International Nuclear Information System (INIS)
Ginter, D.S.; Ginter, M.L.
1988-01-01
We show that a minimal parameter coupled channel model based on eigenquantum defect theory can reproduce quantitatively the known Rydberg structures associated with six channels of nsσ,ndλ( 3 Σ + /sub u/, 3 Σ + /sub u/, 3 Pi/sub u/, 3 Δ/sub u/) v = 0 ancestry in He 2 . Except for a few levels affected by accidental perturbations, these extensive level structures can be reproduced to within average experimental uncertainties. Previously unreported spectral analyses for transitions to the b 3 Pi/sub g/ state from rotational levels in the nl channel segments with n = 12--18 are included in this work. These spectral transitions were predicted and observed in the early stages of this investigation and were used to determine a number of new energy levels for the n = 3--18 data base used in subsequent calculations. The model uses a U matrix modified slightly from a Hund's case (b) to case (d) transformation and energy dependent eigenquantum defects μ/sub α/. Discussed in detail is a specific 14 parameter representation for ∼500 energy levels in which 2 parameters modify U to include interactions between ns and nd and 12 parameters describe the variation of the μ/sub α/'s with energy
Energy Technology Data Exchange (ETDEWEB)
Arroyo Ruiperez, J; Esteban Hernandez, J A
1962-07-01
An experimental study has been made to decide upon the advantages and drawbacks of the different methods and reagents employed in the metallography of U-Si alloys. It has been observed that all samples thermally treated to form the epsilon-phase undergo from the beginning a coalescence of the U{sub 3}Si{sub 2} particles, which makes practically useless any fine state of dispersion that might be present originally, as recommended by some authors. The coalescence of the U{sub 3}Si{sub 2} particle decreases the surface available for reaction and consequently the reaction rate. (Author) 7 refs.
Atomization of U3Si2/U3Si for research reactor fuel
International Nuclear Information System (INIS)
Kuk, Il Hiun
2004-01-01
Instead of comminuting, U 3 Si 2 /U 3 Si powders are produced by atomizating directly from the molten alloys. Many benefits are introduced by applying the atomization technique: reduction of the process, homogeneous alloy composition within a particle and between particles, increase of the thermal conductivity and decrease of the chemical reactivity with aluminium due to particle's spherical shape. (author)
A contribution to the kinetic study of the metatectic reaction U+U3Si2→U3Si
International Nuclear Information System (INIS)
Arroyo Ruiperez, J.; Esteban Hernandez, J. A.
1962-01-01
An experimental study has been made to decide upon the advantages and drawbacks of the different methods and reagents employed in the metallography of U-Si alloys. It has been observed that all samples thermally treated to form the epsilon-phase undergo from the beginning a coalescence of the U 3 Si 2 particles, which makes practically useless any fine state of dispersion that might be present originally, as recommended by some authors. The coalescence of the U 3 Si 2 particle decreases the surface available for reaction and consequently the reaction rate. (Author) 7 refs
Metallographic analysis of irradiated U3Si2/Al fuel element plate of 2.96 gU/cm3 density
International Nuclear Information System (INIS)
Maman Kartaman Ajiriyanto; Aslina Br Ginting; Junaedi
2018-01-01
Metallographic analysis of U 3 Si 2 /Al fuel element plate has been performed in hot cell. The purpose of metallographic analysis is to study changes in PEB U 3 Si 2 /Al microstructure and AlMg 2 cladding thickness after irradiation in reactor until burn up of 56 %. The fuel element plate of irradiated U 3 Si 2 /Al was cut in top, middle and bottom positions with each size around 5 x 5 x 1.37 mm. Metallographic preparation starts from sample cutting using cutting machine with low speed and sample mounting, grinding and polishing in hot cell 104–105. Sample mounting was done by using resin for more than 10 hours followed by grinding with sand papers up to grit size of 2400 and polishing with diamond paste of size 3 to 1 micron at a rotational speed of 150 rpm for 5 minutes. Microstructure observation was performed with optical microscope in hot cell 107 at 200 times magnification. Microstructure examination reveals U 3 Si 2 particles with inverse forms and sizes, Al matrix and AlMg 2 cladding were spread along the U 3 Si 2 /Al side. Microstructure observation of irradiated U 3 Si 2 /Al has not shown good result because only topography observation of U 3 Si 2 /Al meat, Al matrix and AlMg 2 cladding can be done due to limited capability of the optical microscope in hot cell, where maximum magnification can be attained only at 200 times so that the phenomenon of interaction layer and small gas bubble can not be observed. However, U 3 Si 2 /Al microstructure of 56 % burnup, if compared to the microstructure of U 3 Si 2 /Al fuel element plate of 60 % burnup from previous researcher, shows interaction between U 3 Si 2 meat with Al matrix and the existence of layers with a thickness about 5 up to 20 microns. Meanwhile, the observed thickness of AlMg 2 cladding is greater than 0.25 mm, which indicates that irradiation does not significantly change the thickness of AlMg 2 cladding so that the overall irradiated U 3 Si 2 -Al still has good integrity and stability. (author)
International Nuclear Information System (INIS)
Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N.; Alfaro de la T, M. C.
2016-09-01
The present work deals with the methodology established for the quantification of "2"3"2Th, "2"3"4U, "2"3"8U and "2"3"5U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO_3 minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of "2"3"2Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ("2"3"2Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of "2"3"2Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)
Tank 241-U-102, Grab Samples 2U-99-1, 2U-99-2 and 2U-99-3 Analytical Results for the Final Report
International Nuclear Information System (INIS)
STEEN, F.H.
1999-01-01
This document is the final report for tank 241-U-102 grab samples. Five grab samples were collected from riser 13 on May 26, 1999 and received by the 222-S laboratory on May 26 and May 27, 1999. Samples 2U-99-3 and 2U-99-4 were submitted to the Process Chemistry Laboratory for special studies. Samples 2U-99-1, 2U-99-2 and 2U-99-5 were submitted to the laboratory for analyses. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler 1995, Mulkey and Miller 1998). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP
Equilibrium electrode U(4)-U and redox U(4)-U(3) potentials in molten alkali metal chlorides medium
Energy Technology Data Exchange (ETDEWEB)
Smirnov, M V; Kudyakov, V Ya; Komarov, V E; Salyulev, A B [AN SSSR, Sverdlovsk. Inst. Ehlektrokhimii
1979-02-01
Conditional standard electrode potentials of uranium are determined for diluted solutions of its tetrachloride in alkali metal chloride melts (LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl) when using U(4) ion activity coefficient values experimentally found by the tensimetric method. These potentials shift to the electronegative side at the temperature decrease and alkali cation radius increase rsub(Msup(+)) according to the empiric ratio E*U(4)-U= -3.06+6.87x10/sup -4/ T-(1.67-10/sup -4/T-0.44) 1/rsub(Msup(+)) +-0.01. The temperature dependences of formal conditional redox potentials of the U(4)-U(3) system for above melted chlorides are estimated. The E*U(4)-U(3) value also becomes more electronegative in the series LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl. This alternation is satisfactorily described by the empiric expression E*U(4)-U(3)= -1.74+1.74x10/sup -4/T-(0.71x10/sup -4/T-0.20) 1rsub(Msup(+)) +-0.05. The calculated values Eu*(4)-U(3) are compared with those directly measured for the NaCl-KCl equimolar mixture and 3LiCl-2KCl eutectic mixture. A satisfactory confirmity has been observed.
Equilibrium electrode U(4)-U and redox U(4)-U(3) potentials in molten alkali metal chlorides medium
International Nuclear Information System (INIS)
Smirnov, M.V.; Kudyakov, V.Ya.; Komarov, V.E.; Salyulev, A.B.
1979-01-01
Conditional standard electrode potentials of uranium are determined for diluted solutions of its tetrachloride in alkali metal chloride melts (LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl) when using U(4) ion activity coefficient values experimentally found by the tensimetric method. These potentials shift to the electronegative side at the temperature decrease and alkali cation radius increase rsub(Msup(+)) according to the empiric ratio E*U(4)-U= -3.06+6.87x10 -4 T-(1.67-10 -4 T-0.44) 1/rsub(Msup(+)) +-0.01. The temperature dependences of formal conditional redox potentials of the U(4)-U(3) system for above melted chlorides are estimated. The E*U(4)-U(3) value also becomes more electronegative in the series LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl. This alternation is satisfactorily described by the empiric expression E*U(4)-U(3)= -1.74+1.74x10 -4 T-(0.71x10 -4 T-0.20) 1rsub(Msup(+)) +-0.05. The calculated values Eu*(4)-U(3) are compared with those directly measured for the NaCl-KCl equimolar mixture and 3LiCl-2KCl eutectic mixture. A satisfactory confirmity has been observed
Master formula approach to broken chiral U(3)xU(3) symmetry
Energy Technology Data Exchange (ETDEWEB)
Hiroyuki Kamano
2010-04-01
The master formula approach to chiral symmetry breaking proposed by Yamagishi and Zahed is extended to the U_R(3)xU_L(3) group, in which effects of the U_A(1) anomaly and the flavor symmetry breaking m_u \
Karakterisasi Paduan AlMgSi Untuk Kelongsong Bahan Bakar U3Si2/Al Dengan Densitas Uranium 5,2 gU/cm3
Directory of Open Access Journals (Sweden)
Aslina Br. Ginting
2018-03-01
Full Text Available Meningkatnya densitas uranium dari 2,96 gU/cm3 menjadi 5,2 gU/cm3 bahan bakar U3Si2/Al harus diikuti dengan penggunaan kelongsong yang kompatibel. Bahan bakar berdensitas tinggi mempunyai kekerasan yang tinggi, sehingga bila menggunakan paduan AlMg2 sebagai kelongsong dapat menyebabkan terjadi dogbone pada saat perolan. Selain fenomena dogbone, pada saat bahan bakar tersebut digunakan di reaktor dapat terjadi swelling karena meningkatnya hasil fisi maupun burn up. Oleh karena itu, perlu dicari pengganti bahan kelongsong untuk bahan bakar U3Si2/Al densitas tinggi. Pada penelitian ini telah dilakukan karakterisasi paduan AlMgSi sebagai kandidat pengganti kelongsong AlMg2. Karakterisasi yang dilakukan meliputi analisis termal, kekerasan, mikrostruktur dan laju korosi. Analisis termal dilakukan menggunakan DTA (Differential Thermal Analysis dan DSC (Differential Scanning Calorimetry. Analisis kekerasan menggunakan alat uji kekerasan mikro, mikrostruktur menggunakan SEM (Scanning Electron Microscope dan analisis laju korosi dilakukan dengan pemanasan pada temperatur 150 oC selama 77 jam di dalam autoclave. Hasil analisis menunjukkan bahwa kelongsong AlMgSi maupun AlMg2 mempunyai kompatibilitas panas dengan bahan bakar U3Si2/Al cukup stabil hingga temperatur 650 oC. Kelongsong AlMgSi mempunyai kekerasan sebesar 115 HVN dan kelongsong AlMg2 sebesar 70,1 HVN. Sementara itu, analisis mikrostruktur menunjukkan bahwa morfologi ikatan antarmuka (interface bonding kelongsong AlMgSi lebih baik dari kelongsong AlMg2, demikian halnya dengan laju korosi bahwa kelongsong AlMgSi mempunyai laju korosi lebih kecil dibanding kelongsong AlMg2. Hasil karakterisasi termal, kekerasan, mikrostruktur dan laju korosi menunjukkan bahwa PEB U3Si2/Al densitas 5,2 gU/cm3 menggunakan kelongsong AlMgSi lebih baik dibanding PEB U3Si2/Al densitas 5,2 gU/cm3 menggunakan kelongsong AlMg2. Kata kunci: U3Si2/Al, densitas 5,2 gU/cm3, kelongsong AlMgSi dan AlMg2.
Studies on some uranium oxides in the composition range U O3 -U3 O8-z. Vol. 3
International Nuclear Information System (INIS)
El-Fekey, S.A.; El-Mamoon Yahia, M.; Abd El-Razek, A.M.
1996-01-01
Four different crystallographic modifications of U O 3 designated as α, β, γ and δ, as well as the amorphous (A)-U O 3 have been prepared by calcining washed and unwashed uranium peroxide, washed ammonium uranate, uranyl nitrate crystals, and U O 3 .H 2 O at different temperatures. The U O 3 powders obtained were calcined at 650 degree C for 3 h in nitrogen atmosphere. Methanol, ethanol, benzene, toluene, hexane, pentane, acetone, petroleum ether, and kerosene were used as organic liquids for apparent density measurements and kerosene was found most appropriate. The results indicated that the different densities of α, β and A-U O 3 are inversely proportional to uranium concentration and temperature during precipitation while directly proportional with duration and final pH. The sequence of density of U O 3 powders appeared as follows: β>γ>δ>α>A-U O 3 . The porosity of the U O 3 phases was calculated using the equation P=D T - D p . The sequence of porosity appeared as follows A-U O 3 >α>δ>γ>β. The stoichiometry of the U 3 O 8 phase was determined titrimetrically. The use of O/U sequence appeared as follows: δ>γ>α>A-U O 3 >β indicating that the stoichiometry of the U 3 O 8 phase depends on the porosity of the U O 3 from which it was prepared. 1 figs., 3 tabs
Postirradiation examination of high-U-loaded, low-enriched U3O8, UAl2, and U3Si test fuel plates
International Nuclear Information System (INIS)
Gomez, J.; Morando, R.; Perez, E.E.; Giorsetti, D.R.; Copeland, G.L.; Hofman, G.L.; Snelgrove, J.L.
1985-01-01
The scope of this work is to present an evaluation of the postirradiation examination of the second set of high-U-loaded, low-enriched U 3 O 8 , UAl 2 and U 3 Si miniature plates manufactured by the Comision Nacional de Energia Atomica (CNEA) of Argentina, and irradiated and examined, within the framework of the Reduced Enrichment Research and Test Reactor (RERTR) Program, at Oak Ridge National Laboratory and Argonne National Laboratory. This paper includes fabrication details of the plates, their irradiation history and the results of postirradiation examination which are compared to those of the previous test and to present results from other laboratories participating in the RERTR Program. Postirradiation examination of these plates showed satisfactory performance for the oxides, aluminides and silicides (except for the highest-loaded U 3 Si plate) with the only indication of detrimental behavior being the slight bowing of some plates at about 80% burnup
Postirradiation examination of high-U-loaded, low-enriched U3O8, UAl2, and U3Si test fuel plates
International Nuclear Information System (INIS)
Gomez, J.; Morando, R.; Perez, E.E.; Giorsetti, D.R.; Copeland, G.L.; Hofman, G.L.; Snelgrove, J.L.
1985-01-01
The scope of this work is to present an evaluation of the postirradiation examination of the second set of high-U-loaded, low-enriched U 3 O 8 , UAl 2 and U 3 Si miniature plates manufactured by the Comision Nacional de Energia Atomica (CNEA) of Argentina, and irradiated and examined, within the framework of the Reduced Enrichment Research and Test Reactor (RERTR) Program, at Oak Ridge National Laboratory and Argonne National Laboratory. This paper includes fabrication details of the plates, their irradiation history and the results of postirradiation examination which are compared to those of the previous test and to present results from other laboratories participating in the REM Program. Postirradiation examination of these plates showed satisfactory performance for the oxides, aluminides and silicides (except for the highest-loaded U 3 Si plate) with the only indication of detrimental behavior being the slight bowing of some plates at about 80% burnup. (author)
Postirradiation examination of high-U-loaded low-enriched U3O8, UAl2, and U3Si test fuel plates
International Nuclear Information System (INIS)
Gomez, J.; Morando, R.; Perez, E.E.; Giorsetti, D.R.; Copeland, G.L.; Hofmann, G.; Snelgrove, J.L.
1984-01-01
The scope of this work is to present an evaluation of the postirradiation examination of the second set of high-U-loaded low-enriched U 3 O 8 , UAl 2 and U 3 Si miniature plates manufactured by the Comision Nacional de Energia Atomica (CNEA) of Argentina, and irradiated and examinated, within the framework of the Reduced Enrichment Research and Test Reactor (RERTR) Program, at Oak Ridge National Laboratory and Argonne National Laboratory. This paper includes fabrication details of the plates, their irradiation history and the results of postirradiation examination which are compared to those of the previous test and to present results from other laboratories participating in the RERTR Program. Postirradiation examination of these plates showed satisfactory poerformance for the oxides, aluminides and silicides (except for the highest-loaded U 3 Si plate) with the only indication of detrimental behavior during the slight bowing of some plates at about 80% burnup
Excess of "2"3"6U in the northwest Mediterranean Sea
International Nuclear Information System (INIS)
Chamizo, E.; López-Lora, M.; Bressac, M.; Levy, I.; Pham, M.K.
2016-01-01
In this work, we present first "2"3"6U results in the northwestern Mediterranean. "2"3"6U is studied in a seawater column sampled at DYFAMED (Dynamics of Atmospheric Fluxes in the Mediterranean Sea) station (Ligurian Sea, 43°25′N, 07°52′E). The obtained "2"3"6U/"2"3"8U atom ratios in the dissolved phase, ranging from about 2 × 10"−"9 at 100 m depth to about 1.5 × 10"−"9 at 2350 m depth, indicate that anthropogenic "2"3"6U dominates the whole seawater column. The corresponding deep-water column inventory (12.6 ng/m"2 or 32.1 × 10"1"2 atoms/m"2) exceeds by a factor of 2.5 the expected one for global fallout at similar latitudes (5 ng/m"2 or 13 × 10"1"2 atoms/m"2), evidencing the influence of local or regional "2"3"6U sources in the western Mediterranean basin. On the other hand, the input of "2"3"6U associated to Saharan dust outbreaks is evaluated. An additional "2"3"6U annual deposition of about 0.2 pg/m"2 based on the study of atmospheric particles collected in Monaco during different Saharan dust intrusions is estimated. The obtained results in the corresponding suspended solids collected at DYFAMED station indicate that about 64% of that "2"3"6U stays in solution in seawater. Overall, this source accounts for about 0.1% of the "2"3"6U inventory excess observed at DYFAMED station. The influence of the so-called Chernobyl fallout and the radioactive effluents produced by the different nuclear installations allocated to the Mediterranean basin, might explain the inventory gap, however, further studies are necessary to come to a conclusion about its origin. - Highlights: • First "2"3"6U results in the northwest Mediterranean Sea are reported. • Anthropogenic "2"3"6U dominates the whole seawater column at DYFAMED station. • "2"3"6U deep-water column inventory exceeds by a factor of 2.5 the global fallout one. • Saharan dust intrusions are responsible for an annual "2"3"6U flux of 0.02 pg/m"2. • Further studies are necessary to explain the
International Nuclear Information System (INIS)
Khattab, Mahmoud R.
2016-01-01
The present study is an application of a radiochemical procedure using alpha spectrometry technique for determination of uranium isotopes "2"3"8U, "2"3"4U and "2"3"5U on 13 granitic samples. These samples were collected from Gabal Gattar area, Northeastern Desert, Egypt. The collected samples were digested using microwave technique with aqua regia and spiked with "2"3"2U for chemical yield and activity calculation. Separation of uranium isotopes from the samples was done by Dowex 1 x 4 (50-100 mesh) resin followed by source preparation using microprecipitation technique. The concentrations of "2"3"8U were ranged between 28.9±0.9 and 134.8±1.8 Bq/g, and the "2"3"4U concentrations were between 24±0.6 and 147.7±2.2 Bq/g. For the "2"3"5U, the activity concentrations were between 1.3±0.2 and 6.7±1.2 Bq/g. The activity ratio of "2"3"4U/"2"3"8U was calculated and varied from 0.80 to 1.30. (author)
Higgs phenomenology in the minimal S U (3 )L×U (1 )X model
Okada, Hiroshi; Okada, Nobuchika; Orikasa, Yuta; Yagyu, Kei
2016-07-01
We investigate the phenomenology of a model based on the S U (3 )c×S U (3 )L×U (1 )X gauge theory, the so-called 331 model. In particular, we focus on the Higgs sector of the model which is composed of three S U (3 )L triplet Higgs fields and is the minimal form for realizing a phenomenologically acceptable scenario. After the spontaneous symmetry breaking S U (3 )L×U (1 )X→S U (2 )L×U (1 )Y , our Higgs sector effectively becomes that with two S U (2 )L doublet scalar fields, in which the first- and the second-generation quarks couple to a different Higgs doublet from that which couples to the third-generation quarks. This structure causes the flavor-changing neutral current mediated by Higgs bosons at the tree level. By taking an alignment limit of the mass matrix for the C P -even Higgs bosons, which is naturally realized in the case with the breaking scale of S U (3 )L×U (1 )X much larger than that of S U (2 )L×U (1 )Y, we can avoid current constraints from flavor experiments such as the B0-B¯ 0 mixing even for the Higgs bosons masses that are O (100 ) GeV . In this allowed parameter space, we clarify that a characteristic deviation in quark Yukawa couplings of the Standard Model-like Higgs boson is predicted, which has a different pattern from that seen in two Higgs doublet models with a softly broken Z2 symmetry. We also find that the flavor-violating decay modes of the extra Higgs boson, e.g., H /A →t c and H±→t s , can be dominant, and they yield the important signature to distinguish our model from the two Higgs doublet models.
Relativistic U(3) symmetry and pseudo-U(3) symmetry of the Dirac Hamiltonian
International Nuclear Information System (INIS)
Ginocchio, Joseph N.
2010-01-01
The Dirac Hamiltonian with relativistic scalar and vector harmonic oscillator potentials has been solved analytically in two limits. One is the spin limit for which spin is an invariant symmetry of the the Dirac Hamiltonian and the other is the pseudo-spin limit for which pseudo-spin is an invariant symmetry of the Dirac Hamiltonian. The spin limit occurs when the scalar potential is equal to the vector potential plus a constant, and the pseudospin limit occurs when the scalar potential is equal in magnitude but opposite in sign to the vector potential plus a constant. Like the non-relativistic harmonic oscillator, each of these limits has a higher symmetry. For example, for the spherically symmetric oscillator, these limits have a U(3) and pseudo-U(3) symmetry respectively. We shall discuss the eigenfunctions and eigenvalues of these two limits and derive the relativistic generators for the U(3) and pseudo-U(3) symmetry. We also argue, that, if an anti-nucleon can be bound in a nucleus, the spectrum will have approximate spin and U(3) symmetry.
Hennig, Christoph; Ikeda-Ohno, Atsushi; Emmerling, Fanziska; Kraus, Werner; Bernhard, Gert
2010-04-21
The limiting U(IV) carbonate species in aqueous solution was investigated by comparing its structure parameters with those of the complex preserved in a crystal structure. The solution species prevails in aqueous solution of 0.05 M U(IV) and 1 M NaHCO(3) at pH 8.3. Single crystals of Na(6)[U(CO(3))(5)].12H(2)O were obtained directly from this mother solution. The U(IV) carbonate complex in the crystal structure was identified as a monomeric [U(CO(3))(5)](6-) anionic complex. The interatomic distances around the U(IV) coordination polyhedron show average distances of U-O = 2.461(8) A, U-C = 2.912(4) A and U-O(dist) = 4.164(6) A. U L(3)-edge EXAFS spectra were collected from the solid Na(6)[U(CO(3))(5)].12H(2)O and the corresponding solution. The first shell of the Fourier transforms (FTs) revealed, in both samples, a coordination of ten oxygen atoms at an average U-O distance of 2.45 +/- 0.02 A, the second shell originates from five carbon atoms with a U-C distance of 2.91 +/- 0.02 A, and the third shell was fit with single and multiple scattering paths of the distal oxygen at 4.17 +/- 0.02 A. These data indicate the identity of the [U(CO(3))(5)](6-) complex in solid and solution state. The high negative charge of the [U(CO(3))(5)](6-) anion is compensated by Na(+) cations. In solid state the Na(+) cations form a bridging network between the [U(CO(3))(5)](6-) units, while in liquid state the Na(+) cations seem to be located close to the anionic complex. The average metal-oxygen distances of the coordination polyhedron show a linear correlation to the radius contraction of the neighbouring actinide(IV) ions and indicate the equivalence of the [An(CO(3))(5)](6-) coordination within the series of thorium, uranium, neptunium and plutonium.
International Nuclear Information System (INIS)
Weck, Philippe F.; Kim, Eunja
2016-01-01
The structure–property relationships of bulk CeO_2 and Ce_2O_3 have been investigated using AM05 and PBEsol exchange–correlation functionals within the frameworks of Hubbard-corrected density functional theory (DFT+U) and density functional perturbation theory (DFPT+U). Compared with conventional PBE+U, RPBE+U, PW91+U and LDA+U functionals, AM05+U and PBEsol+U describe experimental crystalline parameters and properties of CeO_2 and Ce_2O_3 with superior accuracy, especially when +U is chosen close to its value derived by the linear-response approach. Lastly, the present findings call for a reexamination of some of the problematic oxide materials featuring strong f- and d-electron correlation using AM05+U and PBEsol+U.
Thermal and x-ray studies on Tl2U(MoO4)3 and Tl4U(MoO4)4
International Nuclear Information System (INIS)
Dahale, N.D.; Keskar, Meera; Kulkarni, N.K.; Singh Mudher, K.D.
2006-01-01
In the quaternary Tl-U(IV)-Mo-O system, two new compounds namely Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 were prepared and characterized by powder X-ray diffraction and thermal methods. These compounds were prepared by solid state reactions of Tl 2 MoO 4 , UMoO 5 and MoO 3 in the required stoichiometric ratio at 500 deg C in evacuated sealed quartz ampoule. The XRD data of Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 were indexed on orthorhombic cell. TG curves of Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 did not show any weight change up to 700 deg C in an inert atmosphere. During heating in an inert atmosphere, Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 showed endothermic Dta peaks due to melting of the compounds at 519 and 565 deg C, respectively. (author)
Diffraction study on the nonstoichiometric α-U2N3+x phase
International Nuclear Information System (INIS)
Serizawa, H.; Fukuda, K.; Ishii, Y.; Funahashi, S.; Katsura, M.
1993-01-01
X-ray and neutron diffraction studies were performed on nonstoichiometric α-U 2 N 3+ x having a composition range 1.68 2 N 3+x in this composition range was distorted Mn 2 O 3 -type. Structure parameters of U and N atoms were determined. The results showed that positions of U atoms varied continuously with nitrogen content. No evidence of the modification from bcc to fcc could be obtained. Interatomic distances of U-U and U-N were determined. The position parameter of N atoms showed that N atoms were slightly deviated from the tetrahedral site. (author)
Microstructure of the irradiated U 3Si 2/Al silicide dispersion fuel
Gan, J.; Keiser, D. D.; Miller, B. D.; Jue, J.-F.; Robinson, A. B.; Madden, J. W.; Medvedev, P. G.; Wachs, D. M.
2011-12-01
The silicide dispersion fuel of U 3Si 2/Al is recognized as the best performance fuel for many nuclear research and test reactors with up to 4.8 gU/cm 3 fuel loading. An irradiated U 3Si 2/Al dispersion fuel ( 235U ˜ 75%) from the high-flux side of a fuel plate (U0R040) from the Reduced Enrichment for Research and Test Reactors (RERTR)-8 test was characterized using transmission electron microscopy (TEM). The fuel was irradiated in the Advanced Test Reactor (ATR) for 105 days. The average irradiation temperature and fission density of the U 3Si 2 fuel particles for the TEM sample are estimated to be approximately 110 °C and 5.4 × 10 27 f/m 3. The characterization was performed using a 200-kV TEM. The U/Si ratio for the fuel particle and (Si + Al)/U for the fuel-matrix-interaction layer are approximately 1.1 and 4-10, respectively. The estimated average diameter, number density and volume fraction for small bubbles (<1 μm) in the fuel particle are ˜94 nm, 1.05 × 10 20 m -3 and ˜11%, respectively. The results and their implication on the performance of the U 3Si 2/Al silicide dispersion fuel are discussed.
Redox equilibrium of U4+/U3+ in molten NaCl-2CsCl by UV-Vis spectrophotometry and cyclic voltammetry
International Nuclear Information System (INIS)
Nagai, Takayuki; Uehara, Akihiro; Fujii, Toshiyuki; Shirai, Osamu; Yamana, Hajimu; Sato, Nobuaki
2005-01-01
In order to investigate the redox equilibrium of uranium ions in molten NaCl-2CsCl, UV-Vis absorption spectro-photometry measurements were performed for U 4+ and U 3+ in molten NaCl-2CsCl at 923 K under simultaneous electrolytic control of their ratio. Prominent absorption bands at 480 and 570 nm were assigned to U 3+ , and their molar absorptivities were determined to be 1,260±42 and 963±32 mol -1 ·l·cm -1 respectively. From the dependence of the rest potential of the melt on the spectrophotometrically determined ratio of [U 4+ ]/[U 3+ ], the standard redox potential of the couple U 4+ /U 3+ at 923 K was determined to be -1.481±0.004 V vs. Cl 2 /Cl - . Cyclic voltammetry measurements were carried out for the couple U 4+ /U 3+ , and the results agreed well with this standard redox potential value. By the results of cyclic voltammetry, a temperature dependence of the standard redox potential was found to be -2.094+6.639 x 10 -4 T (T=823-923K). (author)
Positron attachment to the H2(A 3Σu) state
International Nuclear Information System (INIS)
Mitroy, J.; Zhang, J. Y.
2011-01-01
The stochastic variational method is used to compute the binding energy for positrons attached to the repulsive H 2 (A 3 Σ u ) state. Attachment occurs for internuclear separations between 1.616 a 0 and 1.818 a 0 . At these distances the vertical ionization potential for the H 2 (A 3 Σ u ) state is close to the positronium binding energy of 0.250 a.u. The maximum attachment energy occurs at 1.67 a 0 and is 0.003532 a.u.
The Recovery of Uranium From The Rejected Fuel Plate Dispersion Type of U3O8-Al and U3Si2Al by NaOH
International Nuclear Information System (INIS)
Widodo, G; Aji, D
1998-01-01
The recovery of uranium from the rejected fuel plate dispersion type of U 3 O 8 -AI And U 3 Si 2 -AI with a dissolution has been performed.Each of 5 fragment of fuel plate dispersion of U 3 O 8 -AI or U 3 Si 2 Al of 1x4 cm size was put in the distilled glass content of 250 ml NaOH solution whit The concentration variation 10,15,20,25,and 30%,and than was heated at temperature of 102 o C and was stirred constantly by magnetic stirred.Uranium in the form of U 3 O 8 or U 3 Si 2 was separated by filtration and Either residu and filtrate was analyzed by potentiometry using modified Devies Gray method. From the experiment data it was found in the residu that presentation of uranium was 83.99-84.05% and 84.67-86.556% while in filtrate it was found 53.90 ppm and 69.3 ppm
Properties of U3Si2-Al dispersion fuel element and its application
International Nuclear Information System (INIS)
Yin Changgeng
2001-01-01
The properties of U 3 Si 2 fuel and U 3 Si 2 -Al dispersion fuel element are introduced, which include U-loading; the banding quality, U-homogeneity and 'dog-bone' phenomenon, the minimum thickness of cladding and the corrosion performances. The fabrication technique of fuel elements, NDT for fuel plates, assemble technique of fuel elements and the application of U 3 Si 2 -Al dispersion fuel elements in the world are introduced
Directory of Open Access Journals (Sweden)
T. G. Slanger
2004-09-01
Full Text Available Astronomical sky spectra from the Keck I telescope on Mauna Kea have been used to obtain vibrational distributions in the O2A3Σu+ and O2(A'3Δu states from rotationally-resolved Herzberg I and Chamberlain band emissions in the terrestrial nightglow. The A3Σu+ distribution is similar to that presented in earlier publications, with the exception that there is significant population in the previously undiscerned v=0 level. The vibrational distributions of the A'3Δu and A3Σu+ states are essentially the same when comparison is made in terms of the level energies. The intensity of Chamberlain band emission at the peak of the distribution is about one-fourth that of the Herzberg I emission, as previously shown, and may be related primarily to radiative efficiency. The peaks in both population distributions are about 0.25eV below the O(3P+O(3P dissociation limit. We compare these Herzberg state distributions with that of the O2(b1Σg+ state, concurring with others that the intense nightglow emission associated with b1Σg+(v=0 is a reflection of direct transfer from the Herzberg states. This process takes place following O2 collisions, with simultaneous production of very high a1Δg and b1Σg+ vibrational levels.
Reduction of U3O8 to U by a metallic reductant, Li
International Nuclear Information System (INIS)
Jin-Mok Hur; Sun-Seok Hong; Hansoo Lee
2010-01-01
Reduction of U 3 O 8 was investigated for the recycling of spent oxide fuel from a commercial nuclear power plant. The possible reduction methods were proposed and compared. Based on the thermodynamic analysis, Li metal was selected as a reductant. The optimum reaction temperature for the reduction of U 3 O 8 was investigated at the wider reaction temperature range. The adverse oxidation of U metal by Li 2 O at 1,000 deg C was experimentally verified. Ellingham diagram was constructed to investigate the extent of the uranium oxides reduction when the reaction was carried out above melting point of U metal. (author)
International Nuclear Information System (INIS)
Bader, R.
1985-01-01
The tenor of this thesis is the regarding of the U(3) symmetry in the study of nuclear reactions. By the description of the two colliding fragments and their relative motion by means of U(3) quantum numbers U(3) channels and U(3) channel sets are defined. It is shown that in certain collisions the U(3) symmetry of U(3) channels is incompatible with the U(3) symmetry of the compound nucleus. For these U(3) channels the formation of the compound nucleus is forbidden. In this framework a microscopical U(3) model for the phenomenon of the nuclear molecule resonances is developed. U(3) barriers which play an important role in this model are responsible for the repulsion between the two fragments. By microscopical calculations it is confirmed that by the U(3) channels allowed above the U(3) barriers an attraction between the two fragments arises. This interchange of attraction and repulsion leads to the formation of nuclear molecules. Furthermore it is shown that this incompatibility and by this the phenomenon of nuclear molecule resonances can be reduced to an U(3) principle in which the Pauli principle is contained. Basing on this U(3) principle selection rules are formulated which predict candidates for nuclear molecule resonances. This explains why only some binary systems tend to the molecule formation. (orig./HSI) [de
International Nuclear Information System (INIS)
Zhang, Zhibin; Liu, Jun; Cao, Xiaohong; Luo, Xuanping; Hua, Rong; Liu, Yan; Yu, Xiaofeng; He, Likai
2015-01-01
Highlights: • NZVI can be used for adsorbing U(VI)–CO_3 complexes. • Use of NZVI is feasible for remediation of uranium-contaminated soils. • The mechanism of U(VI)–CO_3 complexes adsorbing onto NZVI has been explained. - Abstract: The influence of U(VI)–CO_3 and Ca–U(VI)–CO_3 complexes on U(VI) adsorption onto red soil and nanoscale zero-valent iron (NZVI) was investigated using batch adsorption and fixed-bed column experiments to simulate the feasibility of NZVI as the reactive medium in permeable- reactive barriers (PRB) for in situ remediation of uranium-contaminated red soils. The adsorption capacity (q_e) and distribution constant (K_d) of NZVI and red soil decreased with increasing pH, dissolved carbonate and calcium concentrations, but the q_e and K_d values of NZVI were 5–10 times higher than those of red soil. The breakthrough pore volume (PV) values increased with the decrease of pH, dissolved carbonate and calcium concentration; however, the breakthrough PV values of the PRB column filled with 5% NZVI were 2.0–3.5 times higher than the 100% red soil column. The U(VI)–CO_3 complexes adsorbed onto the surface of red soil/NZVI (≡SOH) to form SO–UO_2CO_3"− or SO–UO_2 (CO_3)_2"3"−. XPS and XRD analysis further confirmed the reduction of U(VI) to U(IV) and the formation of FeOOH on NZVI surfaces. The findings of this study are significant to the remediation of uranium-contaminated red soils and the consideration of practical U(VI) species in the natural environment.
Grain Size and Phase Purity Characterization of U3Si2 Pellet Fuel
Energy Technology Data Exchange (ETDEWEB)
Hoggan, Rita E. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Tolman, Kevin R. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Cappia, Fabiola [Idaho National Lab. (INL), Idaho Falls, ID (United States); Wagner, Adrian R. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Harp, Jason M. [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2018-05-01
Characterization of U3Si2 fresh fuel pellets is important for quality assurance and validation of the finished product. Grain size measurement methods, phase identification methods using scanning electron microscopes equipped with energy dispersive spectroscopy and x-ray diffraction, and phase quantification methods via image analysis have been developed and implemented on U3Si2 pellet samples. A wide variety of samples have been characterized including representative pellets from an initial irradiation experiment, and samples produced using optimized methods to enhance phase purity from an extended fabrication effort. The average grain size for initial pellets was between 16 and 18 µm. The typical average grain size for pellets from the extended fabrication was between 20 and 30 µm with some samples exhibiting irregular grain growth. Pellets from the latter half of extended fabrication had a bimodal grain size distribution consisting of coarsened grains (>80 µm) surrounded by the typical (20-30 µm) grain structure around the surface. Phases identified in initial uranium silicide pellets included: U3Si2 as the main phase composing about 80 vol. %, Si rich phases (USi and U5Si4) composing about 13 vol. %, and UO2 composing about 5 vol. %. Initial batches from the extended U3Si2 pellet fabrication had similar phases and phase quantities. The latter half of the extended fabrication pellet batches did not contain Si rich phases, and had between 1-5% UO2: achieving U3Si2 phase purity between 95 vol. % and 98 vol. % U3Si2. The amount of UO2 in sintered U3Si2 pellets is correlated to the length of time between U3Si2 powder fabrication and pellet formation. These measurements provide information necessary to optimize fabrication efforts and a baseline for future work on this fuel compound.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Zhibin [Key Laboratory of Radioactive Geology and Exploration Technology Fundamental Science for National Defense, East China Institute of Technology, Nanchang 330013 (China); State Key Laboratory Breeding Base of Nuclear Resources and Environment (East China Institute of Technology), Ministry of Education, Nanchang 330013 (China); Chemistry, Biological and Materials Sciences Department, East China Institute of Technology, Nanchang 330013 (China); Liu, Jun [State Key Laboratory Breeding Base of Nuclear Resources and Environment (East China Institute of Technology), Ministry of Education, Nanchang 330013 (China); Cao, Xiaohong, E-mail: xhcao@ecit.cn [Key Laboratory of Radioactive Geology and Exploration Technology Fundamental Science for National Defense, East China Institute of Technology, Nanchang 330013 (China); State Key Laboratory Breeding Base of Nuclear Resources and Environment (East China Institute of Technology), Ministry of Education, Nanchang 330013 (China); Chemistry, Biological and Materials Sciences Department, East China Institute of Technology, Nanchang 330013 (China); Luo, Xuanping [Chemistry, Biological and Materials Sciences Department, East China Institute of Technology, Nanchang 330013 (China); Hua, Rong; Liu, Yan [Key Laboratory of Radioactive Geology and Exploration Technology Fundamental Science for National Defense, East China Institute of Technology, Nanchang 330013 (China); State Key Laboratory Breeding Base of Nuclear Resources and Environment (East China Institute of Technology), Ministry of Education, Nanchang 330013 (China); Chemistry, Biological and Materials Sciences Department, East China Institute of Technology, Nanchang 330013 (China); Yu, Xiaofeng; He, Likai [Chemistry, Biological and Materials Sciences Department, East China Institute of Technology, Nanchang 330013 (China); and others
2015-12-30
Highlights: • NZVI can be used for adsorbing U(VI)–CO{sub 3} complexes. • Use of NZVI is feasible for remediation of uranium-contaminated soils. • The mechanism of U(VI)–CO{sub 3} complexes adsorbing onto NZVI has been explained. - Abstract: The influence of U(VI)–CO{sub 3} and Ca–U(VI)–CO{sub 3} complexes on U(VI) adsorption onto red soil and nanoscale zero-valent iron (NZVI) was investigated using batch adsorption and fixed-bed column experiments to simulate the feasibility of NZVI as the reactive medium in permeable- reactive barriers (PRB) for in situ remediation of uranium-contaminated red soils. The adsorption capacity (q{sub e}) and distribution constant (K{sub d}) of NZVI and red soil decreased with increasing pH, dissolved carbonate and calcium concentrations, but the q{sub e} and K{sub d} values of NZVI were 5–10 times higher than those of red soil. The breakthrough pore volume (PV) values increased with the decrease of pH, dissolved carbonate and calcium concentration; however, the breakthrough PV values of the PRB column filled with 5% NZVI were 2.0–3.5 times higher than the 100% red soil column. The U(VI)–CO{sub 3} complexes adsorbed onto the surface of red soil/NZVI (≡SOH) to form SO–UO{sub 2}CO{sub 3}{sup −} or SO–UO{sub 2} (CO{sub 3}){sub 2}{sup 3−}. XPS and XRD analysis further confirmed the reduction of U(VI) to U(IV) and the formation of FeOOH on NZVI surfaces. The findings of this study are significant to the remediation of uranium-contaminated red soils and the consideration of practical U(VI) species in the natural environment.
Hydrogen absorption in U{sub 3}Si{sub 2} and its impact on electronic properties
Energy Technology Data Exchange (ETDEWEB)
Mašková, Silvie, E-mail: maskova@mag.mff.cuni.cz [Department of Condensed Matter Physics, Charles University, Prague 2, The Czech Republic (Czech Republic); Miliyanchuk, Khrystyna [Department of Inorganic Chemistry, Ivan Franko National University of Lviv, Lviv (Ukraine); Havela, Ladislav [Department of Condensed Matter Physics, Charles University, Prague 2, The Czech Republic (Czech Republic)
2017-04-15
U{sub 3}Si{sub 2} reversibly absorbs hydrogen at very low H{sub 2} pressures (kPa range), yielding U{sub 3}Si{sub 2}H{sub 1.8}. One characteristic desorption temperature implies that there is only one type of H sites. U{sub 3}Si{sub 2} is a weak Pauli paramagnet (χ < 2·10{sup −8} m{sup 3}/mol U) with the shortest inter-uranium distances between the U atoms in different sheets (d{sub U-U} = 332 pm). The volume-expanded (10%) hydride is a spin fluctuator with temperature dependent magnetic susceptibility and a weak ferromagnetic component gradually arising below T = 100 K. The location of U{sub 3}Si{sub 2}H{sub 1.8} at the verge of magnetic ordering is evidenced by the low temperature specific heat with an upturn in C/T and a dramatic enhancement of the Sommerfeld coefficient of electronic specific heat γ, which reaches 500 mJ/mol f.u. K{sup 2}. - Highlights: •U{sub 3}Si{sub 2} can be hydrogenated at very low H{sub 2} pressure, yielding U{sub 3}Si{sub 2}H{sub 1.8}. •The H absorption to a single H-site is reversible. •Hydrogenation leads to the expansion of the unit cell by 10%. •U{sub 3}Si{sub 2} is a weak Pauli paramagnet. •The hydride is a spin fluctuator with temperature dependent magnetic susceptibility.
