice receiving B19 NS1 protein. However, no significant difference was observed in livers of NZB/W F1 mice receiving B19 VP1u or VP2 as compared to the controls. These findings indicate that B19 NS1 plays a crucial role in exacerbating liver fibrosis in NZB/W F1 mice through enhancing the TGF-â/Smad fibrotic signaling. PMID:23840852
Microstructure of the irradiated U 3Si 2/Al silicide dispersion fuel
Gan, J.; Keiser, D. D.; Miller, B. D.; Jue, J.-F.; Robinson, A. B.; Madden, J. W.; Medvedev, P. G.; Wachs, D. M.
2011-12-01
The silicide dispersion fuel of U 3Si 2/Al is recognized as the best performance fuel for many nuclear research and test reactors with up to 4.8 gU/cm 3 fuel loading. An irradiated U 3Si 2/Al dispersion fuel ( 235U ˜ 75%) from the high-flux side of a fuel plate (U0R040) from the Reduced Enrichment for Research and Test Reactors (RERTR)-8 test was characterized using transmission electron microscopy (TEM). The fuel was irradiated in the Advanced Test Reactor (ATR) for 105 days. The average irradiation temperature and fission density of the U 3Si 2 fuel particles for the TEM sample are estimated to be approximately 110 °C and 5.4 × 10 27 f/m 3. The characterization was performed using a 200-kV TEM. The U/Si ratio for the fuel particle and (Si + Al)/U for the fuel-matrix-interaction layer are approximately 1.1 and 4-10, respectively. The estimated average diameter, number density and volume fraction for small bubbles (<1 μm) in the fuel particle are ˜94 nm, 1.05 × 10 20 m -3 and ˜11%, respectively. The results and their implication on the performance of the U 3Si 2/Al silicide dispersion fuel are discussed.
Energy Technology Data Exchange (ETDEWEB)
Grosjean, C
2005-03-15
The thorium-U{sup 233} fuel cycle might provided safer and cleaner nuclear energy than the present Uranium/Pu fuelled reactors. Over the last 10 years, a vast campaign of measurements has been initiated to bring the precision of neutron data for the key nuclei (Th{sup 232}, Pa{sup 233} and U{sup 233}) at the level of those for the U-Pu cycle. This is the framework of these measurements, the energy dependent neutron induced fission cross section of Th{sup 232} and U{sup 233} has been measured from 1 to 7 MeV with a target accuracy lesser than 5 per cent. These measurements imply the accurate determination of the fission rate, the number of the target nuclei as well as the incident neutron flux impinging on the target, the latter has been obtained using the elastic scattering (n,p). The cross section of which is very well known in a large neutron energy domain ({approx} 0,5 % from 1 eV to 50 MeV) compared to the U{sup 235}(n,f) reaction. This technique has been applied for the first time to the Th{sup 232}(n,f) and U{sup 233}(n,f) cases. A Hauser-Feshbach statistical model has been developed. It consists of describing the different decay channels of the compound nucleus U{sup 234} from 0,01 to 10 MeV neutron energy. The parameters of this model were adjusted in order to reproduce the measured fission cross section of U{sup 233}. From these parameters, the cross sections from the following reactions could be extracted: inelastic scattering U{sup 233}(n,n'), radiative capture U{sup 233}(n,{gamma}) and U{sup 233}(n,2n). These cross sections are still difficult to measure by direct neutron reactions. The calculated values have allowed us to fill the lack of experimental data for the major fissile nucleus of the thorium cycle. (author)
(18)F-FDG PET/CT versus bone scintigraphy in the follow-up of gastric cancer.
Sollini, M; Calabrese, L; Zangheri, B; Erba, P A; Gramaglia, A; Gasparini, M
2016-01-01
A 53-year-old patient underwent a positron emission tomography/computed tomography with 2-fluoro-2-deoxy-d-glucose ((18)F-FDG PET/CT) in the suspicious of gastric tumor recurrence (mediastinal and abdominal lymph nodes). PET/CT identified only an area of (18)F-FDGuptake in the twelfth thoracic vertebrae. Unexpectedly, a bone scintigraphy revealed many "hot" spots changing the diagnosis (single metastasis versus plurimetastatic disease) and impacting on patient's management. Copyright © 2015 Elsevier España, S.L.U. and SEMNIM. All rights reserved.