Structure and Lamb shift of 2s1/2-2p3/2 levels in lithiumlike U89+ through neonlike U82+
International Nuclear Information System (INIS)
Beiersdorfer, P.; Knapp, D.; Marrs, R.E.; Elliott, S.R.; Chen, M.H.
1993-01-01
The first Doppler-shift-free crystal-spectrometer measurement of stationary highly stripped uranium ions from a high-energy electron beam ion trap is presented. Thirteen 2s 1/2- 2p 3/2 transitions in eight ionization states bteween Li-like U 89+ and Ne-like U 82+ are identified and measured with an accuracy as high as 37 ppm, providing benchmarks for testing relativistic correlation and quantum electrodynamic effects in highly charged multielectron ions. A value of 47.39±0.35 eV is found for the 2s 1/2 Lamb shift in Li-like U 89+ , in excellent agreement with theory
Structure and lamb shift of 2s1/2-2p3/2 levels in lithiumlike U89+ through neonlike U82+
International Nuclear Information System (INIS)
Beiersdorfer, P.; Knapp, D.; Marrs, R.E.; Elliott, S.; Chen, M.H.
1993-01-01
The first Doppler-shift-free crystal- spectrometer measurements from stationary highly stripped uranium ions are presented. Eleven 2s 1/2 -2p 3/2 transitions in eight ionization stages between Li-like U 89+ and Ne-like U 82+ are identified and measured with an accuracy as high as 45 ppm, providing benchmarks for testing relativistic correlation and quantum electrodynamical effects in highly charged multi-electron ions. A value of 47.38 ± 0.35 eV is found for the 2s 1/2 Lamb shift in Li-like U 89+ , in excellent agreement with the theoretical value of 47.58 eV
Atomization of U3Si2 for research reactor fuel
International Nuclear Information System (INIS)
Kim, C.K.; Kim, K.H.; Lee, C.T.; Kuk, I.H.
1995-01-01
Rotating disk atomization technique is applied to KMRR (Korea Multi-purpose Research Reactor) fuel fabrication. A rotating disk atomizer is designed and manufactured locally and U-4.0 wt. % Si alloy powders are produced. The atomized powders are heat-treated to transform into U 3 Si and the mixture of U 3 Si and Al are extruded to fuel meat. Most of the atomized powders are spherical in shape. The microstructure of the powder is fine due to the rapid solidification. The time required for peritectoid reaction is reduced due to the fine microstructures and the resultant U 3 Si grain size is finer than ever obtained from ingot process. The mechanical properties of the fuel meat are improved: yield strength about 30 %, tensile strength 10% and elongation 250 % increased. (author)
International Nuclear Information System (INIS)
Moon, M.W.; Hsi, R.S.P.
1992-01-01
(R)-5-(diallylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one (12b) was prepared in 9% overall yield from 3-aminoquinoline. Reaction of 12b in ethyl acetate with tritium gas in presence of a 5% platinum on carbon catalyst afforded a mixture of (R)-5-(di[2,3- 3 H 2 ]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]-quinolin-2(1H)-one ([ 3 H]U-86170, 69 Ci/mmol) and (R)-5-([2,3- 3 H 2 ]-propylamino)5,6-dihydro-4H-imidazo-[4,5,1-ij]quinolin-2(1H)-one ( [ 3 H]U-91356, 34 Ci/mmol) which was separated by preparative reverse-phase chromatography. U-86170 and U-91356 are potent dopamine D2 agonists. The labelled compounds are useful for drug disposition studies. [ 3 H]U-86170 is also useful as a dopamine D2 agonist radioligand for receptor binding studies. (author)
International Nuclear Information System (INIS)
Cermak, V.; Markvart, M.; Novy, P.; Vanka, M.
1989-01-01
The tests are briefly described or proportioning U 3 O 8 powder of a granulometric grain size range of 0-160 μm using a vertical screw, a horizontal dual screw and a vibration dispenser with a view to proportioning very fine U 3 O 8 powder fractions produced in the oxidation of UO 2 fuel pellets. In the tests, the evenness of proportioning was assessed by the percentage value of the proportioning rate spread measured at one-minute intervals at a proportioning rate of 1-3 kg/h. In feeding the U 3 O 3 in a flame fluorator, it is advantageous to monitor the continuity of the powder column being proportioned and to assess it radiometrically by the value of the proportioning rate spread at very short intervals (0.1 s). (author). 10 figs., 1 tab., 12 refs
Transuranium element incorporation into the β-U3O8 uranyl sheet
International Nuclear Information System (INIS)
Miller, M.L.; Burns, P.C.; Ewing, R.C.; Finch, R.J.
1997-01-01
Spent nuclear fuel (SNF) is unstable under oxidizing conditions. Although recent studies have determined the paragenetic sequence for uranium phases that result from the corrosion of SNF, there are only limited data on the potential of alteration phases for the incorporation of transuranium elements. The crystal chemical characteristics of transuranic elements (TUE) are to a certain extent similar to uranium; thus TUE incorporation into the sheets of uranyl oxide hydrate structures can be assessed by examination of the structural details of the β-U 3 O 8 sheet type. The sheets of uranyl polyhedra observed in the crystal structure of β-U 3 O 8 also occur in the mineral billietite, where they alternate with α-U 3 O 8 type sheets. Preliminary crystal structure determinations for the minerals ianthinite, and wyartite, indicate that these phases also contain β-U 3 O 8 type sheets. The β-U 3 O 8 sheet anion topology contains triangular, rhombic, and pentagonal sites in the proportions 2:1:2. In all structures containing β-U 3 O 8 type sheets, the triangular sites are vacant. The pentagonal sites are filled with U 6+ O 2 forming pentagonal bipyramids. The rhombic dipyramids filling the rhombic sites contain U 6+ O 2 in billietite, U 4+ O 2 in β-U 3 O 8 , U 4+ (H 2 O) 2 in ianthinite, and U 4+ O 3 in wyartite-II. Interlayer species include: H 2 O (billietite, wyartite II, and ianthinite), Ba 2+ (billietite) Ca 2+ wyartite II, and Co 3 2- wyartite II; there is no interlayer in β-U 3 O 8 . The similarity of known TUE coordination polyhedra with those of U suggests that the β-U 3 O 8 sheet will accommodate TUE substitution coupled with variations in apical anion configuration and interlayer population providing the required charge balance
U3Si2 Fabrication and Testing for Implementation into the BISON Fuel Performance Code
Energy Technology Data Exchange (ETDEWEB)
Knight, Travis W.
2018-04-23
A creep test stand was designed and constructed for compressive creep testing of U3Si2 pellets. This is described in Chapter 3.
Energy Technology Data Exchange (ETDEWEB)
Buschinelli, A. J.A.
1974-06-01
This work is a contribution to the study of the mechanism and of the kinetics of the U$_2$C$_3$ formation by the synthetic reaction. The influences of a mechanical and a thermical pre-treatment of the samples on the reaction kinetics were investigated and discussed taking into account other information from the literature. The relative increasing of the U$_2$C$_3$ nucleation rate due to the pulverization corresponds approximately to the surface enlargement of the pulverized material. The activation energy for the synthetic reaction in powder was found to be 94 +- 7 kcal/mol. The negative influence of nitrogen, oxygen and tungsten on the U$_2$C$_3$ formation was reported. In the decomposition of UC$_2$ to U$_2$C$_3$ and graphite, the influences of the morphology of the graphite precipitate and the fast neutron irradiation on the beginning of the U$_2$C$_3$ formation were also investigated.
Neutronic Analysis of the RSG-GAS Compact Core without CIP Silicide 3.55 g U/cc and 4.8 g U/cc
International Nuclear Information System (INIS)
Jati S; Lily S; Tukiran S
2004-01-01
Fuel conversion from U 3 O 8 -Al to U 3 Si 2 -Al 2.96 g U/cc density in the RSG-GAS core had done successfully step by step since 36 th core until 44 th core. So that, since the 45 th core until now (48 th core) had been using full of silicide 2.96 g U/cc. Even though utilization program of silicide fuel with high density (3.55 g U/cc and 4.8 g U/cc) and optimize operation of RSG-GAS core under research. Optimalitation of core with increasing operation cycle have been analyzing about compact core. The mean of compact core is the RSG-GAS core with decrease number of IP or CIP position irradiation. In this research, the neutronic calculation to cover RSG-GAS core and RSG-GAS core without CIP that are using U 3 Si 2 -Al 2.96 g U/cc, 3.55 g U/cc and 4.8 g U/cc had done. Two core calculation done at 15 MW power using SRAC-ASMBURN code. The calculation result show that fuel conversion from 2.96 g U/cc density to 3.55 g U/cc and 4.8 g U/cc will increasing cycle length for both RSG-GAS core and RSG-GAS compact core without CIP. However, increasing of excess reactivity exceeded from nominal value of first design that 9.2%. Change of power peaking factor is not show significant value and still less than 1.4. Core fuelled with U 3 Si 2 -Al 4.8 g U/cc density have maximum discharge burn-up which exceeded from licensing value (70%). RSG-GAS compact core without CIP fuelled U 3 Si 2 -Al 2.96 g U/cc have longer cycle operation then RSG-GAS core and fulfil limitation neutronic parameter at the first design value. (author)
Irradiation behaviour of solid and hollow U{sub 3}Si fuel elements: results to 15,000 MWd/tonne U
Energy Technology Data Exchange (ETDEWEB)
Feraday, M A; Chalder, G H; Cotnam, K D
1969-06-15
U{sub 3}Si fuel elements clad in zirconium alloy sheaths have been irradiated to burnups close to 15,000 MWd/tonne U in pressurized water at 220{sup o}C, 98 bars. The results show that the external swelling can be controlled by incorporating free volume in the element. The dimensional stability of such elements is adequate to permit their use in power reactor fuel bundles. A diameter increase of 1.2% had occurred in an element initially containing 12.8% total free volume, after a burnup of 14,700 MWd/tonne U. There was no change in diameter between burnups of 5200 and 14,700 MWd/tonne U. Elements containing 3% total free volume had increased in diameter about 2.5% at 2000 MWd/tonne U compared to 0.2% at 9500 MWd/tonne U for elements containing 22% total free volume. The observed swelling in the U{sub 3}Si is discussed in terms of possible mechanisms. (author)
Determination of U{sub 3}O{sub 8} in UO{sub 2} by infrared spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Silva, Liliane Aparecida; Lameiras, Fernando Soares; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa; Barbosa, Joao Batista Santos, E-mail: lasfisica@gmail.com, E-mail: sl@cdtn.br, E-mail: amms@cdtn.br, E-mail: ferrazw@cdtn.br, E-mail: jbsb@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN), Belo Horizonte, MG (Brazil)
2017-01-15
The oxygen-uranium (O-U) system has various oxides, such as UO{sub 2}, U{sub 4}O{sub 9}, U{sub 3}O{sub 8}, and UO{sub 3}. Uranium dioxide is the most important one because it is used as nuclear fuel in nuclear power plants. UO{sub 2} can have a wide stoichiometric variation due to excess or deficiency of oxygen in its crystal lattice, which can cause significant modifications of its proprieties. O/U relation determination by gravimetry cannot differentiate a stoichiometric deviation from contents of other uranium oxides in UO{sub 2}. The presence of other oxides in the manufacturing of UO{sub 2} powder or sintered pellets is a critical factor. Fourier Transform Infrared Spectroscopy (FTIR) was used to identify U{sub 3}O{sub 8} in samples of UO{sub 2} powder. UO{sub 2} can be identified by bands at 340 cm{sup -1} and 470 cm{sup -1}, and U{sub 3}O{sub 8} and UO{sub 3} by bands at 735 cm{sup -1}, 910 cm{sup -1}, respectively. The methodology for sample preparation for FTIR spectra acquisition is presented, as well as the calibration for quantitative measurement of U{sub 3}O{sub 8} in UO{sub 2}. The content of U{sub 3}O{sub 8} in partially calcined samples of UO{sub 2} powder was measured by FTIR with good agreement with X-rays diffractometry (XRD). (author)
Progress in the development of uranium silicide (U3Si2) fuel at BATAN
International Nuclear Information System (INIS)
Suripto, A.; Soentono, S.
1995-01-01
After successful fabrication of two full-size prototype fuel elements containing ∼3.0 gU/cm 3 in the form of U 3 Si 2 -Al dispersion now undergoing irradiation in the Reaktor Serba Guna G.A. Siwabessy (RSG-GAS) core since 1990, further development in U 3 Si 2 -A2 dispersion fuel element manufacturing has been pursued, whose progress in discussed in this paper, with a special attention on the use of much higher-loading aimed at obtaining a better understanding on the influence of higher-loading on fuel core and plate manufacturing and quality. At present, high-loading U 3 Si 2 -AI dispersion miniplates are being manufactured for preparing some mini-fuel elements to be test-irradiated in the new MTR in-pile loop of the RSG-GAS. (author)
The effect of U3O-8 addition on the UO2 pellet
International Nuclear Information System (INIS)
Indrati, Y.T.; Syarif, D. G.; Handayani, A.
1998-01-01
The purpose of varied U 3 O 8 addition on the UO 2 pellet fabrication is to from 1-3 mu pores. The green pellets, compacted with 3 ton/cm 2 , are a mixture powder of UO 2 , TiO 2 (0.1% weight) and varied U 3 O 8 (0-12.5% weight). The green pellets were presintered by H2 atmosphere. The presintered pellets were put on the ceramic crucibles and than those were put on the SS 316 tube with argon atmosphere. The 1400 o C sintering was hold with the soaking time 3 hr and the same rate of heating and cooling 150 o C/hr. The UO 2 pellet with 5% (weight) U 3 O 8 addition has 95.17% of theoretic density and 548.4 ±6.57 VH. Based on the identification of microstructure of pellet, it is not acceptable for nuclear fuel although pellet has 10.02 mu on grain size and 1.3 mu on closed pore size. By the diffractometer X-ray, crystal structure of pellet is face centered cubic (FCC) with the O/U ratio is 2.08
International Nuclear Information System (INIS)
Chebotarev, N.T.; Konovalov, L.N.; Zhmak, V.A.; Chebotarev, Ya.N.
1996-01-01
Results of studies into the Al-UAl 3 -USi 3 -Si of the U-Al-Si ternary system are presented. It is established that phase equilibrium between the intermetallic compound U(Al, Si) 3 and the aluminium-silicon alloys may be presented in form of conodes on the isothermal cross-section of the state diagram. It is shown that the U(Al, Si) 3 intermetallic compound, containing up to 6.5 at.% silicon, interacts both with liquid and solid aluminium with the U(Al, Si) 4 phase formation [ru
A survey of the mechanical properties of uranium alloys U-5Mo-3Nb wt.% and U-3Mo-3Nb wt.%
Energy Technology Data Exchange (ETDEWEB)
Dupont, G.
1969-04-15
In a continuing program on the development of soft and ductile uranium alloys for armament applications, two compositions were studied. These gamma extruded uranium alloys were U-5Mo-3Nb wt.% and U-3Mo-3Nb wt.%. This study was carried out to determine the influence of tempering heat treatments associated with extrusion on the ductility of these uranium alloys. The mechanical properties of both alloys were measured in the extruded condition, in the extruded and annealed condition and in the quenched and tempered condition. A maximum elongation of 13.7% in tension with a low amount of work hardening was obtained for the U-3Mo-3Nb wt.% alloy after 1 1/2 hours anneal at 1200 deg F (650 deg C) followed by a rapid cooling in water at 70 deg F (21 deg C). A maximum elongation of 17.3% with a large amount of work hardening was obtained for alloy U-5Mo-3Nb wt.% after vacuum annealing, normalizing, gamma phase solubilizing at 1500 deg F (815 deg C) and quenching in water at 700 deg F (210 deg C). The maximum ductility achieved in these two alloys by our approaches is low compared with the ductility of Armco Iron employed for the same applications in the field of ballistics.
U(1) x U(1) x U(1) symmetry of the Kimura 3ST model and phylogenetic branching processes
International Nuclear Information System (INIS)
Bashford, J D; Jarvis, P D; Sumner, J G; Steel, M A
2004-01-01
An analysis of the Kimura 3ST model of DNA sequence evolution is given on the basis of its continuous Lie symmetries. The rate matrix commutes with a U(1) x U(1) x U(1) phase subgroup of the group GL(4) of 4 x 4 invertible complex matrices acting on a linear space spanned by the four nucleic acid base letters. The diagonal 'branching operator' representing speciation is defined, and shown to intertwine the U(1) x U(1) x U(1) action. Using the intertwining property, a general formula for the probability density on the leaves of a binary tree under the Kimura model is derived, which is shown to be equivalent to established phylogenetic spectral transform methods. (letter to the editor)
Investigation for thermal stability of U3Si2 and protection methods
International Nuclear Information System (INIS)
Zhang Huiying; Sun Jichang; Sun Rongxian
1994-08-01
The thermal stability of U 3 Si 2 in Ar, N 2 and air, and the interaction between U 3 Si 2 and Al, Zr have been investigated by thermal analysis method. According to the results of thermal analysis, protection measures for various procedures have been improved. From the practice, it shows that the protection measures can ensure the safety of production and raise the product quality as well as reduce the cost effectively
Radiation-induced grain subdivision and bubble formation in U3Si2 at LWR temperature
Yao, Tiankai; Gong, Bowen; He, Lingfeng; Harp, Jason; Tonks, Michael; Lian, Jie
2018-01-01
U3Si2, an advanced fuel form proposed for light water reactors (LWRs), has excellent thermal conductivity and a high fissile element density. However, limited understanding of the radiation performance and fission gas behavior of U3Si2 is available at LWR conditions. This study explores the irradiation behavior of U3Si2 by 300 keV Xe+ ion beam bombardment combining with in-situ transmission electron microscopy (TEM) observation. The crystal structure of U3Si2 is stable against radiation-induced amorphization at 350 °C even up to a very high dose of 64 displacements per atom (dpa). Grain subdivision of U3Si2 occurs at a relatively low dose of 0.8 dpa and continues to above 48 dpa, leading to the formation of high-density nanoparticles. Nano-sized Xe gas bubbles prevail at a dose of 24 dpa, and Xe bubble coalescence was identified with the increase of irradiation dose. The volumetric swelling resulting from Xe gas bubble formation and coalescence was estimated with respect to radiation dose, and a 2.2% volumetric swelling was observed for U3Si2 irradiated at 64 dpa. Due to extremely high susceptibility to oxidation, the nano-sized U3Si2 grains upon radiation-induced grain subdivision were oxidized to nanocrystalline UO2 in a high vacuum chamber for TEM observation, eventually leading to the formation of UO2 nanocrystallites stable up to 80 dpa.
U3Si2 behavior in H2O: Part I, flowing steam and the effect of hydrogen
Wood, E. Sooby; White, J. T.; Grote, C. J.; Nelson, A. T.
2018-04-01
Recent interest in U3Si2 as an advanced light water reactor fuel has driven assessment of numerous properties, but characterization of its response to H2O environments is absent from the literature. The behavior of U3Si2 in H2O containing atmospheres is investigated and presented in a two-part series of articles aimed to understand the degradation mechanism of U3Si2 in H2O. Reported here are thermogravimetric data for U3Si2 exposed to flowing steam at 250-470 °C. Additionally the response of U3Si2 to flowing Ar-6% H2 from 350 to 400 °C is presented. Microstructural degradation is observed following hours of exposure at 350 °C in steam. U3Si2 undergoes pulverization on the timescale of minutes when temperatures are increased above 400 °C. This mechanism is accelerated in flowing Ar-H2 at the same temperatures.
Analysis of transuranic isotopes in irradiated U3Si2-Al fuel by alpha spectrometry
International Nuclear Information System (INIS)
Dian Anggraini; Aslina B Ginting; Arif Nugroho
2011-01-01
Separation and analysis of transuranic isotopes (uranium and plutonium) in irradiated U 3 Si 2 -Al plate has been done. The analysis experiment includes sample preparation (i.e. cutting, dissolving, filtering, dilution), fission products separation from heavy elements, and analysis of transuranic isotopes content with alpha spectrometer. The separation of transuranic isotopes (U, Pu) was done by two methods, i.e. direct method and ion exchanger method with zeolite. Measurement of standard transuranic isotope (AMR 43) and standard U 3 O 8 was done in advance in order to determine percentage of 235 U recovery and detector efficiency. Recovery of 235 U isotope was obtained as much as 92,58%, which fulfills validation requirement, and the detector efficiency was 0.314. Based on the measured recovery and detector efficiency, the separation was done by direct electrodeposition method of 250 µL irradiated U 3 Si 2 -Al solution. The deposited sample was subsequently analyzed with alpha spectrometer. The separation with ion exchanger was done by mixing and shaking of 300 µL irradiated U 3 Si 2 -Al solution and 0.5 gram zeolite to separate the liquid phase from the solid phase. The liquid phase was electrodeposited and analyzed with alpha spectrometer. The analysis of transuranic isotopes (U, Pu) by both methods shows different results. Heavy element ( 238 U, 236 U, 234 U, 239 Pu) content obtained by direct method was 0.0525 g/g and 235 U= 0.0076 g/g, while the separation using zeolite ion exchanger resulted in Heavy element = 0.0253 g/g and 235 U = 0.0092 g/g. (author)
Irradiation mixing of Al into U3Si
International Nuclear Information System (INIS)
Birtcher, R.C.; Ding, F.R.; Kestel, B.J.; Baldo, P.M.; Zaluzec, N.J.
1995-11-01
Thermal and irradiation induced intermixing of uranium silicide reactor fuels with the aluminum cladding is an important consideration in understanding their fission gas and fuel swelling behavior. The authors have used Rutherford backscattering to follow the behavior of an Al thin film on U 3 Si and U 3 Si 2 during 1.5 MeV Kr ion irradiation at temperatures of 30 and 350 C. After an initial dose during which no intermixing occurs, the Al mixes quickly into U 3 Si. The threshold dose is believed to be associated with an oxide layer between the Al and the uranium silicide. At 300 C and doses greater than threshold, rates of mixing and aluminide phase growth are extracted
U3O8 microspheres sintering kinetics
International Nuclear Information System (INIS)
Godoy, A.L.E.
1986-01-01
U 3 O 8 microspheres sintering kinetics was determined using a hot-stage optical microscopy apparatus, able to reach temperature up to 1350 0 C in controlled atmospheres. The sintered material had its microstructure analysed by optical and electron microscopy. The microspheres were characterized initialy utilizing X-ray diffractometry and thermogravimetry. The equation which describes the microspheres shrinkage in function of the time was obtained using finite difference analysis X-ray diffractometry indicated hexagonal structure for the microspheres main starting material, ammonium diuranate thermogravimetric analysis showed reduction of this material to U 3 O 8 at 600 0 C. Ceramography results showed 5 hours sintered microspheres grain sizes G vary with the temperature. Sintered U 3 O 8 micrographs compared with published results for UO 2 , indicate similar homogeneity microstructural characteristics and suggest the processed micorspheres to be potentially useful as nuclear fuels. (Author) [pt
Low silicon U(Al,Si)3 stabilization by Zr addition
International Nuclear Information System (INIS)
Pizarro, L.M.; Alonso, P.R.; Rubiolo, G.H.
2009-01-01
Previous knowledge states that (U,Zr)Al 3 and U(Al,Si) 3 phases with Zr and Si content higher than 6 at.% (7.7 wt%) and 4 at.% (1.4 wt%), respectively, does not partially transform to UAl 4 at 600 o C. In this work, four alloys within the quaternary system U-Al-Si-Zr were made with a fixed nominal 0.18 at.% (0.1 wt%) Si content in order to assess the synergetic effect of both Zr and Si alloying elements to the thermodynamic stability of the (U,Zr)(Al,Si) 3 phase. Heat treatments at 600 deg. C were undertaken and samples were analyzed by means of XRD, EPMA and EDS techniques. A remarkable conclusion is that addition of 0.3 at.% Si in the (U,Zr)(Al,Si) 3 phase reduces in 2.7 at.% the necessary Zr content to inhibit its transformation to U(Al,Si) 4 .
International Nuclear Information System (INIS)
Haase, R.W.; Butler, P.H.
1985-01-01
We give tables of algebraic formulas for some nontrivial 6j symbols and 3jm symbols of the unitary groups. The tables demonstrate that the building-up method can be used successfully to obtain the rank dependence of unitary group j and jm symbols. To emphasize the rank-dependent nature of this calculation, we have employed the composite Young tableaux notation (or back-to-back notation) to label the unitary group irreps. In using this notation, the transpose conjugate symmetry of the corresponding composite Young diagram leads to a new symmetry of the unitary group 6j and 3jm symbols. The transposition of the groups U/sub m/ and U/sub n/ gives rise to a further symmetry of the 3jm symbols of U/sub m/n contains U/sub m/ x U/sub n/
On some factors affecting the nonstoichiometry in U 3O 8
Fujino, Takeo; Tagawa, Hiroaki; Adachi, Takeo
1981-03-01
The nonstoichiometry of U 3O 8 was studied under various conditions. The {O}/{U} atom ratios obtained by the oxidation of uranium metal in air followed by cooling with moderate rates (method 1) are 2.67 ± 0.01 in the temperature range 700 900°C and 2.662 ± 0.005 at 1000°C and are generally larger than the ratio by thermogravimetry. If the oxidation was carried out in a crucible with a lid, a compositional peak was observed at 900 950°C, which did not appear for the U 3O 8 samples from UO 2. The U 3O 8 made from UO 2 by method 1 have {O}/{U} ratios 2.655 ± 0.005 (700° C), 2.653 ± 0.004 (800° C), 2.648 ± 0.004 (900° C) and 2.645 ± 0.003 (1000° C). Differences were observed in the O/U ratios of heating and cooling series. X-ray diffraction analysis showed several additional peaks other than those of α-U 3O 8 for the samples which exhibited the compositional peak.
Tank 241-U-103, grab samples 3U-99-1, 3u-99-2 and 3U-99-3
Energy Technology Data Exchange (ETDEWEB)
STEEN, F.H.
1999-08-25
This document is the final report for tank 241-U-103 grab samples. Three grab samples were collected from riser 13 on March 12, 1999 and received by the 222-S laboratory on March 15, 1999. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP.
International Nuclear Information System (INIS)
Tao Chengying
1986-01-01
The data of molar volumes of uranous nitrate and nitric acid are necessary for the calculation of the changes in phase volume during the extraction in U(NO 3 ) 4 -HNO 3 /30%TBP-kerosene system. However, the data of the partial molar volume of U(NO 3 ) 4 are not available in literature. In the present work, the molar volumes of U(NO 3 ) 4 and HNO 3 are calculated by linear fitting of the experimental data. The result of the molar volume of HNO 3 is consistent with those in literature
Fabrication and thermophysical property characterization of UN/U3Si2 composite fuel forms
White, J. T.; Travis, A. W.; Dunwoody, J. T.; Nelson, A. T.
2017-11-01
High uranium density composite fuels composed of UN and U3Si2 have been fabricated using a liquid phase sintering route at temperatures between 1873 K and 1973 K and spanning compositions of 10 vol% to 40 vol% U3Si2. Microstructural analysis and phase characterization revealed the formation of an U-Si-N phase of unknown structure. Microcracking was observed in the U-Si portion of the composite microstructure that likely originates from the mismatched coefficient of thermal expansion between the UN and U3Si2 leading to stresses on heating and cooling of the composite. Thermal expansion coefficient, thermal diffusivity, and thermal conductivity were characterized for each of the compositions as a function of temperature to 1673 K. Hysteresis is observed in the thermal diffusivity for the 20 vol% through 40 vol% specimens between room temperature and 1273 K, which is attributed to the microcracking in the U-Si phase. Thermal conductivity of the composites was modeled using the MOOSE framework based on the collected microstructure data. The impact of irradiation on thermal conductivity was also simulated for this class of composite materials.
The qualification of U3O8 as research reactor fuel
International Nuclear Information System (INIS)
Krull, W.
1983-01-01
This report summarizes the today knowledge of the qualification status of U 3 O 8 as low enriched ( 3 O 8 is so far qualified to start testing of ten (10) fuel elements with an U-density of 3.1 g U/cc in the FRG-2 research reactor. (orig.) [de
HYDROGEOLOGIC CHARACTERIZATION OF THE U-3bl COLLAPSE ZONE
International Nuclear Information System (INIS)
Bechtel Nevada and National Security Technologies, LLC
2006-01-01
The U-3bl collapse crater was formed by an underground nuclear test in August 1962. This crater and the adjoining U-3ax crater were subsequently developed and used as a bulk low-level radioactive waste disposal cell (U-3ax/bl), which is part of the Area 3 Radioactive Waste Management Site at the Nevada Test Site (NTS). Various investigations have been conducted to assess the hydrogeologic characteristics and properties in the vicinity of the U-3ax/bl waste disposal cell. This report presents data from one of these investigations, conducted in 1996. Also included in this report is a review of pertinent nuclear testing records, which shows that the testing operations and hydrogeologic setting of the U-3ax/bl site were typical for the period and location of testing
Synthesis of [3-14C]- and [phenyl-U-14C] olaquindox
International Nuclear Information System (INIS)
Maul, W.; Scherling, D.; Seng, F.
1981-01-01
Olaquindox is a new feed additive. [ 14 C]Olaquindox, labelled in different positions, was needed for tracer-studies of pharmacokinetics, biotransformation and residues in several species of animals. 2-[N-(2-hydroxethyl)-carbamoyl]-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide([3- 14 C]Olaquindox) was synthesized from barium[ 14 C]carbonate (22 mmoles; 1.15 Ci) via [1- 14 C]acetic acid, sodium[1- 14 C]acetate, [1- 14 C]acetylchloride, ethyl[3- 14 C]acetoacetate and 2-carbethoxy-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide with an overall yield of 10%, based on barium[ 14 C]carbonate. The radiochemical purity was better than 98% (tlc). The specific activities of three preparations were 10.5, 8.4 and 5.45 μCi/mg respectively. [phenyl-U- 14 C]Olaquindox was synthesized starting from [U- 14 C]aniline (19.8 mmoles; 284.4 mCi). Intermediate products were N-acetyl[U- 14 C]aniline, 2-nitro-N-acetyl[U- 14 C]aniline, 2-nitro[U- 14 C]aniline and [U- 14 C]benzofurazanoxide. The total yield was 50% as calculated for [U- 14 C]aniline. At calibration samples of two preparations showed specific activities of 49.5 and 11.1 μCi/mg respectively. The radiochemical purity was checked by tlc and exceeded 98%. (author)
First-principles investigations on the electronic structures of U{sub 3}Si{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Wang, Tong [College of Information & Communication, Harbin Engineering University, Harbin, 150001 (China); Qiu, Nianxiang [Engineering Laboratory of Specialty Fibers and Nuclear Energy Materials, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang, 315201 (China); Wen, Xiaodong [State Key Laboratory of Coal Conversion, Institute of Coal Chemistry, Chinese Academy of Sciences, P.O. Box 165, Taiyuan, Shanxi, 030001 (China); Synfuels China, 100195 (China); Tian, Yonghui [College of Life Science, Sichuan University, Chengdu, Sichuan, 610064 (China); He, Jian [Center for Translational Medicine, Department of Biotechnology, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian, Liaoning, 116023 (China); Luo, Kan; Zha, Xianhu; Zhou, Yuhong; Huang, Qing; Lang, Jiajian [Engineering Laboratory of Specialty Fibers and Nuclear Energy Materials, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang, 315201 (China); Du, Shiyu, E-mail: dushiyu@nimte.ac.cn [Engineering Laboratory of Specialty Fibers and Nuclear Energy Materials, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang, 315201 (China)
2016-02-15
U{sub 3}Si{sub 2} has been widely utilized as a high-power uranium fuel for research reactors due to its high density of uranium. However, theoretical investigations on this material are still scarce up to now. For this reason, the computational study via density functional theory (DFT) is performed on the U{sub 3}Si{sub 2} compound in this work. The properties of U{sub 3}Si{sub 2}, such as stable crystalline structures, density of states, charge distributions, formation energy of defects, as well as the mechanical properties are explored. The calculation results show that the U{sub 3}Si{sub 2} material is metallic and brittle, which is in good agreement with the previous experimental observations. The formation energy of uranium vacancy defect is predicted to be the lowest, similar with that of UN. The theoretical investigation of this work is expected to provide new insight of uranium silicide fuels.
Thermal expansion studies on UMoO5, UMoO6, Na2U(MoO4)3 and Na4U(MoO4)4
International Nuclear Information System (INIS)
Keskar, Meera; Dahale, N.D.; Krishnan, K.
2009-01-01
In the present work, thermal expansion behavior of lower valent sodium uranium molybdates, i.e., Na 2 U(MoO 4 ) 3 and Na 4 U(MoO 4 ) 4 were studied under vacuum in the temperature range of 298-873 K using high temperature X-ray diffractometry (HTXRD). Expansion behaviors of UMoO 5 and UMoO 6 were also studied in vacuum from 298 to 873 K and 773 K, respectively. UMoO 5 was synthesized by reacting UO 2 with MoO 3 in equi-molar proportion in evacuated sealed quartz ampoule at 1173 K for 14 h. Na 2 U(MoO 4 ) 3 and Na 4 U(MoO 4 ) 4 were prepared by reacting UMoO 5 and MoO 3 with 1 and 2 moles of Na 2 MoO 4 , respectively, at 873 K in evacuated sealed quartz ampoule. XRD data of UMoO 5 and UMoO 6 were indexed on orthorhombic and monoclinic systems, respectively, whereas, the data of Na 2 U(MoO 4 ) 3 and Na 4 U(MoO 4 ) 4 were indexed on tetragonal system. The lattice parameters and cell volume of all the four compounds, fit into polynomial expression with respect to temperature, showed positive thermal expansion (PTE) up to 873 K.
Examinations of the irradiation behaviour of U3Si2 test fuel plates with low enrichment
International Nuclear Information System (INIS)
Muellauer, J.
1989-01-01
Five low-enriched (19.7% 235 U), high-density (4.7 gU/cm/ 3 ) U 3 Si 2 -test fuel plates (miniplates) with different fine grain contents have been qualified under irradiation. During the course of irradiation up to burnup of 63% 235 U depletion, no released fractions of gaseous or solid fission products from the fuel plate to the rig coolant were detected. The measured swelling rate of the fuel zone (meat) is less than 0.45% ΔV/10 20 fissions/cm 3 the blister-threshold temperature of the fuel plates is above 520 0 C. The favourable irradiation behavior of the U 3 Si 2 fuel plates was not influenced by using higher amounts of fine grained particles (40% [de
Determination of interstitial oxygen atom position in U2N3+xOy by near edge structure study
Jiang, A. K.; Zhao, Y. W.; Long, Z.; Hu, Y.; Wang, X. F.; Yang, R. L.; Bao, H. L.; Zeng, R. G.; Liu, K. Z.
2018-06-01
The determination of interstitial oxygen atom site in U2N3+xOy film could facilitate the understanding of the oxidation mechanism of α-U2N3 and the effect of U2N3+xOy on anti-oxidation. By comparing the similarities and variances between N K edge and O K edge electron energy loss spectra (EELS) for oxidized α-U2N3 and UO2, the present work looks at the local structure of nitrogen and oxygen atoms in U2N3+xOy film, identifying the most possible position of interstitial O atom.
SU(3)_C× SU(2)_L× U(1)_Y( × U(1)_X ) as a symmetry of division algebraic ladder operators
Furey, C.
2018-05-01
We demonstrate a model which captures certain attractive features of SU(5) theory, while providing a possible escape from proton decay. In this paper we show how ladder operators arise from the division algebras R, C, H, and O. From the SU( n) symmetry of these ladder operators, we then demonstrate a model which has much structural similarity to Georgi and Glashow's SU(5) grand unified theory. However, in this case, the transitions leading to proton decay are expected to be blocked, given that they coincide with presumably forbidden transformations which would incorrectly mix distinct algebraic actions. As a result, we find that we are left with G_{sm} = SU(3)_C× SU(2)_L× U(1)_Y / Z_6. Finally, we point out that if U( n) ladder symmetries are used in place of SU( n), it may then be possible to find this same G_{sm}=SU(3)_C× SU(2)_L× U(1)_Y / Z_6, together with an extra U(1)_X symmetry, related to B-L.
International Nuclear Information System (INIS)
Damunir
2007-01-01
The reaction kinetics aspect of U 3 O 8 kernel with gas H 2 on the characteristics of activation energy, reaction rate constant and O/U ratio of UO 2 kernel had been studied. U 3 O 8 kernel was reacted with gas H 2 in a reduction furnace at varied reaction time and temperature. The reaction temperature was varied at 600, 700, 750 and 850 °C with a pressure of 50 mmHg for 3 hours in gas N 2 atmosphere. The reation time was varied at 1, 2, 3 and 4 hours at a temperature of 750 °C using similar conditions. The reaction product was UO 2 kernel. The reaction kinetic aspect between U 3 O 8 and gas H 2 comprised the minimum activation energy (ΔE), the reaction rate constant and the O/U ratio of UO 2 kernel. The minimum activation energy was determined from a straight line slope of equation ln [{D b . R o {(1 - (1 - X b ) ⅓ } / (b.t.Cg)] = -3.9406 x 10 3 / T + 4.044. By multiplying with the straight line slope -3.9406 x 10 3 , the ideal gas constant (R) 1.985 cal/mol and the molarity difference of reaction coefficient 2, a minimum activation energy of 15.644 kcal/mol was obtained. The reaction rate constant was determined from first-order chemical reaction control and Arrhenius equation. The O/U ratio of UO 2 kernel was obtained using gravimetric method. The analysis result of reaction rate constant with chemical reaction control equation yielded reaction rate constants of 0.745 - 1.671 s -1 and the Arrhenius equation at temperatures of 650 - 850 °C yielded reaction rate constants of 0.637 - 2.914 s -1 . The O/U ratios of UO 2 kernel at the respective reaction rate constants were 2.013 - 2.014 and the O/U ratios at reaction time 1 - 4 hours were 2.04 - 2.011. The experiment results indicated that the minimum activation energy influenced the rate constant of first-order reaction and the O/U ratio of UO 2 kernel. The optimum condition was obtained at reaction rate constant of 1.43 s -1 , O/U ratio of UO 2 kernel of 2.01 at temperature of 750 °C and reaction time of 3
U.S. phosphate industry as a source of U3O8 to the year 2000
International Nuclear Information System (INIS)
Borg, I.Y.
1976-01-01
U 3 O 8 recovered as a by-product of the phosphate fertilizer industry may equal 3600-5200 tons by 1985 and represent 7-10 percent of the anticipated annual U.S. demand. If the enormous U.S. phosphate reserves and resources are mined primarily for their uranium content they appear sufficient to fill more than twice the projected cumulative U.S. demand to the year 2000
Post-irradiation examination of prototype Al-64 wt% U3Si2 fuel rods from NRU
International Nuclear Information System (INIS)
Sears, D.F.; Primeau, M.F.; Buchanan, C.; Rose, D.
1997-01-01
Three prototype fuel rods containing Al-64 wt% U 3 Si 2 (3.15 gU/cm 3 ) have been irradiated to their design burnup in the NRU reactor without incident. The fuel was fabricated using production-scale equipment and processes previously developed for Al-U 3 Si fuel fabrication at Chalk River Laboratories, and special equipment developed for U 3 Si 2 powder production and handling. The rods were irradiated in NRU up to 87 at% U-235 burnup under typical driver fuel conditions; i.e., nominal coolant inlet temperature 37 degrees C, inlet pressure 654 kPa, mass flow 12.4 L/s, and element linear power ratings up to 73 kW/m. Post-irradiation examinations showed that the fuel elements survived the irradiation without defects. Fuel core diametral increases and volumetric swelling were significantly lower than that of Al-61 wt% U 3 Si fuel irradiated under similar conditions. This irradiation demonstrated that the fabrication techniques are adequate for full-scale fuel manufacture, and qualified the fuel for use in AECL's research reactors
Transformation temperatures γU → δUZr2 Y γU →αU in U-Zr-Nb alloys
International Nuclear Information System (INIS)
Komar Varela, Carolina L.; Arico, Sergio F.; Gribaudo, Luis M.; Comision Nacional de Energia Atomica, General San Martin
2009-01-01
The international RERTR program has as primary objective the development of new fuels for research and test reactors to satisfy the requirement of low enrichment in 235 U (lower than 20 %). It is known that the cubic-phase (γU) has an excellent behaviour under irradiation. In this context, in the Materials Department (GIDAT-GAEN-CNEA) U-Zr-Nb alloys are considered candidates for the development of a high-density monolithic-type nuclear fuel. It is necessary to evaluate the thermodynamic parameters that allow to obtain a range of concentrations of the U-Zr-Nb system in which this phase can be retained in the metastable condition with the required 235 U density. In this work, eight U alloys with concentrations ranging from 13.9 to 43.7 wt.% Zr and from 0 to 6.4 wt.% Nb, were fabricated. Dynamical measurements of electrical resistivity, with a cooling rate of 4 o C/min, were performed and the results were analyzed. Considering this cooling rate, a Nb concentration of at least 17.8 wt. % would inhibit the transformation γU→ δUZr 2 and a concentration of al least 23.3 wt % would inhibit the γU → αU transformation. (author)
Thermal Characteristic Of AIMg2 Cladding And Fuel Plates Of U3Si2-Al With Various Uranium Loading
International Nuclear Information System (INIS)
Aslina, Br. G.; Suparjo; Aggraini, D.; Hasbullah, N.
1998-01-01
Thermal characteristic analyzed in this paper included linear expansion value, coefficient expansion, and enthalpy of cladding material fuel core and fuel plate of U 3 Si 2 -AI. Before analyzing, the fresh cladding of AIMg2 (without treatment) and the rolled AIMg2 were annealed at temperature of 425 o C for 1 hour, and the fuel plates of U 3 Si 2 -AI was prepared for various uranium loading of 0.9 - 3.6 - 4.2 - 4.8 and 5.2 g/cm 3 . Linear expansion nominal value and expansion coefficient were analyzed by using Dilatometer whereas enthalpy determination used Differential Thermal Analysis (DTA). The linear expansion and expansion coefficient analysis was performed to study the dimension cladding and of fuel plates during their stay in the reactor core, whereas determination of enthalpy was carried out to estimate the energy absorbed and released by fuel meat of U 3 Si 2 -AI to the cooling water through AlMg2 as a cladding. The result showed that the linear expansion and expansion coefficient of fresh AIMg2 cladding, rolled AIMg2 and fuel plates of U 3 Si 2 -AI are increased with the increase of temperature as well as the increase of uranium loading. The enthalpy measure showed that the enthalpy of fresh AIMg2 is smaller than that of rolled AIMg2 but melting temperature of fresh AIMg2 is greater than that of rolled AIMg2. The enthalpy of fuel plates and meat of U 3 Si 2 -AI is less than that of plates of U 3 Si 2 -AI. The enthalpy of fuel platers and meat of U 3 Si 2 -AI decrease with the increase of uranium loading. It is concluded that the fuel meat more reactive than fuel plates of U 3 Si 2 -AI
Mechanical behaviour of U3O8-Al cermets
International Nuclear Information System (INIS)
Figueredo, A.M. de; Ferreira, I.
1981-01-01
Homogeneous, high density U 3 O 8 -Al cermets, containing between 5 W% and 55 Wt% of U 3 ω 8 were fabricated using hot swaging and powder metallurgy technics. Tensile tests were performed at room temperature on specimens obtained from the cermets fabricated. The results show that the ultimate tensile strength (UTS) and elongation to fracture decrease with increasing U 3 O 8 in the cermet. The UTS is shown to be proportional to the minimum matrix load bearing cross-sectional area. The main influence of an increase in the content of U 3 O 8 in the cermet appears to be the decrease in the minimum matrix, load bearing cross-section. (Author) [pt
2010-01-01
... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... Standards for Florida Avocados Grades § 51.3053 U.S. No. 3. “U.S. No. 3” consists of avocados of similar...
Preparation and melting of uranium from U3O8
International Nuclear Information System (INIS)
Hur, Jin-Mok; Choi, In-Kyu; Cho, Soo-Haeng; Jeong, Sang-Mun; Seo, Chung-Seok
2008-01-01
In this paper, we report on the preparation and melting of uranium in association with a spent nuclear fuel conditioning process. U 3 O 8 powder was electrochemically reduced in a mixture of molten LiCl-Li 2 O (∼3 wt.% of Li 2 O in LiCl) at 650 deg. C resulting in the formation of uranium and Li 2 O with a yield of >99%. When the powder of uranium with a residual LiCl-Li 2 O salt was heated in order to melt the metal, the uranium oxidation to UO 2 due to the reaction with Li 2 O was observed. We were able to synthesize FeU 6 by using a Fe based cathode during the U 3 O 8 reduction procedure. FeU 6 could be melted to below the temperatures where the oxidation of uranium by Li 2 O occurred. The idea of compound formation and melting is applicable to the melting and casting of a spent nuclear fuel which contains oxidative residual salts due to its conditioning in a molten salt
Directory of Open Access Journals (Sweden)
Chun-Yu Chen
2017-04-01
Full Text Available The NOD-like receptor pyrin domain 3 (NLRP3 inflammasome contains Nod-like receptors, a subclass of pattern recognition receptors, suggesting that this complex has a prominent role in host defenses. Various structurally diverse stimulators activate the NLRP3 inflammasome through different signaling pathways. We previously reported that ugonin U (UgU, a natural flavonoid isolated from Helminthostachys zeylanica (L Hook, directly stimulates phospholipase C (PLC and triggers superoxide release in human neutrophils. In the present study, we showed that UgU induced NLRP3 inflammasome assembly and subsequent caspase-1 and interleukin (IL-1β processing in lipopolysaccharide-primed human monocytes. Moreover, UgU elicited mitochondrial superoxide generation in a dose-dependent manner, and a specific scavenger of mitochondrial reactive oxygen species (ROS diminished UgU-induced IL-1β and caspase-1 activation. UgU induced Ca2+ mobilization, which was inhibited by treatment with inhibitors of PLC or inositol triphosphate receptor (IP3R. Blocking Ca2+ mobilization, PLC, or IP3R diminished UgU-induced IL-1β release, caspase-1 activation, and mitochondrial ROS generation. These data demonstrated that UgU activated the NLPR3 inflammasome activation through Ca2+ mobilization and the production of mitochondrial ROS. We also demonstrated that UgU-dependent NLRP3 inflammasome activation enhanced the bactericidal function of human monocytes. The ability of UgU to stimulate human neutrophils and monocytes, both of which are professional phagocytes, and its capacity to activate the NLRP3 inflammasome, which is a promising molecular target for developing anti-infective medicine, indicate that UgU treatment should be considered as a possible novel therapy for treating infectious diseases.
Structure of tris(trimethylsilylcyclopentadienyl)uranium(III), [(CH3)3SiC5H43U
International Nuclear Information System (INIS)
Brennan, J.; Andersen, R.A.; Zalkin, A.
1986-02-01
Crystals of [(CH 3 ) 3 SiC 5 H 4 ] 3 U are orthorhombic, Pbca, with a = 22.630(8), b = 29.177(10) and c = 8.428(3) A at 23 0 C. For Z = 8 the calculated density is 1.551 g/cm 3 . The structure was refined by full-matrix least-squares to a conventional R factor of 0.041 [2251 data, F 2 > 2 sigma(F 2 )]. The uranium atom is bonded to the three cyclopentadienyl rings in a pentahapto fashion and is in the plane of the ring centroids. The U to ring distances are 2.54, 2.47 and 2.51 A, and the average U-C distance is 2.78 +- 0.04 A. 7 refs., 1 fig., 3 tabs
Drosophila SMN complex proteins Gemin2, Gemin3, and Gemin5 are components of U bodies
International Nuclear Information System (INIS)
Cauchi, Ruben J.; Sanchez-Pulido, Luis; Liu, Ji-Long
2010-01-01
Uridine-rich small nuclear ribonucleoproteins (U snRNPs) play key roles in pre-mRNA processing in the nucleus. The assembly of most U snRNPs takes place in the cytoplasm and is facilitated by the survival motor neuron (SMN) complex. Discrete cytoplasmic RNA granules called U bodies have been proposed to be specific sites for snRNP assembly because they contain U snRNPs and SMN. U bodies invariably associate with P bodies, which are involved in mRNA decay and translational control. However, it remains unknown whether other SMN complex proteins also localise to U bodies. In Drosophila there are four SMN complex proteins, namely SMN, Gemin2/CG10419, Gemin3 and Gemin5/Rigor mortis. Drosophila Gemin3 was originally identified as the Drosophila orthologue of human and yeast Dhh1, a component of P bodies. Through an in silico analysis of the DEAD-box RNA helicases we confirmed that Gemin3 is the bona fide Drosophila orthologue of vertebrate Gemin3 whereas the Drosophila orthologue of Dhh1 is Me31B. We then made use of the Drosophila egg chamber as a model system to study the subcellular distribution of the Gemin proteins as well as Me31B. Our cytological investigations show that Gemin2, Gemin3 and Gemin5 colocalise with SMN in U bodies. Although they are excluded from P bodies, as components of U bodies, Gemin2, Gemin3 and Gemin5 are consistently found associated with P bodies, wherein Me31B resides. In addition to a role in snRNP biogenesis, SMN complexes residing in U bodies may also be involved in mRNP assembly and/or transport.
Drosophila SMN complex proteins Gemin2, Gemin3, and Gemin5 are components of U bodies
Energy Technology Data Exchange (ETDEWEB)
Cauchi, Ruben J.; Sanchez-Pulido, Luis [MRC Functional Genomics Unit, Department of Physiology, Anatomy and Genetics, University of Oxford, Oxford OX1 3QX (United Kingdom); Liu, Ji-Long, E-mail: jilong.liu@dpag.ox.ac.uk [MRC Functional Genomics Unit, Department of Physiology, Anatomy and Genetics, University of Oxford, Oxford OX1 3QX (United Kingdom)
2010-08-15
Uridine-rich small nuclear ribonucleoproteins (U snRNPs) play key roles in pre-mRNA processing in the nucleus. The assembly of most U snRNPs takes place in the cytoplasm and is facilitated by the survival motor neuron (SMN) complex. Discrete cytoplasmic RNA granules called U bodies have been proposed to be specific sites for snRNP assembly because they contain U snRNPs and SMN. U bodies invariably associate with P bodies, which are involved in mRNA decay and translational control. However, it remains unknown whether other SMN complex proteins also localise to U bodies. In Drosophila there are four SMN complex proteins, namely SMN, Gemin2/CG10419, Gemin3 and Gemin5/Rigor mortis. Drosophila Gemin3 was originally identified as the Drosophila orthologue of human and yeast Dhh1, a component of P bodies. Through an in silico analysis of the DEAD-box RNA helicases we confirmed that Gemin3 is the bona fide Drosophila orthologue of vertebrate Gemin3 whereas the Drosophila orthologue of Dhh1 is Me31B. We then made use of the Drosophila egg chamber as a model system to study the subcellular distribution of the Gemin proteins as well as Me31B. Our cytological investigations show that Gemin2, Gemin3 and Gemin5 colocalise with SMN in U bodies. Although they are excluded from P bodies, as components of U bodies, Gemin2, Gemin3 and Gemin5 are consistently found associated with P bodies, wherein Me31B resides. In addition to a role in snRNP biogenesis, SMN complexes residing in U bodies may also be involved in mRNP assembly and/or transport.
Scalar mesons and glueballs in a chiral U(3)xU(3) quark model with 't Hooft interaction
International Nuclear Information System (INIS)
Nagy, M.; Volkov, M.K.; Yudichev, V.L.
2000-01-01
In a U(3)xU(3) quark chiral model of the Nambu-Jona-Lasino (NJL) type with the 't Hooft interaction, the ground scalar isoscalar mesons and a scalar glueball are described. The glueball (dilaton) is introduced into the effective meson Lagrangian written in a chirally symmetric form on the basis of scale invariance. The singlet-octet mixing of scalar isoscalar mesons and their mixing with the glueball are taken into account. Mass spectra of the scalar mesons and glueball and their strong decays are described
Spectroscopy and electrochemistry of U(IV/III) in basic AlCl3-EMIC
International Nuclear Information System (INIS)
Anderson, C.J.; Deakin, M.R.; Choppin, G.R.; Heerman, L.; D'Olieslager, W.; Pruett, D.J.
1990-01-01
The electrochemistry of U(IV) has been investigated in the solvent AlCl 3 -1-ethyl-3-methyl imidazolium chloride (EMIC), a room temperature ionic liquid. In basic solutions ( 3 ) the reduction of U(IV) to U(III) on glassy carbon electrodes is reversible. Spectroscopic data as well as measurements of the formal potential for U(IV)/U(III) as a function of the basic melt composition indicate that U(IV) and U(III) are both hexachloro anions. Diffusion coefficients for these species have been measured by two methods. The values are comparable to those of transition metal hexachloro complexes in the same solvent, supporting the assignment of UCl 6 2- and UCl 6 3-
Evaluation of covariances for resolved resonance parameters of 235U, 238U, and 239Pu in JENDL-3.2
International Nuclear Information System (INIS)
Kawano, Toshihiko; Shibata, Keiichi
2003-02-01
Evaluation of covariances for resolved resonance parameters of 235 U, 238 U, and 239 Pu was carried out. Although a large number of resolved resonances are observed for major actinides, uncertainties in averaged cross sections are more important than those in resonance parameters in reactor calculations. We developed a simple method which derives a covariance matrix for the resolved resonance parameters from uncertainties in the averaged cross sections. The method was adopted to evaluate the covariance data for some important actinides, and the results were compiled in the JENDL-3.2 covariance file. (author)
U3Si2 behavior in H2O environments: Part II, pressurized water with controlled redox chemistry
Nelson, A. T.; Migdisov, A.; Wood, E. Sooby; Grote, C. J.
2018-03-01
Recent interest in U3Si2 as an advanced light water reactor fuel has driven assessment of numerous properties, but characterization of its response to H2O environments is sparse in available literature. The behavior of U3Si2 in H2O containing atmospheres is investigated and presented in a two-part series of articles. This work examines the behavior of U3Si2 following exposure to pressurized H2O at temperatures from 300 to 350 °C. Testing was performed using two autoclave configurations and multiple redox conditions. Use of solid state buffers to attain a controlled water chemistry is also presented as a means to test actinide-bearing systems. Buffers were used to vary the hydrogen concentration between 1 and 30 parts per million H2. Testing included UN, U3Si5, and UO2. Both UN and U3Si5 were found to rapidly pulverize in less than 50 h at 300 °C. Uranium dioxide was included as a control for the autoclave system, and was found to be minimally impacted by exposure to pressurized water at the conditions tested for extended time periods. Testing of U3Si2 at 300 °C found reasonable stability through 30 days in 1-5 ppm H2. However, pulverization was observed following 35 days. The redox condition of testing strongly affected pulverization. Characterization of the resulting microstructures suggests that the mechanism responsible for pulverization under more strongly reducing conditions differs from that previously identified. Hydride formation is hypothesized to drive this transition. Testing performed at 350 °C resulted in rapid pulverization of U3Si2 in under 50 h.
Influence of Fuel Meat Porosity on Heat Capacities of Fuel Element Plate U3Si2-Al
International Nuclear Information System (INIS)
Ginting, Aslina Br.; Supardjo; Sutri Indaryati
2007-01-01
Analyze of heat capacities of Al powder, AIMg 2 cladding, U 3 Si 2 powder and PEB U 3 Si 2 -Al with the meat porosity of 4.9; 5.53 ; 6.25 ; 6.95 %; 7.90; 8.66% have been done. Analysis was conducted by using Differential Scanning Calorimeter (DSC) at temperature 30℃ to 450℃ with heating rate 1℃ /minute in Argon gas media. The purpose of analyze is to know the influence of increasing of fuel meat porosity on heat capacities because increasing of percentage of meat porosity will cause degradation the of heat capacities of PEB U 3 Si 2 -Al. Result of analysis showed that the heat capacities of Al powder, AIMg 2 cladding increase by temperature, while heat capacities of U 3 Si 2 powder was stable with increasing of temperature up to 450℃. Analysis of heat capacities toward PEB U 3 Si 2 -Al indicate that increasing of fuel meat porosity of caused degradation of the heat capacities of PEB U 3 Si 2 -Al. Data obtained were expected to serve the purpose of input to fabricator of research reactor fuel in for design of fuel element type silicide with high loading. (author)
Spark plasma sintering and microstructural analysis of pure and Mo doped U3Si2 pellets
Lopes, Denise Adorno; Benarosch, Anna; Middleburgh, Simon; Johnson, Kyle D.
2017-12-01
U3Si2 has been considered as an alternative fuel for Light Water Reactors (LWRs) within the Accident Tolerant Fuels (ATF) initiative, begun after the Fukushima-Daiichi Nuclear accidents. Its main advantages are high thermal conductivity and high heavy metal density. Despite these benefits, U3Si2 presents an anisotropic crystallographic structure and low solubility of fission products, which can result in undesirable effects under irradiation conditions. In this paper, spark plasma sintering (SPS) of U3Si2 pellets is studied, with evaluation of the resulting microstructure. Additionally, exploiting the short sintering time in SPS, a molybdenum doped pellet was produced to investigate the early stages of the Mo-U3Si2 interaction, and analyze how this fission product is accommodated in the fuel matrix. The results show that pellets of U3Si2 with high density (>95% TD) can be obtained with SPS in the temperature range of 1200°C-1300 °C. Moreover, the short time employed in this technique was found to generate a unique microstructure for this fuel, composed mainly of closed nano-pores (uranium with small quantities of dissolved Si and Mo at the front of the reaction.
International Nuclear Information System (INIS)
Hoeppe, Henning A.; Daub, Michi
2012-01-01
The catena-metaphosphates of tetravalent cerium and tetravalent uranium were obtained as phase pure crystalline powders by reaction of the respective dioxides with phosphoric acid at 500 C. Ce(PO 3 ) 4 and U(PO 3 ) 4 crystallise in space group C2/c (Z = 16, a Ce = 13.7696(3) Aa, b Ce = 29.7120(7) Aa, c Ce = 8.9269(2) Aa, β Ce = 90.00(1) Aa 3 and a U = 13.786(3) Aa, b U = 29.843(6) Aa, c U = 8.9720(18) Aa, β U = 90.01(3) Aa 3 ). The vibrational and optical spectra of pale yellow Ce(PO 3 ) 4 and emerald-greenish U(PO 3 ) 4 are also reported. (orig.)
Solid state reactions of MoO3 and Na2MoO4 with (U.85,Ce.15)O2x
International Nuclear Information System (INIS)
Dahale, N.D.; Keskar, Meera; Singh Mudher, K.D.; Chawla, K.L.
1999-01-01
(U .85 ,Ce .15 )MoO 6-x was prepared by the solid state reactions of (U .85 ,Ce .15 )O 2±x with MoO 3 in air at 600 deg C. Solid state reactions of Na 2 MoO 4 with (U .85 ,Ce .15 )MoO 6.x up to 550 deg C in air led to the formation of Na 2 (U .85 ,Ce .15 )Mo 2 O 10-x and Na 2 (U .85 , Ce .15 ) 2 Mo 3 O 16-x . These compounds were characterised by x-ray and thermal methods. The x-ray powder data of (U .85 , Ce .15 ) MoO 6-x were indexed on monoclinic system whereas, data of Na 2 (U .85 ,Ce .15 ) Mo 2 O 10-x and Na 2 (U .85 ,Ce .15 ) 2 Mo 3 O 16-x were indexed on orthorhombic and monoclinic system respectively. (author)
238U, 234U and 232Th in seawater
International Nuclear Information System (INIS)
Chen, J.H.; Edwards, R.L.; Wasserburg, G.J.
1986-01-01
We have developed techniques to determine 238 U, 234 U and 232 Th concentrations in seawater by isotope dilution mass spectrometry. Using these techniques, we have measured 238 U, 234 U and 232 Th in vertical profiles of unfiltered, acidified seawater from the Atlantic and 238 U and 234 U in vertical profiles from the Pacific. Determinations of 234 U/ 238 U at depths ranging from 0 to 4900 m in the Atlantic (7 0 44'N, 40 0 43'W) and the Pacific (14 0 41'N, 160 0 01'W) Oceans are the same within experimental error (±5per mille, 2σ). The average of these 234 U/ 238 U measurements is 144±2per mille (2σ) higher than the equilibrium ratio of 5.472 x 10 -5 . U concentrations, normalized to 35per mille salinity, range from 3.162 to 3.281 ng/g, a range of 3.8%. The average concentration of the Pacific samples (31 0 4'N, 159 0 1'W) is ∝1% higher than that of the Atlantic (7 0 44'N, 40 0 43'W and 31 0 49'N, 64 0 6'W). 232 Th concentrations from an Atlantic profile range from 0.092 to 0.145 pg/g. The observed constancy of the 234 U/ 238 U ratio is consistent with the predicted range of 234 U/ 238 U using a simple two-box model and the residence time of deep water in the ocean determined from 14 C. The variation in salinity-normalized U concentrations suggests that U may be much more reactive in the marine environment than previously thought. (orig./WB)
Preparation methods of U3O8 powder for MTR fuel elements
International Nuclear Information System (INIS)
Leal Neto, R.M.; Riella, H.G.
1990-01-01
Three preparation methods of U 3 O 8 powder have been studied with the aim of finding a simple and economic processing route: grinding of sintered U 3 O 8 pellets (Method-1); sintering of U 3 O 8 calcined granules (Method-2); and sintering of ammonium diuranate (ADU) granules (Method-3). Granulometric yield, powder characteristics and processing steps and difficulties have been taken into account for comparison purposes. Method-2 have been found to give the best results. Method-3 gives also good results, but there were some difficulties with ADU handling. (author) [pt
The Influence of Oxidation on the Quality of U3O8 Kernels
International Nuclear Information System (INIS)
Damunir; Sukarsono; Indra Suryawan
2002-01-01
The influence of oxidation on quality of U 3 O 8 kernels have been studied. The investigated the influence was changed of time and temperature oxidation of Uranyl-4(ammonia)-2(polyvinyl alcohol) gel on surface area, pore radius, pore volume, porosity and diameter size of U 3 O 8 kernel. The spherical of uranyl-4(ammonia)-2(polyvinyl alcohol) containing 150g U/l were oxidized at 200-800 o C temperature for 2-24 hours, formed U 3 O 8 kernel. After that, the quality of U 3 O 8 kernel were measured by their physical properties i.e. the surface area and pore radius using Surface areameter with N 2 gas as absorbent. The pore volume and porosity using pycnometer with aquabidest of water as a solvent, diameter size using a optical microscope. The experiment results, showed that the time and temperature oxidation of uranyl-4(ammonia)-2(polyvinyl alcohol) grain the influence to quality of U 3 O 8 in formed the surface area of specific, pore radius, pore volume of specific, porosity, and diameter size of U 3 O 8 kernel. The best accurred at 600-800 o C oxidation temperature and oxidation time was 2-5 hours. The resulted quality of U 3 O 8 kernel i.e surface area of specific was 10.84 - 5.99 m 2 /g, pore volume of specific was 10.35x10 -2 - 3.23x10 -2 cc/g, pore radius was 21.05 - 24.62 Angstrom, diameter size was 1264 - 1456 μm and porosity was 49.49 - 21.36 % Vol with Cumulative analysis error was 8.55 % Vol. (author)
195Pt and 119Sn Knight shifts of U3Pt3Sn4
International Nuclear Information System (INIS)
Kojima, K.; Takabatake, T.; Harada, A.; Hihara, T.
1995-01-01
The 195 Pt and 119 Sn Knight shifts in U 3 Pt 3 Sn 4 have been measured in the temperature range 4.2-298K. They exhibit Curie-Weiss like behaviors above about 50K and remain constant below about 10K. This suggests that the deviation of χ(T) from the modified Curie-Weiss law is an intrinsic property of U 3 Pt 3 Sn 4 . ((orig.))
Hydrogeologic Characterization of the U-3bl Collapse Zone
International Nuclear Information System (INIS)
NSTec Geotechnical Services
2006-01-01
The U-3bl collapse crater was formed by an underground nuclear test in August 1962. This crater and the adjoining U-3ax crater were subsequently developed and used as a bulk low-level radioactive waste disposal cell (U-3ax/bl), which is part of the Area 3 Radioactive Waste Management Site at the Nevada Test Site (NTS). Various investigations have been conducted to assess the hydrogeologic characteristics and properties in the vicinity of the U-3ax/bl waste disposal cell. This report presents data from one of these investigations, conducted in 1996. Also included in this report is a review of pertinent nuclear testing records, which shows that the testing operations and hydrogeologic setting of the U-3ax/bl site were typical for the period and location of testing. Borehole U-3bl-D2 is a 45-degree-angle hole drilled from the edge of the crater under the waste cell to intercept the U-3bl collapse zone, the disturbed alluvium between the crater (surface collapse sink) and the nuclear test cavity. A casing-advance system with an air percussion hammer was used to drill the borehole, and air was used as the drilling fluid. Properties of the U-3bl crater collapse zone were determined from cores collected within the interval, 42.1 to 96.6 meters (138 to 317 feet) below the ground surface. Selected core samples were analyzed for particle density, particle size, bulk density, water retention, hydraulic conductivity, water content, water potential, chloride, carbonate, stable isotopes, and tritium. Physical and hydraulic properties were typical of alluvial valley sediments at the NTS. No visual evidence of preferential pathways for water transport was observed in the core samples. Soil parameters showed no trends with depth. Volumetric water content values ranged from 0.08 to 0.20 cubic meters per cubic meter, and tended to increase with depth. Water-retention relations were typical for soils of similar texture. Water potentials ranged from -1.9 MegaPascals at a depth of 42
Irradiation damage in U{sub 3}Si
Energy Technology Data Exchange (ETDEWEB)
MacEwan, J R; Bethune, B
1969-04-15
The ordered body-centered tetragonal structure of U{sub 3}S1 transforms allotropically or by irradiation damage to ordered and disordered face -centered cubic structures respectively. An exposure of about 6 x 10{sup 16} fissions/cm{sup 3} at 100{sup o}C produced X-ray diffraction patterns of the cubic form with a 0.6% decrease in X-ray density. However, immersion density measurements showed a volume increase of 2.3% at a similar exposure. Further irradiation removed all but two peaks from the diffraction pattern indicating a trend to an amorphous structure. Electrical resistivity measurements showed that U{sub 3}Si is an electronic conductor with a large positive temperature coefficient. Measurements made below the irradiation temperature of 100{sup o}C showed that the temperature coefficient decreased with irradiation and approached zero at high exposure, Amorphous materials have a negligible temperature coefficient, so the result confirms the trend observed by X-ray analyses. (author)
Convergence of exterior solutions to radial Cauchy solutions for $\\partial_t^2U-c^2\\Delta U=0$
Directory of Open Access Journals (Sweden)
Helge Kristian Jenssen
2016-09-01
Full Text Available Consider the Cauchy problem for the 3-D linear wave equation $\\partial_t^2U-c^2\\Delta U=0$ with radial initial data $U(0,x=\\Phi(x=\\varphi(|x|$, $U_t(0,x=\\Psi(x=\\psi(|x|$. A standard result states that $U$ belongs to $C([0,T];H^s(\\mathbb{R}^3$ whenever $(\\Phi,\\Psi\\in H^s\\times H^{s-1}(\\mathbb{R}^3$. In this article we are interested in the question of how U can be realized as a limit of solutions to initial-boundary value problems on the exterior of vanishing balls $B_\\varepsilon$ about the origin. We note that, as the solutions we compare are defined on different domains, the answer is not an immediate consequence of $H^s$ well-posedness for the wave equation.
Oxidation of uraninite: does tetragonal U3O7 occur in nature?
International Nuclear Information System (INIS)
Janeczek, J.; Ewing, R.C.; Thomas, L.E.
1993-01-01
Samples of uraninite and pitchblende annealed at 1200 C in H 2 , and untreated pitchblende were sequentially oxidized in air at 180-190 C, 230 C, and 300 C. Uraninite and untreated pitchblende oxidized to the U 4 O 9 -type oxide, and their X-ray symmetry remained isometric up to 300 C. Reduced pitchblende after oxidation to UO 2+x and U 4 O 9 -type oxides transformed into α-U 3 O 8 at 300 C. Two major mechanisms control uraninite and untreated pitchblende stability during oxidation: (1) Th and/or REE maintain charge balance and block oxygen interstitials near impurity cations; (2) the uraninite structure saturates with respect to excess oxygen and radiation-induced oxygen interstitials. Untreated pitchblende during oxidation behaved similarly to irradiated UO 2 in spent nuclear fuel; whereas, reduced pitchblende resembled nonirradiated UO 2 . An analysis of the data in the literature, as well as our own efforts to identify U 3 O 7 in samples from Cigar Lake, Canada, failed to provide conclusive evidence of the natural occurrence of tetragonal α-U 3 O 7 . Most probably, reported occurrences of U 3 O 7 are mixtures of isometric uraninites of slightly different compositions. (orig.)
International Nuclear Information System (INIS)
Scapin, Marcos A.; Guilhen, Sabine N.; Azevedo, Luciana C. de; Cotrim, Marycel E.B.; Pires, Maria Ap. F.
2017-01-01
The determination of silicon (Si), total uranium (U) and impurities in uranium-silicide (U 3 Si 2 ) samples by wavelength dispersion X-ray fluorescence technique (WDXRF) has been already validated and is currently implemented at IPEN's X-Ray Fluorescence Laboratory (IPEN-CNEN/SP) in São Paulo, Brazil. Sample preparation requires the use of approximately 3 g of H 3 BO 3 as sample holder and 1.8 g of U 3 Si 2 . However, because boron is a neutron absorber, this procedure precludes U 3 Si 2 sample's recovery, which, in time, considering routinely analysis, may account for significant unusable uranium waste. An estimated average of 15 samples per month are expected to be analyzed by WDXRF, resulting in approx. 320 g of U 3 Si 2 that would not return to the nuclear fuel cycle. This not only impacts in production losses, but generates another problem: radioactive waste management. The purpose of this paper is to present the mathematical models that may be applied for the correction of systematic errors when H 3 BO 3 sample holder is substituted by cellulose-acetate {[C 6 H 7 O 2 (OH) 3-m (OOCCH 3 )m], m = 0∼3}, thus enabling U 3 Si 2 sample’s recovery. The results demonstrate that the adopted mathematical model is statistically satisfactory, allowing the optimization of the procedure. (author)
The [U{sub 2}F{sub 12}]{sup 2-} anion of Sr[U{sub 2}F{sub 12}
Energy Technology Data Exchange (ETDEWEB)
Scheibe, Benjamin; Pietzonka, Clemens; Conrad, Matthias; Kraus, Florian [Fachbereich Chemie, Philipps-Universitaet Marburg (Germany); Mustonen, Otto; Karppinen, Maarit; Karttunen, Antti J. [Department of Chemistry, Aalto University (Finland); Atanasov, Mihail; Neese, Frank [Max-Planck Institute for Chemical Energy Conversion, Muelheim an der Ruhr (Germany)
2018-03-05
The D{sub 2h}-symmetric dinuclear complex anion [U{sub 2}F{sub 12}]{sup 2-} of pastel green Sr[U{sub 2}F{sub 12}] shows a hitherto unknown structural feature: The coordination polyhedra around the U atoms are edge-linked monocapped trigonal prisms, the U{sup V} atoms are therefore seven-coordinated. This leads to a U-U distance of 3.8913(6) Aa. A weak U{sup V}-U{sup V} interaction is observed for the dinuclear [U{sub 2}F{sub 12}]{sup 2-} complex and described by the antiferromagnetic exchange J{sub exp} of circa -29.9 cm{sup -1}. The crystalline compound can be easily prepared from SrF{sub 2} and β-UF{sub 5} in anhydrous hydrogen fluoride (aHF) at room temperature. It was studied by means of single crystal X-ray diffraction, IR, Raman and UV/VIS spectroscopy, magnetic measurements, and by molecular as well as by solid-state quantum chemical calculations. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Photochemistry of U(BH4)4 and U(BD4)4
International Nuclear Information System (INIS)
Paine, R.T.; Schonberg, P.R.; Light, R.W.; Danen, W.C.; Freund, S.M.
1979-01-01
U(BH 4 ) 4 and U(BD 4 ) 4 are observed to undergo complex degradation reactions promoted by broadband UV radiation. The primary products of these reactions appear to be U(BH 4 ) 3 , B 2 H 6 , H 2 , U(BD 4 ) 3 , B 2 D 6 and D 2 . Further, U(BD 4 ) 4 undergoes a related decomposition reaction under the influence of CO 2 laser irradiation at 924.97 cm -1 . (author)
Thermal properties of KUO3(s) and K2U2O7 - by high temperature Calvet calorimeter
International Nuclear Information System (INIS)
Jayanthi, K.; Iyer, V.S.; Venugopal, V.
1998-01-01
The thermal properties of KUO 3 (s) and K 2 U 2 O 7 (s) were determined using a high temperature Calvet calorimeter by drop method. The enthalpy increments, (H T o - H 298.15 0 ), in kJ/mol for KUO 3 (s) and K 2 U 2 O 7 (s) can be represented by, H T o - H 298.15 0 KUO 3 (s) kJ/mol ± 0.7 = -39.15 + 0.129T + 0.1005x10 -4 T 2 (369-714K) and H T o -H 298.15 0 K 2 U 2 O 7 (s) kJ/mol ± 0.7 = -52.99 + 0.1361T + 0.146x10 -3 T 2 (391 - 683K). (author)
12 CFR 211.3 - Foreign branches of U.S. banking organizations.
2010-01-01
... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Foreign branches of U.S. banking organizations. 211.3 Section 211.3 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Operations of U.S. Banking...
Oxidation behaviour of plutonium rich (U, Pu)C and (U, Pu)O{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Sali, S.K., E-mail: sksali@barc.gov.in [Fuel Chemistry Division (India); Kulkarni, N.K.; Phatak, Rohan [Fuel Chemistry Division (India); Agarwal, Renu [Product Development Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India)
2016-10-15
Oxidation behaviour of (U{sub 0.3}Pu{sub 0.7})C{sub 1.06} was investigated in air by heating samples up to 1073 K and 1273 K. Thermogravimetry (TG) of the samples and X-ray powder diffraction (XRD) of the intermediate products were used to understand the phenomenon taking place during this process. Theoretical calculations were carried out to understand the multiple phase changes taking place during oxidation of carbide. Theoretical results were validated by XRD analysis of the products obtained at different stages of oxidation. The final oxidized products were found to be a single FCC phase with O/M = 2.15 (M = U + Pu). Oxidation kinetic studies of (U{sub 0.3}Pu{sub 0.7})O{sub 2} and (U{sub 0.47}Pu{sub 0.53})O{sub 2} were carried out in dry air, using thermogravimetry, under non-isothermal conditions. The activation energy of oxidation was found to be 49 and 70 kJ/mol, respectively. Lattice parameter dependence on Pu/M and O/M of plutonium rich mixed oxide (MOX) was established using combined results of XRD and TG analysis of (U{sub 0.3}Pu{sub 0.7})O{sub 2+x} and (U{sub 0.47}Pu{sub 0.53})O{sub 2+x}.
U3O8 powder from uranyl-loaded cation exchange resin
International Nuclear Information System (INIS)
Mosley, W.C.
1985-01-01
Large batches of U 3 O 8 , suitable for powder metallurgy fabrication of Al-U 3 O 8 cores for reactor fuel tubes, have been produced by deep-bed calcination of granular uranyl-loaded macroporous sulfonate cation exchange resin at 900 to 950 0 C in air. Deep-bed calcination is the backup process for the reference process of rotary calcination and sintering. These processes are to be used for recycling uranium, and to produce U 3 O 8 in the Fuel Production Facility to be built at the Savannah River Plant. 2 refs., 6 figs
Structural stability and fission product behaviour in U{sub 3}Si
Energy Technology Data Exchange (ETDEWEB)
Middleburgh, S.C., E-mail: simon.middleburgh@hotmail.co.uk [IME, Australian Nuclear Science and Technology Organisation, Lucas Heights, New South Wales (Australia); Westinghouse Electric Sweden AB, SE-72163 Västerås (Sweden); Burr, P.A. [Department of Materials, Imperial College London, South Kensington, London SW7 2AZ (United Kingdom); King, D.J.M.; Edwards, L.; Lumpkin, G.R. [IME, Australian Nuclear Science and Technology Organisation, Lucas Heights, New South Wales (Australia); Grimes, R.W. [Department of Materials, Imperial College London, South Kensington, London SW7 2AZ (United Kingdom)
2015-11-15
The crystalline and amorphous structures of U{sub 3}Si have been investigated using density functional theory techniques for the first time. The effects of disorder and the impact of fission products has been separated to understand the swelling characteristics of U{sub 3}Si in both crystalline and amorphous U{sub 3}Si. Initially, the stability of the three experimentally observed polymorphs of U{sub 3}Si were explored. Subsequently, we modelled the amorphous U{sub 3}Si system and conclude that initial increase in volume observed experimentally at low temperature corresponds well with the volume change that occurs with the observed amorphisation of the material. The solubility of Xe and Zr into both the crystalline and amorphous systems was subsequently investigated.
Estimation of covariances of 16O, 23Na, Fe, 235U, 238U and 239Pu neutron nuclear data in JENDL-3.2
International Nuclear Information System (INIS)
Shibata, Keiichi; Nakajima, Yutaka; Kawano, Toshihiko; Oh, Soo-Youl; Matsunobu, Hiroyuki; Murata, Toru.
1997-10-01
Covariances of nuclear data have been estimated for 6 nuclides contained in JENDL-3.2. The nuclides considered are 16 O, 23 Na, Fe, 235 U, 238 U, and 239 Pu, which are regarded as important for the nuclear design study of fast reactors. The physical quantities for which covariances are deduced are cross sections, resolved and unresolved resonance parameters, and the first order Legendre-polynomial coefficient for the angular distribution of elastically scattered neutrons. As for 235 U, covariances were obtained also for the average number of neutrons emitted in fission. The covariances were estimated by using the same methodology that had been used in the JENDL-3.2 evaluation in order to keep a consistency between mean values and their covariances. The least-squares fitting code GMA was used in estimating covariances for reactions of which JENDL-3.2 cross sections had been evaluated by taking account of measurements. In nuclear model calculations, the covariances were calculated by the KALMAN system. The covariance data obtained were compiled in the ENDF-6 format, and will be put into the JENDL-3.2 Covariance File which is one of JENDL special purpose files. (author). 193 refs
A review of microstructural analysis on U3Si2-Al plate-type fuel
International Nuclear Information System (INIS)
Ti Zhongxin; Guo Yibai
1995-12-01
The microstructure of U 3 Si 2 -Al plate-type fuel, that is the microstructure of fuel particles, compatibility of the fuel particles and Al matrix, fuel particles distribution, dogbone area morphology, clad and meat thickness, bone quality of clad/frame and clad/fuel core, and the effect of these factors on products quality were comprehensively investigated and analyzed by means of optical microscopy (OM), scanning electron microscopy (SEM), X-ray diffraction (XRD), energy dispersive X-ray spectrometry (EDX), image processing technique, etc.. The main results are as following: U-7.7%Si alloy contains two phases: primary U 3 Si 2 and small amount of USi (about 12%), free-uranium was not detected in fuel particles; the dogbone area is the key factor affecting fuel plate quality (1 ref., 16 figs., 4 tabs.)
Thermophysical properties of U3Si to 1150 K
International Nuclear Information System (INIS)
White, J.T.; Nelson, A.T.; Byler, D.D.; Valdez, J.A.; McClellan, K.J.
2014-01-01
U 3 Si has the highest uranium density of the U–Si compounds, making it an attractive option for specialized reactor applications. Although the compound has been used in research and test reactors for nearly six decades, little data has been published in the literature which characterizes the thermophysical properties at elevated temperatures. A systematic study was conducted on U 3 Si to characterize thermal expansion, heat capacity, thermal diffusivity, and thermal conductivity as a function of temperature to 1150 K. Thermophysical properties were also tabulated for the high temperature δ ′ -U 3 Si phase as a function of temperature, which has not been reported previously
The herpes simplex virus 1 U{sub S}3 regulates phospholipid synthesis
Energy Technology Data Exchange (ETDEWEB)
Wild, Peter, E-mail: pewild@access.uzh.ch [Institute of Veterinary Anatomy, University of Zuerich (Switzerland); Institute of Virology, University of Zuerich (Switzerland); Oliveira, Anna Paula de [Institute of Virology, University of Zuerich (Switzerland); Sonda, Sabrina [Institute for Parasitology, University of Zuerich (Switzerland); Schraner, Elisabeth M. [Institute of Veterinary Anatomy, University of Zuerich (Switzerland); Institute of Virology, University of Zuerich (Switzerland); Ackermann, Mathias; Tobler, Kurt [Institute of Virology, University of Zuerich (Switzerland)
2012-10-25
Herpes simplex virus type 1 capsids bud at nuclear and Golgi membranes for envelopment by phospholipid bilayers. In the absence of U{sub S}3, nuclear membranes form multiple folds harboring virions that suggests disturbance in membrane turnover. Therefore, we investigated phospholipid metabolism in cells infected with the U{sub S}3 deletion mutant R7041({Delta}U{sub S}3), and quantified membranes involved in viral envelopment. We report that (i) [{sup 3}H]-choline incorporation into nuclear membranes and cytoplasmic membranes was enhanced peaking at 12 or 20 h post inoculation with wild type HSV-1 and R7041({Delta}U{sub S}3), respectively, (ii) the surface area of nuclear membranes increased until 24 h of R7041({Delta}U{sub S}3) infection forming folds that equaled {approx}45% of the nuclear surface, (iii) the surface area of viral envelopes between nuclear membranes equaled {approx}2400 R7041({Delta}U{sub S}3) virions per cell, and (iv) during R7041({Delta}U{sub S}3) infection, the Golgi complex expanded dramatically. The data indicate that U{sub S}3 plays a significant role in regulation of membrane biosynthesis.
Short Communication on "In-situ TEM ion irradiation investigations on U3Si2 at LWR temperatures"
Miao, Yinbin; Harp, Jason; Mo, Kun; Bhattacharya, Sumit; Baldo, Peter; Yacout, Abdellatif M.
2017-02-01
The radiation-induced amorphization of U3Si2 was investigated by in-situ transmission electron microscopy using 1 MeV Kr ion irradiation. Both arc-melted and sintered U3Si2 specimens were irradiated at room temperature to confirm the similarity in their responses to radiation. The sintered specimens were then irradiated at 350 °C and 550 °C up to 7.2 × 1015 ions/cm2 to examine their amorphization behavior under light water reactor (LWR) conditions. U3Si2 remains crystalline under irradiation at LWR temperatures. Oxidation of the material was observed at high irradiation doses.