Kernel Principal Component Analysis for dimensionality reduction in fMRI-based diagnosis of ADHD
Directory of Open Access Journals (Sweden)
Gagan S Sidhu
2012-11-01
Full Text Available This article explores various preprocessing tools that select/create features to help a learner produce a classifier that can use fMRI data to effectively discriminate Attention-Deficit Hyperactivity Disorder (ADHD patients from healthy controls. We consider four different learning tasks: predicting either two (ADHD vs control or three classes (ADHD-1 vs ADHD-3 vs control, where each use either the imaging data only, or the phenotypic and imaging data. After averaging, BOLD-signal normalization, and masking of the fMRI images, we considered applying Fast Fourier Transform (FFT, possibly followed by some Principal Component Analysis (PCA variant (over time: PCA-t; over space and time: PCA-st or the kernelized variant, kPCA-st, to produce inputs to a learner, to determine which learned classifier performs the best – or at least better than the baseline of 64.2%, which is the proportion of the majority class (here, controls.In the two-class setting, PCA-t and PCA-st did not perform statistically better than baseline, whereas FFT and kPCA-st did (FFT, 68.4%; kPCA-st, 70.3%; when combined with the phenotypic data, which by itself produces 72.9% accuracy, all methods performed statistically better than the baseline, but none did better than using the phenotypic data. In the three-class setting, neither the PCA variants, or the phenotypic data classifiers, performed statistically better than the baseline.We next used the FFT output as input to the PCA variants. In the two-class setting, the PCA variants performed statistically better than the baseline using either the FFTed waveforms only (FFT+PCA-t, 69.6%,; FFT+PCA-st, 69.3% ; FFT+kPCA-st, 68.7%, or combining them with the phenotypic data (FFT+PCA-t, 70.6%; FFT+PCA-st, 70.6%; kPCA-st, 76%. In both settings, combining FFT+kPCA-st’s features with the phenotypic data was better than using only the phenotypic data, with the result in the two-class setting being statistically better.
International Nuclear Information System (INIS)
Neuhausen, Christine; Rocker, Frank; Tremel, Wolfgang
2012-01-01
The novel uranium thiophosphate CsLiU(PS_4)_2 has been synthesized by reacting uranium metal, Cs_2S, Li_2S, S, and P_2S_5 at 700 C in an evacuated silica tube. The crystal structure was determined by single-crystal X-ray diffraction techniques. CsLiU(PS_4)_2 crystallizes in the rhombohedral space group R anti 3c (a = 15.2797(7) Aa; c = 28.778(2) Aa, V = 5818.7(5) Aa"3, Z = 18). The structure of CsLiU(PS_4)_2 is a unique three-dimensional U(PS_4)_2"2"- framework with large tunnels with an approximate diameter of 6.6 Aa running parallel to the crystallographic c axis. The tunnels are filled with Cs"+ cations. The smaller Li"+ cations are located at tetrahedral sites at the periphery of the channels. In the structure of CsLiU(PS_4)_2 the uranium atoms are coordinated by thiophosphate groups in a pseudotetrahedral fashion, and the PS_4 groups act as linear connectors. Topologically, CsLiU(PS_4)_2 may be regarded a chalcogenide analogue of silicate frameworks, with the uranium atoms and PS_4 groups replacing silicon and oxygen atoms. Alternatively, CsLiU(PS_4)_2 may be viewed as a coordination polymer, which is formed in salt melts by the solid state equivalent of the ''self-assembly'' reactions in solution. Magnetic susceptibility measurements indicated Curie-Weiss-type behavior between 4 K and 300 K. The μ_e_f_f of 2.83 μ_B at 300 K is in agreement with an f"2 configuration of U"4"+. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Census of U.S. Civil Aircraft: Calendar Year 1987
1987-12-31
PILATUS BRITTEN-NORMAN LIMITED BN-2b-21 10 51 u 2% F/W MULTI REC. ENG 51 0 3 3 TOTAL 0 3 3 PINE AIR SUPER V 4 51 2 0 1 1 F/W MULTI REC. ENG 51 01 1 TOTAL...Osceola 8 3 5 Page 36 16 18 1 1 Palo Alto 15 6 9 Plymouth 29 11 11 3 1 2 1 Pocahontas 21 7 13 1 Polk 396 108 180 33 15 18 1 7 5 1 28 *va- Pottawatta...lard 3 2 e- ".’ Barren 16 4 9 1_ 2. .r""- BatriI Bel ’ 1 1 1 8 2r- 41 ’ ,/ Boone 20 7 10 2 1. % wr# Bovf 42 11 13 9 2 I- 1" Boyle 17 4 11 2 Bracken