Tensile mechanical properties of U3Si2-Al fuel plate
International Nuclear Information System (INIS)
Xu Yong; Hu Huawei; Zhuang Hongquan; Wang Xishu
2003-01-01
The fuel plate made of fuel meat, with the U 3 Si 2 -Al dispersion fuel center, and 6061 Al alloy cladding, is a new kind of fuel used in research reactors. The mechanical property data of the fuel meat is the basic data in the design of fuel group, but the mechanical property of this fuel meat has not been studied all over the world till now. In this paper, the mechanical properties of U 3 Si 2 -Al fuel meats of different sizes used in research reactors are investigated and analyzed, and at the same time the carrying capacity of tensile in different directions are also compared. In order to get more knowledge about the mechanical properties of the fuel meat, the tensile experiment has been carried out repeatedly. Considering the lower ratio of elongation and the brittleness, the microscope has been used to examine the zone of fracture after tensile test. (authors)
High-pressure U3O8 with the fluorite-type structure
International Nuclear Information System (INIS)
Zhang, F.X.; Lang, M.; Wang, J.W.; Li, W.X.; Sun, K.; Prakapenka, V.; Ewing, R.C.
2014-01-01
A new high-pressure phase of U 3 O 8 , which has a fluorite-type structure, forms at pressures greater than ∼8.1 GPa that was confirmed by in situ x-ray diffraction (XRD) measurements. The fluorite-type U 3 O 8 is stable at pressures at least up to ∼40 GPa and temperatures to 1700 K, and quenchable to ambient conditions. Based on the XRD analysis, there is a huge volume collapse (>20%) for U 3 O 8 during the phase transition and the quenched high-pressure phase is 28% denser than the initial orthorhombic phase at ambient conditions. The high-pressure phase has a very low compressibility comparing with the starting orthorhombic phase. - Graphical abstract: α-U 3 O 8 is in a layered structure with orthorhombic symmetry, at high pressures, it transformed to a fluorite-type cubic structure. There are a lot of defects in the cubic structure, and it is a new kind of hyperstoichiometric uranium oxide, which is stable at ambient conditions. - Highlights: • A new fluorite-type high-pressure phase was found in hyperstoichometric UO 2 +x (x∼0.8). • The new high-pressure structure is quenchable to ambient conditions. • Pressure driven phase transition in orthorhombic U 3 O 8 was first found
Microstructure studies of interdiffusion behavior of U{sub 3}Si{sub 2}/Zircaloy-4 at 800 and 1000 °C
Energy Technology Data Exchange (ETDEWEB)
He, Lingfeng, E-mail: Lingfeng.He@inl.gov; Harp, Jason M., E-mail: Jason.Harp@inl.gov; Hoggan, Rita E.; Wagner, Adrian R.
2017-04-01
Fuel swelling during normal reactor operations could lead to unfavorable chemical interactions when in contact with its cladding. As new fuel types are developed, it is crucial to understand the interaction behavior between fuel and its cladding. Diffusion experiments between U{sub 3}Si{sub 2} and Zricaloy-4 (Zry-4) were conducted at 800 and 1000 °C up to 100 h. The microstructure of pristine U{sub 3}Si{sub 2} and U{sub 3}Si{sub 2}/Zry-4 interdiffusion products were examined using scanning electron microscopy (SEM) and transmission electron microscopy (TEM) equipped with an energy dispersive X-ray spectroscopy (EDS) system. The primary interdiffusion product observed at 800 °C is ZrSi{sub 2}, with secondary phases of U-Zr in the Zry-4, and Fe-Cr-W-Zr-Si phases at Zry-4/ZrSi{sub 2} interface and Fe-Cr-U-Si phases at ZrSi{sub 2}/U-Si interface. The primary interdiffusion products at 1000 °C were Zr{sub 2}Si, U-Zr-Fe-Ni, U, U-Zr, and a low melting point phase U{sub 6}Fe.
Post-irradiation examination of prototype Al-64 wt% U{sub 3}Si{sub 2} fuel rods from NRU
Energy Technology Data Exchange (ETDEWEB)
Sears, D.F.; Primeau, M.F.; Buchanan, C.; Rose, D. [Chalk River Labs., Ontario (Canada)
1997-08-01
Three prototype fuel rods containing Al-64 wt% U{sub 3}Si{sub 2} (3.15 gU/cm{sup 3}) have been irradiated to their design burnup in the NRU reactor without incident. The fuel was fabricated using production-scale equipment and processes previously developed for Al-U{sub 3}Si fuel fabrication at Chalk River Laboratories, and special equipment developed for U{sub 3}Si{sub 2} powder production and handling. The rods were irradiated in NRU up to 87 at% U-235 burnup under typical driver fuel conditions; i.e., nominal coolant inlet temperature 37{degrees}C, inlet pressure 654 kPa, mass flow 12.4 L/s, and element linear power ratings up to 73 kW/m. Post-irradiation examinations showed that the fuel elements survived the irradiation without defects. Fuel core diametral increases and volumetric swelling were significantly lower than that of Al-61 wt% U{sub 3}Si fuel irradiated under similar conditions. This irradiation demonstrated that the fabrication techniques are adequate for full-scale fuel manufacture, and qualified the fuel for use in AECL`s research reactors.
Optical properties of LiYF4:U3+. Infrared laser use
International Nuclear Information System (INIS)
Louis, M.
1995-01-01
In this study are proposed a complete interpretation of the optical spectra of trivalent uranium in LiYF 4 (LYF). Single crystals of uranium doped LYF were grown by Czochralski method with different concentration (0.05%-0.20%). The obtained crystals have pale green color, characteristic of tetravalent uranium. The absorption spectra show that effectively only U 4+ is present in this crystal. In order to reduce the oxidation state of the U 4+ , the pale green crystal containing 0.07% of U 4+ was exposed to gamma irradiation. The sample becomes orange brown and the absorption spectrum is characteristic of U 3+ . The irradiation technology is an efficient method to convert 100% of U 4+ in U 3+ . From the analysis of the polarized optical absorption and emission spectra the spectroscopic parameters have been determined. The Judd-Ofelt theory was applied in order to simulate the intensity of the 5 f 3 →5 f 3 transitions between Stark levels of U 3+ in LYF. Because of the large crystal field splitting of the J multiplet in the actinides a set of phenomenological intensity parameters is introduced to describe the transition probabilities between crystal field sublevels. A continuous laser emission of an actinide ion at ambient temperature has been revealed. In the last part of this thesis the fundamental aspect of the energy transfer process that takes place in laser crystal LYF codoped with an 4 f element Nd 3+ and an 5 f one U 3+ has been investigated. (author). 111 refs., 69 figs., 19 tabs
Residual Z{sub 2} symmetries and leptonic mixing patterns from finite discrete subgroups of U(3)
Energy Technology Data Exchange (ETDEWEB)
Joshipura, Anjan S. [Physical Research Laboratory,Navarangpura, Ahmedabad 380 009 (India); Patel, Ketan M. [Indian Institute of Science Education and Research, Mohali,Knowledge City, Sector 81, S A S Nagar, Manauli 140 306 (India)
2017-01-30
We study embedding of non-commuting Z{sub 2} and Z{sub m}, m≥3 symmetries in discrete subgroups (DSG) of U(3) and analytically work out the mixing patterns implied by the assumption that Z{sub 2} and Z{sub m} describe the residual symmetries of the neutrino and the charged lepton mass matrices respectively. Both Z{sub 2} and Z{sub m} are assumed to be subgroups of a larger discrete symmetry group G{sub f} possessing three dimensional faithful irreducible representation. The residual symmetries predict the magnitude of a column of the leptonic mixing matrix U{sub PMNS} which are studied here assuming G{sub f} as the DSG of SU(3) designated as type C and D and large number of DSG of U(3) which are not in SU(3). These include the known group series Σ(3n{sup 3}), T{sub n}(m), Δ(3n{sup 2},m), Δ(6n{sup 2},m) and Δ{sup ′}(6n{sup 2},j,k). It is shown that the predictions for a column of |U{sub PMNS}| in these group series and the C and D types of groups are all contained in the predictions of the Δ(6N{sup 2}) groups for some integer N. The Δ(6N{sup 2}) groups therefore represent a sufficient set of G{sub f} to obtain predictions of the residual symmetries Z{sub 2} and Z{sub m}.
Supersymmetric U boson and the old U(1) problem
International Nuclear Information System (INIS)
Kim, B.R.
1983-01-01
In the supersymmetric SU(3)xSU(2)xU(1)xUsup(')(1) model the new gauge group Usup(')(1) enforces the introduction of mirror fermions. In this note we address the inverse question. If one starts with SU(3)xSU(2)xU(1) including mirror fermions, what physical arguments other than the supersymmetric require the introduction of a new gauge group Usup(')(1). It turns out that the old U(1) problem is closely related with this question. Further we give an estimate for the upper bound for the parameter of the supersymmetric U boson r and x. (orig.)
Estimation of build up of dose rate on U3O8 product drum
International Nuclear Information System (INIS)
Pandey, J.P.N.; Shinde, A.M.; Deshpande, M.D.
2008-01-01
In fuel reprocessing plant, plutonium oxide and uranium oxide (U 3 O 8 ) are products. Approximately 180 kg U 3 O 8 is filled in SS drum and sealed firmly before storage. In PHWR natural uranium (UO 2 ) is used as fuel. In natural uranium, thorium-232 is present as an impurity at few tens of ppm level. During irradiation in power reactors, due to nuclear reaction formation of 232 U from 232 Th takes place. Natural decay of 232 U leads to the formation of 208 Tl. As time passes, there is buildup of 208 Tl and hence increase in dose rate on the drum containing U 3 O 8 . It is essential to estimate the buildup of dose rate considering the external radiological hazards involved during U 3 O 8 drum handling, transportation and fuel fabrication. This paper describes the calculation of dose rate on drum in future years using MCNP code. For dose rate calculation decay of fission product activity which remains as contamination in product and build up of '2 08 Tl from 232 U is considered. Some measured values of dose rate on U 3 O 8 drum are given for the comparisons with estimated dose rate based on MCNP code. (author)
Simulation of accident-tolerant U3Si2 fuel using FRAPCON code
International Nuclear Information System (INIS)
Gomes, Daniel S.; Silva, Antonio T.; Abe, Alfredo Y.; Muniz, Rafael O.R.; Giovedi, Claudia
2017-01-01
The research on accident-tolerant fuels (ATFs) increased after the Fukushima event. This benefited risk management in nuclear operations. In this investigation, the physical properties of the materials being developed for the ATF program were compared with those of the standard UO 2 - Zr fuel system. The research efforts in innovative fuel design include rigorous characterization of thermal, mechanical, and chemical assessment, with the objectives of making the burnup cycle longer, increasing power density, and improving safety performance. Fuels must reach a high uranium density - above that supported by UO 2 - and possess coating that exhibits better oxidation resistance than Zircaloy. The uranium density and thermal conductivity of ATFs, such as U 3 Si 2 , UN, and UC, is higher than that of UO 2 ; their combination with advanced cladding provides possible fuel - cladding options. An ideal combination of fuel and cladding must increase fuel performance in loss-of-coolant scenarios. The disadvantages of U 3 Si 2 , UN, and UC are their swelling rates, which are higher than that of UO 2 . The thermal conductivities of ATFs are approximately four times higher than that of UO2. To prevent the generation of hydrogen due to oxidation of zirconium-based alloys in contact with steam, cladding options, such as ferritic alloys, were studied. It was verified that FeCrAl alloys and SiC provide better response under severe conditions because of their thermophysical properties. The findings of this study indicate that U 3 Si 2 and the FeCrAl fuel cladding concept should replace UO 2 - Zr as the fuel system of choice. (author)
Rate theory scenarios study on fission gas behavior of U 3 Si 2 under LOCA conditions in LWRs
Energy Technology Data Exchange (ETDEWEB)
Miao, Yinbin; Gamble, Kyle A.; Andersson, David; Mei, Zhi-Gang; Yacout, Abdellatif M.
2018-01-01
Fission gas behavior of U3Si2 under various loss-of-coolant accident (LOCA) conditions in light water reactors (LWRs) was simulated using rate theory. A rate theory model for U3Si2 that covers both steady-state operation and power transients was developed for the GRASS-SST code based on existing research reactor/ion irradiation experimental data and theoretical predictions of density functional theory (DFT) calculations. The steady-state and LOCA condition parameters were either directly provided or inspired by BISON simulations. Due to the absence of in-pile experiment data for U3Si2's fuel performance under LWR conditions at this stage of accident tolerant fuel (ATF) development, a variety of LOCA scenarios were taken into consideration to comprehensively and conservatively evaluate the fission gas behavior of U3Si2 during a LOCA.
Status of U3Si2-Al fuel development in China
International Nuclear Information System (INIS)
Sun Rongxian; Huang Dechen; Yin Changgeng; Zhang Qindi; He Fengqi; Li Shuhua; Xiang Xingbi; Zhang Zhiyi; Wang Zhaoyue
1995-01-01
On the basis of the research and development work, a production line of U 3 Si 2 -Al dispersion fuel elements has been established and tens of the fuel elements have been produced. A lot of technical improvements and reliable inspection system ensure that all technical performance of the fuel elements meet International standards. (author)
Tank 241-U-103, grab samples 3U-99-1, 3u-99-2 and 3U-99-3 analytical results for the final report
International Nuclear Information System (INIS)
STEEN, F.H.
1999-01-01
This document is the final report for tank 241-U-103 grab samples. Three grab samples were collected from riser 13 on March 12, 1999 and received by the 222-S laboratory on March 15, 1999. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal Year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP
U3O8 obtained from metallic uranium
International Nuclear Information System (INIS)
Lopez, Marisol; Gonzalez, Alfredo; Pasqualini, Enrique E.
2003-01-01
Enriched uranium oxide, U 3 O 8 , used as nuclear powder in MTR's, can be obtained by direct oxidation of metallic uranium at 800 C degrees. Maximum density, 8.2 gr/cm 3 , is achieved after grinding and a high temperature treatment at 1400 C degrees. All the process is highly controllable and performed in dry environments. (author)
Manikyamba, C.; Said, Nuru; Santosh, M.; Saha, Abhishek; Ganguly, Sohini; Subramanyam, K. S. V.
2018-05-01
Phanerozoic boninites record enrichments of U over Th, giving Th/U: 0.5-1.6, relative to intraoceanic island arc tholeiites (IAT) where Th/U averages 2.6. Uranium enrichment is attributed to incorporation of shallow, oxidized fluids, U-rich but Th-poor, from the slab into the melt column of boninites which form in near-trench to forearc settings of suprasubduction zone ophiolites. Well preserved Archean komatiite-tholeiite, plume-derived, oceanic volcanic sequences have primary magmatic Th/U ratios of 4.4-3.6, and Archean convergent margin IAT volcanic sequences, having REE and HFSE compositions similar to Phanerozoic IAT equivalents, preserve primary Th/U of 4-3.6. The best preserved Archean boninites of the 3.0 Ga Olondo and 2.7 Ga Gadwal greenstone belts, hosted in convergent margin ophiolite sequences, also show relative enrichments of U over Th, with low average Th/U ∼3 relative to coeval IAT, and Phanerozoic counterparts which are devoid of crustal contamination and therefore erupted in an intraoceanic setting, with minimal contemporaneous submarine hydrothermal alteration. Later enrichment of U is unlikely as Th-U-Nb-LREE patterns are coherent in these boninites whereas secondary effects induce dispersion of Th/U ratios. The variation in Th/U ratios from Archean to Phanerozoic boninites of greenstone belts to ophiolitic sequences reflect on genesis of boninitic lavas at different tectono-thermal regimes. Consequently, if the explanation for U enrichment in Phanerozoic boninites also applies to Archean examples, the implication is that U was soluble in oxygenated Archean marine water up to 600 Ma before the proposed great oxygenation event (GOE) at ∼2.4 Ga. This interpretation is consistent with large Ce anomalies in some hydrothermally altered Archean volcanic sequences aged 3.0-2.7 Ga.
International Nuclear Information System (INIS)
Pan Feng
1991-01-01
VCS representations of SO 5 contains SU 2 + SU 2 contains U 1 + U 1 and SO 5 contains U 1 + U 1 are discussed. Reduced matrix elements for SO 5 contains SU 2 + SU 2 are derived. The multiplicity of a weight for SO 5 is determined by using the K-matrix technique
DFT+U study of polaronic conduction in Li2O2 and Li2CO3
DEFF Research Database (Denmark)
García Lastra, Juan Maria; Myrdal, J.S.G.; Christensen, Rune
2013-01-01
The main discharge products formed at the cathode of nonaqueous Li-air batteries are known to be Li2O2 and residual Li2CO3. Recent experiments indicate that the charge transport through these materials is the main limiting factor for the battery performance. It has been also shown...... that the performance of the battery decreases drastically when the amount of Li2CO3 at the cathode increases with respect to Li2O2. In this work, we study the formation and transport of hole and electron polarons in Li2O2 and Li2CO3 using density functional theory (DFT) within the PBE+U approximation. For both...... materials, we find that the formation of polarons (both hole and electron) is stabilized with respect to the delocalized states for all physically relevant values of U. We find a much higher mobility for hole polarons than for the electron polarons, and we show that the poor charge transport in Li2CO3...
Thermal expansion anomaly and thermal conductivity of U3O8
International Nuclear Information System (INIS)
Schulz, B.
1975-01-01
The anomaly in the thermal expansion of U 3 O 8 and results of the thermal conductivity of this compound are described. U 3 O 8 powder heat treated at 1,223 K was consolidated by pressing and sintering in air at 1,223 and 1,373 K to a density of 66% and 80.8% TD. The O/U ratio was 2.67 and 2.63 respectively, the crystal structure being orthorhombic in both cases. For UOsub(2.63) the thermal linear expansion was measured in the temperature range 293 K-1,063 K in pressing direction and normal to it, while for UOsub(2.67) measurements were done parallel to the pressing direction. The curves of the linear thermal expansion from 373 K up to 623 K show negative values and above positive for the three curves. The results are related to known data of phase-transition-temperatures of the orthorhombic U 3 O 8 . Measurements of the thermal conductivity were done on UOsub(2.67). Because of the high porosity of the samples, known relationships for the porosity correction of the thermal conductivity were proved on alumina with 34 % porosity. The values of the thermal conductivity of UOsub(2.67) (corrected to zero porosity) show a very slight temperature dependence, they are about three times lower than those of the stoichiometric uranium dioxide in the same temperature range
Energy Technology Data Exchange (ETDEWEB)
Scapin, Marcos A.; Salvador, Vera L.R.; Cotrim, Marycel E.B.; Pires, Maria Ap. F.; Sato, Ivone M., E-mail: mascapin@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP) Sao Paulo, SP (Brazil). Centro de Quimica e Meio Ambiente
2009-07-01
Uranium silicide (U{sub 3}Si{sub 2}), 20% {sup 235}U enriched powder, is an intermetallic compound used as nuclear fuel material; that is the state-of-the-art among nuclear fuel materials used in modern research reactors. It is produced by IPEN and used as nuclear fuel of the IEA-R1 reactor (IPEN/CNEN, Sao Paulo, Brazil); U{sub 3}Si{sub 2} has 92.3%wtU and 7.7%wtSi. The qualification of this material requires chemical and physical tests such as Si and U{sub total} content, isotope ratio, impurities, density, specific surface area and particle size determination. The Si and U{sub total} determination were made by gravimetric and volumetric procedures at the Environment Chemistry Center (CQMA-IPEN/CNEN). Usually, these classical methods require a long time for analyses and are expensive. The objective of this study was to establish a fast and efficient analytical method to meet ISO/IEC 17025:2005 requirements in the Si and U{sub total} determination. The X-ray fluorescence techniques (XRF) were chosen to allow a direct and non-destructive testing, what is a principal advantage faced to other instrumental techniques, since previous chemical treatments are not necessary. In this study, the performance of the wavelength dispersive (WDXRF) and energy dispersive (EDXRF) X- ray fluorescence techniques was evaluated. Furthermore, two different sample preparation procedures, plain powdered and pressed powdered were evaluated. Statistical tools were used to evaluate the results and a comparison between these results and the conventional methods was done. (author)
Walls of massive K\\"ahler sigma models on SO(2N)/U(N) and Sp(N)/U(N)
Arai, Masato; Shin, Sunyoung
2011-01-01
We study the Bogomol'nyi-Prasad-Sommerfield wall solutions in massive K\\"ahler nonlinear sigma models on SO(2N)/U(N) and Sp(N)/U(N) in three-dimensional spacetime. We show that SO(2N)/U(N) and Sp(N)/U(N) models have 2^{N-1} and 2^N discrete vacua, respectively. We explicitly construct the exact BPS multiwall solutions for N\\le 3.
Energy Technology Data Exchange (ETDEWEB)
Scapin, Marcos A.; Guilhen, Sabine N.; Azevedo, Luciana C. de; Cotrim, Marycel E.B.; Pires, Maria Ap. F., E-mail: mascapin@ipen.br, E-mail: snguilhen@ipen.br, E-mail: lvsantana@ipen.br, E-mail: mecotrim@ipen.br, E-mail: mapires@ipen.br [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil)
2017-07-01
The determination of silicon (Si), total uranium (U) and impurities in uranium-silicide (U{sub 3}Si{sub 2}) samples by wavelength dispersion X-ray fluorescence technique (WDXRF) has been already validated and is currently implemented at IPEN's X-Ray Fluorescence Laboratory (IPEN-CNEN/SP) in São Paulo, Brazil. Sample preparation requires the use of approximately 3 g of H{sub 3}BO{sub 3} as sample holder and 1.8 g of U{sub 3}Si{sub 2}. However, because boron is a neutron absorber, this procedure precludes U{sub 3}Si{sub 2} sample's recovery, which, in time, considering routinely analysis, may account for significant unusable uranium waste. An estimated average of 15 samples per month are expected to be analyzed by WDXRF, resulting in approx. 320 g of U{sub 3}Si{sub 2} that would not return to the nuclear fuel cycle. This not only impacts in production losses, but generates another problem: radioactive waste management. The purpose of this paper is to present the mathematical models that may be applied for the correction of systematic errors when H{sub 3}BO{sub 3} sample holder is substituted by cellulose-acetate {[C_6H_7O_2(OH)_3_-_m(OOCCH_3)m], m = 0∼3}, thus enabling U{sub 3}Si{sub 2} sample’s recovery. The results demonstrate that the adopted mathematical model is statistically satisfactory, allowing the optimization of the procedure. (author)
Analysis of hydrogen, carbon, sulfur and volatile compounds in (U3Si2 - Al) nuclear fuel
International Nuclear Information System (INIS)
Moura, Sergio C.; Redigolo, Marcelo M.; Amaral, Priscila O.; Leao, Claudio; Oliveira, Glaucia A.C. de; Bustillos, Oscar V.
2015-01-01
Uranium silicide U 3 Si 2 is used as nuclear fuel in the research nuclear reactor IEA-R1 at IPEN/CNEN, Sao Paulo, Brazil. The U 3 Si 2 is dispersed in aluminum reaching high densities of uranium in the nucleus of the fuel, up to 4.8 gU cm -3 . This nuclear fuel must comply with a quality control, which includes analysis of hydrogen, carbon and sulfur for the U 3 Si 2 and volatile compound for the aluminum. Hydrogen, carbon and sulfur are analyzed by the method of Radio Frequency gas extraction combustion coupled with Infrared detector. Volatile compounds are analyzed by the method of heated gas extraction coupled with gravimetric measurement. These methods are recommended by the American Society for Testing Materials (ASTM) for nuclear materials. The average carbon and sulfur measurements are 30 μg g -1 and 3 μg g -1 , respectively, and 40 μg g -1 for volatile compounds. The hydrogen analyzer is a TCHEN 600 LECO, carbon and sulfur analyzer is a CS 244 LECO and the volatile compounds analyzer is a home-made apparatus that use a resistant furnace, a gas pipe measurement and a glove-box with controlled atmosphere where an analytical balance has been installed, this analyzer was made at IPEN laboratory. (author)
Biochemical function of typical and variant Arabidopsis thaliana U-box E3 ubiquitin-protein ligases
DEFF Research Database (Denmark)
Wiborg, Jakob; O'Shea, Charlotte; Skriver, Karen
2008-01-01
of the distant U-box protein, AtPUB49, representing a large family of eukaryotic proteins containing a U-box linked to a cyclophilin-like peptidyl-prolyl cis-trans isomerase domain, was characterized biochemically. AtPUB49 functioned both as a prolyl isomerase and a chaperone by catalysing cis......The variance of the U-box domain in 64 Arabidopsis thaliana (thale cress) E3s (ubiquitin-protein ligases) was used to examine the interactions between E3s and E2s (ubiquitin-conjugating enzymes). E2s and E3s are components of the ubiquitin protein degradation pathway. Seven U-box proteins were...... analysed for their ability to ubiquitinate proteins in vitro in co-operation with different E2s. All U-box domains exhibited ubiquitination activity and interacted productively with UBC4/5-type E2s. Three and four of the U-box domains mediated ubiquitin addition in the presence of UBC13 and UBC7 E2s...
Lynn, Bryan W.; Starkman, Glenn D.
2017-09-01
In the S U (2 )L×S U (2 )R linear sigma model with partially conserved axial-vector currents, a tower of Ward-Takahashi identities (WTI) have long been known to give relations among 1-scalar-particle-irreducible (1 -ϕ -I ) Green's functions, and among I-scalar-particle-reducible (1 -ϕ -R ) transition-matrix (T-matrix) elements for external scalars [i.e. the Brout-Englert-Higgs (BEH) scalar H , and three pseudoscalars π →]. In this paper, we extend these WTI and the resulting relations to the S U (3 )C×S U (2 )L×U (1 )Y linear sigma model including the heaviest generation of Standard Model (SM) fermions—the ungauged (i.e. global) Standard Model SMtb τ ντ G —supplemented with the minimum necessary neutrino content—right-handed neutrinos and Yukawa-coupling-induced Dirac neutrino mass—to obtain the charge-parity (C P )-conserving νDSMtb τ ντ G , and extract powerful constraints on the effective Lagrangian: e.g. showing that they make separate tadpole renormalization unnecessary, and guarantee infrared finiteness. The crucial observation is that ultraviolet quadratic divergences (UVQD), and all other relevant operators, contribute only to mπ2, a pseudo-Nambu-Goldstone boson (NGB) mass-squared, which appears in intermediate steps of calculations. A WTI between T-matrix elements (or, in this global theory equivalently the Goldstone theorem) then enforces mπ2=0 exactly for the true NGB in the spontaneous symmetry breaking (SSB) mode of the theory. The Goldstone theorem thus causes all relevant operator contributions, originating to all-loop-orders from virtual scalars H ,π → , quarks qLc;tRc;bRc and leptons lL;ντR;τR with (c =r , w , b ), to vanish identically. We show that our regularization-scheme-independent, WTI-driven results are unchanged by the addition of certain S U (3 )C×S U (2 )L×U (1 )Y heavy (MHeavy2≫|q2|,mWeak2 ) C P -conserving matter, such as originate in certain beyond the SM (BSM) models. The global axial-vector WTI
Making of U3O8 Microsphere as a Preliminary Material for Manufacturing UO2 Kernel of HTR
International Nuclear Information System (INIS)
Hidayati; Triyono; Endang Nawangsih
2007-01-01
The making of U 3 O 8 microsphere as a preliminary material for manufacturing UO 2 kernel of HTR on various feed solution with internal gelation method use of paraffin gelation medium has been done. The aim of this research is to make U 3 O 8 microsphere as preliminary material for making UO 2 kernel which has good characteristic and for knowing to some extent the feed solution influence on U 3 O 8 microsphere. Uranyl nitrate solution was used as a feed solution with acidity 1 M and some various of ADUN solution. ADUN solution was made by adding various of ammonia solution on the solution of uranyl nitrate. Each of the feed solution was added urea + HMTA solution and then it was dropped to a column containing hot paraffin solution at the temperature 95°Celsius in order to get UO 3 gel. UO 3 gel was dipped and washed with NH 4 OH, dried and calcined at the temperature of 800°Celsius . The obtained product was analyzed its surface area, radius of pore, total volume of pore and distribution of pore size of Surface Area Analyzer NOVA-1000. The density was analyzed with pycnometer and the form of microsphere was analyzed with SEM. The obtained product shows that U 3 O 8 microsphere with less ammonium nitrate gave U 3 O 8 much better and vice versa. The best U 3 O 8 obtained from the with ratio mole nitrate/uranium = 1.9, namely uranyl nitrate solution with the feed acidity of 1 N which was added by the lest amount of NH 4 OH. U 3 O 8 microsphere has density 7.06 g/cc (85.62% theoretical density), specific surface area = 6.77 m 2 /g, mean pore radius 20.52 Å, and also total pore volume 6.91x10 -3 cc/g. (author)
Comparison of thermal compatibility between atomized and comminuted U3Si dispersion fuels
International Nuclear Information System (INIS)
Ryu, Woo-Seog; Park, Jong-Man; Kim, Chang-Kyu; Kuk, II-Hyun
1997-01-01
Thermal compatibility of atomized U 3 Si dispersion fuels were evaluated up to 2600 hours in the temperature range from 250 to 500 degrees C, and compared with that of comminuted U 3 Si. Atomized U 3 Si showed better performance in terms of volume expansion of fuel meats. The reaction zone of U 3 Si and Al occurred along the grain boundaries and deformation bands in U 3 Si particles. Pores around fuel particles appeared at high temperature or after long-term annealing tests to remain diffusion paths over the trench of the pores. The constraint effects of cladding on fuel rod suppressed the fuel meat, and reduced the volume expansion
2. Interferometry and polarimetry. 2.3. Polarimetry on JT-60U
International Nuclear Information System (INIS)
Kawano, Yasunori
2000-01-01
In order to establish an electron density measurement method with high reliability and stability for magnetic-confinement fusion devices, studies on infrared polarimetry have been carried out in JT-60U. Electron density measurement based on tangential Faraday rotation has been verified using a CO 2 laser polarimeter developed for JT-60U. In this article, basic ideas of studies, results from polarimetry experiments, and suggestions for future devices are presented. (author)
CERCA's 25 years experience in U3Si2 fuel manufacturing
International Nuclear Information System (INIS)
Durand, JP.; Duban, B.; Lavastre, Y.; Perthuis, S. de
2003-01-01
This paper documents the experience gained at CERCA in manufacturing, testing, and inspecting U 3 Si 2 fuel elements for various Material Test Reactors (MTR) since the beginning of the RERTR Program in 1978, up to now. It emphasises how the company controls the product to insure compliance with the fuel-related safety parameters. Finally, those statements are considered in the UMo fuel production perspective. (author)
International Nuclear Information System (INIS)
Scapin, Marcos A.; Silva, Clayton P.; Cotrim, Marycel E.B.; Pires, Maria Aparecida F.
2013-01-01
The aim of this work is to establish and validate a methodology for a nondestructive quantitative chemical analysis method for simultaneous determination of the major constituents (U total and Si) and impurities (B, Mg, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn, Mo, Cd,etc.) present in U 3 Si 2 . The method must also meet the needs of nuclear reactors for the nuclear fuel qualification type,MTR, with low cost and analysis time, while also minimizing waste generation. For this purpose, an X-ray fluorescence technique will be applied. The technique is nondestructive,aside from sample preparation procedures that do not require previous chemical treatments (dissolving, digesting), and allows for fast chemical analysis. The fundamental parameters (FP) method was applied to corrections for spectral and matrix effects. The calibration model was obtained via principal component analysis using orthogonal decomposition by the singular value decomposition method (SVD) in U 3 O 8 and U 3 Si 2 samples. The results were compared by means of statistical tests in accordance with ISO 17025 on CRMs of U 3 O 8 from New Brunswick Laboratory (NBL) and 16 U 3 Si 2 samples provided by CCN of IPEN/CNEN-SP. Multivariate calibration is a promising method for determination of major and minor constituents inU 3 Si 2 and U 3 O 8 nuclear fuel, because the precision and accuracy are statistically equivalent to volumetric analysis (U total determination), gravimetric analysis (Si determination), and ICP-OES methods (impurities determination). (author)
Corrosion of MTR type fuel plates containing U3O8-Al cermet cores
International Nuclear Information System (INIS)
Durazzo, M.
1985-01-01
The fuel plate samples containing U 3 O 8 -Al cermet cores with concentrations from 10 to 90% of U 3 O 8 weight were fabricated. Samples with 58% of U 3 O 8 eight were fabricated using compacts with densities from 75 to 95% of theoretical density. The influences of U 3 O 8 concentration and porosity of compacted core on porosity and uniformity of core thickness are discussed. The U 3 O 8 -Al cores were submitted to corrosion tests and exposed to deionized water at temperatures of 30, 50, 70 and 90 0 C by cladding deffect produced artificially. The results shown that core corrosion is accompanied by hydrogen release. The total volum of released hydrogen and the time interval to observe the initiation of hydrogen releasing (incubation time) are depending on core pososity and absolute temperature. A mechanism for U 3 O 8 -Al core corrosion process is proposed and discussed. The cladding of fuel plate samples was submitted to corrosion tests under similar conditons of the IAE-R1 reactor operating at 2, 5 and 10 MW. (Author) [pt
International Nuclear Information System (INIS)
Dumitrescu, T.S.
1977-01-01
A new method is applied in order to obtain the irreducible single row representations of the groups under study. For the case U(3) contained in SO(3) also an explicit realization is constructed. The method has the advantage of being simpler than the previously used ones. (author)
U(3)-flavor nonet scalar as an origin of the flavor mass spectra
International Nuclear Information System (INIS)
Koide, Yoshio
2008-01-01
According to an idea that the quark and lepton mass spectra originate in a VEV structure of a U(3)-flavor nonet scalar Φ, the mass spectra of the down-quarks and charged leptons are investigated. The U(3) flavor symmetry is spontaneously and completely broken by non-zero and non-degenerated VEVs of Φ, without passing any subgroup of U(3). The ratios (m e +m μ +m τ )/(√(m e )+√(m μ )+√(m τ )) 2 and √(m e m μ m τ )/(√(m e )+√(m μ )+√(m τ )) 3 are investigated based on a toy model
Biochemical function of typical and variant Arabidopsis thaliana U-box E3 ubiquitin-protein ligases.
Wiborg, Jakob; O'Shea, Charlotte; Skriver, Karen
2008-08-01
The variance of the U-box domain in 64 Arabidopsis thaliana (thale cress) E3s (ubiquitin-protein ligases) was used to examine the interactions between E3s and E2s (ubiquitin-conjugating enzymes). E2s and E3s are components of the ubiquitin protein degradation pathway. Seven U-box proteins were analysed for their ability to ubiquitinate proteins in vitro in co-operation with different E2s. All U-box domains exhibited ubiquitination activity and interacted productively with UBC4/5-type E2s. Three and four of the U-box domains mediated ubiquitin addition in the presence of UBC13 and UBC7 E2s respectively, but no productive interaction was observed with the UBC15 E2 tested. The activity of AtPUB54 [Arabidopsis thaliana (thale cress) plant U-box 54 protein] was dependent on Trp(266) in the E2-binding cleft, and the E2 selectivity was changed by substitution of this position. The function of the distant U-box protein, AtPUB49, representing a large family of eukaryotic proteins containing a U-box linked to a cyclophilin-like peptidyl-prolyl cis-trans isomerase domain, was characterized biochemically. AtPUB49 functioned both as a prolyl isomerase and a chaperone by catalysing cis-trans isomerization of peptidyl-prolyl bonds and dissolving protein aggregates. In conclusion, both typical and atypical Arabidopsis U-box proteins were active E3s. The overlap in the E3/E2 selectivity suggests that in vivo specificity is not determined only by the E3-E2 interactions, but also by other parameters, e.g. co-existence or interactions with additional domains. The biochemical functions of AtPUB49 suggest that the protein can be involved in folding or degradation of protein substrates. Similar functions can also be retained within a protein complex with separate chaperone and U-box proteins.
Cai, Wenting; Morales-Martínez, Roser; Zhang, Xingxing; Najera, Daniel; Romero, Elkin L; Metta-Magaña, Alejandro; Rodríguez-Fortea, Antonio; Fortier, Skye; Chen, Ning; Poblet, Josep M; Echegoyen, Luis
2017-08-01
Charge transfer is a general phenomenon observed for all endohedral mono-metallofullerenes. Since the detection of the first endohedral metallofullerene (EMF), La@C 82 , in 1991, it has always been observed that the oxidation state of a given encapsulated metal is always the same, regardless of the cage size. No crystallographic data exist for any early actinide endohedrals and little is known about the oxidation states for the few compounds that have been reported. Here we report the X-ray structures of three uranium metallofullerenes, U@ D 3h -C 74 , U@ C 2 (5)-C 82 and U@ C 2v (9)-C 82 , and provide theoretical evidence for cage isomer dependent charge transfer states for U. Results from DFT calculations show that U@ D 3h -C 74 and U@ C 2 (5)-C 82 have tetravalent electronic configurations corresponding to U 4+ @ D 3h -C 74 4- and U 4+ @ C 2 (5)-C 82 4- . Surprisingly, the isomeric U@ C 2v (9)-C 82 has a trivalent electronic configuration corresponding to U 3+ @ C 2v (9)-C 82 3- . These are the first X-ray crystallographic structures of uranium EMFs and this is first observation of metal oxidation state dependence on carbon cage isomerism for mono-EMFs.
International Nuclear Information System (INIS)
Ginting, A. Br.; Samosir, N.; Suparjo; Nasution, H.
2000-01-01
Expansion analysis has been conducted to 50 x 20-mm U 3 Si 2 -AI mini plate of 3.6 g/cm 3 uranium loading using dilatometer. The analysis was carried out at various temperatures of 170 o C, 350 o C and 550 o C in Argon medium with delay time 4 days. The result showed that the fuel plate was relatively stable with increasing of heating time but underwent significant expansion. Heating at 170 o C, 350 o C and 550 o C resulted in the expansion of the U 3 Si 2 -AI fuel plate of to 83-212 mum, 333-475 mum, and 433-724 mum with coefficient expansion of 24.2x10 -6 / o C - 24.3x10 -6 / o C, 25.5x10 -6 / o C - 26.2x10 -6 /'oC and 26.6 x 10 -6 / o C - 28.2 x 10 -6 / o C respectively. Microanalysis of the U 3 Si 2 -AI mini plate fuel with SEM-EDS upon heating at those temperature variation showed that microstructure change didn't occur at 170 o C, mean while interaction between AIMg2 cladding and the fuel meat appeared to take place at 350 o C and 550 o C. Data on the expansion and microstructure change of U 3 Si 2 -AI fuel plate upon heating are of great important for the manufacture/fabrication of research fuel plate to produce silicide fuel element for higher uranium loading. (author)
Optical spectroscopy and crystal-field analysis of U3+: Ba2YCl7
International Nuclear Information System (INIS)
Karbowiak, M.; Mech, A.; Drozdzyndki, J.; Gajek, Z.; Edelstein, N.M.
2002-01-01
High resolution absorption spectra of a U 3+ (0.3%): Ba 2 YCl 7 single crystal were recorded in the 4000-50 000 cm -1 range at 7 K. The observed crystal-field levels were assigned and fit to the parameters of the simplified angular overlap model (AOM) as well as a semi-empirical Hamiltonian representing the combined atomic and one-electron crystal-field interactions. The starting values of the AOM parameters were obtained from ab initio calculations. The analysis of the spectra allowed the assignment of 65 crystal-field levels with a relatively small rms deviation of 25 cm -1 and has shown that the AOM approach can predict quite well the B q k crystal-field parameters. The value determined for the crystal-field strength parameter, N v , corresponds well with those determined for U 3+ in other chloride single crystals. (authors)
International Nuclear Information System (INIS)
Suripto, A; Yuwono
1998-01-01
Heat treatment experiments upon U 3 Si 2 - U ss ingot have been cam e d out to obtain free uranium particle size improvement which is required to enhance the U-Al inter-diffusion reaction in the fuel plate meat. . Heat treatment experiments upon fuel plates containing dispersion of U 3 Si 2 - U ss in Al matrix have also been carried out to study the effect of temperature and treatment duration on the extent of inter-diffusion reaction between free uranium particle and aluminium matrix in the fuel plate meat. Both the experiments indicate that a drastic size improvement has occurred with the U 3 Si 2 as well as free uranium particles upon heat treatment at controlled temperature between the U 3 Si 2 peritectic and peritectoid temperatures and that the inter-diffusion reaction between free uranium and Al matrix occurs quite significantly at temperatures higher than that ordinarily used in the fabrication procedure
International Nuclear Information System (INIS)
Kobayashi, Fumiaki; Kitawaki, Shinichi; Amamoto, Ippei; Igarashi, Miyuki
1999-02-01
The Ag/ AgCl reference electrode is often used in electrochemical measurements of molten chloride system. By measuring the U/U 3+ equilibrium potential in the cell, U(s) | UCl 3 , LiCl-KCl parallel LiCl-KCl, Ag + | Ag (s), the characterization of the Ag/AgCl reference electrode was made. The behavior of two types of reference electrode having either a mullite or a Pyrex-glass membrane bridge was examined. It was confirmed that the two types of reference electrode can be regarded as almost equivalent. The reproducibility of the reading from the electrodes having the identical construction was showing to be within 0.003 V. (author)
Path integral for coherent states of the dynamical U2 group and U2/1 supergroup
International Nuclear Information System (INIS)
Kochetov, E.A.
1992-01-01
A part-integral formulation in the representation of coherent states for the unitary U 2 group and U 2/1 supergroup is introduced. U 2 and U 2/1 path integrals are shown to be defined on the coset spaces U 2 /U 1 xU 1 and U 2/1 /U 1/1 xU 1 , respectively. These coset appears as curved classical phase spaces. Partition functions are expressed as path integrals over these spaces. In the case when U 2 and U 2/1 are the dynamical groups, the corresponding path integrals are evaluated with the help of linear fractional transformations that appear as the group (supergroup) action in the coset space (superspace). Possible applications for quantum models are discussed. 9 refs
International Nuclear Information System (INIS)
Iturbe G, J.L.
1990-02-01
In this work the determination of the isotope ratio 234 U/ 238 U and 235 U/ 238 U obtained by means of the alpha spectroscopy technique in uranium reagents of commercial marks is presented. The analyzed uranium reagents were: UO 2 (*) nuclear purity, UO 3 (*) poly-science, metallic uranium, uranyl nitrate and uranyl acetate Merck, uranyl acetate and uranyl nitrate Baker, uranyl nitrate (*) of the Refinement and Conversion Department of the ININ, uranyl acetate (*) Medi-Lab Sigma of Mexico and uranyl nitrate Em Science. The obtained results show that the reagents that are suitable with asterisk (*) are in radioactive balance among the one 234 U/ 238 U, since the obtained value went near to the unit. In the case of the isotope ratio 235 U/ 238 U the near value was also obtained the one that marks the literature that is to say 0.04347, what indicates that these reagents contain the isotope of 235 U in the percentage found in the nature of 0.71%. The other reagents are in radioactive imbalance among the 234 U/ 238 U, the found values fluctuated between 0.4187 and 0.1677, and for the quotient of activities 235 U/ 238 U its were of 0.0226, and the lowest of 0.01084. Also in these reagents it was at the 236 U as impurity. The isotope of 236 U is an isotope produced artificially, for what is supposed that the reagents that are in radioactive imbalance were synthesized starting from irradiated fuel. (Author)
U3O8 production cost analysis study
International Nuclear Information System (INIS)
1978-08-01
This report presents the User's Manual for the computer program resulting from Bechtel's uranium production cost analysis. The model incorporates engineering and financial costs of sandstone mining and milling in the western United States. It does not consider exploration costs. The model was written in Fortran V, IBM compatible. Inputs from the user are such items as: ore grades, open pit or underground mines, acid or carbonate leach, and debt/equity ratio. The user may either input the desired discounted cash flow rate of return and obtain the necessary U 3 O 8 price, or input an estimated U 3 O 8 price and obtain the resulting discounted cash flow rate of return
Li, Keying; Gor, Jayesh; Perkins, Stephen J
2010-10-01
Component C3 is the central protein of the complement system. During complement activation, the thioester group in C3 is slowly hydrolysed to form C3u, then the presence of C3u enables the rapid conversion of C3 into functionally active C3b. C3u shows functional similarities to C3b. To clarify this mechanism, the self-association properties and solution structures of C3 and C3u were determined using analytical ultracentrifugation and X-ray scattering. Sedimentation coefficients identified two different dimerization events in both proteins. A fast dimerization was observed in 50 mM NaCl but not in 137 mM NaCl. Low amounts of a slow dimerization was observed for C3u and C3 in both buffers. The X-ray radius of gyration RG values were unchanged for both C3 and C3u in 137 mM NaCl, but depend on concentration in 50 mM NaCl. The C3 crystal structure gave good X-ray fits for C3 in 137 mM NaCl. By randomization of the TED (thioester-containing domain)/CUB (for complement protein subcomponents C1r/C1s, urchin embryonic growth factor and bone morphogenetic protein 1) domains in the C3b crystal structure, X-ray fits showed that the TED/CUB domains in C3u are extended and differ from the more compact arrangement of C3b. This TED/CUB conformation is intermediate between those of C3 and C3b. The greater exposure of the TED domain in C3u (which possesses the hydrolysed reactive thioester) accounts for the greater self-association of C3u in low-salt conditions. This conformational variability of the TED/CUB domains would facilitate their interactions with a broad range of antigenic surfaces. The second dimerization of C3 and C3u may correspond to a dimer observed in one of the crystal structures of C3b.
Wongabel Rhabdovirus Accessory Protein U3 Targets the SWI/SNF Chromatin Remodeling Complex
Joubert, D. Albert; Rodriguez-Andres, Julio; Monaghan, Paul; Cummins, Michelle; McKinstry, William J.; Paradkar, Prasad N.; Moseley, Gregory W.
2014-01-01
ABSTRACT Wongabel virus (WONV) is an arthropod-borne rhabdovirus that infects birds. It is one of the growing array of rhabdoviruses with complex genomes that encode multiple accessory proteins of unknown function. In addition to the five canonical rhabdovirus structural protein genes (N, P, M, G, and L), the 13.2-kb negative-sense single-stranded RNA (ssRNA) WONV genome contains five uncharacterized accessory genes, one overlapping the N gene (Nx or U4), three located between the P and M genes (U1 to U3), and a fifth one overlapping the G gene (Gx or U5). Here we show that WONV U3 is expressed during infection in insect and mammalian cells and is required for efficient viral replication. A yeast two-hybrid screen against a mosquito cell cDNA library identified that WONV U3 interacts with the 83-amino-acid (aa) C-terminal domain of SNF5, a component of the SWI/SNF chromatin remodeling complex. The interaction was confirmed by affinity chromatography, and nuclear colocalization was established by confocal microscopy. Gene expression studies showed that SNF5 transcripts are upregulated during infection of mosquito cells with WONV, as well as West Nile virus (Flaviviridae) and bovine ephemeral fever virus (Rhabdoviridae), and that SNF5 knockdown results in increased WONV replication. WONV U3 also inhibits SNF5-regulated expression of the cytokine gene CSF1. The data suggest that WONV U3 targets the SWI/SNF complex to block the host response to infection. IMPORTANCE The rhabdoviruses comprise a large family of RNA viruses infecting plants, vertebrates, and invertebrates. In addition to the major structural proteins (N, P, M, G, and L), many rhabdoviruses encode a diverse array of accessory proteins of largely unknown function. Understanding the role of these proteins may reveal much about host-pathogen interactions in infected cells. Here we examine accessory protein U3 of Wongabel virus, an arthropod-borne rhabdovirus that infects birds. We show that U3 enters the
International Nuclear Information System (INIS)
Ugajin, Mitsuhiro; Itoh, Akinori; Akabori, Mitsuo
1993-06-01
Details of equipment installed, method adopted and final products were described on the preparation of uranium silicides and other fuels for capsule irradiation. Main emphasis was placed on the preparation of laboratory-scale aluminum-dispersion plate-type fuel (miniplates) loaded to the first and second JMTR silicide capsules. Fuels contained in the capsules are as follows: (A) uranium-silicide base alloys U 3 Si 2 , Mo- added U 3 Si 2 , U 3 Si 2 +U 3 Si, U 3 Si 2 +USi, U 3 Si, U 3 (Si 0.8 Ge 0.2 ), U 3 (Si 0.6 Ge 0.4 ) (B) U 6 Me-type alloys with higher uranium density U 6 Mn, U 6 Ni, U 6 (Fe 0.4 Ni 0.6 ), U 6 (Fe 0.6 Mn 0.4 ) The powder-metallurgical picture-frame method was adopted and laboratory-scale technique was established for the preparation of miniplates. As a result of inspection for capsule irradiation, miniplates were prepared to meet the requirements of specification. (author)
Morais, Nathanael Wagner Sales; Lopes, Denise Adorno; Schön, Cláudio Geraldo
2018-04-01
The present work is the second and final part of an extended investigation on Usbnd Nb - Zr alloys. It investigates the effect of mechanical processing routes on microstructure of alloys U - 3 wt % Nb - 9 wt % Zr and U - 9 wt% Nb - 3 wt% Zr, through X-ray diffraction and scanning electron microscopy, completing the investigation, which started with alloy U - 6 wt% Nb - 6 wt% Zr in part 1. Mechanical properties are determined using microhardness and bending tests and correlated with the developed microstructures. The results show that processing sequence, in particular the inclusion of a 1000 °C heat treatment step, affects significantly the microstructure and mechanical properties of these alloys alloy in different ways. Microstructural characterization shows that both alloys present significant volume fraction of precipitates of a body-centered cubic (BCC) γ-Nb-Zr rich phase in addition the uranium-rich matrix. Bending tests show that sample ductility does not correlate necessarily with hardness and that the key factor appears to be the amount of the γ-Nb-Zr precipitates, which controls the matrix microstructure. Samples with a monoclinic α″ cellular microstructure and/or with the tetragonally-distorted BCC phase (γ0), although not strictly ductile, showed the largest allowed strains-before-break and complete elastic recovery of the broken pieces, pointing out to the macroscopic observation of superelasticity.
International Nuclear Information System (INIS)
Tkachuk, Andriy V.; Muirhead, Craig P.T.; Mar, Arthur
2006-01-01
The ternary uranium transition-metal antimonides U 3 MSb 5 (M = Zr, Hf, Nb) were prepared by arc-melting reactions followed by annealing at 800 deg. C, or by use of a Sn flux. These compounds extend the previously known series U 3 MSb 5 (M = Ti, V, Cr, Mn) and RE 3 MSb 5 (RE = La, Ce, Pr, Nd, Sm; M = Ti, Zr, Hf, Nb). The crystal structures of U 3 MSb 5 were determined by single-crystal X-ray diffraction data (Pearson symbol hP18, hexagonal, space group P6 3 /mcm, Z = 2; U 3 ZrSb 5 , a = 9.2223(3) A, c = 6.1690(2) A; U 3 HfSb 5 , a = 9.2084(4) A, c = 6.1629(3) A; U 3 NbSb 5 , a = 9.1378(4) A, c 6.0909(6) A). U 3 TaSb 5 has also been identified in microcrystalline form (a = 9.233(3) A, c = 6.142(3) A). Four-probe electrical resistivity measurements on single crystals and dc magnetic susceptibility measurements on powders indicated prominent transitions that are attributed to ferromagnetic ordering. The Curie temperatures, T C , located from ac magnetic susceptibility curves, are 135 K for U 3 ZrSb 5 , 141 K for U 3 HfSb 5 , and 107 K for U 3 NbSb 5
Energy Technology Data Exchange (ETDEWEB)
Boero, N; Sassone, A; Mendez de Leo, L; Novara, O; Ramella, J [Comision Nacional de Energia Atomica, San Martin (Argentina). Unidad de Actividad Combustibles Nucleares
1997-12-31
At present, obtention of U{sub 3}O{sub 8} used in the manufacturing of MTR plates nuclear fuels, is performed by hydrolysis of UF6 to obtain uranyl fluoride. Uranyl fluoride is precipitated with ammonium hydroxide to get ammonium polyuranate (ADU). Afterwards ADU is calcinated to U{sub 3}O{sub 8} and mechanical and thermally treated in order to obtain a powder in a determined specification. In the present work, ultrasound has been applied in the stage of precipitation of ADU and for different times in the stage of digestion in order to fasten the stages of ADU filtering and eliminate the U{sub 3}O{sub 8} milling and sieving. Experiences on UO{sub 2} have also been performed. The aspect of ADU changes considerably when they have been ultrasonically treated, its filtering rate is faster and it is easier to dry as it contains less humidity. U{sub 3}O{sub 8} obtained after 800degreeC calcination of treated ADU results in an easy to desagregate powder. Only a soft mechanical treatment is needed to be performed on it before starting thermal treatment at 1400degreeC. After thermal treatment at 1400degreeC treated U{sub 3}O{sub 8} has shown adequate characteristics of size, shape and density (8.2 g/cm{sup 3}). Regarding UO{sub 2}, the shape of the agglomerates is almost spherical, leading to a free-flowing powder, whose apparent and TAP density showed to be adequate. The characteristics of the different compounds were followed by electron scanning micrographies, X-Rays, specific area measurements and differential thermal analysis. The great advantage of ultrasound appliance is that hard mechanical treatment is avoided in the obtention of U{sub 3}O{sub 8}, saving time and effort. Furthermore, UO{sub 2} proves to be adequate to make pellets, the same precursor could be used in the obtention of both uranium oxides. (author). 5 refs., 6 figs.
The Experiment Production And Examination Of The U3Si2-AI Mini plates For Irradiation Test
International Nuclear Information System (INIS)
Supardjo; Boybul; Yowono; Susworo; Permana, S.
1998-01-01
The fuel plates containing U 3 Si 2 -AI dispersion fuel having respective loading of 3.55; 4.20; and 4.80 g/cm 3 were prepared by dispersing certain amount of U 3 Si 2 powder in the AI powder as matrix. The weight ratio of U 3 Si 2 and AI at different loading was chosen based on the 19.23 cm 3 volume basis fuel core calculation. Each fuel mixture was pressed into a fuel core having dimension of 100.20 x 60.35 x 3.15 +- (0.05) mm, which was then cut into mini fuel core having dimension of 16 x 8 x 3.15 +- (0.05) mm. The mini plates were prepared by picture and frame technique using AIMg2 as cladding material. The mini plates have been tested for blister, homogeneity, white spots, surface defects and their cladding thickness, revealing that out of 74 mini plates, they are ten (10) mini plates that have to be rejected due to blisters and white spots, thus of 64 mini plates can be further fabricated as samples for irradiation test
International Nuclear Information System (INIS)
Jelassi, H.; Viaris de Lesegno, B.; Pruvost, L.
2006-01-01
We report on photoassociation of cold 87 Rb atoms providing the spectroscopy of (5s 1/2 +5p 1/2 )0 u + long-range molecular states, in the energy range of [-12.5, -0.7 cm -1 ] below the dissociation limit. A Lu-Fano approach coupled to the LeRoy-Bernstein formula is used to analyze the data. The Lu-Fano graph exhibits the coupling of the molecular series with the (5s 1/2 +5p 3/2 )0 u + one, which is due to spin effects in the molecule. A two-channel model involving an improved LeRoy-Bernstein formula allows us to characterize the molecular series, to localize (5s 1/2 +5p 3/2 )0 u + levels, to evaluate the coupling, and to predict the energy and width of the first predissociated level of (5s 1/2 +5p 3/2 )0 u + series. An experimental spectrum confirms the prediction
Properties measurements of (U{sub 0.7}Pu{sub 0.3})O{sub 2-x} in PO{sub 2}-controlled atmosphere
Energy Technology Data Exchange (ETDEWEB)
Kato, M.; Murakami, T.; Sunaoshi, T. [Advanced Nuclear System Research and Development Directorate, Japan Atomic Energy Agency, Muramatsu Tokai-mura Ibaraki, 319-1194 (Japan); Nelson, A.T.; McClellan, K.J. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States)
2013-07-01
The investigation of physical properties of uranium and plutonium mixed oxide (MOX) fuels is important for the development of fast reactor fuels. It is well known that MOX is a nonstoichiometric oxide, and the physical properties change drastically with the Oxygen-to-Metal (O/M) ratio. A control technique for O/M ratio was established for measurements of high temperature properties of uranium and plutonium mixed oxide fuels. Sintering behavior, thermal expansion and O/M change of (U{sub 0.7}Pu{sub 0.3})O{sub 2.00} and (U{sub 0.7}Pu{sub 0.3})O{sub 1.99} were investigated in PO{sub 2}-controlled atmosphere which was controlled by H{sub 2}/H{sub 2}O gas system. Sintering behavior changed drastically with O/M ratio, and shrinkage of (U{sub 0.7}Pu{sub 0.3})O{sub 2.00} was faster and more advanced at lower temperatures as compared with (U{sub 0.7}Pu{sub 0.3})O{sub 1.99}. Thermal expansion was observed to be slightly increased with decreasing O/M ratio. (authors)
Subjective experiences of watching stereoscopic Avatar and U2 3D in a cinema
Pölönen, Monika; Salmimaa, Marja; Takatalo, Jari; Häkkinen, Jukka
2012-01-01
A stereoscopic 3-D version of the film Avatar was shown to 85 people who subsequently answered questions related to sickness, visual strain, stereoscopic image quality, and sense of presence. Viewing Avatar for 165 min induced some symptoms of visual strain and sickness, but the symptom levels remained low. A comparison between Avatar and previously published results for the film U2 3D showed that sickness and visual strain levels were similar despite the films' runtimes. The genre of the film had a significant effect on the viewers' opinions and sense of presence. Avatar, which has been described as a combination of action, adventure, and sci-fi genres, was experienced as more immersive and engaging than the music documentary U2 3D. However, participants in both studies were immersed, focused, and absorbed in watching the stereoscopic 3-D (S3-D) film and were pleased with the film environments. The results also showed that previous stereoscopic 3-D experience significantly reduced the amount of reported eye strain and complaints about the weight of the viewing glasses.
Energy Technology Data Exchange (ETDEWEB)
J. L. Smith
2001-08-01
This Closure Report (CR) has been prepared for the Area 3 Radioactive Waste Management Site (RWMS) U-3ax/bl Disposal Unit Corrective Action Unit (CAU) 110 in accordance with the reissued (November 2000) Resource Conservation and Recovery Act (RCRA) Part B operational permit NEV HW009 (Nevada Division of Environmental Protection [NDEP], 2000) and the Federal Facility and Consent Order (FFACO) (NDEP et al., 1996). CAU 110 consists of one Corrective Action Site 03-23-04, described as the U-3ax/bl Subsidence Crater. Certifications of closure are located in Appendix A. The U-3ax/bl is a historic disposal unit within the Area 3 RWMS located on the Nevada Test Site (NTS). The unit, which was formed by excavating the area between two subsidence craters (U-3ax and U-3bl), was operationally closed in 1987. The U-3ax/bl disposal unit was closed under the RCRA, as a hazardous waste landfill. Existing records indicate that, from July 1968 to December 1987, U-3ax/bl received 2.3 x 10{sup 5} cubic meters (m{sup 3}) (8.12 x 10{sup 6} cubic feet [ft{sup 3}]) of waste. NTS atmospheric nuclear device testing generated approximately 95% of the total waste volume disposed of in U-3ax/bl; 80% of the total volume was generated from the Waste Consolidation Project. Area 3 is located in Yucca Flat, within the northeast quadrant of the NTS. The Yucca Flat watershed is a structurally closed basin encompassing an area of approximately 780 square kilometers (300 square miles). The structural geomorphology of Yucca Flat is typical of the Basin and Range Physiographic Province. Yucca Flat lies in one of the most arid regions of the country. Water balance calculations for Area 3 indicate that it is normally in a state of moisture deficit.
DEFF Research Database (Denmark)
Sørensen, Hans Eibe; Williamson, Trevor
Abstract In September 2014, nine months after launching a major growth opportunity, Jenny Dunne, managing director of Nu2U, called for an extraordinary status meeting with her COO and CMO. A fast-growing online retailer of refurbished household appliances, Nu2U planned to acquire market share...... by improving internal logistics and delivery services, aided by a new, fully integrated software system. The company's gross profit had been increasing steadily, but recent accounts revealed a fall in net profit margins. It became apparent that implementation of the business plan for the project...... was problematic because of loose governance and poor communication across Nu2U's different specialist functions during planning and implementation. The Nu2U case illustrates how executives' cognition and span of control/overview may be hampered in fast-growing firms and how this ...
Hydrogen isotope effect on storage behavior of U{sub 2}Ti and UZr{sub 2.3}
Energy Technology Data Exchange (ETDEWEB)
Jat, Ram Avtar; Sawant, S.G.; Rajan, M.B.; Dhanuskar, J.R. [Product Development Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Kaity, Santu [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Parida, S.C., E-mail: sureshp@barc.gov.in [Product Development Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India)
2013-11-15
U{sub 2}Ti and UZr{sub 2.3} alloys were prepared by arc melting method, vacuum annealed and characterized by XRD, SEM and EDX methods. Hydrogen isotope effect on the storage behavior of these alloys were studied by measuring the hydrogen/deuterium desorption pressure–composition–temperature (PCT) profiles in the temperature range of 573–678 K using a Sievert’s type volumetric apparatus. It was observed that, in the temperature and pressure range of investigation, all the isotherms show a single desorption plateau. The PCT data reveals that both U{sub 2}Ti and UZr{sub 2.3} alloys had normal isotope effects on hydrogen/deuterium desorption at all experimental temperatures. Thermodynamic parameters for dehydrogenation and dedeuteration reactions of the corresponding hydrides and deuterides of the above alloys were deduced from the PCT data.
Comparison of thermal compatibility between atomized and comminuted U{sub 3}Si dispersion fuels
Energy Technology Data Exchange (ETDEWEB)
Ryu, Woo-Seog; Park, Jong-Man; Kim, Chang-Kyu; Kuk, II-Hyun [Korea Atomic Research Institute, Taejon (Korea, Republic of)
1997-08-01
Thermal compatibility of atomized U{sub 3}Si dispersion fuels were evaluated up to 2600 hours in the temperature range from 250 to 500{degrees}C, and compared with that of comminuted U{sub 3}Si. Atomized U{sub 3}Si showed better performance in terms of volume expansion of fuel meats. The reaction zone of U{sub 3}Si and Al occurred along the grain boundaries and deformation bands in U{sub 3}Si particles. Pores around fuel particles appeared at high temperature or after long-term annealing tests to remain diffusion paths over the trench of the pores. The constraint effects of cladding on fuel rod suppressed the fuel meat, and reduced the volume expansion.
Photochemistry of U(BH/sub 4/)/sub 4/ and U(BD/sub 4/)/sub 4/
Energy Technology Data Exchange (ETDEWEB)
Paine, R T; Schonberg, P R; Light, R W [New Mexico Univ., Albuquerque (USA). Dept. of Chemistry; Danen, W C; Freund, S M
1979-01-01
U(BH/sub 4/)/sub 4/ and U(BD/sub 4/)/sub 4/ are observed to undergo complex degradation reactions promoted by broadband UV radiation. The primary products of these reactions appear to be U(BH/sub 4/)/sub 3/, B/sub 2/H/sub 6/, H/sub 2/, U(BD/sub 4/)/sub 3/, B/sub 2/D/sub 6/ and D/sub 2/. Further, U(BD/sub 4/)/sub 4/ undergoes a related decomposition reaction under the influence of CO/sub 2/ laser irradiation at 924.97 cm/sup -1/.
Principles and Practices of Mature-Age Education at U3As
Siedle, Rob
2011-01-01
A movement known as the Universities of the Third Age (U3As) provides educational, cultural and social services for mature-age people in Australia and internationally. This paper focuses on the educational courses run by U3As and discusses two basic questions: What are the expectations of learners who enrol in these classes? and How can tutors…
International Nuclear Information System (INIS)
Dilecce, G; Ambrico, P F; De Benedictis, S
2007-01-01
The present paper deals with the determination of discharge parameters using N 2 (C 3 Π u , v) populations deduced from 2.PG emission spectra, focusing on the influence of N 2 (C 3 Π u , v) collision rate coefficients on these determinations. In particular it is shown that the new set of quenching and vibrational relaxation rate coefficients of N 2 (C 3 Π u , v 0-4) vibronic levels recently measured by optical-optical double resonance laser induced fluorescence (LIF) have a large effect on discharge parameter determination in high-pressure discharges. In the present paper we explore this effect, evidencing the differences with respect to the old data set case, in both simulated and real cases of N 2 (C 3 Π u , v) vibrational distributions measured at high pressure in a dielectric barrier discharge. Finally we point out the improved potentiality of 2.PG spectroscopy as a diagnostic technique: with the new rate coefficients, and measurement of the N 2 (C 3 Π u , v) distribution up to at least v = 3, it is possible to have a quasi-independent evaluation of the electron temperature and of the first level vibrational temperature of the N 2 ground state
Theoretical Mn K-edge XANES for Li2MnO3: DFT + U study
International Nuclear Information System (INIS)
Tamura, Tomoyuki; Ohwaki, Tsukuru; Ito, Atsushi; Ohsawa, Yasuhiko; Kobayashi, Ryo; Ogata, Shuji
2012-01-01
Spectral features of Mn K-edge x-ray absorption near-edge structure (XANES) for Li 2 MnO 3 were calculated using the first-principles full projector augmented wave method with the general gradient approximation plus U method. We demonstrated that the U parameter affects the spectral features in the pre-edge region while it does not affect those in the major absorption region. From the comparison with the experimental spectra and those of reference compounds, we showed that the spectral features of Mn K-edge XANES and the differences in the valence state can be reproduced well. (paper)
New insights in third phase formation in the U(VI)-HNO3, TBP-alkane system
International Nuclear Information System (INIS)
Jensen, M. P.; Chiarizia, R.; Ferraro, J. R.; Borkowski, M.; Nash, K. L.; Thiyagarajan, P.; Littrell, K. C.
2001-01-01
In this work, the system U(VI)-HNO 3 -tributylphosphate (TBP)-n-dodecane has been revisited with the objective of gaining coordination chemistry and structural information on the species that are formed in the organic phase before and after third phase formation. Chemical analyses, spectroscopic and EXAFS data indicate that U(VI) is extracted as the UO 2 (NO 3 ) 2 · 2TBP adduct, while the third phase species has the composition UO 2 (NO 3 ) 2 · 2TBP · HNO 3 . Small-angle neutron scattering (SANS) data reveal the presence in the organic phase, both before and after phase splitting, of ellipsoidal aggregates whose formation seems to depend more on the extraction of HNO 3 than that of U(VI)
Sorption of U(VI) in surfaces of SrTiO{sub 3}; Sorcion de U(VI) en superficies de SrTiO{sub 3}
Energy Technology Data Exchange (ETDEWEB)
Ortiz O, H.B.; Ordonez R, E.; Fernandez V, S.M. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)
2004-07-01
In this work is presented the physico chemical characterization and evaluation of those surface properties and of sorption of U on the SrTiO{sub 3} like possible candidate for contention barrier in the deep geological confinement. The made studies showed that the SrTiO{sub 3} presents maximum levels of sorption of positive nature species (mainly UO{sub 2}{sup 2+} and UO{sub 2}NO{sub 3}{sup +}). (Author)
Third phase formation revisited: the U(VI), HNO3 - TBP, n-dodecane system
International Nuclear Information System (INIS)
Chiarizia, R.; Jensen, M.P.; Borkowski, M.; Ferraro, J.R.; Thiyagarajan, P.; Littrell, K.C.
2003-01-01
In this work, the system U(VI), HNO 3 -tri-n-butylphosphate (TBP), n-dodecane has been revisited with the objective of gaining information on the coordination chemistry and structural evolution of the species formed in the organic phase before and after third phase formation. Chemical analyses, spectroscopic and EXAFS data indicate that U(VI) is extracted as the UO 2 (NO 3 ) 2 ·2TBP adduct, while the third phase species have the average composition UO 2 (NO 3 ) 2 ·2TBP·HNO 3 . Small-angle neutron scattering (SANS) measurements on TBP solutions loaded with only HNO 3 or with increasing amounts of U(VI) have revealed the presence, before phase splitting, of ellipsoidal aggregates with the major and minor axes up to about 64 and 15 A, respectively. The formation of these aggregates, very likely of the reverse micelle-type, is observed in all cases, that is, when only HNO 3 , only UO 2 (NO 3 ) 2 , or both HNO 3 and UO 2 (NO 3 ) 2 are extracted by the TBP solution. Upon third phase formation, the SANS data reveal the presence of smaller aggregates in the light organic phase, while the heavy organic phase contains pockets of diluent, each with an average of about two molecules of n-dodecane.
A gravimetric and an X-ray fluorescence method for the determination of rubidium in Rb2U(SO4)3
International Nuclear Information System (INIS)
Mudher, K.D.S.; Krishnan, K.; Jayadevan, N.C.
1993-01-01
Chemical characterization of rubidium uranium(IV) trisulfate, RB 2 U(SO 4 ) 3 , a new chemical assay standard for uranium requires accurate analysis of rubidium. A gravimetric and an X-ray fluorescence method (XRF) for the determination of rubidium in this compound are described. In the gravimetric method, rubidium is determined as Rb 2 Na[Co(NO 2 ) 6 ].H 2 O without separating uranium with a precision of the order of ±0.5%. In the XRF method, the concentration ratio of rubidium to uranium, C Rb /C U , is determined in the solid samples by the binary ratio method using calibration between intensity ratios (I Rb /I U ) and concentration ratios (C Rb /C U ). (author) 6 refs.; 2 figs.; 3 tabs
Uniqueness of Positive Solutions of Δu+f(u)=0 in N, N<=3
Cortázar, Carmen; Elgueta, Manuel; Felmer, Patricio
We study the uniqueness of radial ground states for the semilinear elliptic partial differential equation $Δ u+f(u)=0 {(*)}$ in N. We assume that the function f has two zeros, the origin and u0>0. Above u0 the function f is positive, is locally Lipschitz continuous and satisfies convexity and growth conditions of a superlinear nature. Below u0, f is assumed to be non-positive, non-identically zero and merely continuous. Our results are obtained through a careful analysis of the solutions of an associated initial-value problem, and the use of a monotone separation theorem. It is known that, for a large class of functions f, the ground states of (*) are radially symmetric. In these cases our result implies that (*) possesses at most one ground state.
Thermal Stabilization of 233UO2, 233UO3, and 233U3O8
International Nuclear Information System (INIS)
Thein, S.M.; Bereolos, P.J.
2000-01-01
This report identifies an appropriate thermal stabilization temperature for 233 U oxides. The temperature is chosen principally on the basis of eliminating moisture and other residual volatiles. This report supports the U. S. Department of Energy (DOE) Standard for safe storage of 233 U (DOE 2000), written as part of the response to Recommendation 97-1 of the Defense Nuclear Facilities Safety Board (DNFSB), addressing safe storage of 233 U
Comparison of 235U fission cross sections in JENDL-3.3 and ENDF/B-VI
International Nuclear Information System (INIS)
Kawano, Toshihiko; Carlson, Allan D.; Matsunobu, Hiroyuki; Nakagawa, Tsuneo; Shibata, Keiichi
2002-01-01
Comparisons of evaluated fission cross sections for 235 U in JENDL-3.3 and ENDF/B-VI are carried out. The comparisons are made for both the differential and integral data. The fission cross sections as well as the fission ratios are compared with the experimental data in detail. Spectrum averaged cross sections are calculated and compared with the measurements. The employed spectra are the 235 U prompt fission neutron spectrum, the 252 Cf spontaneous fission neutron spectrum, and the neutron spectrum produced by a 9 Be(d, xn) reaction. For 235 U prompt fission neutron spectrum, the ENDF/B-VI evaluation reproduces experimental averaged cross sections. For 252 Cf and 9 Be(d, xn) neutron spectra, the JENDL-3.3 evaluation gives better results than ENDF/B-VI. (author)
Energy Technology Data Exchange (ETDEWEB)
Iturbe G, J L
1990-02-15
In this work the determination of the isotope ratio {sup 234} U/{sup 238} U and {sup 235} U/{sup 238} U obtained by means of the alpha spectroscopy technique in uranium reagents of commercial marks is presented. The analyzed uranium reagents were: UO{sub 2} (*) nuclear purity, UO{sub 3} (*) poly-science, metallic uranium, uranyl nitrate and uranyl acetate Merck, uranyl acetate and uranyl nitrate Baker, uranyl nitrate (*) of the Refinement and Conversion Department of the ININ, uranyl acetate (*) Medi-Lab Sigma of Mexico and uranyl nitrate Em Science. The obtained results show that the reagents that are suitable with asterisk (*) are in radioactive balance among the one {sup 234} U/{sup 238} U, since the obtained value went near to the unit. In the case of the isotope ratio {sup 235} U/{sup 238} U the near value was also obtained the one that marks the literature that is to say 0.04347, what indicates that these reagents contain the isotope of {sup 235} U in the percentage found in the nature of 0.71%. The other reagents are in radioactive imbalance among the {sup 234} U/{sup 238} U, the found values fluctuated between 0.4187 and 0.1677, and for the quotient of activities {sup 235} U/{sup 238} U its were of 0.0226, and the lowest of 0.01084. Also in these reagents it was at the {sup 236} U as impurity. The isotope of {sup 236} U is an isotope produced artificially, for what is supposed that the reagents that are in radioactive imbalance were synthesized starting from irradiated fuel. (Author)
Coextrusion of 60 to 80 wt % U3O8 nuclear fuel elements
International Nuclear Information System (INIS)
Peacock, H.B.
1980-01-01
Aluminum-clad billets with up to 80 wt % U 3 O 8 in U 3 O 8 -Al cores have been coextruded at SRP. However, above 70 wt % U 3 O 8 , yields are low because of core-cracking. Proper selection of materials and extrusion parameters will give process conditions for successful fabrication. Studies were begun of the effects of these parameters on the flow of metal during coextrusion. In coextruded tubes, cracks are formed in large uranium oxide particles. Cracking is caused by the high tensile deformation of these particles that occurs as the cermet material flows through the die. Lower extrusion ratios and larger die angles appear to reduce severe particle cracking and increase fabrication yields. The particle size distribution of the ceramic fuel phase also influences fabricability. Six P/M assemblies with up to 57 wt % U 3 O 8 in U 3 O 8 -Al cores were successfully irradiated to 1.6 x 10 21 fissions per cm 3 of core. No swelling or blistering of the tubes occurred
Simulation of accident-tolerant U{sub 3}Si{sub 2} fuel using FRAPCON code
Energy Technology Data Exchange (ETDEWEB)
Gomes, Daniel S.; Silva, Antonio T.; Abe, Alfredo Y.; Muniz, Rafael O.R., E-mail: dsgomes@ipen.br, E-mail: teixeira@ipen.br, E-mail: alfredo@ctmsp.mar.mil.br, E-mail: rafael.orm@gmail.com [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil); Giovedi, Claudia, E-mail: claudia.giovedi@ctmsp.mar.mil.br [Universidade de São Paulo (USP), São Paulo, SP (Brazil). Departamento de Engenharia Naval e Oceânica
2017-07-01
The research on accident-tolerant fuels (ATFs) increased after the Fukushima event. This benefited risk management in nuclear operations. In this investigation, the physical properties of the materials being developed for the ATF program were compared with those of the standard UO{sub 2} - Zr fuel system. The research efforts in innovative fuel design include rigorous characterization of thermal, mechanical, and chemical assessment, with the objectives of making the burnup cycle longer, increasing power density, and improving safety performance. Fuels must reach a high uranium density - above that supported by UO{sub 2} - and possess coating that exhibits better oxidation resistance than Zircaloy. The uranium density and thermal conductivity of ATFs, such as U{sub 3}Si{sub 2}, UN, and UC, is higher than that of UO{sub 2}; their combination with advanced cladding provides possible fuel - cladding options. An ideal combination of fuel and cladding must increase fuel performance in loss-of-coolant scenarios. The disadvantages of U{sub 3}Si{sub 2}, UN, and UC are their swelling rates, which are higher than that of UO{sub 2}. The thermal conductivities of ATFs are approximately four times higher than that of UO2. To prevent the generation of hydrogen due to oxidation of zirconium-based alloys in contact with steam, cladding options, such as ferritic alloys, were studied. It was verified that FeCrAl alloys and SiC provide better response under severe conditions because of their thermophysical properties. The findings of this study indicate that U{sub 3}Si{sub 2} and the FeCrAl fuel cladding concept should replace UO{sub 2} - Zr as the fuel system of choice. (author)
Aaltonen, J; Trzaska, V; Gromova, E A; Yakovlev, V A
2001-01-01
Preparation of sup 2 sup 3 sup 6 Pu, sup 2 sup 3 sup 7 Pu and sup 2 sup 3 sup 5 Np by reactions sup 2 sup 3 sup 6 U( sup 3 He, t beta sup -) sup 2 sup 3 sup 6 Pu, sup 2 sup 3 sup 6 U( sup 3 He, 2n) sup 2 sup 3 sup 7 Pu and sup 2 sup 3 sup 6 U( sup 3 He, p3n) sup 2 sup 3 sup 5 Np in sup 3 He ion beams, their energy 43 and 60 MeV, in the K-130 cyclotron at Yuvyaskyul University (Finland) was studied. Cross sections of the reactions were determined. Yield curves for thick targets were calculated. The results are discussed and compared with previously obtained data on other reactions giving rise to formation of the same products. Methods of radiochemical separation of the products and sample preparation for alpha- and gamma-spectrometry are described
Energy Technology Data Exchange (ETDEWEB)
Muhammad, Farhan [Department of Nuclear Engineering, Pakistan Institute of Engineering and Applied Sciences, Nilore, Islamabad 45650 (Pakistan)], E-mail: farhan73@hotmail.com; Majid, Asad [Department of Nuclear Engineering, Pakistan Institute of Engineering and Applied Sciences, Nilore, Islamabad 45650 (Pakistan)
2008-10-15
The reactivity feedback coefficients of a material test research reactor fueled with high-density U{sub 3}Si{sub 2} dispersion fuels were calculated. For this purpose, the low-density LEU fuel of an MTR was replaced with high-density U{sub 3}Si{sub 2} LEU fuels currently being developed under the RERTR program. Calculations were carried out to find the fuel temperature reactivity coefficient, moderator temperature reactivity coefficient and moderator density reactivity coefficient. Nuclear reactor analysis codes including WIMS-D4 and CITATION were employed to carry out these calculations. It is observed that the average values of fuel temperature reactivity feedback coefficient, moderator temperature reactivity coefficient and moderator density reactivity coefficient from 20 deg. C to 100 deg. C, at the beginning of life, followed the relationships (in units of {delta}k/k x 10{sup -5} K{sup -1}) -2.116 - 0.118 {rho}{sub U}, 0.713 - 37.309/{rho}{sub U} and -12.765 - 34.309/{rho}{sub U}, respectively for 4.0 {<=} {rho}{sub U} (g/cm{sup 3}) {<=} 6.0.
International Nuclear Information System (INIS)
Johnson, Kyle D.; Raftery, Alicia M.; Lopes, Denise Adorno; Wallenius, Janne
2016-01-01
In this study, U_3Si_2 was synthesized via the use of arc-melting and mixed with UN powders, which together were sintered using the SPS method. The study revealed a number of interesting conclusions regarding the stability of the system – namely the formation of a probable but as yet unidentified ternary phase coupled with the reduction of the stoichiometry in the nitride phase – as well as some insights into the mechanics of the sintering process itself. By milling the silicide powders and reducing its particle size ratio compared to UN, it was possible to form a high density UN-U_3Si_2 composite, with desirable microstructural characteristics for accident tolerant fuel applications. - Highlights: • U_3Si_2 fabricated from elemental uranium and silicon through arc melting. • Homogeneity of the silicides assessed through densitometry, XRD, SEM and EDS, chemical etching and optical microscopy. • UN powder fabricated using hydriding-nitriding method. • No phase transformations detected when sintering using silicide particle sizes less than UN particle size. • High density composite (98%TD) fabricated with silicide grain coating using spark plasma sintering at 1450 °C.
The inflow of 234U and 238U from the River Odra drainage basin to the Baltic Sea
Directory of Open Access Journals (Sweden)
Bogdan Skwarzec
2010-12-01
Full Text Available In this study the activity of uranium isotopes 234U and 238U in Odra river water samples, collected from October 2003 to July2004, was measured using alpha spectrometry. The uranium concentrations were different in each of the seasons analysed; the lowest values were recorded in summer. In all seasons, uranium concentrations were the highest in Bystrzyca river waters (from 27.81 ± 0.29Bq m-3 of 234U and 17.82 ± 0.23 Bq m-3 of 238U in spring to 194.76 ± 3.43 Bq m-3 of 234U and 134.88 ± 2.85 Bq m-3 of 238U in summer. The lowest concentrations were noted in the Mała Panew (from 1.33 ± 0.02 Bq m-3 of 234U and 1.06 ± 0.02 Bq m-3 of 238U in spring to 3.52 ± 0.05 Bq m-3 of 234U and 2.59± 0.04 Bq m-3 of 238U in autumn. The uranium radionuclides 234U and 238U in the water samples were not in radioactive equilibrium. The 234U / 238U activity ratios were the highest in Odra water samples collected at Głogów (1.84 in autumn, and the lowest in water from the Noteć (1.03 in winter and spring. The 234U / 238U activity ratio decreases along the main stream of the Odra, owing to changes in the salinity of the river's waters. Annually, 8.19 tons of uranium (126.29 G Bq of 234U and 100.80 G Bq of 238U flow into the Szczecin Lagoon with Odra river waters.
Temperature effect on the retention of U(VI) by SrTiO3
International Nuclear Information System (INIS)
Garcia Rosales, G.
2007-11-01
The purpose of this research was the study of the interaction mechanisms between U(VI) ions and SrTiO 3 surfaces versus pH and temperature: 25, 50, 75 and 90 C. Firstly, a physicochemical characterization was realized (DRX, MEB, FTIR) and the surface site density was determined. The potentiometric titration data were simulated, for each temperature, using the constant capacitance model and taking into account bath protonation of the ≡Sr-OH surface sites and deprotonation of the ≡Ti-OH ones (one pK a model). Both enthalpy and entropy changes, corresponding to the surface acid-base reactions, were evaluated using the van't Hoff relation. U(VI) was sorbed onto SrTiO 3 powder in the pH range 0.5-5.0 with an U(VI) initial concentration 1.10 -4 M. By TRLIFS two U(VI) complexes were detected associated with two lifetime values (60 ± 5 and 12 ± 2 μs at 25 C). The sorption edges were simulated using FITEQL 4.0 software. The surface complexation constants of the system SrTiO 3 /U(VI) between 25 and 90 C temperature range were thus obtained with the constant capacitance model considering two reactive surface sites. It reveals that two types of surface complex, namely [(≡SrOH)(≡TiOH)UO 2 ] 2+ and [(≡TiOH)(≡TiO)UO 2+ ] 2+ , are needed to properly describe the experimental observations. By application of the van't Hoff equation, Delta R S 0 and Delta R H 0 were obtained, which indicated an endothermic sorption process. Finally, an energy transfer study was realised by TRLIFS. The energy transfer between Tb 3+ and Eu 3+ ions sorbed onto SrTiO 3 powders were investigated. The results showed that the energy transfer between Tb 3+ and Eu 3+ is a non-radiative process and follows a dipole-dipole type interaction. A formalism based on the Dexter and the Inokuti-Hirayama theories was used to calculate the distances (2,7-3,4 Angstroms between Tb 3+ and Eu 3+ onto SrTiO 3 surface. (author)
The use of U3Si2 dispersed in aluminum in plate-type fuel elements for research and test reactors
International Nuclear Information System (INIS)
Snelgrove, J.L.; Domagala, R.F.; Hofman, G.L.; Wiencek, T.C.; Copeland, G.L.; Hobbs, R.W.; Senn, R.L.
1987-10-01
A high-density fuel based on U 3 Si 2 dispersed in aluminum has been developed and tested for use in converting plate-type research and test reactors from the use of highly enriched uranium to the use of low-enriched uranium. Results of preirradiation testing and the irradiation and postirradiation examination of miniature fuel plates and full-sized fuel elements are summarized. Swelling of the U 3 Si 2 fuel particles is a linear function of the fission density in the particle to well beyond the fission density achievable in low-enriched fuels. U 3 Si 2 particle swelling rate is approximately the same as that of the commonly used UAl/sub x/ fuel particle. The presence of minor amounts of U 3 Si or uranium solid solution in the fuel result in greater, but still acceptable, fuel swelling. Blister threshold temperatures are at least as high as those of currently used fuels. An exothermic reaction occurs near the aluminum melting temperature, but the measured energy releases were low enough not to substantially worsen the consequences of an accident. U 3 Si 2 -aluminum dispersion fuel with uranium densities up to at least 4.8 Mg/m 3 is a suitable LEU fuel for typical plate-type research and test reactors. 42 refs., 28 figs., 7 tabs
Gerbi, Susan A.; Lange, Thilo Sascha
2002-01-01
Previously, we showed that spliceosomal U6 small nuclear RNA (snRNA) transiently passes through the nucleolus. Herein, we report that all individual snRNAs of the [U4/U6.U5] tri-snRNP localize to nucleoli, demonstrated by fluorescence microscopy of nucleolar preparations after injection of fluorescein-labeled snRNA into Xenopus oocyte nuclei. Nucleolar localization of U6 is independent from [U4/U6] snRNP formation since sites of direct interaction of U6 snRNA with U4 snRNA are not nucleolar localization elements. Among all regions in U6, the only one required for nucleolar localization is its 3′ end, which associates with the La protein and subsequently during maturation of U6 is bound by Lsm proteins. This 3′-nucleolar localization element of U6 is both essential and sufficient for nucleolar localization and also required for localization to Cajal bodies. Conversion of the 3′ hydroxyl of U6 snRNA to a 3′ phosphate prevents association with the La protein but does not affect U6 localization to nucleoli or Cajal bodies. PMID:12221120
Analysis of an Organisation: A University of the Third Age (U3A), Mornington, Victoria
Small, Michael
2017-01-01
The purpose of this paper is two fold: to look at Mornington U3A in organisational terms and then look at U3AM as a loosely coupled system. One outcome of the study would be to undertake further analyses of U3As in Victoria to determine the levels of bureaucracy under which each operates. Questions to be asked: are U3As in Victoria operating as…
Energy Technology Data Exchange (ETDEWEB)
Miao, Yinbin, E-mail: ymiao@anl.gov [Argonne National Laboratory, Lemont, IL 60439 (United States); Harp, Jason [Idaho National Laboratory, Idaho Fall, ID 83415 (United States); Mo, Kun [Argonne National Laboratory, Lemont, IL 60439 (United States); Bhattacharya, Sumit [Northwestern University, Evanston, IL 60208 (United States); Baldo, Peter; Yacout, Abdellatif M. [Argonne National Laboratory, Lemont, IL 60439 (United States)
2017-02-15
The radiation-induced amorphization of U{sub 3}Si{sub 2} was investigated by in-situ transmission electron microscopy using 1 MeV Kr ion irradiation. Both arc-melted and sintered U{sub 3}Si{sub 2} specimens were irradiated at room temperature to confirm the similarity in their responses to radiation. The sintered specimens were then irradiated at 350 °C and 550 °C up to 7.2 × 10{sup 15} ions/cm{sup 2} to examine their amorphization behavior under light water reactor (LWR) conditions. U{sub 3}Si{sub 2} remains crystalline under irradiation at LWR temperatures. Oxidation of the material was observed at high irradiation doses.
Hydrogen absorption properties of U6Mn and U6Ni
International Nuclear Information System (INIS)
Ito, H.; Yamawaki, M.; Yamamoto, T.
1998-01-01
The hydrogen absorption properties of U, U 6 Mn and U 6 Ni were investigated at hydrogen pressures below 10 5 Pa. The pressure-composition (P-C) isotherms of U, U 6 Mn and U 6 Ni were obtained and the amounts of absorbed hydrogen for U, U 6 Mn and U 6 Ni were determined to be 3, 16.6 and 16.0 for x in MH x , where M is U, U 6 Mn and U 6 Ni, respectively. The desorption plateau pressures at 573 K decreased in the order: U 6 Mn-H>U 6 Ni-H>U-H. In addition, the results for the amounts of absorbed hydrogen suggests the formation of ternary hydrides U 6 MnH 18 and U 6 NiH 14 . (orig.)
Nitric acid titration in the presence of UO2(NO3)2, Th(NO3)4, U(NO3)4 or Zr(NO3)4
International Nuclear Information System (INIS)
Nakashima, T.; Lieser, K.H.
1986-01-01
Procedures are described for titration of HNO 3 in presence of UO 2 2+ , Th 4+ , U 4+ and Zr 4+ without formation of interfering precipitates. In the first step the hydrolysable ions are masked by addition of complexing agents and in the second step the acid is titrated by NaOH as usual. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Garcia Rosales, G
2007-11-15
The purpose of this research was the study of the interaction mechanisms between U(VI) ions and SrTiO{sub 3} surfaces versus pH and temperature: 25, 50, 75 and 90 C. Firstly, a physicochemical characterization was realized (DRX, MEB, FTIR) and the surface site density was determined. The potentiometric titration data were simulated, for each temperature, using the constant capacitance model and taking into account bath protonation of the {identical_to}Sr-OH surface sites and deprotonation of the {identical_to}Ti-OH ones (one pK{sub a} model). Both enthalpy and entropy changes, corresponding to the surface acid-base reactions, were evaluated using the van't Hoff relation. U(VI) was sorbed onto SrTiO{sub 3} powder in the pH range 0.5-5.0 with an U(VI) initial concentration 1.10{sup -4} M. By TRLIFS two U(VI) complexes were detected associated with two lifetime values (60 {+-} 5 and 12 {+-} 2 {mu}s at 25 C). The sorption edges were simulated using FITEQL 4.0 software. The surface complexation constants of the system SrTiO{sub 3}/U(VI) between 25 and 90 C temperature range were thus obtained with the constant capacitance model considering two reactive surface sites. It reveals that two types of surface complex, namely [({identical_to}SrOH)({identical_to}TiOH)UO{sub 2}]{sup 2+} and [({identical_to}TiOH)({identical_to}TiO)UO{sup 2+}]{sup 2+}, are needed to properly describe the experimental observations. By application of the van't Hoff equation, Delta{sub R}S{sup 0} and Delta{sub R}H{sup 0} were obtained, which indicated an endothermic sorption process. Finally, an energy transfer study was realised by TRLIFS. The energy transfer between Tb{sup 3+} and Eu{sup 3+} ions sorbed onto SrTiO{sub 3} powders were investigated. The results showed that the energy transfer between Tb{sup 3+} and Eu{sup 3+} is a non-radiative process and follows a dipole-dipole type interaction. A formalism based on the Dexter and the Inokuti-Hirayama theories was used to calculate the
Jraij, A; Allouche, A R; Magnier, S; Aubert-Frécon, M
2009-06-28
A theoretical investigation of the electronic structure of the K(2) molecule, including spin-orbit effects, has been performed. Potential energies have been calculated over a large range of R up to 75a(0) for the 88 Omega(g,u)(+/-) states dissociating adiabatically into the limits up to K(4p (2)P(3/2))+K(4p (2)P(3/2)). Equilibrium distances, transition energies, harmonic frequencies, as well as depths for wells and heights for barriers are reported for all of the bound Omega(g,u)(+/-) states. Present ab initio calculations are shown to be able to reproduce quite accurately the small structures (wells and barrier) displayed at very long-range (R>50a(0)) by the (2,3)1(u) and (2)0(g)(-) purely long-range states. As the present data could help experimentalists, we make available extensive tables of energy values versus internuclear distances in our database at the web address http://www-lasim.univ-lyon1.fr/spip.php?rubrique99.
Magnetic correlations in UPt3 and U/sub 1-x/Th/sub x/Pt3
International Nuclear Information System (INIS)
Aeppli, G.; Bucher, E.; Goldman, A.I.; Shirane, G.; Broholm, C.; Kjems, J.K.
1988-01-01
Neutron scattering experiments on UPt 3 and U/sub 1-x/Th/sub x/Pt 3 are reviewed. At relatively high energies (/approximately/5 MeV), the magnetic fluctuation spectrum is modulated by the structure factor derived from short-range antiferromagnetic correlations where the two U ions in each unit cell are oppositely polarized. In contrast, at low energies (≤ 1 MeV), the diffuse inelastic scattering is associated with antiferromagnetic correlations where the unit cell is doubled. Nominally pure UPt 3 exhibits magnetic order with the wavevector corresponding to this doubling and a static moment of 0.02 +- 0.01 μ/sub B/. (U/sub 1-x/Th/sub x/)Pt 3 with x ≅ 0.05 exhibits ordering of the same type, but with a much larger static moment, 0.65 +- 0.1 μ/sub B/. Neutron scattering measurements on UPt 3 with implications for superconductivity are surveyed. 23 refs., 7 figs
International Nuclear Information System (INIS)
Kim Ki Hwan; Lee Don Bae; Kim Chang Kyu; Kuk Il Hyun; Hofman, G.E.
1997-01-01
Research on the intermetallic compounds of uranium was revived in 1978 with the decision by the international research reactor community to develop proliferation-resistant fuels. The reduction of 93% 235 U (HEU) to 20% 235 U (LEU) necessitates the use of higher U-loading fuels to accommodate the addition 238 U in the LEU fuels. While the vast majority of reactors can be satisfied with U 3 Si 2 -Al dispersion fuel, several high performance reactors require high loadings of up to 8-9 g U cm -3 . Consequently, in the renewed fuel development program of the Reduced Enrichment for Research and Test Reactors (RERTR) Program, attention has shifted to high density uranium alloys. Early irradiation experiments with uranium alloys showed promise of acceptable irradiation behavior, if these alloys can be maintained in their cubic γ-U crystal structure. It has been reported that high density atomized U-Mo powders prepared by rapid cooling have metastable isotropic γ-U phase saturated with molybdenum, and good γ-U phase stability, especially in U-10wt.%Mo alloy fuel. If the alloy has good thermal compatibility with aluminium, and this metastable gamma phase can be maintained during irradiation, U-Mo alloy would be a prime candidate for dispersion fuel for research reactors. In this paper, U-2w.%Mo and U-10w.%Mo alloy powder which have high density (above 15 g-U/cm 3 ), are prepared by centrifugal atomization. The U-Mo alloy fuel meats are made into rods extruding the atomized powders. The characteristics related to the thermal compatibility of U-2w.%Mo and U-10w.%Mo alloy fuel meat at 400 o C for time up to 2000 hours are examined. (author)
Interdiffusion between U(Mo,Pt) or U(Mo,Zr) and Al or Al A356 alloy
International Nuclear Information System (INIS)
Komar Varela, C.; Mirandou, M.; Arico, S.; Balart, S.; Gribaudo, L.
2009-01-01
Solid state reactions in chemical diffusion couples U-7 wt.%Mo-0.9 wt.%Pt/Al at 580 deg. C and U-7 wt.%Mo-0.9 wt.%Pt/Al A356 alloy, U-7 wt.%Mo-1 wt.%Zr/Al and U-7 wt.%Mo-1 wt.%Zr/Al A356 alloy at 550 deg. C were characterized. Results were obtained from optical and scanning electron microscopy, electron probe microanalysis and X-ray diffraction. The UAl 3, UAl 4 and Al 20 Mo 2 U phases were identified in the interaction layers of γU(Mo,Pt)/Al and γU(Mo,Zr)/Al diffusion couples. Al 43 Mo 4 U 6 ternary compound was also identified in γU(Mo,Zr)/Al due to the decomposition of γU(Mo,Zr) phase. The U(Al,Si) 3 and U 3 Si 5 phases were identified in the interaction layers of γU(Mo,Pt)/Al A356 and γU(Mo,Zr)/Al A356 diffusion couples. These phases are formed due to the migration of Si to the interaction layer. In the diffusion couple U(Mo,Zr)/Al A356, Zr 5 Al 3 phase was also identified in the interaction layer. The use of synchrotron radiation at Brazilian Synchrotron Light Laboratory (LNLS, CNPq, Campinas, Brazil) was necessary to achieve a complete crystallographic characterization.
Energy Technology Data Exchange (ETDEWEB)
Shibata, Keiichi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Nakajima, Yutaka; Kawano, Toshihiko; Oh, Soo-Youl; Matsunobu, Hiroyuki; Murata, Toru
1997-10-01
Covariances of nuclear data have been estimated for 6 nuclides contained in JENDL-3.2. The nuclides considered are {sup 16}O, {sup 23}Na, Fe, {sup 235}U, {sup 238}U, and {sup 239}Pu, which are regarded as important for the nuclear design study of fast reactors. The physical quantities for which covariances are deduced are cross sections, resolved and unresolved resonance parameters, and the first order Legendre-polynomial coefficient for the angular distribution of elastically scattered neutrons. As for {sup 235}U, covariances were obtained also for the average number of neutrons emitted in fission. The covariances were estimated by using the same methodology that had been used in the JENDL-3.2 evaluation in order to keep a consistency between mean values and their covariances. The least-squares fitting code GMA was used in estimating covariances for reactions of which JENDL-3.2 cross sections had been evaluated by taking account of measurements. In nuclear model calculations, the covariances were calculated by the KALMAN system. The covariance data obtained were compiled in the ENDF-6 format, and will be put into the JENDL-3.2 Covariance File which is one of JENDL special purpose files. (author). 193 refs.
3 CFR 8357 - Proclamation 8357 of April 3, 2009. Education and Sharing Day, U.S.A., 2009
2010-01-01
... economy and to contribute to their communities. Commemorating Education and Sharing Day, U.S.A., we... Sharing Day, U.S.A., 2009 8357 Proclamation 8357 Presidential Documents Proclamations Proclamation 8357 of April 3, 2009 Proc. 8357 Education and Sharing Day, U.S.A., 2009By the President of the United States of...
Determination of 11 trace elements in U3O8 CRMs by ICP-AES
International Nuclear Information System (INIS)
Liu Husheng
1994-01-01
The TBP extractant-containing resin and extraction chromatography technique were used to separate 11 trace elements in U 3 O 8 CRMs. The sample was separated at a flow rate of 0.5 mL/min with 3 mol/L HNO 3 as medium. A model 975 ICP direct reading spectrometer was used to determine the trace elements of Ca, Cd, Cr, Cu, Fe, Mg, Mn, Mo, Ni, Pb and Sn in U 3 O 8 CRMs. The lowest quantitatively determinable concentration of impurities in U 3 O 8 CRMs are 0.02-1.6 μg/g. The RSD is less than 10%. The proposed method provides excellent and accurate analytical data for the U 3 O 8 samples prepared as certified reference materials (CRMs)
Park, Hyo-Young
2017-04-21
The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms. These proteins also move rapidly and continuously in the nuclei, and their movements are affected by ATP depletion. The U2AF65 proteins are splicing factors that interact with SF1 and U2AF35 proteins to promote U2snRNP for the recognition of the pre-mRNA 3\\' splice site during early spliceosome assembly. We have determined the subcellular localization and movement of these proteins\\' Arabidopsis homologs. It was found that Arabidopsis U2AF65 homologs, AtU2AF65a, and AtU2AF65b proteins interact with AtU2AF35a and AtU2AF35b, which are Arabidopsis U2AF35 homologs. We have examined the mobility of these proteins including AtSF1 using fluorescence recovery after photobleaching and fluorescence loss in photobleaching analyses. These proteins displayed dynamic movements in nuclei and their movements were affected by ATP depletion. We have also demonstrated that these proteins shuttle between nuclei and cytoplasms, suggesting that they may also function in cytoplasm. These results indicate that such splicing factors show very similar characteristics to their human counterparts, suggesting evolutionary conservation.
Park, Hyo-Young; Lee, Keh Chien; Jang, Yun Hee; Kim, SoonKap; Thu, May Phyo; Lee, Jeong Hwan; Kim, Jeong-Kook
2017-01-01
The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms. These proteins also move rapidly and continuously in the nuclei, and their movements are affected by ATP depletion. The U2AF65 proteins are splicing factors that interact with SF1 and U2AF35 proteins to promote U2snRNP for the recognition of the pre-mRNA 3' splice site during early spliceosome assembly. We have determined the subcellular localization and movement of these proteins' Arabidopsis homologs. It was found that Arabidopsis U2AF65 homologs, AtU2AF65a, and AtU2AF65b proteins interact with AtU2AF35a and AtU2AF35b, which are Arabidopsis U2AF35 homologs. We have examined the mobility of these proteins including AtSF1 using fluorescence recovery after photobleaching and fluorescence loss in photobleaching analyses. These proteins displayed dynamic movements in nuclei and their movements were affected by ATP depletion. We have also demonstrated that these proteins shuttle between nuclei and cytoplasms, suggesting that they may also function in cytoplasm. These results indicate that such splicing factors show very similar characteristics to their human counterparts, suggesting evolutionary conservation.
Predicted irradiation behavior of U3O8-Al dispersion fuels for production reactor applications
International Nuclear Information System (INIS)
Cronenberg, A.W.; Rest, J.
1990-01-01
Candidate fuels for the new heavy-water production reactor include uranium/aluminum alloy and U 3 O 8 -Al dispersion fuels. The U 3 O 8 -Al dispersion fuel would make possible higher uranium loadings and would facilitate uranium recycle. Research efforts on U 3 O 8 -Al fuel include in-pile irradiation studies and development of analytical tools to characterize the behavior of dispersion fuels at high-burnup. In this paper the irradiation performance of U 3 O 8 -Al is assessed using the mechanistic Dispersion Analysis Research Tool (DART) code. Predictions of fuel swelling and alteration of thermal conductivity are presented and compared with experimental data. Calculational results indicate good agreement with available data where the effects of as-fabricated porosity and U 3 O 8 -Al oxygen exchange reactions are shown to exert a controlling influence on irradiation behavior. The DART code is judged to be a useful tool for assessing U 3 O 8 -Al performance over a wide range of irradiation conditions
Evaluation of fission cross sections and covariances for 233U, 235U, 238U, 239Pu, 240Pu, and 241Pu
International Nuclear Information System (INIS)
Kawano, Toshihiko; Matsunobu, Hiroyuki; Murata, Toru
2000-02-01
A simultaneous evaluation code SOK (Simultaneous evaluation on KALMAN) has been developed, which is a least-squares fitting program to absolute and relative measurements. The SOK code was employed to evaluate the fission cross sections of 233 U, 235 U, 238 U, 239 Pu, 240 Pu, and 241 Pu for the evaluated nuclear data library JENDL-3.3. Procedures of the simultaneous evaluation and the experimental database of the fission cross sections are described. The fission cross sections obtained were compared with evaluated values given in JENDL-3.2 and ENDF/B-VI. (author)
International Nuclear Information System (INIS)
Suripto, A.; Sugondo, S.; Nasution, H.
1994-01-01
The first low-enriched U 3 Si 2 -Al dispersion plate-type fuel element produced at the Nuclear Fuel Element Center, BATAN, Indonesia, was irradiated to a peak 235 U burnup of 62%. Postirradiation examinations performed to data shows the irradiation behavior of this element to be similar to that of U 3 Si 2 -Al plate-type fuel produced and tested at other institutions. The main effect of irradiation on the fuel plates is a thickness increase of 30--40 μm (2.5-3.0%). This thickness increase is almost entirely due to the formation of a corrosion layer (Boehmite). The contribution of fuel swelling to the thickness increase is rather small (less than 10 μm) commensurate with the burnup of the fuel and the relatively moderate as-fabricated fuel volume fraction of 27% in the fuel meat
Energy Technology Data Exchange (ETDEWEB)
Solis, D.
1998-10-16
The DART code is based upon a thermomechanical model that can predict swelling, recrystallization, fuel-meat interdiffusion and other issues related with MTR dispersed FE behavior under irradiation. As a part of a common effort to develop an optimized version of DART, a comparison between DART predictions and CNEA miniplates irradiation experimental data was made. The irradiation took place during 1981-82 for U3O8 miniplates and 1985-86 for U{sub 3}Si{sub x} at Oak Ridge Research Reactor (ORR). The microphotographs were studied by means of IMAWIN 3.0 Image Analysis Code and different fission gas bubbles distributions were obtained. Also it was possible to find and identify different morphologic zones. In both kinds of fuels, different phases were recognized, like particle peripheral zones with evidence of Al-U reaction, internal recrystallized zones and bubbles. A very good agreement between code prediction and irradiation results was found. The few discrepancies are due to local, fabrication and irradiation uncertainties, as the presence of U{sub 3}Si phase in U{sub 3}Si{sub 2} particles and effective burnup.
International Nuclear Information System (INIS)
Annamalai, Sathesh Kumar; Arunachalam, Kantha Deivi
2017-01-01
Highlights: • Exposure to "2"3"8U deteriorated the antioxidant defenses like SOD, CAT and LPO. • Flow cytometric analysis revealed the increase in G2/M phase and S phase. • Micronucleus frequencies increased with Increased "2"3"8U exposure and time. • Exposure to waterborne "2"3"8U induces both chemical and radiotoxicity in P. sutchi. • ROS-mediated "2"3"8U toxic mechanism and the antioxidant responses has been proposed. - Abstract: The strategic plan of this study is to analyze any possible radiological impact on aquatic organisms from forthcoming uranium mining facilities around the Nagarjuna Sagar Dam in the future. The predominantly consumed and dominant fish species Pangasius sutchi, which is available year-round at Nagarjuna Sagar Dam, was selected for the study. To comprehend the outcome and to understand the mode of action of "2"3"8U, the fish species Pangasius sutchi was exposed to ¼ and ½ of the LC_5_0 doses of waterborne "2"3"8U in a static system in duplicate for 21 days. Blood and organs, including the gills, liver, brain and muscles, were collected at different time periods—0 h, 24 h, 48 h, 72 h, 96 h, 7, days 14 days and 21 days—using ICP-MS to determine the toxic effects of uranium and the accumulation of "2"3"8U concentrations. The bioaccumulation of "2"3"8U in P. sutchi tissues was dependent on exposure time and concentration. The accumulation of uranium was, in order of magnitude, measured as gills > liver > brain > tissue, with the highest accumulation in the gills. It was observed that exposure to "2"3"8U significantly reduced antioxidant enzymes such as superoxide dismutase, catalase, and lipid peroxidase. The analysis of DNA fragmentation by comet assay and cell viability by flow cytometry was performed at different time intervals. DNA histograms by flow cytometry analysis revealed an increase in the G2/M phase and the S phase. The long-term "2"3"8U exposure studies in fish showed increasing micronucleus frequencies in
Sorption of U(VI) in surfaces of SrTiO3
International Nuclear Information System (INIS)
Ortiz O, H.B.; Ordonez R, E.; Fernandez V, S.M.
2004-01-01
In this work is presented the physico chemical characterization and evaluation of those surface properties and of sorption of U on the SrTiO 3 like possible candidate for contention barrier in the deep geological confinement. The made studies showed that the SrTiO 3 presents maximum levels of sorption of positive nature species (mainly UO 2 2+ and UO 2 NO 3 + ). (Author)
Site selective excitation spectroscopy of CsCdBr sub 3 :U sup 3 sup +
Yin Min
2002-01-01
The CsCdBr sub 3 :U sup 3 sup + crystal was grown by the Bridgman technique from the starting materials CsBr, CdBr sub 2 and UBr sub 4. X-ray check showed that the sample crystallized in the CsNiBr sub 3 structure. Under selective excitation at low temperature, the emission spectra and the fluorescence decay curve were measured and discussed
Yeast endoribonuclease stimulated by Novikoff Hepatoma small nuclear RNAS U1 and U2
International Nuclear Information System (INIS)
Stevens, A.
1982-01-01
Using [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) from yeast as a substrate, an endoribonuclease has been detected in enzyme fractions derived from a high salt wash of ribonucleoprotein particles of Saccharomyces cerevisiae. The [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) seems to be a preferred substrate since other polyribonucleotides are hydrolyzed more slowly, if at all. The enzyme is inhibited by ethidium bromide, but fully double-stranded polyribonucleotides are not hydrolyzed. The hydrolysis of [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) is stimulated about 2.5-fold by the addition of small nuclear RNAs U1 and U2 of Novikoff hepatoma cells. Results show that the stimulation involves an interaction of the labeled RNA with the small nuclear RNA
International Nuclear Information System (INIS)
Shigekawa, Y.; Kasamatsu, Y.; Shinohara, A.
2016-01-01
The nucleus "2"3"5"mU is an isomer with extremely low excitation energy (76.8 eV) and decays dominantly through the internal conversion (IC) process. Because outer-shell electrons are involved in the IC process, the decay constant of "2"3"5"mU depends on its chemical environment. We plan to study the deexcitation process of "2"3"5"mU by measuring the energy spectra of IC electrons in addition to the decay constants for various chemical forms. In this paper, the preparation method of "2"3"5"mU samples from "2"3"9Pu by using alpha-recoil energy is reported. A Collection Apparatus for Recoil Products was fabricated, and then collection efficiencies under various conditions were determined by collecting "2"2"4Ra recoiling out of "2"2"8Th electrodeposited and precipitated sources. The pressure in the apparatus (vacuum or 1 atm of N_2 gas) affected the variations of the collection efficiencies depending on the negative voltage applied to the collector. The maximum values of the collection efficiencies were mainly affected by the thickness of the "2"2"8Th sources. From these results, the suitable conditions of the "2"3"9Pu sources for preparation of "2"3"5"mU were determined. In addition, dissolution efficiencies were determined by washing collected "2"2"4Ra with solutions. When "2"2"4Ra was collected in 1 atm of N_2 gas and dissolved with polar solutions such as water, the dissolution efficiencies were nearly 100%. The method of rapid dissolution of recoil products would be applicable to rapid preparation of short-lived "2"3"5"mU samples for various chemical forms.
28 CFR 45.3 - Disciplinary proceedings under 18 U.S.C. 207(j).
2010-07-01
.... 207(j). 45.3 Section 45.3 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) EMPLOYEE RESPONSIBILITIES § 45.3 Disciplinary proceedings under 18 U.S.C. 207(j). (a) Upon a determination by the Assistant... authorized by 18 U.S.C. 207(j), or subjected to other appropriate disciplinary action under that statute. The...
The effect of symmetry on the U L3 NEXAFS of octahedral coordinated uranium(vi)
Energy Technology Data Exchange (ETDEWEB)
Bagus, Paul S. [Department of Chemistry, University of North Texas, Denton, Texas 76203-5017, USA; Nelin, Connie J. [Consultant, Austin, Texas 78730, USA; Ilton, Eugene S. [Pacific Northwest National Laboratory, Richland, Washington 99352, USA
2017-03-21
We describe a detailed theoretical analysis of how distortions from ideal cubic or Oh symmetry affect the shape, in particular the width, of the U L3-edge NEXAFS for U(VI) in octahedral coordination. The full-width-half-maximum (FWHM) of the L3-edge white line decreases with increasing distortion from Oh symmetry due to the mixing of symmetry broken t2g and eg components of the excited state U(6d) orbitals. The mixing is allowed because of spin-orbit splitting of the ligand field split 6d orbitals. Especially for higher distortions, it is possible to identify a mixing between one of the t2g and one of the eg components, allowed in the double group representation when the spin-orbit interaction is taken into account. This mixing strongly reduces the ligand field splitting, which, in turn, leads to a narrowing of the U L3 white line. However, the effect of this mixing is partially offset by an increase in the covalent anti-bonding character of the highest energy spin-orbit split eg orbital. At higher distortions, mixing overwhelms the increasing anti-bonding character of this orbital which leads to an accelerated decrease in the FWHM with increasing distortion. Additional evidence for the effect of mixing of t2g and eg components is that the FWHM of the white line narrows whether the two axial U-O bond distances shorten or lengthen. Our ab initio theory uses relativistic wavefunctions for cluster models of the structures; empirical or semi-empirical parameters were not used to adjust prediction to experiment. A major advantage is that it provides a transparent approach for determining how the character and extent of the covalent mixing of the relevant U and O orbitals affect the U L3-edge white line.
Effect of U-238 and U-235 cross sections on nuclear characteristics of fast and thermal reactors
Energy Technology Data Exchange (ETDEWEB)
Akie, Hiroshi; Takano, Hideki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kaneko, Kunio
1997-03-01
Benchmark calculation has been made for fast and thermal reactors by using ENDF/B-VI release 2(ENDF/B-VI.2) and JENDL-3.2 nuclear data. Effective multiplication factors (k{sub eff}s) calculated for fast reactors calculated with ENDF/B-VI.2 becomes about 1% larger than the results with JENDL-3.2. The difference in k{sub eff} is caused mainly from the difference in inelastic scattering cross section of U-238. In all thermal benchmark cores, ENDF/B-VI.2 gives smaller multiplication factors than JENDL-3.2. In U-235 cores, the difference is about 0.3%dk and it becomes about 0.6% in TCA U cores. The difference in U-238 data is also important in thermal reactors, while there are found 0.1-0.3% different v values of U isotopes in thermal energy between ENDF/B-VI.2 and JENDL-3.2. (author)
Comparison of {sup 235}U fission cross sections in JENDL-3.3 and ENDF/B-VI
Energy Technology Data Exchange (ETDEWEB)
Kawano, Toshihiko [Kyushu Univ., Fukuoka (Japan); Carlson, Allan D. [National Institute of Standards and Technology (United States); Matsunobu, Hiroyuki [Data Engineering, Inc., Fujisawa, Kanagawa (Japan); Nakagawa, Tsuneo; Shibata, Keiichi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Talou, Patrick; Young, Philip G.; Chadwick, Mark B. [Los Alamos National Laboratory, Los Alamos, NM (United States)
2002-01-01
Comparisons of evaluated fission cross sections for {sup 235}U in JENDL-3.3 and ENDF/B-VI are carried out. The comparisons are made for both the differential and integral data. The fission cross sections as well as the fission ratios are compared with the experimental data in detail. Spectrum averaged cross sections are calculated and compared with the measurements. The employed spectra are the {sup 235}U prompt fission neutron spectrum, the {sup 252}Cf spontaneous fission neutron spectrum, and the neutron spectrum produced by a {sup 9}Be(d, xn) reaction. For {sup 235}U prompt fission neutron spectrum, the ENDF/B-VI evaluation reproduces experimental averaged cross sections. For {sup 252}Cf and {sup 9}Be(d, xn) neutron spectra, the JENDL-3.3 evaluation gives better results than ENDF/B-VI. (author)
Zmuidzinas, J. S. (Inventor)
1978-01-01
A technique is disclosed for achieving large populations of metastable spin-aligned He2(a 3 Sigma u +) molecules in superfluid helium to obtain lasing in the vacuum ultraviolet wavelength regime around 0.0800 micron m by electronically exciting liquid (superfluid) helium with a comparatively low-current electron beam and spin aligning the metastable molecules by means of optical pumping with a modestly-powered (100mW) circularly-polarized continuous wave laser operating at, for example, 0.9096 or 0.4650 micron m. Once a high concentration of spin-aligned He2 (a 3 Sigma u +) is achieved with lifetimes of a few milliseconds, a strong microwave signal destroys the spin alignment and induces a quick collisional transition of He2 (a 3 Sigma u +) molecules to the a 1 Sigma u + state and thereby a lasing transition to the X 1 Sigma g + state.
Neutron inelastic-scattering cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu
International Nuclear Information System (INIS)
Smith, A.B.; Guenther, P.T.
1982-01-01
Differential-neutron-emission cross sections of 232 Th, 233 U, 235 U, 238 U, 239 Pu and 240 Pu are measured between approx. = 1.0 and 3.5 MeV with the angle and magnitude detail needed to provide angle-integrated emission cross sections to approx. 232 Th, 233 U, 235 U and 238 U inelastic-scattering values, poor agreement is observed for 240 Pu, and a serious discrepancy exists in the case of 239 Pu
International Nuclear Information System (INIS)
1994-01-01
The purpose of this report is to provide baseline geochemical and hydrogeologic data relative to corrective action for underground storage tanks (USTs) 0439-U, 0440-U, 2073-U, 2074-U, and 2075-U at the East End Fuel Station, Buildings 9754 and 9754-2 at the Oak Ridge Y-12 Plant. Progress in support of corrective action at the East End Fuel Station has included monitoring well installation, tank removal, and baseline groundwater sampling and analysis. This document represents the baseline report for corrective action at the East End Fuel Station and is organized into three sections. Section 1 presents introductory information relative to the site, including the regulatory initiative, site description, and progress to date. Section 2 includes a summary of additional monitoring well installation activities, the results of baseline groundwater sampling, a summary of tank removal activities, and the results of confirmatory soil sampling performed during tank removal. Section 3 presents the baseline hydrogeology and planned zone of influence for groundwater remediation
2006-07-24
oxide ( TeO2 ) , fluorine- containing silicate (SiOF2) and germanate (GeOF2) glass hosts for each dopant by characterising the spectroscopic properties...Earth Oxide Ion (Tm3+, Ho3+, And U3+) Doped Glasses And Fibres For 1.8 To 4 Micrometer Coherent And Broadband Sources 5c. PROGRAM ELEMENT NUMBER 5d...Rare-earth oxide ion (Tm3+, Ho3+, and U3+) doped glasses and fibres for 1.8 to 4 micrometer coherent and broadband sources Report prepared
Study of the U3O8-Al thermite reaction and strength of reactor fuel tubes
International Nuclear Information System (INIS)
Peacock, H.B.
1983-08-01
Heating tests using 53 wt % U 3 O 8 -Al pellets show that an exothermic reaction occurs between 875 and 1000 0 C and takes 10 to 20 seconds to reach maximum temperature. The maximum temperature is a function of particle size of the U 3 O 8 with large particles exhibiting lower peak temperatures. The calculated energy release was 123 cal/g of U 3 O 8 -aluminum fuel. Tests using aluminum clad outer fuel tube sections gave lower peak temperatures than for pellets. No violent reactions occurred. The results are reasonably consistent with recent reported data indicating that the exothermic U 3 O 8 -Al reaction is not an important energy source. The compressive and tensile strengths of U 3 O 8 tubes above 660 0 C are low. In compression, sections with 2 psi average axial stress failed at 917 0 C, while sections with 7 psi failed at 669 0 C. Tubes with U-Al alloy cores failed at about 670 0 C with no applied load. The stresses in fuel tubes during a reactor transient may range up to several hundred psi and are less than 7 psi only in the upper part of the fuel tube
U and Th background contents in the Crimea rocks, Th/U ratio interpretation
International Nuclear Information System (INIS)
Gerasimov, Yu.G.; Voronova, M.A.; AN Ukrainskoj SSR, Kiev. Inst. Geologicheskikh Nauk)
1981-01-01
Radiogeochemical sampling of rocks in the Crimea is carried out. Analyses for U are made by luminescence method, while for Th by X-ray one. About 1000 samples, characterizing the whole stratigraphical cross section except Pz of crystalline rocks, have been analyzed. Low background values for U and Th are established; U content of 1.3-2.3 g/kg and Th content of 7.0-9.0 g/kg are predominant, that is lower than the clark of the earth crust. The distribution of radioelements in stepper and submontane Crimea is gradual, while in mountain part - the mosaic one. Results of Th/U ratios interpretation are presented [ru
Effect of the fabrication process on fatigue performance of U3Si2 fuel plate with sandwich structure
International Nuclear Information System (INIS)
Wang Xishu; Li Shuangshou; Wang Qingyuan; Xu Yong
2005-01-01
U 3 Si 2 -Al fuel plate is one of the dispersion fuel structure materials recently developed and widely used in research reactors. The mechanical properties of this structural material, especially the fatigue performance, are strongly dependent on its fabrication process. To investigate the effects of these processing technologies, the fatigue tests for the different specimens were carried out. The S-N curves indicate that the fabrication processing technologies of U 3 Si 2 fuel plate, such as the addition of U 3 Si 2 particles into aluminum powder to form the fuel meat, holding and rolling the processes of meat and cladding of 6061-Al alloy, plays an important role in improving the mechanical properties and fatigue performance of this fuel plate. In addition, some factors that influence the crack initiation and propagation are summarized based on the fatigue images that are in situ observations with SEM. The critical criterion for fatigue damage is proposed based on the fatigue data of the structural material, which were obtained at the different conditions
Energy Technology Data Exchange (ETDEWEB)
Hosler, W R [ed.
1976-01-01
The first (Phase I) joint U.S.-U.S.S.R. test of U.S. electrode materials was carried out in Moscow between September 25 and October 8, 1975 in the Soviet U-02 MHD facility. The test procedure followed closely a predetermined work plan designed to test five different zirconia based materials and the cathode and anode electrode wall modules under MHD operating conditions. The materials which were selected were 88Zr0/sub 2/-12Y/sub 2/0/sub 3/, 82Zr0/sub 2/-18Ce02, 50Zr0/sub 2/-50Ce0/sub 2/, 25Zr0/sub 2/-75Ce0/sub 2/ and 20Zr0/sub 2/-78Ce0/sub 2/-2Ta/sub 2/0/sub 5/. The electrode modules were constructed by Westinghouse Research and Development Laboratory. Each of the five electrode materials had four different current densities established between the anode and cathode during the experiment which lasted a total of 127 hours. There were four main phases in the test schedule: (1) start-up of the channel over a specific heating period. No seed (K/sub 2/C0/sub 3/) introduction - 18 hours. (2) Electrical tests at operating temperature to investigate electro-physical characteristics of the channel and electrodes - 6 hours. (3) Operating life test - 94 hours. (4) Shut-down of the channel over a specific cool down period - 9 hours. All except six electrode pairs performed satisfactorily during the entire test. These were the pairs which were designated to carry maximum or near maximum current density. Five pairs failed early in the life test and the sixth pair failed in the last several hours. Failure was not due to the electrode materials, however, but due to lead-out melting caused by joule heating in the platinum wires. The U-02 facility is described and the operational parameters are given for each phase of the test. The electrode and insulating walls are described and the appropriate parameters that are used to predict the performance of the module are given.
International Nuclear Information System (INIS)
Lu, Erli; Tuna, Floriana; Kaltsoyannis, Nikolas; Liddle, Stephen T.; Lewis, William
2016-01-01
We report uranium(IV)-carbene-imido-amide metalla-allene complexes [U(BIPM"T"M"S)(NCPh_3)(NHCPh_3)(M)] (BIPM"T"M"S=C(PPh_2NSiMe_3)_2; M=Li or K) that can be described as R_2C=U=NR' push-pull metalla-allene units, as organometallic counterparts of the well-known push-pull organic allenes. The solid-state structures reveal that the R_2C=U=NR' units adopt highly unusual cis-arrangements, which are also reproduced by gas-phase theoretical studies conducted without the alkali metals to remove their potential structure-directing roles. Computational studies confirm the double-bond nature of the U=NR' and U=CR_2 interactions, the latter increasingly attenuated by potassium then lithium when compared to the hypothetical alkali-metal-free anion. Combined experimental and theoretical data show that the push-pull effect induced by the alkali metal cations and amide auxiliary gives a fundamental and tunable structural influence over the C=U"I"V=N units. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
International Nuclear Information System (INIS)
Saha, Abhijit; Deb, S.B.; Nagar, B.K.; Saxena, M.K.; Samanta, Papu
2014-01-01
An analytical methodology was developed for precise quantification and isotope ratio measurement of boron in U 3 Si 2 matrix by using ICP-MS after matrix separation. The analytical technique was validated by recovery studies employing standard addition method and the accuracy in isotope ratio measurement was improved by correcting the bias factor after analyzing NIST SRM951. The quantification of B in the three U 3 Si 2 samples was found in the range of 2.32-3.90 μg g -1 with a maximum standard deviation of 3%. The 10 B/ 11 B value in the three samples was found to be 0.2455±0.0042, 0.2451±0.0036 and 0.2452±0.0041. (author)
International Nuclear Information System (INIS)
Ge, Xiangkun; Fan, Guang; Chen, Zhangru; Ai, Yujie; Li, Guowu
2017-01-01
Mianningite (IMA 2014-072), ideally (□,Pb,Ce,Na)(U"4"+,Mn,U"6"+) Fe"3"+_2(Ti,Fe"3"+)_1_8O_3_8, is a new member of the crichtonite group from the Maoniuping REE deposit, Mianning county, Sichuan province, China. It was found in fractures of lamprophyre veins and in the contact between lamprophyre and a later quartz-alkali feldspar syenite dyke with REE mineralization, and is named after its type locality. Associated minerals are microcline, albite, quartz, iron-rich phlogopite, augite, muscovite, calcite, baryte, fluorite, epidote, pyrite, magnetite, hematite, galena, hydroxylapatite, titanite, ilmenite, rutile, garnet-group minerals, zircon, allanite-(Ce), monazite-(Ce), bastnaesite-(Ce), parisite-(Ce), maoniupingite-(Ce), thorite, pyrochlore-group minerals and chlorite. Mianningite occurs as opaque subhedral to euhedral tabular crystals, up to 1-2 mm in size, black in color and streak, and with a submetallic luster. Mianningite is brittle, with a conchoidal fracture. Its average micro-indentation hardness is 83.8 kg/mm"2 (load 0.2 kg), which is equivalent to ∝6 on the Mohs hardness scale. Its measured and calculated densities are 4.62 (8) g/cm"3 and 4.77 g/cm"3, respectively. Under reflected light, mianningite is grayish white, with no internal reflections. It appears isotropic and exhibits neither bireflectance nor pleochroism. The empirical formula, calculated on the basis of 38 O atoms per formula unit (apfu), is [□_0_._3_2_2(Pb_0_._2_1_5Ba_0_._0_3_7Sr_0_._0_3_6Ca_0_._0_1_0)_Σ_0_._2_9_8(Ce_0_._1_2_8La_0_._0_7_7Nd_0_._0_1_2)_Σ_0_._2_1_7 (Na_0_._1_2_7K_0_._0_3_6)_Σ_0_._1_6_3]_Σ_0_1_._0_0_0(U"4"+_0_._4_4_7Mn_0_0_._2_9_3U"6 "+_0_._1_1_2Y_0_._0_9_1Zr_0_._0_2_3Th_0_._0_1_1)_Σ_0_._9_7_7(Fe"3"+_1_._2_2_4Fe"2"+_0_._2_4_3Mg_0_._0_2_3P_0_._0_0_8Si_0_._0_0_6 □_0_._4_9_6)_Σ_2_._0_0_0(Ti_1_2_._4_6_4Fe"3"+_5_._2_9_2V"5"+_0_._1_1_8Nb_0_._0_8_3Al_0_._0_2_6Cr"3"+_0_._0_1_7)_Σ_1_8_._0_0_0O_3_8. Mianningite is trigonal, belongs to the space group R anti 3, and has
Measurement of 233U/234U ratios in contaminated groundwater using alpha spectrometry
International Nuclear Information System (INIS)
Harrison, Jennifer J.; Payne, Timothy E.; Wilsher, Kerry L.; Thiruvoth, Sangeeth; Child, David P.; Johansen, Mathew P.; Hotchkis, Michael A.C.
2016-01-01
The uranium isotope 233 U is not usually observed in alpha spectra from environmental samples due to its low natural and fallout abundance. It may be present in samples from sites in the vicinity of nuclear operations such as reactors or fuel reprocessing facilities, radioactive waste disposal sites or sites affected by clandestine nuclear operations. On an alpha spectrum, the two most abundant alpha emissions of 233 U (4.784 MeV, 13.2%; and 4.824 MeV, 84.3%) will overlap with the 234 U doublet peak (4.722 MeV, 28.4%; and 4.775 MeV, 71.4%), if present, resulting in a combined 233+234 U multiplet. A technique for quantifying both 233 U and 234 U from alpha spectra was investigated. A series of groundwater samples were measured both by accelerator mass spectrometry (AMS) to determine 233 U/ 234 U atom and activity ratios and by alpha spectrometry in order to establish a reliable 233 U estimation technique using alpha spectra. The Genie™ 2000 Alpha Analysis and Interactive Peak Fitting (IPF) software packages were used and it was found that IPF with identification of three peaks ( 234 U minor, combined 234 U major and 233 U minor, and 233 U major) followed by interference correction on the combined peak and a weighted average activity calculation gave satisfactory agreement with the AMS data across the 233 U/ 234 U activity ratio range (0.1–20) and 233 U activity range (2–300 mBq) investigated. Correlation between the AMS 233 U and alpha spectrometry 233 U was r 2 = 0.996 (n = 10). - Highlights: • Describes a technique for deconvoluting the combined 233 U and 234 U multiplet in alpha spectra. • Enables 233 U and 234 U activities and 233 U/ 234 U ratios to be quantified without requiring additional analysis and measurement. • Applicable to an environmental matrix (groundwater) using standard alpha spectrometry counting equipment, operation and set-up.
Comparing simulated and theoretical sampling distributions of the U3 person-fit statistic
Emons, W.H.M.; Meijer, R.R.; Sijtsma, K.
2002-01-01
The accuracy with which the theoretical sampling distribution of van der Flier's person-.t statistic U3 approaches the empirical U3 sampling distribution is affected by the item discrimination. A simulation study showed that for tests with a moderate or a strong mean item discrimination, the Type I
Closure report for underground storage tank 141-R3U1 and its associated underground piping
Energy Technology Data Exchange (ETDEWEB)
Mallon, B.J.; Blake, R.G.
1994-03-01
Underground storage tank UST 141-R3U1 at Lawrence Livermore National Laboratory (LLNL), was registered with the State Water Resources Control Board on June 27, 1984. This tank system consisted of a concrete tank, lined with polyvinyl chloride, and approximately 100 feet of PVC underground piping. UST 141-R3U1 had a capacity of 450 gallons. The underground piping connected three floor drains and one sink inside Building 141 to UST 141-R3U1. The wastewater collected in UST 141-R3U1 contained organic solvents, metals, and inorganic acids. On November 30, 1987, the 141-R3U1 tank system failed a precision tank test. The 141-R3U1 tank system was subsequently emptied and removed from service pending further precision tests to determine the location of the leak within the tank system. A precision tank test on February 5, 1988, was performed to confirm the November 30, 1987 test. Four additional precision tests were performed on this tank system between February 25, 1988, and March 6, 1988. The leak was located where the inlet piping from Building 141 penetrates the concrete side of UST 141-R3U1. The volume of wastewater that entered the backfill and soil around and/or beneath UST 141-R3U1 is unknown. On December 13, 1989, the LLNL Environmental Restoration Division submitted a plan to close UST 141-R3U1 and its associated piping to the Alameda County Department of Environmental Health. UST 141-R3U1 was closed as an UST, and shall be used instead as additional secondary containment for two aboveground storage tanks.
Closure report for underground storage tank 141-R3U1 and its associated underground piping
International Nuclear Information System (INIS)
Mallon, B.J.; Blake, R.G.
1994-03-01
Underground storage tank UST 141-R3U1 at Lawrence Livermore National Laboratory (LLNL), was registered with the State Water Resources Control Board on June 27, 1984. This tank system consisted of a concrete tank, lined with polyvinyl chloride, and approximately 100 feet of PVC underground piping. UST 141-R3U1 had a capacity of 450 gallons. The underground piping connected three floor drains and one sink inside Building 141 to UST 141-R3U1. The wastewater collected in UST 141-R3U1 contained organic solvents, metals, and inorganic acids. On November 30, 1987, the 141-R3U1 tank system failed a precision tank test. The 141-R3U1 tank system was subsequently emptied and removed from service pending further precision tests to determine the location of the leak within the tank system. A precision tank test on February 5, 1988, was performed to confirm the November 30, 1987 test. Four additional precision tests were performed on this tank system between February 25, 1988, and March 6, 1988. The leak was located where the inlet piping from Building 141 penetrates the concrete side of UST 141-R3U1. The volume of wastewater that entered the backfill and soil around and/or beneath UST 141-R3U1 is unknown. On December 13, 1989, the LLNL Environmental Restoration Division submitted a plan to close UST 141-R3U1 and its associated piping to the Alameda County Department of Environmental Health. UST 141-R3U1 was closed as an UST, and shall be used instead as additional secondary containment for two aboveground storage tanks
International Nuclear Information System (INIS)
Fitzmaurice, T. M.
2000-01-01
This Closure Plan has been prepared for the Area 3 RWMS U-3ax/bl Disposal Unit Corrective Action Unit 110 in accordance with the Federal Facility and Consent Order (Nevada Division of Environmental Protection [NDEP] et al., 1996). The U-3ax/bl is a historic disposal unit within the Area 3 Radioactive Waste Management Site located on the Nevada Test Site (NTS). The unit, which was formed by excavating the area between two subsidence craters (U-3ax and U-3bl), was operationally closed in 1987. The U-3ax/bl disposal unit is scheduled for permanent closure under the Resource Conservation and Recovery Act as a hazardous waste landfill. Existing records indicate that, from July 1968 to December 1987, U-3ax/bl received 2.3 x 10 5 cubic meters (8.12 x 10 6 cubic feet) of waste. NTS nuclear device testing generated approximately 95 percent of the total volume disposed of in U-3ax/bl, the majority of which came from the Waste Consolidation Project (80 percent of the total volume) (Elletson and Johnejack, 1995). Area 3 is located in Yucca Flat, within the northeast quadrant of the NTS. The Yucca Flat watershed is a structurally closed basin encompassing an area of approximately 780 square kilometers (300 square miles). The structural geomorphology of Yucca Flat is typical of the Basin and Range Physiographic Province. Yucca Flat lies in one of the most arid regions of the country. Water balance calculations for Area 3 indicate that it is continuously in a state of moisture deficit. The U-3ax/bl Disposal Unit will be closed in place by installing a Resource Conservation and Recovery Act equivalent cover. Following cover construction a fence will be installed around the cover to prevent accidental damage to the cover. Post-closure monitoring will consist of site inspections to determine the condition of the engineered cover and cover performance monitoring using Time-Domain Reflectometry arrays to monitor moisture migration in the cover. Any identified maintenance and repair
Energy Technology Data Exchange (ETDEWEB)
T. M. Fitzmaurice
2000-08-01
This Closure Plan has been prepared for the Area 3 RWMS U-3ax/bl Disposal Unit Corrective Action Unit 110 in accordance with the Federal Facility and Consent Order (Nevada Division of Environmental Protection [NDEP] et al., 1996). The U-3ax/bl is a historic disposal unit within the Area 3 Radioactive Waste Management Site located on the Nevada Test Site (NTS). The unit, which was formed by excavating the area between two subsidence craters (U-3ax and U-3bl), was operationally closed in 1987. The U-3ax/bl disposal unit is scheduled for permanent closure under the Resource Conservation and Recovery Act as a hazardous waste landfill. Existing records indicate that, from July 1968 to December 1987, U-3ax/bl received 2.3 x 10{sup 5} cubic meters (8.12 x 10{sup 6} cubic feet) of waste. NTS nuclear device testing generated approximately 95 percent of the total volume disposed of in U-3ax/bl, the majority of which came from the Waste Consolidation Project (80 percent of the total volume) (Elletson and Johnejack, 1995). Area 3 is located in Yucca Flat, within the northeast quadrant of the NTS. The Yucca Flat watershed is a structurally closed basin encompassing an area of approximately 780 square kilometers (300 square miles). The structural geomorphology of Yucca Flat is typical of the Basin and Range Physiographic Province. Yucca Flat lies in one of the most arid regions of the country. Water balance calculations for Area 3 indicate that it is continuously in a state of moisture deficit. The U-3ax/bl Disposal Unit will be closed in place by installing a Resource Conservation and Recovery Act equivalent cover. Following cover construction a fence will be installed around the cover to prevent accidental damage to the cover. Post-closure monitoring will consist of site inspections to determine the condition of the engineered cover and cover performance monitoring using Time-Domain Reflectometry arrays to monitor moisture migration in the cover. Any identified maintenance and
Energy Technology Data Exchange (ETDEWEB)
Boucher, R; Barthelemy, P [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires
1964-07-01
The data concerning the U-Pu, U-Pu-Mo and U-Pu-Nb are recalled. The results obtained with U-Pu-Ti and U-Pu-Zr alloys containing 15-20 per cent Pu and 10 wt. per cent ternary element are reported. The transformation temperatures, the expansion coefficients, the nature of phases, the thermal cycling behaviour have been determined. A list of the principal properties of these different alloys is presented and the possibilities of their use as fast reactor's fuel element are considered. The U-Pu-Ti alloys seem to be quite promising: easiness of fabrication, large thermal stability, excellent behaviour in air, small quantity of zeta phase, temperature of solidus superior to 1100 deg. C. (authors) [French] On rappelle brievement les connaissances acquises sur les alliages U-Pu, U-Pu-Mo et U-Pu-Nb. On presente les resultats obtenus avec les alliages U-Pu-Ti et U-Pu-Zr pour des teneurs de 15 a 20 pour cent de plutonium et 10 pour cent en poids d'element ternaire. On a determine les temperatures de transformation, les coefficients de dilatation, la nature des phases, la conductibilite thermique a 20 deg. C, la tenue au cyclage thermique et diverses autres proprietes. Un tableau resume les principales proprietes des divers alliages. On considere les possibilites d'emploi de ces alliages comme combustibles de reacteur rapide. Les alliages U-Pu-Ti paraissent particulierement interessants: facilite d'elaboration, stabilite thermique etendue, tenue dans l'air excellente, faible quantite de la phase U-Pu zeta, temperature de fusion commencante superieure a 1100 deg. C. (auteurs)
Uncertainty assessing of measure result of tungsten in U3O8 by ICP-AES
International Nuclear Information System (INIS)
Du Guirong; Nie Jie; Tang Lilei
2011-01-01
According as the determining method and the assessing criterion,the uncertainty assessing of measure result of tungsten in U 3 O 8 by ICP-AES is researched. With the assessment of each component in detail, the result shows that u rel (sc)> u rel (c)> u rel (F)> u rel (m) by uncertainty contribution. Other uncertainty is random, calculated by repetition. u rel (sc) is contributed to uncertainty mainly. So the general uncertainty is reduced with strict operation to reduce u rel (sc). (authors)
Observation of the a3Σu+-Χ1Σg+ system of calcium dimer
International Nuclear Information System (INIS)
Gondal, M.A.; Khan, M.A.; Rais, M.H.
1998-01-01
The authors report the observation of collision-induced spectra of calcium dimer in the 680-692 nm region. The spectra were recorded after resonant laser excitation of 4s4p 3 P 1 state of atomic calcium. Here the upper state a 3 Σ u + is populated through collisions. The same spectra were reproduced in a low-current glow discharge in calcium vapor. The assignment of the observed spectral lines was carried out by applying the Dunham-type analysis and the spectra were assigned to the a 3 Σ u + -Χ 1 Σ g + transition of Ca 2 . The existence of a a 3 Σ u + state with v 00 =13850±1 cm -1 and ω e ∼37.6 cm -1 is confirmed
Comparing simulated and theoretical sampling distributions of the U3 person-fit statistic
Emons, Wilco H.M.; Meijer, R.R.; Sijtsma, Klaas
2002-01-01
The accuracy with which the theoretical sampling distribution of van der Flier’s person-fit statistic U3 approaches the empirical U3 sampling distribution is affected by the item discrimination. A simulation study showed that for tests with a moderate or a strong mean item discrimination, the Type I
International Nuclear Information System (INIS)
Gao Liang; Sun Jizhong; Feng Chunlei; Bai Jing; Ding Hongbin
2012-01-01
A particle-in-cell plus Monte Carlo collisions method has been employed to investigate the nitrogen discharge driven by a nanosecond pulse power source. To assess whether the production of the metastable state N 2 (A 3 Σ u + ) can be efficiently enhanced in a nanosecond pulsed discharge, the evolutions of metastable state N 2 (A 3 Σ u + ) density and electron energy distribution function have been examined in detail. The simulation results indicate that the ultra short pulse can modulate the electron energy effectively: during the early pulse-on time, high energy electrons give rise to quick electron avalanche and rapid growth of the metastable state N 2 (A 3 Σ u + ) density. It is estimated that for a single pulse with amplitude of -9 kV and pulse width 30 ns, the metastable state N 2 (A 3 Σ u + ) density can achieve a value in the order of 10 9 cm -3 . The N 2 (A 3 Σ u + ) density at such a value could be easily detected by laser-based experimental methods.
Gao, Liang; Sun, Jizhong; Feng, Chunlei; Bai, Jing; Ding, Hongbin
2012-01-01
A particle-in-cell plus Monte Carlo collisions method has been employed to investigate the nitrogen discharge driven by a nanosecond pulse power source. To assess whether the production of the metastable state N2(A3 Σu+) can be efficiently enhanced in a nanosecond pulsed discharge, the evolutions of metastable state N2(A3 Σu+) density and electron energy distribution function have been examined in detail. The simulation results indicate that the ultra short pulse can modulate the electron energy effectively: during the early pulse-on time, high energy electrons give rise to quick electron avalanche and rapid growth of the metastable state N2(A3 Σu+) density. It is estimated that for a single pulse with amplitude of -9 kV and pulse width 30 ns, the metastable state N2(A3 Σu+) density can achieve a value in the order of 109 cm-3. The N2(A3 Σu+) density at such a value could be easily detected by laser-based experimental methods.
Stoichiometry of the U3O8 phase formed during calcination of some uranium compounds
International Nuclear Information System (INIS)
El-Fekey, S.A.; Farah, M.Y.; Rofail, N.H.
1981-01-01
Although recent work has shown U 3 O 8 phase to be the decomposition product obtained after calcining uranyl nitrate, sulphate or ammonium uranate, neither the necessary conditions for obtaining stoichiometric U 3 O 8 nor the details of the reaction have been established. Presence of sulphate or nitrate ions during preparation greatly affects the O/U of the obtained oxides and the physico-chemical properties of uranium tetrafluoride prepared afterwards from it (1-3). The aim of the present investigation was to study the effect of calcination regimes on the stoichiometry of the U 3 O 8 phase produced by the thermal decomposition of uranyl nitrate, sulphate, and ammonium uranate, which was prepared by precipitation from nuclear-pure uranyl sulphate. Stoichiometry of the U 3 O 8 phase formed during calcination of ammonium uranate precipitated from nuclear pure uranyl nitrate solution was reported before (1)
International Nuclear Information System (INIS)
Baig, M.; Colet, J.
1986-01-01
Using Monte Carlo simulations the SU(2)xU(1) lattice gauge theory has been analyzed, which is equivalent for the Wilson action to a U(2) theory, at space-time dimensionalities from d=3 to 5. It has been shown that there exist first-order phase transitions for both d=4 and d=5. A monopole-condensation mechanism seems to be responsible for these phase transitions. At d=3 no phase transitions have been detected. (orig.)
Ce2Co3Ge5: a new U2Co3Si5 - type valance fluctuating compound
International Nuclear Information System (INIS)
Layek, Samar; Hossain, Zakir
2010-01-01
Poly crystalline sample of Ce 2 Co 3 Ge 5 have been prepared by arc melting and consequently annealing at 1100 deg C. Rietveld refinement of XRD shows that it crystallize in the orthorhombic U 2 Co 3 Si 5 structure (space group Ibam) with crystal parameters a= 9.802A, b= 11.777A and c= 5.941A and unit cell volume V= 684.8 A 3 The unit cell volume of Ce 2 Co 3 Ge 5 is seen clearly to deviate from that expected on the basis of lanthanide contraction. From susceptibility measurement, effective magnetic moment of this compound μ eff = 0.95 μ B which is lower than magnetic moment free for Ce 3+ ions (2.54 μB) but higher than that of non-magnetic Ce 4+ state (0 μ B ). All these results clearly indicated Ce 2 Co 3 Ge 5 to be a mixed valance compound. (author)
Determination of Uranium In UO2 And U3O8 Powder Using UV-VIS Spectrophotometry
International Nuclear Information System (INIS)
Natalia Adventini; Diah Dwiana Lestiani; Muhayatun; Endah Damastuti
2009-01-01
Lab. TAR PTNBR BATAN - Bandung has been accredited by National Accreditation Committee on May 2 nd , 2006 as a test laboratory with number LP-311-ID, has to maintain its laboratory performance by participating in a proficiency test. In this activity, the determination of uranium in 2 samples of UO 2 with A1 and A2 codes and other 2 samples of U 3 O 8 with B1 and B2 codes using UV-Vis spectrophotometry was carried out. Colouring method was used by reacting thiocyanate ion with the uranyl ion in acidic solution to develop a stable yellow colour of uranyl thiocyanate complex solution and measured at wavelength of 380 nm. The result gave that concentration of uranium in A1, A2, B1 and B2 samples were 77.95; 75.29; 64.58 and 63.69% respectively. The Z-score value for A samples was - 1.99, meanwhile for B samples the Z score value of between laboratory was −1.29 with intra laboratory was -1,09. It meant that Z-score values for both samples were in good category. From this result, it showed that UV-Vis spectrophotometry is one of the several methods that can be used to determine uranium in UO 2 and U 3 O 8 powder. The Lab. TAR’s proficiency test for determination of uranium in UO 2 and U 3 O 8 gave a good result and it was hoped to support BATAN's program in the nuclear fuel field. (author)
238U, 234U and 230Th in uranium miners' lungs
International Nuclear Information System (INIS)
Singh, M.P.; Wrenn, M.E.; Archer, V.E.; Saccomanno, G.
1981-01-01
Fourteen uranium miners' lungs from Colorado plateau were collected at autopsy and the concentrations of 238 U, 234 U and 230 Th were determined by radiochemical procedures utilizing solvent extraction - alpha spectrometric techniques. The uranium and thorium isotopes are in near equilibrium with average concentrations of 238 U, 234 U and 230 Th being 89.3, 95.2 and 91.1 pCi/kg respectively. The combined average radiation dose rate to lung from these three isotopes is about 24.2 mrad/year at death excluding the unmeasured contribution from the 226 Ra and daughters. The average concentration of 230 Th is about 65 times higher than the mean concentration of 230 Th in lungs of non-miners dying at comparable ages from the same region
Comparing Simulated and Theoretical Sampling Distributions of the U3 Person-Fit Statistic.
Emons, Wilco H. M.; Meijer, Rob R.; Sijtsma, Klaas
2002-01-01
Studied whether the theoretical sampling distribution of the U3 person-fit statistic is in agreement with the simulated sampling distribution under different item response theory models and varying item and test characteristics. Simulation results suggest that the use of standard normal deviates for the standardized version of the U3 statistic may…
Energy Technology Data Exchange (ETDEWEB)
Barbier, R
1995-09-22
This thesis concerns some aspects of new symmetries in Nuclear Physics. It comprises three parts. The first one is devoted to the study of the quantum algebra U{sub qp}(u{sub 2}). More precisely, we develop its Hopf algebraic structure and we study its co-product structure. The bases of the representation theory of U{sub qp}(u{sub 2}) are introduced. On one hand, we construct the finite-dimensional irreducible representations of U{sub qp}(u{sub 2}). On the other hand, we calculate the Clebsch-Gordan coefficients with the projection operator method. To complete our study, we construct some deformed boson mappings of the quantum algebras U{sub qp}(u{sub 2}), U{sub q{sup 2}}(su{sub 2}) and U{sub qp}(u{sub 1,1}). The second part deals with the construction of a new phenomenological model of the non rigid rotator. This model is based on the quantum algebra U{sub qp}(u{sub 2}). The rotational energy and the E2 reduced transition probabilities are obtained. They depend on the two deformation parameters q and p of the quantum algebra. We show how the use of the two-parameter deformation of the algebra U{sub qp}(u{sub 2}) leads to a generalization of the U{sub q}(su{sub 2})-rotator model. We also introduce a new model of the anharmonic oscillator on the basis of the quantum algebra U{sub qp}(u{sub 2}). We show that the system of the U{sub q}(su{sub 2})-rotator and of the anharmonic oscillator can be coupled with the use of the deformation parameters of U{sub qp}(u{sub 2}). A ro-vibration energy formula and expansion `a la` Dunham are obtained. The aim of the last part is to apply our non rigid rotator model to the rotational collective dynamics of the superdeformed nuclei of the A{approx}130 - 150 and A{approx}190 mass regions and deformed nuclei of the actinide and rare earth series. We adjust the free parameters of our model and compare our results with those from four other models of the non rigid rotator. A comparative analysis is given in terms of transition energies.
Semidirect product gauge group [SU(3)cxSU(2)L]xU(1)Y and quantization of hypercharge
International Nuclear Information System (INIS)
Hattori, Chuichiro; Matsunaga, Mamoru; Matsuoka, Takeo
2011-01-01
In the standard model the hypercharges of quarks and leptons are not determined by the gauge group SU(3) c xSU(2) L xU(1) Y alone. We show that, if we choose the semidirect product group [SU(3) c xSU(2) L ]xU(1) Y as its gauge group, the hyperchages are settled to be n/6 mod Z(n=0,1,3,4). In addition, the conditions for gauge-anomaly cancellation give strong constraints. As a result, the ratios of the hypercharges are uniquely determined and the gravitational anomaly is automatically canceled. The standard charge assignment to quarks and leptons can be properly reproduced. For exotic matter fields their hypercharges are also discussed.
A yeast endoribonuclease stimulated by Novikoff hepatoma small nuclear RNAs U1 and U2
International Nuclear Information System (INIS)
Stevens, A.
1982-01-01
Using [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) from yeast as a substrate, an endoribonuclease has been detected in enzyme fractions derived from a high salt wash of ribonucleoprotein particles of Saccharomyces cerevisiae. The [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) seems to be a preferred substrate since other polyribonucleotides are hydrolyzed more slowly, if at all. The enzyme is inhibited by ethidium bromide, but fully double-stranded polyribonucleotides are not hydrolyzed. The hydrolysis of [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) is stimulated about 2.5-fold by the addition of small nuclear RNAs U1 and U2 of Novikoff hepatoma cells. Results show that the stimulation involves an interaction of the labeled RNA with the small nuclear RNA
Analysis of 235U enrichment by chemical exchange in U(IV) - U(VI) system on anionite
International Nuclear Information System (INIS)
Raica, Paula; Axente, Damian
2007-01-01
Full text: A theoretical study about the 235 U enrichment by chemical exchange method in U(IV)-U(VI) system on anion-exchange resins is presented. The 235 U isotope concentration profiles along the band were numerically calculated using an accurate mathematical model and simulations were carried out for the situation of product and waste withdrawal and feed supply. By means of numerical simulation, an estimation of the migration time, necessary for a desired enrichment degree, was obtained. The required migration distance, the production of uranium 3 at.% 235 U per year and the plant configuration are calculated for different operating conditions. An analysis of the process scale for various experimental conditions is also presented. (authors)
Wieben, E D; Nenninger, J M; Pederson, T
1985-05-05
Biosynthetic precursors of U2 small nuclear RNA have been identified in cultured human cells by hybrid-selection of pulse-labeled RNA with cloned U2 DNA. These precursor molecules are one to approximately 16 nucleotides longer than mature U2 RNA and contain 2,2,7-trimethylguanosine "caps". The U2 RNA precursors are associated with proteins that react with a monoclonal antibody for antigens characteristic of small nuclear ribonucleoprotein particles. Like previously described precursors of U1 and U4 small nuclear RNAs, the pre-U2 RNAs are recovered in cytoplasmic fractions, although it is not known if this is their location in vivo. The precursors are processed to mature-size U2 RNA when cytoplasmic extracts are incubated in vitro at 37 degrees C. Mg2+ is required but ATP is not. The ribonucleoprotein structure of the pre-U2 RNA is maintained during the processing reaction in vitro, as are the 2,2,7-trimethylguanosine caps. The ribonucleoprotein organization is of major importance, as exogenous, protein-free U2 RNA precursors are degraded rapidly in the in vitro system. Two lines of evidence indicate that the conversion of U2 precursors to mature-size U2 RNA involves a 3' processing reaction. First, the reaction is unaffected by a large excess of mature U2 small nuclear RNP, whose 5' trimethylguanosine caps would be expected to compete for a 5' processing activity. Second, when pre-U2 RNA precursors are first stoichiometrically decorated with an antibody specific for 2,2,7-trimethylguanosine, the extent of subsequent processing in vitro is unaffected. These results provide the first demonstration of a eukaryotic RNA processing reaction in vitro occurring within a ribonucleoprotein particle.
Energy Technology Data Exchange (ETDEWEB)
Johnson, Kyle D., E-mail: kylej@kth.se; Raftery, Alicia M.; Lopes, Denise Adorno; Wallenius, Janne
2016-08-15
In this study, U{sub 3}Si{sub 2} was synthesized via the use of arc-melting and mixed with UN powders, which together were sintered using the SPS method. The study revealed a number of interesting conclusions regarding the stability of the system – namely the formation of a probable but as yet unidentified ternary phase coupled with the reduction of the stoichiometry in the nitride phase – as well as some insights into the mechanics of the sintering process itself. By milling the silicide powders and reducing its particle size ratio compared to UN, it was possible to form a high density UN-U{sub 3}Si{sub 2} composite, with desirable microstructural characteristics for accident tolerant fuel applications. - Highlights: • U{sub 3}Si{sub 2} fabricated from elemental uranium and silicon through arc melting. • Homogeneity of the silicides assessed through densitometry, XRD, SEM and EDS, chemical etching and optical microscopy. • UN powder fabricated using hydriding-nitriding method. • No phase transformations detected when sintering using silicide particle sizes less than UN particle size. • High density composite (98%TD) fabricated with silicide grain coating using spark plasma sintering at 1450 °C.
International Nuclear Information System (INIS)
Evarestov, R A; Panin, A I; Bandura, A V; Losev, M V
2008-01-01
The results of LCAO DFT calculations of lattice parameters, cohesive energy and bulk modulus of the crystalline uranium nitrides UN, U 2 N 3 and UN 2 are presented and discussed. The LCAO computer codes Gaussian03 and Crystal06 are applied. The calculations are made with the uranium atom relativistic effective small core potential by Stuttgart-Cologne group (60 electrons in the core). The calculations include the U atom basis set optimization. Powell, Hooke-Jeeves, conjugated gradient and Box methods are implemented in the author's optimization package, being external to the codes for molecular and periodic calculations. The basis set optimization in LCAO calculations improves the agreement of the lattice parameter and bulk modulus of UN crystal with the experimental data, the change of the cohesive energy due to the optimization is small. The mixed metallic-covalent chemical bonding is found both in LCAO calculations of UN and U 2 N 3 crystals; UN 2 crystal has the semiconducting nature
Study of new U(VI) and Pu(VI) coprecipitation methods for the preparation of (U,Pu)O2
International Nuclear Information System (INIS)
Sanoit, J. de.
1990-01-01
Two U(VI) and Pu(VI) coprecipitation methods have been studied, for the definition of new processes to prepare (U,Pu)O 2 mixed oxides suitable for making MoX fuels or fast breeder reactor fuels. The first system is based on the coprecipitation of a new U(VI), Pu(VI) compound; ammonium uranoplutonate, where as a second system is related to the precipitation of uranyl plutonyl monocarbonate. Experimental conditions to optimize the precipitation and the filtration steps of these two systems have been determined. After calcination under reducing conditions, the mixed oxides obtained are characterized according to different techniques: granulometry, thermogravimetry, solubility in boiling HNO 3 solutions. The properties of such oxides are excellent. The possible processes for preparing (U, Pu)O 2 using these new routes are compared with those actually exploited [fr
Mechanism of disintegration of sup 2 sup 3 sup 8 U nuclei by relativistic projectiles
Andronenko, L N; Kravtsov, A V; Solyakin, G E
2002-01-01
The sup 2 sup 3 sup 8 U nuclei disintegration through the 16 GeV energy protons and sup 3 He 2 GeV energy nuclei are considered. The pulse mechanism compensation is proposed to explain the formation of collinear mass fragments accompanied by a large amount of charged secondaries and neutrons flying on the m sub 1 relativistic particle heavy nuclei on the account of the particle emission with the mass m sub 2 > m sub 1
International Nuclear Information System (INIS)
Joseph, D.; Jha, S.N.; Nayak, C.; Bhattacharyya, D.; Babu, P. Venu
2014-01-01
Uranium L 3 X-ray absorption edge was measured in various compounds containing uranium in U 4+ , U 5+ and U 5+ oxidation states. The measurements have been carried out at the Energy Dispersive EXAFS beamline (BL-08) at INDUS-2 synchrotron radiation source at RRCAT, Indore. Energy shifts of ∼ 2-3 eV were observed for U L 3 edge in the U-compounds compared to their value in elemental U. The different chemical shifts observed for the compounds having the same oxidation state of the cation but different anions or ligands show the effect of different chemical environments surrounding the cations in determining their X-ray absorption edges in the above compounds. The above chemical effect has been quantitatively described by determining the effective charges on U cation in the above compounds. (author)
Hydrogen absorption-desorption properties of U2Ti
International Nuclear Information System (INIS)
Yamamoto, Takuya; Tanaka, Satoru; Yamawaki, Michio
1990-01-01
Hydrogen absorption-desorption properties of U 2 Ti intermetallic compound was examined over the temperature range of 298 to 973 K and at hydrogen pressures below 10 5 Pa. It absorbs hydrogen up to 7.6 atoms per F.U. (formula unit) by two step reactions and hence each desorption isotherm is separated into two plateau regions. In the first plateau, a newly-found ternary hydride is formed, where the hydrogen concentration, c H , reaches 2.4 H atoms/F.U. In the second plateau, UH 3 is formed and c H reaches 7.6 H atoms/F.U. The specimen is disintegrated into fine powder in the second plateau, while in the first plateau the ternary hydride which was identified to be UTi 2 H x (x=4.8 to 6.2) showed high durability against powdering. It is predicted that UTi 2 can be suitable material for tritium storage. (orig.)
Obtaining of U-2.5Zr7.5Nb and U-3Zr-9Nb alloys by sintering process
International Nuclear Information System (INIS)
Mazzeu, Thiago de Oliveira; Paula, Joao Bosco de; Ferraz, Wilmar Barbosa; Santos, Ana Maria Matildes dos; Brina, Jose Giovanni Mascarenhas
2011-01-01
The development of metallic fuels with low enrichment to be used in research and test reactors, as well in the future pressurized water reactors, focuses on the search for uranium alloys of high density. Alloying elements such as Zr, Nb and Mo are added to uranium to improve fuel performance in reactors. In this context, the Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) in Belo Horizonte is developing the U-2.5Zr-7.5Nb and U- 3Zr-9Nb (weight %) alloys by the innovative process of sintering that utilizes raw materials in the form of powders. The powders were pressed at 400MPa and then sintered under a vacuum of about 5 x 10-6 Torr at temperatures ranging from 1050 deg to 1300 deg C. The densities of the alloys were measured geometrically and by hydrostatic method using water. The microstructures of the pellets were observed by scanning electron microscopy (SEM) and the elements of alloying were identified by energy dispersive X-ray spectroscopy (SEM/EDS) analysis. The obtained results showed a small increasing density with rising sintering temperature. The highest density achieved was approximately 80% of theoretical density. It was also qualitatively observed that the superficial oxidation of the pellets increased with increasing sintering temperature thus avoiding the fusion of the alloys at higher temperatures. (author)
Intake of 210Po, 234U and 238U radionuclides with beer in Poland
International Nuclear Information System (INIS)
Skwarzec, B.; Struminska, D.I.; Borylo, A.; Falandysz, J.
2004-01-01
238 U, 234 U and 210 Po activity concentrations were determined in beer in Poland by alpha-spectrometry with low-level activity silicon detectors. The results revealed that the mean concentrations of 238 U, 234 U and 210 Po in the analyzed beer samples were 4.63, 4.11 and 4.94 mBq x dm -3 , respectively, the highest in Tyskie (5.71 for 210 Po, 5.06 for 234 U and 6.11 for 238 U) and the lowest in Lech (2.49 for 210 Po). The effective radiation dose due to uranium and polonium ingestions by beer was calculated and were compared to the effective radiation dose from drinking water. (author)
International Nuclear Information System (INIS)
Saliba-Silva, A.M.; Souza, J.A.B.; Frajndlich, E.U.C.; Durazzo, M.; Perrotta, J.A.
1997-01-01
The own supply of LEU U 3 Si 2 is crucial for IPEN, since the whole scale-up of IPEN MTR IEA-Rlm reactor will rely on it. The Brazilian request for radioisotopes production is fully linked with the already made power scale-up from 2 to 5 MW for this reactor. IPEN now depends on fuel element material upgrading from U 3 O 8 towards LEU U 3 Si 2 . The fuel plate productive technology from the powdered material is already well established, only needing simple making of minor adjustments, but to reach the stage of producing U 3 Si 2 we need a fully settled chemical pilot plant in order to reach a LEU UF 4 productive routine. Complementing this process, it was also needed to scale down the previous practice of uranium magnesiothermic reduction to around a sub-critical safe uranium mass of approximately 3000g. To complete the metallurgical processing, it is being developed the production of U 3 Si 2 in a vacuum induction furnace. Some experiments to get this intermetallic, using natural uranium, have already been carried out in order to build up a general idea of the future process of LEU U 3 Si 2 . These experiments are described in this paper and also some of the initial characterization results, such as the qualification pattern of the ingot. It is also discussed some new features of inhomogeneity of solidified phases that may be deleterious to future production routine. (author)
Isothermal section of diagram of U-Mo-B and U-Re-B systems
International Nuclear Information System (INIS)
Val'ovka, I.P.; Kuz'ma, Yu.B.
1986-01-01
The methods of X-ray analysis are used to study the U-Mo-B and U-Re-B systems and to plot phase equilibrium diagrams at 1000 and 800 deg C, respectively. A formation of boride UMoB 4 (structure of the ThMoB 4 type) is confirmed in the U-Mo-B system and new compounds are found: U 2 MoB 6 (rhombic structure of the Y 2 ReB 6 type, a=0.9301(9), b=1.1434(11), c=0.3678(4) nm), ∼UMo 2 B 6 and ∼ UMo 4 B 4 with unknown structures. In the U-Re-B system besides previously known boride UReB 4 (the ThMoB 4 structure type), new ones are obtained: U 2 ReB 6 (Y 2 ReB 6 type, a=0.9373(9), b=1.1529(13), c0.3653(4) nm) and UReB 3 (hexagonal structure of the proper type, a=0.5083(1), c=0.5095(1) nm)
The Effect of Early Diagenesis on the 238U/235U Ratio of Platform Carbonates.
Tissot, F.; Chen, C.; Go, B. M.; Naziemiec, M.; Healy, G.; Swart, P. K.; Dauphas, N.
2017-12-01
In the past 15 years, the so-called non-traditional stable isotopes systems (e.g., Mg, Fe, Mo, U) have emerged as powerful tracers of both high-T and low-T geochemical processes (e.g., [1]). Of particular interest for paleoredox studies is the ratio of "stable" isotopes of U (238U/235U), which has the potential to track the global extent of oceanic anoxia (e.g., [2, 3]). Indeed, in the modern ocean, U exists in two main oxidation states, soluble U6+ and insoluble U4+, and has a mean residence time of 400 kyr ([4]), much longer than the global ocean mixing time (1-2 kyr). As such the salinity-normalized ocean is homogeneous with regards to both U concentrations and isotopes (δ238USW = -0.392±0.005 ‰, [2]). The value of δ238USW at any given time is therefore the balance between U input to the ocean, mainly from rivers, and U removal, mostly into biogenic carbonates, anoxic/euxinic sediments and suboxic/hypoxic sediments (e.g., [2, 5]). Because the 238U/235U ratio of the past ocean cannot be measured directly, it has to be estimated from the measurement of the 238U/235U ratio of a sedimentary rock and assuming a constant fractionation factor. Carbonates appear as a promising record since they span most of Earth's history, and the δ238U values of modern primary carbonate precipitates and well-preserved fossil aragonitic coral up to 600 ka are indistinguishable from that of seawater (e.g., [2, 6, 7]). Yet, the effect of secondary processes on the δ238U values of non-coral carbonates, which represent the bulk of the rock record, has only been studied in a handful of shallow samples (down to 40cm, [6]) and remains poorly understood. To investigate the effect of early diagenesis on the 238U/235U ratio of carbonates on the 30kyr to 1Myr timescale, we measured δ13C, δ18O, and δ238U in samples from a 220m long drill core from the Bahamas carbonate platform. In order to separate lattice bound U from secondary U we developed a leaching protocol applicable to carbonate
Choi, Hyun-Woo; Kim, Hye-Ran; Baek, Hee-Jo; Kook, Hoon; Cho, Duck; Shin, Jong-Hee; Suh, Soon-Pal; Ryang, Dong-Wook; Shin, Myung-Geun
2015-01-01
Recurrent somatic SET-binding protein 1 (SETBP1) and splicing pathway gene mutations have recently been found in atypical chronic myeloid leukemia and other hematologic malignancies. These mutations have been comprehensively analyzed in adult AML, but not in childhood AML. We investigated possible alteration of the SETBP1, splicing factor 3B subunit 1 (SF3B1), U2 small nuclear RNA auxiliary factor 1 (U2AF1), and serine/arginine-rich splicing factor 2 (SRSF2) genes in childhood AML. Cytogenetic and molecular analyses were performed to reveal chromosomal and genetic alterations. Sequence alterations in the SETBP1, SF3B1, U2AF1, and SRSF2 genes were examined by using direct sequencing in a cohort of 53 childhood AML patients. Childhood AML patients did not harbor any recurrent SETBP1 gene mutations, although our study did identify a synonymous mutation in one patient. None of the previously reported aberrations in the mutational hotspot of SF3B1, U2AF1, and SRSF2 were identified in any of the 53 patients. Alterations of the SETBP1 gene or SF3B1, U2AF1, and SRSF2 genes are not common genetic events in childhood AML, implying that the mutations are unlikely to exert a driver effect in myeloid leukemogenesis during childhood.
International Nuclear Information System (INIS)
Guerrero, José Luis; Vallejos, Ángela; Cerón, Juan Carlos; Sánchez-Martos, Francisco; Pulido-Bosch, Antonio; Bolívar, Juan Pedro
2016-01-01
Sierra de Gádor is a karst macrosystem with a highly complex geometry, located in southeastern Spain. In this arid environment, the main economic activities, agriculture and tourism, are supported by water resources from the Sierra de Gádor aquifer system. The aim of this work was to study the levels and behaviour of some of the most significant natural radionuclides in order to improve the knowledge of the hydrogeochemical processes involved in this groundwater system. For this study, 28 groundwater and 7 surface water samples were collected, and the activity concentrations of the natural U-isotopes ("2"3"8U, "2"3"5U and "2"3"4U) and "2"2"6Ra by alpha spectrometry were determined. The activity concentration of "2"3"8U presented a large variation from around 1.1 to 65 mBq L"−"1. Elevated groundwater U concentrations were the result of oxidising conditions that likely promoted U dissolution. The PHREEQC modelling code showed that dissolved U mainly existed as uranyl carbonate complexes. The "2"3"4U/"2"3"8U activity ratios were higher than unity for all samples (1.1–3.8). Additionally, these ratios were in greater disequilibrium in groundwater than surface water samples, the likely result of greater water-rock contact time. "2"2"6Ra presented a wide range of activity concentrations, (0.8 up to about 4 × 10"2 mBq L"−"1); greatest concentrations were detected in the thermal area of Alhama. Most of the samples showed "2"2"6Ra/"2"3"4U activity ratios lower than unity (median = 0.3), likely the result of the greater mobility of U than Ra in the aquifer system. The natural U-isotopes concentrations were strongly correlated with dissolution of sulphate evaporites (mainly gypsum). "2"2"6Ra had a more complex behaviour, showing a strong correlation with water salinity, which was particularly evident in locations where thermal anomalies were detected. The most saline samples showed the lowest "2"3"4U/"2"3"8U activity ratios, probably due to fast uniform bulk
Deep Keck u-Band Imaging of the Hubble Ultra Deep Field: A Catalog of z ~ 3 Lyman Break Galaxies
Rafelski, Marc; Wolfe, Arthur M.; Cooke, Jeff; Chen, Hsiao-Wen; Armandroff, Taft E.; Wirth, Gregory D.
2009-10-01
We present a sample of 407 z ~ 3 Lyman break galaxies (LBGs) to a limiting isophotal u-band magnitude of 27.6 mag in the Hubble Ultra Deep Field. The LBGs are selected using a combination of photometric redshifts and the u-band drop-out technique enabled by the introduction of an extremely deep u-band image obtained with the Keck I telescope and the blue channel of the Low Resolution Imaging Spectrometer. The Keck u-band image, totaling 9 hr of integration time, has a 1σ depth of 30.7 mag arcsec-2, making it one of the most sensitive u-band images ever obtained. The u-band image also substantially improves the accuracy of photometric redshift measurements of ~50% of the z ~ 3 LBGs, significantly reducing the traditional degeneracy of colors between z ~ 3 and z ~ 0.2 galaxies. This sample provides the most sensitive, high-resolution multi-filter imaging of reliably identified z ~ 3 LBGs for morphological studies of galaxy formation and evolution and the star formation efficiency of gas at high redshift.
Isotope shift of 234U, 236U, 238U in U I
International Nuclear Information System (INIS)
Gagne, J.M.; Nguyen Van, S.; Saint-Dizier, J.P.; Pianarosa, P.
1976-01-01
New and very accurate data of isotope shifts and relative isotope shifts in 234 U, 236 U, 238 U are presented. The invariance of the relative isotope shift, for the transitions we have investigated, supports the hypothesis that the so called specific mass effect is negligible in uranium
Anti-U-like as an alloantibody in S-s-U- and S-s-U+(var) black people.
Peyrard, Thierry; Lam, Yin; Saison, Carole; Arnaud, Lionel; Babinet, Jérôme; Rouger, Philippe; Bierling, Philippe; Janvier, Daniel
2012-03-01
S, s, and U antigens belong to the MNS system. They are carried by glycophorin B (GPB), encoded by GYPB. Black people with the low-prevalence S-s- phenotype, either U- or U+(var), can make a clinically significant anti-U. Anti-U-like, a cold immunoglobulin G autoantibody quite commonly observed in S-s+U+ black persons, was previously described to be nonreactive with ficin-, α-chymotrypsin-, and pronase-treated red blood cells (RBCs); nonreactive or weakly reactive with papain-treated RBCs; and reactive with trypsin-treated RBCs. Here we describe, in S-s- people from different molecular backgrounds, an alloantibody to a high-prevalence GPB antigen, which presents the same pattern of reactivity with proteases as autoanti-U-like. Four S-s- patients with an alloantibody to a high-prevalence GPB antigen were investigated by serologic and molecular methods. An alloantibody was observed in two S-s-U-/Del GYPB, one S-s-U+(var)/GYPB(P2), and one S-s-U+(var)/GYPB(NY) patients. As this alloantibody showed the same pattern of reactivity with proteases as autoanti-U-like, we decided to name it "anti-U-like." Anti-U-like made by the two S-s-U- patients was reactive with the S-s-U+(var) RBCs of the two other patients. S-s-U-/Del GYPB, S-s-U+(var)/GYPB(P2), and S-s-U+(var)/GYPB(NY) patients can make an alloanti-U-like. Anti-U-like made by S-s-U- people appears reactive with GYPB(P2) and GYPB(NY) RBCs, which both express a weak and partial U-like reactivity. We recommend transfusing S-s-U- RBCs in S-s-U- patients showing alloanti-U-like. Our study contributes to a better understanding of alloimmunization to GPB in black people and confirms importance of genotyping in S-s- patients, especially those with sickle cell disease to be frequently transfused. © 2011 American Association of Blood Banks.
Irradiation tests of U3Si2-Al fuels up to very high fission densities
International Nuclear Information System (INIS)
Nuding, M.; Boening, K.
2001-01-01
The new research reactor of the Munich Technical University (TUM), the FRM-II, will have U 3 Si 2 -Al as the fuel. This fuel is considered qualified and optimally usable in the light of findings obtained in the RERTR program (Reduced Enrichment for Research and Test Reactors). The RERTR program was conducted to develop new fuel for the use of low enriched uranium (LEU) in research reactors. As the unique properties of the FRM-II in research and application are based also on achieving a very compact reactor core with highly enriched uranium (HEU), additional irradiation tests were performed on the basis of the RERTR program. They were run in close cooperation with the French Commissariat a l'Energie Atomique (CEA) in its SILOE and OSIRIS facilities, among others. After extensive evaluation, also of other studies, these tests confirm the RERTR findings about fuel swelling behavior and, consequently, the suitability of U 3 Si 2 -Al (HEU) for use in the compact core of the FRM-II. (orig.) [de
Yang, Masaki J. S.
2017-03-01
In this paper, we attempt to build a unified model with the democratic texture, that has some unification between up-type Yukawa interactions Yν and Yu . Since the S3 L×S3 R flavor symmetry is chiral, the unified gauge group is assumed to be Pati-Salam type S U (4 )c×S U (2 )L×S U (2 )R. The breaking scheme of the flavor symmetry is considered to be S3 L×S3 R→S2 L×S2 R→0 . In this picture, the four-zero texture is desirable for realistic masses and mixings. This texture is realized by a specific representation for the second breaking of the S3 L×S3 R flavor symmetry. Assuming only renormalizable Yukawa interactions, type-I seesaw mechanism, and neglecting C P phases for simplicity, the right-handed neutrino mass matrix MR can be reconstructed from low energy input values. Numerical analysis shows that the texture of MR basically behaves like the "waterfall texture." Since MR tends to be the "cascade texture" in the democratic texture approach, a model with type-I seesaw and up-type Yukawa unification Yν≃Yu basically requires fine-tunings between parameters. Therefore, it seems to be more realistic to consider universal waterfall textures for both Yf and MR, e.g., by the radiative mass generation or the Froggatt-Nielsen mechanism. Moreover, analysis of eigenvalues shows that the lightest mass eigenvalue MR 1 is too light to achieve successful thermal leptogenesis. Although the resonant leptogenesis might be possible, it also requires fine-tunings of parameters.
Optical spectroscopy and crystal-field analysis of U{sup 3+}: Ba{sub 2}YCl{sub 7}
Energy Technology Data Exchange (ETDEWEB)
Karbowiak, M.; Mech, A.; Drozdzyndki, J. [Wroclaw Univ., Faculty of Chemistry (Poland); Gajek, Z. [Polish Academy of Sciences, W. Trzebiatowski Institute of Low Temperature and Structure Research, Wroclaw (Poland); Edelstein, N.M. [Lawrence Berkeley National Lab., Chemical Sciences Div., CA (United States)
2002-11-01
High resolution absorption spectra of a U{sup 3+}(0.3%): Ba{sub 2}YCl{sub 7} single crystal were recorded in the 4000-50 000 cm{sup -1} range at 7 K. The observed crystal-field levels were assigned and fit to the parameters of the simplified angular overlap model (AOM) as well as a semi-empirical Hamiltonian representing the combined atomic and one-electron crystal-field interactions. The starting values of the AOM parameters were obtained from ab initio calculations. The analysis of the spectra allowed the assignment of 65 crystal-field levels with a relatively small rms deviation of 25 cm{sup -1} and has shown that the AOM approach can predict quite well the B{sub q}{sup k} crystal-field parameters. The value determined for the crystal-field strength parameter, N{sub v}, corresponds well with those determined for U{sup 3+} in other chloride single crystals. (authors)
uPA/uPAR system activation drives a glycolytic phenotype in melanoma cells.
Laurenzana, Anna; Chillà, Anastasia; Luciani, Cristina; Peppicelli, Silvia; Biagioni, Alessio; Bianchini, Francesca; Tenedini, Elena; Torre, Eugenio; Mocali, Alessandra; Calorini, Lido; Margheri, Francesca; Fibbi, Gabriella; Del Rosso, Mario
2017-09-15
In this manuscript, we show the involvement of the uPA/uPAR system in the regulation of aerobic glycolysis of melanoma cells. uPAR over-expression in human melanoma cells controls an invasive and glycolytic phenotype in normoxic conditions. uPAR down-regulation by siRNA or its uncoupling from integrins, and hence from integrin-linked tyrosine kinase receptors (IL-TKRs), by an antagonist peptide induced a striking inhibition of the PI3K/AKT/mTOR/HIF1α pathway, resulting into impairment of glucose uptake, decrease of several glycolytic enzymes and of PKM2, a checkpoint that controls metabolism of cancer cells. Further, binding of uPA to uPAR regulates expression of molecules that govern cell invasion, including extracellular matrix metallo-proteinases inducer (EMPPRIN) and enolase, a glycolytyc enzyme that also serves as a plasminogen receptor, thus providing a common denominator between tumor metabolism and phenotypic invasive features. Such effects depend on the α5β1-integrin-mediated uPAR connection with EGFR in melanoma cells with engagement of the PI3K-mTOR-HIFα pathway. HIF-1α trans-activates genes whose products mediate tumor invasion and glycolysis, thus providing the common denominator between melanoma metabolism and its invasive features. These findings unveil a unrecognized interaction between the invasion-related uPAR and IL-TKRs in the control of glycolysis and disclose a new pharmacological target (i.e., uPAR/IL-TKRs axis) for the therapy of melanoma. © 2017 UICC.
Crystal-field analysis of U3+ ions in K2LaX5 (X=Cl, Br or I) single crystals
Karbowiak, M.; Edelstein, N.; Gajek, Z.; Drożdżyński, J.
1998-11-01
An analysis of low temperature absorption spectra of U3+ ions doped in K2LaX5 (X=Cl, Br or I) single crystals is reported. The energy levels of the U3+ ion in the single crystals were assigned and fitted to a semiempirical Hamiltonian representing the combined atomic and crystal-field interactions at the Cs symmetry site. An analysis of the nephelauxetic effect and crystal-field splittings in the series of compounds is also reported.
Site Characterization Data from the U3ax/bl Exploratory Boreholes at the Nevada Test Site
International Nuclear Information System (INIS)
2005-01-01
This report provides qualitative analyses and preliminary interpretations of hydrogeologic data obtained from two 45-degree, slanted exploratory boreholes drilled within the Area 3 Radioactive Waste Management Site (RWMS) at the Nevada Test Site. Borehole UE-3bl-D1 was drilled beneath the U3ax/bl mixed waste disposal unit, and Borehole UE-3bl-U1 was drilled in undisturbed alluvium adjacent to the disposal unit. The U3ax/bl disposal unit is located within two conjoined subsidence craters, U3ax and U3bl, which were created by underground nuclear testing. Data from these boreholes were collected to support site characterization activities for the U3ax/bl disposal unit and the entire Area 3 RWMS. Site characterization at disposal units within the Area 3 RWMS must address the possibility that subsidence craters and associated disturbed alluvium of the chimneys beneath the craters might serve as pathways for contaminant migration. The two boreholes were drilled and sampled to compare hydrogeologic properties of alluvium below the waste disposal unit with those of adjacent undisturbed alluvium. Whether Borehole UE-3bl-D1 actually penetrated the chimney of the U3bl crater is uncertain. Analyses of core samples showed little difference in hydrogeologic properties between the two boreholes. Important findings of this study include the following: No hazardous or radioactive constituents of waste disposal concern were found in the samples obtained from either borehole. No significant differences in physical and hydrogeologic properties between boreholes is evident, and no evidence of significant trends with depth for any of these properties was observed. The values observed are typical of sandy materials. The alluvium is dry, with volumetric water content ranging from 5.6 to 16.2 percent. Both boreholes exhibit a slight increase in water content with depth, the only such trend observed. Water potential measurements on core samples from both boreholes show a large positive
Site Characterization Data from the U3ax/bl Exploratory Boreholes at the Nevada Test Site
Energy Technology Data Exchange (ETDEWEB)
Bechtel Nevada; U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office
2005-08-01
This report provides qualitative analyses and preliminary interpretations of hydrogeologic data obtained from two 45-degree, slanted exploratory boreholes drilled within the Area 3 Radioactive Waste Management Site (RWMS) at the Nevada Test Site. Borehole UE-3bl-D1 was drilled beneath the U3ax/bl mixed waste disposal unit, and Borehole UE-3bl-U1 was drilled in undisturbed alluvium adjacent to the disposal unit. The U3ax/bl disposal unit is located within two conjoined subsidence craters, U3ax and U3bl, which were created by underground nuclear testing. Data from these boreholes were collected to support site characterization activities for the U3ax/bl disposal unit and the entire Area 3 RWMS. Site characterization at disposal units within the Area 3 RWMS must address the possibility that subsidence craters and associated disturbed alluvium of the chimneys beneath the craters might serve as pathways for contaminant migration. The two boreholes were drilled and sampled to compare hydrogeologic properties of alluvium below the waste disposal unit with those of adjacent undisturbed alluvium. Whether Borehole UE-3bl-D1 actually penetrated the chimney of the U3bl crater is uncertain. Analyses of core samples showed little difference in hydrogeologic properties between the two boreholes. Important findings of this study include the following: No hazardous or radioactive constituents of waste disposal concern were found in the samples obtained from either borehole. No significant differences in physical and hydrogeologic properties between boreholes is evident, and no evidence of significant trends with depth for any of these properties was observed. The values observed are typical of sandy materials. The alluvium is dry, with volumetric water content ranging from 5.6 to 16.2 percent. Both boreholes exhibit a slight increase in water content with depth, the only such trend observed. Water potential measurements on core samples from both boreholes show a large positive
Prelaunch Performance of the 118 GHz Polarcube 3U Cubesat Temperature Sounding Radiometer
Periasamy, L.; Gasiewski, A. J.; Gallaher, D. W.; Sanders, B. T.; Belter, R.; Kraft, D.; Castillo, J.; Gordon, J. A.; Hurowitz, M.
2017-12-01
The low cost PolarCube 3U CubeSat supports a 118.75 GHz imaging spectrometer for temperature profiling of the troposphere and surface temperature. It is a demonstrator for a constellation of LEO passive microwave sensors at V-band and other frequencies using 3U/6U CubeSats. Such a satellite constellation for weather forecasting will provide data at high spatial and temporal resolution to observe rapidly evolving mesoscale weather. The satellite's payload is an eight channel, double sideband passive microwave temperature sounder with cross-track scanning and will provide 18 km surface resolution from a 400 km orbit. The radiometer implements a two-point calibration using an internal PIN switch and view of cold space. Although the instrument is based on a well established classical design, the challenges lie in developing a sensitive spectrometer that fits in a 1.5U volume, is low cost, consumes 4 W power and satisfies the CubeSat weight and envelope constraints. PolarCube is scheduled for launch on a Virgin Galactic flight in summer, 2018. The estimated radiometer sensitivity, ΔTrms varies from 0.3 to 2 K across the eight channels. The 50 MHz to 7 GHz 8-channel filter bank (designed with surface mount capacitors and inductors) fits on a 9x5 cm2 RO4350B PCB and includes 2-stage amplification and detector circuitry. The scanning reflector with an 8 cm2 main aperture uses a 3D printed corrugated feed that includes a WR8 to WC8 waveguide transition with a 17° bend. Initial performance results from the instrument using the 3D printed feed and IF/VA board obtained from airborne measurements over Antarctica on the NASA DC8 in early November 2016 indicate a well-functioning radiometer. The end-to-end characterization of the payload with the satellite bus, performance results from vibration and thermal-vacuum tests and roof-top measurements will be presented.
Hydrolysis of U(VI) and sodium uranates
International Nuclear Information System (INIS)
Pongi, N.-K.; Double, Gerard; Hurwic, Jozef
1980-01-01
The potentiometric titration curves of UO 2 (NO 3 ) 2 aqueous solutions by NaOH have been interpreted. The results we have got verify and complete those published before. From isohydric species (UO 2 ) 3 (OH) 7 - , with pH = 7,8 and the experimental molar value of the relation xsub(i) = Na/U = 2.33, the following ionic and molecular species in acid medium have been deduced: (UO 2 ) 2 (OH) 2 2+ , (UO 2 ) 3 (OH) 2 2+ , (UO 2 ) 3 (OH) 5 + and (UO 2 ) 3 (OH) 6 . The composition of the precipitates corresponding to the particular points of the potentiometric titration curves, by chemical, thermal decomposition analysis and by X-rays diffraction, have been carried out: (UO 2 ) 6 (OH) 12 .6H 2 O, Na 2 U 8 O 25 , Na 2 U 6 O 19 , Na 2 U 4 O 13 and Na 2 U 2 O 7 for xsub(i) = 1,67 and 2.00, 2.23, 2.33, 2.52, 3.00 and over, respectively. The uranyl hydroxide was obtained for first time from an aqueous solution [fr
Timm, Kerstin N; Hartl, Johannes; Keller, Markus A; Hu, De-En; Kettunen, Mikko I; Rodrigues, Tiago B; Ralser, Markus; Brindle, Kevin M
2015-12-01
A resonance at ∼181 ppm in the (13) C spectra of tumors injected with hyperpolarized [U-(2) H, U-(13) C]glucose was assigned to 6-phosphogluconate (6PG), as in previous studies in yeast, whereas in breast cancer cells in vitro this resonance was assigned to 3-phosphoglycerate (3PG). These peak assignments were investigated here using measurements of 6PG and 3PG (13) C-labeling using liquid chromatography tandem mass spectrometry (LC-MS/MS) METHODS: Tumor-bearing mice were injected with (13) C6 glucose and the (13) C-labeled and total 6PG and 3PG concentrations measured. (13) C MR spectra of glucose-6-phosphate dehydrogenase deficient (zwf1Δ) and wild-type yeast were acquired following addition of hyperpolarized [U-(2) H, U-(13) C]glucose and again (13) C-labeled and total 6PG and 3PG were measured by LC-MS/MS RESULTS: Tumor (13) C-6PG was more abundant than (13) C-2PG/3PG and the resonance at ∼181 ppm matched more closely that of 6PG. (13) C MR spectra of wild-type and zwf1Δ yeast cells showed a resonance at ∼181 ppm after labeling with hyperpolarized [U-(2) H, U-(13) C]glucose, however, there was no 6PG in zwf1Δ cells. In the wild-type cells 3PG was approximately four-fold more abundant than 6PG CONCLUSION: The resonance at ∼181 ppm in (13) C MR spectra following injection of hyperpolarized [U-(2) H, U-(13) C]glucose originates predominantly from 6PG in EL4 tumors and 3PG in yeast cells. © 2014 Wiley Periodicals, Inc.
238U, 234U and 230Th in uranium miners' lungs
International Nuclear Information System (INIS)
Singh, N.P.; Wrenn, M.E.; Bennett, D.B.; Archer, V.; Saccomanno, G.
1982-01-01
Fourteen uranium miners' lungs from the Colorado Plateau were collected at autopsy and the concentrations of 238 U, 234 U and 230 Th were determined by radiochemical procedures utilizing solvent extraction and alpha spectrometric techniques. The uranium and thorium isotopes are in near equilibrium with average concentrations of 238 U, 234 U and 230 Th being 89.3, 95.2, and 91.1 pCi/kg respectively. The combined average radiation dose rate to lung from these three isotopes is about 24.1 mrad/year at death excluding the unmeasured contribution from the 226 Ra and daughters. The average concentration of 230 Th is about 65 times higher than the mean concentration of 230 Th in lungs of non-miners from the same region dying at comparable ages
Electrochemical reduction behavior of U3O8 powder in a LiCl molten salt
International Nuclear Information System (INIS)
Jeong, Sang Mun; Shin, Ho-Sup; Hong, Sun-Seok; Hur, Jin-Mok; Do, Jae Bum; Lee, Han Soo
2010-01-01
The reduction path of the U 3 O 8 powder vol-oxidized at 1200 deg. C has been determined by a series of electrochemical experiments in a 1 wt.% Li 2 O/LiCl molten salt. Various reaction intermediates are observed by during electrolysis of U 3 O 8 . The formation of the metallic uranium is caused from two different reduction paths, a direct reduction of uranium oxide and an electro-lithiothermic reduction. As the uranium oxide is converted to the metallic uranium, the lithium metal is more actively formed in the cathode basket. The reducibility of the rare earth oxides with the U 3 O 8 powder has been tested by constant voltage electrolysis. The results suggest the advanced vol-oxidation could lead to the enhancement in the reducibility of the rare earth fission products.
International Nuclear Information System (INIS)
Kim, Ki Hwan; Park, Jong Man; Yoo, Byeong Ok; Park, Dae Kyu; Lee, Choong Sung; Kim, Chang Kyu
2002-01-01
The irradiation test on full-size U 3 Si dispersion fuel elements, prepared by centrifugal atomization and conventional comminution method, has been performed up to about 77 at.% U-235 in maximum burn-up at CT hole position having the highest power condition in the HANARO reactor, in order to examine the irradiation performance of the atomized U 3 Si for the driver fuels of HANARO. The in-reactor interaction of the atomized U 3 Si dispersion fuel meats is generally assumed to be acceptable with the range of 5-15 μm in average thickness. The atomized spherical particles have more uniform and thinner reaction layer than the comminuted irregular particles. The U 3 Si particles have relatively fine and uniform size distribution of fission gas bubbles, irrespective of the powdering method. The bubble population in the atomized particles appears to be finer and more homogeneous with the characteristics of narrower bubble size distribution than that of the comminuted fuel. The atomized U 3 Si dispersion fuel elements exhibit sound swelling behaviours of 5 % in ΔV/V m even at ∼77 at.% U-235 burn-up, which meets with the safety criterion of the fuel rod, 20vol.% for HANARO. The atomized U3Si dispersion fuel elements show smaller swelling than the comminuted fuel elements
Preparation of U3O8 powder for MTR type fuel from ammonium uranyl carbonate
International Nuclear Information System (INIS)
Marcondes, G.H.; Riella, H.G.
1990-08-01
In this paper it is described the research done at IPEN-CNEN/SP on the preparation of U 3 O 8 powder from calcination of the AUC, with appropriate characteristics to be used as dispersoid for MTR type fuel. The calcination in air of the AUC leads a U 3 O 8 powder that is further processed to obtain a powder with density and particle size as especifications. The important process parameters are here discussed with the variation AUC calcination temperature and sintering time of the U 3 O 8 powder. (author) [pt
Measurement of the 235U/238U fission cross section ratio in the 235U fission neutron spectrum
International Nuclear Information System (INIS)
Azimi-Garakani, D.; Bagheri-Darbandi, M.
1983-06-01
Fission cross section ratio of 235 U to 238 U has been measured in the fast neutron field generated by the 235 U fission plate installed on the thermal column of the Tehran Research Reactor (TRR) with a Makrofol solid state nuclear track detector. The experiments were carried out with a set of total six enriched 235 U and depleted 238 U deposits with different masses and Makrofol films of 0.025mm and 0.060mm thicknesses. The chemically etched tracks were counted by an optical microscope. No significant differences were observed with the thin and the thick films. The results showed that the average fission cross section ratio is 3.83+-0.25. (author)
High-Uranium-Loaded U3O8-Al fuel element development program. Part 1
International Nuclear Information System (INIS)
Martin, M.M.
1993-01-01
The High-Uranium-Loaded U 3 O 8 -Al Fuel Element Development Program supports Argonne National Laboratory efforts to develop high-uranium-density research and test reactor fuel to accommodate use of low-uranium enrichment. The goal is to fuel most research and test reactors with uranium of less than 20% enrichment for the purpose of lowering the potential for diversion of highly-enriched material for nonpeaceful usages. The specific objective of the program is to develop the technological and engineering data base for U 3 O 8 -Al plate-type fuel elements of maximal uranium content to the point of vendor qualification for full scale fabrication on a production basis. A program and management plan that details the organization, supporting objectives, schedule, and budget is in place and preparation for fuel and irradiation studies is under way. The current programming envisions a program of about four years duration for an estimated cost of about two million dollars. During the decades of the fifties and sixties, developments at Oak Ridge National Laboratory led to the use of U 3 O 8 -Al plate-type fuel elements in the High Flux Isotope Reactor, Oak Ridge Research Reactor, Puerto Rico Nuclear Center Reactor, and the High Flux Beam Reactor. Most of the developmental information however applies only up to a uranium concentration of about 55 wt % (about 35 vol % U 3 O 8 ). The technical issues that must be addressed to further increase the uranium loading beyond 55 wt % U involve plate fabrication phenomena of voids and dogboning, fuel behavior under long irradiation, and potential for the thermite reaction between U 3 O 8 and aluminum
Ceramic grade (U,Pu)O2 powder fabrication
International Nuclear Information System (INIS)
Cristallini, O.A.; Villegas de Maroto, Marina; De Pino, J.I.; Osuna, H.A.
1980-01-01
Ceramic grade UO 2 powder was obtained by the homogeneous precipitation method. This procedure was afterwards applied to the fabrication of ceramic grade (U,Pu)O 2 powders, and mixed oxide powders with Pu content ranging from 0.7 to 16% were obtained. The obtainment of mixed ceramic oxides as well as the recuperation of fabrication scraps were developed in three steps: 1)study of the process of homogeneous precipitation of ammonium diuranate (ADU); 2) co-precipitation of ADU/PuO 2 .H 2 O for Pu concentrations of 0.6 and 6.8; 3) the thermal conditioning to mixed oxide (U,Pu)O 2 powders. The experimental procedure involves the following steps: preparation of the PuO 2 (NO 3 ) 4 solution; co-precipitation of the PuO 2 (NO 3 ) 2 solution with an UO 2 (NO 3 ) 2 solution; filtration and drying of the precipitate, thermal treatment and finally, mixing, pressing and sintering of the (U,Pu)O 2 and Nukem UO 2 powder with a 0. of zinc stearate. Different controls were made by means of physical, chemical and ceramographic tests. This method can be used for the fabrication of fast reactor fuels or, previous mechanical dispersion in UO 2 powder, for the fabrication of thermal reactors fuels. (M.E.L.) [es
A kinetic analysis of kappa-opioid agonist binding using the selective radioligand (/sup 3/H)U69593
Energy Technology Data Exchange (ETDEWEB)
Smith, J.A.; Hunter, J.C.; Hill, R.G.; Hughes, J.
1989-07-01
The interaction of the nonselective opioid ligand (3H)bremazocine and of the kappa-opioid (3H)U69593 with the kappa-receptor was investigated in guinea-pig cortical membranes. Each radioligand bound to a single population of high-affinity sites, although (3H)U69593 apparently recognised only 70% of those sites labelled by (3H)bremazocine. Naloxone and the kappa-selective ligands U69593 and PD117302 exhibited full inhibition of the binding of both radioligands. Kinetic analysis demonstrated biphasic rates of association and dissociation for both (3H)bremazocine and (3H)U69593. Detailed analysis of the binding of (3H)U69593 revealed that the fast rate of association was dependent on radioligand concentration, in contrast to the slow rate, which was independent of ligand concentration. Guanylyl-5'-imidodiphosphate (GppNHp) inhibited binding of (3H)U69593; saturation analysis demonstrated that the inhibitory effects of GppNHp resulted in a decrease in affinity without any significant change in binding capacity. GppNHp attenuated the formation of the slow component of (3H)U69593 binding, while accelerating the fast component. The data are consistent with the formation of a high-affinity complex between the kappa-receptor and a guanine nucleotide binding protein. Guanine nucleotides promote the dissociation of this ternary complex and the stabilisation of a lower-affinity state of the receptor.
U2AF1 mutations alter splice site recognition in hematological malignancies.
Ilagan, Janine O; Ramakrishnan, Aravind; Hayes, Brian; Murphy, Michele E; Zebari, Ahmad S; Bradley, Philip; Bradley, Robert K
2015-01-01
Whole-exome sequencing studies have identified common mutations affecting genes encoding components of the RNA splicing machinery in hematological malignancies. Here, we sought to determine how mutations affecting the 3' splice site recognition factor U2AF1 alter its normal role in RNA splicing. We find that U2AF1 mutations influence the similarity of splicing programs in leukemias, but do not give rise to widespread splicing failure. U2AF1 mutations cause differential splicing of hundreds of genes, affecting biological pathways such as DNA methylation (DNMT3B), X chromosome inactivation (H2AFY), the DNA damage response (ATR, FANCA), and apoptosis (CASP8). We show that U2AF1 mutations alter the preferred 3' splice site motif in patients, in cell culture, and in vitro. Mutations affecting the first and second zinc fingers give rise to different alterations in splice site preference and largely distinct downstream splicing programs. These allele-specific effects are consistent with a computationally predicted model of U2AF1 in complex with RNA. Our findings suggest that U2AF1 mutations contribute to pathogenesis by causing quantitative changes in splicing that affect diverse cellular pathways, and give insight into the normal function of U2AF1's zinc finger domains. © 2015 Ilagan et al.; Published by Cold Spring Harbor Laboratory Press.
A SU(3) x U(1) model for electroweak interactions
International Nuclear Information System (INIS)
Pisano, F.; Pleitez, V.
1992-01-01
We consider a gauge model based on a SU(3) vector U(1) symmetry in which the lepton number is violated explicitly by charged scalar and gauge boson, including a vector field with double electric charge. (author)
Irges, Nikos; Zoupanos, George
2011-01-01
We present an extension of the Standard Model inspired by the E_8 x E_8 Heterotic String. In order that a reasonable effective Lagrangian is presented we neglect everything else other than the ten-dimensional N=1 supersymmetric Yang-Mills sector associated with one of the gauge factors and certain couplings necessary for anomaly cancellation. We consider a compactified space-time M_4 x B_0 / Z_3, where B_0 is the nearly-Kaehler manifold SU(3)/U(1) x U(1) and Z_3 is a freely acting discrete group on B_0. Then we reduce dimensionally the E_8 on this manifold and we employ the Wilson flux mechanism leading in four dimensions to an SU(3)^3 gauge theory with the spectrum of a N=1 supersymmetric theory. We compute the effective four-dimensional Lagrangian and demonstrate that an extension of the Standard Model is obtained with interesting features including a conserved baryon number and fixed tree level Yukawa couplings and scalar potential. The spectrum contains new states such as right handed neutrinos and heavy ...
Energy Technology Data Exchange (ETDEWEB)
Yang, Hee-Chul, E-mail: nhcyang@kaeri.re.kr; Kim, Hyung-Ju; Lee, Si-Young; Yang, In-Hwan; Chung, Dong-Yong
2017-06-15
The thermochemical properties of uranium compounds have attracted much interest in relation to thermochemical treatments and the safe disposal of radioactive waste bearing uranium compounds. The characteristics of the thermal decomposition of uranium metaphosphate, U(PO{sub 3}){sub 4}, into uranium pyrophosphate, UP{sub 2}O{sub 7}, have been studied from the view point of reaction kinetics and acting mechanisms. A mixture of U(PO{sub 3}){sub 4} and UP{sub 2}O{sub 7} was prepared from the pyrolysis residue of uranium-bearing spent TBP. A kinetic analysis of the reaction of U(PO{sub 3}){sub 4} into UP{sub 2}O{sub 7} was conducted using an isoconversional method and a master plot method on the basis of data from a non-isothermal thermogravimetric analysis. The thermal decomposition of U(PO{sub 3}){sub 4} into UP{sub 2}O{sub 7} followed a single-step reaction with an activation energy of 175.29 ± 1.58 kJ mol{sup −1}. The most probable kinetic model was determined as a type of nucleation and nuclei-growth models, the Avrami-Erofeev model (A3), which describes that there are certain restrictions on nuclei growth of UP{sub 2}O{sub 7} during the solid-state decomposition of U(PO{sub 3}){sub 4}. - Highlights: •Thermal decomposition kinetics of U(PO{sub 3}){sub 4} into UP{sub 2}O{sub 7} was investigated. •The thermal decomposition followed a single-step reaction with an activation energy of 175.3 ± 1.6 kJ mol{sup −1}. •The most probable kinetic model was determined as a type of nucleation and nuclei-growth models, the Avrami-Erofeev (A3).
Roger, Mathieu; Barros, Noémi; Arliguie, Thérèse; Thuéry, Pierre; Maron, Laurent; Ephritikhine, Michel
2006-07-12
Reaction of U(NEt(2))(4) with HS-2,4,6-(t)Bu(3)C(6)H(2) (HSMes) gave U(SMes)(3)(NEt(2))(py) (1), whereas similar treatment of U[N(SiMe(3))SiMe(2)CH(2)][N(SiMe(3))(2)](2) afforded U(SMes)[N(SiMe(3))(2)](3) (2) and U(SMes)(3)[N(SiMe(3))(2)]. The first neutral homoleptic uranium(IV) thiolate to have been crystallographically characterized, U(SMes)(4) (4), was isolated from the reaction of U(BH(4))(4) and KSMes. The first homoleptic thiolate complex of uranium(III), U(SMes)(3) (5), was synthesized by protonolysis of U[N(SiMe(3))(2)](3) with HSMes in cyclohexane. The crystal structure of 5 exhibits the novel eta(3) ligation mode for the arylthiolate ligand. Comparison of the crystal structure of 5 with those of the isomorphous lanthanide congeners Ln(SMes)(3) (Ln = La, Ce, Pr, and Nd) indicates that the U-S, U-C(ipso)(), and U-C(ortho)() bond lengths are shorter than the corresponding ones in the 4f-element analogues, when taking into account the variation in the ionic radii of the metals. The distance between the uranium and the carbon atoms involved in the U...H-C epsilon agostic interaction of each thiolate ligand is shorter, by approximately 0.05 A, than that expected from a purely ionic bonding model. The lanthanide(III)/actinide(III) differentiation was analyzed by density functional theory (DFT). The nature of the M-S bond is shown to be ionic strongly polarized at the sulfur for M = U and iono-covalent (i.e. strongly ionic with low orbital interaction), for M = Ln. The strength of the U...H-C epsilon agostic interaction is proposed to be controlled by the maximization of the interaction between U(+) and S(-) under steric constraints. The eta(3) ligation mode of the arylthiolate ligand is also obtained from DFT.
Energy Technology Data Exchange (ETDEWEB)
Yeon, Jeongho; Smith, Mark D. [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Tapp, Joshua; Möller, Angela [Department of Chemistry and Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Loye, Hans-Conrad zur, E-mail: zurloye@mailbox.sc.edu [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States)
2016-04-15
Two new uranium(IV) fluorides, Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} (1) and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30} (2), were synthesized through an in situ mild hydrothermal route, and were structurally characterized by single crystal X-ray diffraction. The compounds exhibit complex crystal structures composed of corner- or edge-shared UF{sub 9} and MF{sub 6} (M=Mg, Mn) polyhedra, forming hexagonal channels in the three-dimensional framework, in which ordered or disordered divalent metal and sodium atoms reside. The large hexagonal voids contain the nearly regular M(II)F{sub 6} octahedra and sodium ions, whereas the small hexagonal cavities include M(II) and sodium ions on a mixed-occupied site. Magnetic susceptibility measurements yielded effective magnetic moments of 8.36 and 11.6 µ{sub B} for 1 and 2, respectively, confirming the presence and oxidation states of U(IV) and Mn(II). The large negative Weiss constants indicate the spin gap between a triplet and a singlet state in the U(IV). Magnetization data as a function of applied fields revealed that 2 exhibits paramagnetic behavior due to the nonmagnetic singlet ground state of U(IV) at low temperature. UV–vis diffuse reflectance and X-ray photoelectron spectroscopy data were also analyzed. - Graphical abstract: Two new quaternary U(IV) fluorides, Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30}, were crystallized via an in situ reduction step of U(VI) to U(IV) under mild hydrothermal conditions. The compounds show complex crystal structures based on the 3-D building block of U{sub 6}F{sub 30}. Magnetic property measurements revealed that the U(IV) exhibits a nonmagnetic singlet ground state at low temperature with a spin gap. - Highlights: • Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30} have been synthesized and characterized. • The U(IV) fluorides exhibit complex three-dimensional crystal structures. • The
Hydrophysical Evaluation of Wells TW-B, TW-7, UE-6d, U-2gg PSE 3A, U-10L 1, and UE-6e in Yucca Flat
Energy Technology Data Exchange (ETDEWEB)
Pohlmann, Karl [Desert Research Inst. (DRI), Las Vegas, NV (United States); Healey, John [Desert Research Inst. (DRI), Las Vegas, NV (United States); Lyles, Bred [Desert Research Inst. (DRI), Reno, NV (United States); Cooper, Clay [Desert Research Inst. (DRI), Reno, NV (United States); Hershey, Ronald L. [Desert Research Inst. (DRI), Reno, NV (United States)
2017-05-01
This study evaluated six wells in Yucca Flat in support of the Underground Test Area (UGTA) Activity conducted by the U.S. Department of Energy (DOE) at the Nevada National Security Site (NNSS). Accessibility and groundwater sampling conditions were assessed and if conditions permitted, samples were collected for tritium analysis. Four of the wells, TW-B, UE-6d, UE-6e, and TW-7 were sampled in support of UGTA responses to recommendations made by the Yucca Flat/Climax Mine External Peer Review Committee (Navarro, 2016). In addition to its role in support of these responses, TW-7 was included because it is listed in the NNSS Integrated Groundwater Sampling Plan (DOE, 2014) as a required sampling location, although it had not been sampled since 1994. U-2gg PSE 3A and U-10L 1 were evaluated to determine whether deteriorating well conditions can be addressed so that these wells can be used as additional sampling points in Yucca Flat.
International Nuclear Information System (INIS)
Radtke, M.; Boberg, M.; Pleiss, U.; Rosentreter, U.
1994-01-01
The title compound [ 14 C]BAY u 3405 (1) was synthesized as part of 8-step sequence. Starting from [U- 14 C]aniline hydrogensulfate the final product 1 was obtained with a specific activity of 741 MBq/mmol (20 mCi/mmol) and a radiochemical purity of > 98 % in an overall yield of 6 and 10 % depending on the method. (author)
DEEP KECK u-BAND IMAGING OF THE HUBBLE ULTRA DEEP FIELD: A CATALOG OF z ∼ 3 LYMAN BREAK GALAXIES
International Nuclear Information System (INIS)
Rafelski, Marc; Wolfe, Arthur M.; Cooke, Jeff; Chen, H.-W.; Armandroff, Taft E.; Wirth, Gregory D.
2009-01-01
We present a sample of 407 z ∼ 3 Lyman break galaxies (LBGs) to a limiting isophotal u-band magnitude of 27.6 mag in the Hubble Ultra Deep Field. The LBGs are selected using a combination of photometric redshifts and the u-band drop-out technique enabled by the introduction of an extremely deep u-band image obtained with the Keck I telescope and the blue channel of the Low Resolution Imaging Spectrometer. The Keck u-band image, totaling 9 hr of integration time, has a 1σ depth of 30.7 mag arcsec -2 , making it one of the most sensitive u-band images ever obtained. The u-band image also substantially improves the accuracy of photometric redshift measurements of ∼50% of the z ∼ 3 LBGs, significantly reducing the traditional degeneracy of colors between z ∼ 3 and z ∼ 0.2 galaxies. This sample provides the most sensitive, high-resolution multi-filter imaging of reliably identified z ∼ 3 LBGs for morphological studies of galaxy formation and evolution and the star formation efficiency of gas at high redshift.
Production of U3O8 by uranyl formate precipitation and calcination in a full-scale pilot facility
International Nuclear Information System (INIS)
Kendrick, L.S.; Wilson, W.A.; Mosley, W.C.
1984-08-01
The uranyl formate process for the production of U 3 O 8 with a controlled particle size has been extensively studied on a laboratory scale. Based on this study, a pilot-scale facility (the Uranyl Formate Facility) was built to investigate the key steps of the process on a larger scale. These steps were the precipitation of a uranyl formate monohydrate salt and the calcination of this salt to U 3 O 8 . Tests of the facility and process were conducted at conditions recommended by the laboratory-scale studies for a full-scale production facility. These tests demonstrated that U 3 O 8 of the required particle size for the PM process can be produced on a plant scale by the calcination of uranyl formate crystals. The performance of the U 3 O 8 produced by the uranyl formate process in fuel tube fabrication was also investigated. Small-scale extrusion tests of U 3 O 8 -Al cores which used the U 3 O 8 produced in the Uranyl Formate Facility were conducted. These tests demonstrated that the U 3 O 8 quality was satisfactory for the PM process
Energy Technology Data Exchange (ETDEWEB)
Kutty, T.R.G. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India)]. E-mail: tkutty@magnum.barc.ernet.in; Hegde, P.V. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Khan, K.B. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Jarvis, T. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Sengupta, A.K. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Majumdar, S. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Kamath, H.S. [Nuclear Fuels Group, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India)
2004-12-01
ThO{sub 2} containing around 2-3% {sup 233}UO{sub 2} is the proposed fuel for the forthcoming Indian Advanced Heavy Water Reactor (AHWR). This fuel is prepared by powder metallurgy technique using ThO{sub 2} and U{sub 3}O{sub 8} powders as the starting material. The densification behaviour of the fuel was evaluated using a high temperature dilatometer in four different atmospheres Ar, Ar-8%H{sub 2}, CO{sub 2} and air. Air was found to be the best medium for sintering among them. For Ar and Ar-8%H{sub 2} atmospheres, the former gave a slightly higher densification. Thermogravimetric studies carried out on ThO{sub 2}-2%U{sub 3}O{sub 8} granules in air showed a continuous decrease in weight up to 1500 deg. C. The effectiveness of U{sub 3}O{sub 8} in enhancing the sintering of ThO{sub 2} has been established.
Study of processes for the preparation of U3O8 powder for MTR fuel elements
International Nuclear Information System (INIS)
Neto, R.M.L.
1989-01-01
Three preparation methods of high-density U 3 O 8 powder have been studied: grinding of sintered U 3 O 8 pellets, sintering of calcined U 3 O 8 granules; and sintering of ammonium diuranate (ADU) granules. Experiments have been carried out varying ADU calcination time and temperature as well as sintering time, yielding ten U 3 O 8 batches. Powder characteristics, granulometric yield, and number of process steps have been taken into account for comparison purposes. Impurity content, specific surface area, stoichiometry, morphology, density, porosity distribution and phase identification have been considered as parameters for powder characterization. The main conclusions show that the second method (following a 600 0 C/3h ADU calcination) gives the best results. Moreover, the third method gives also good results, but there were some difficulties with ADU handling. (author) [pt
International Nuclear Information System (INIS)
Gardie, P.
1992-01-01
High temperature thermodynamic properties study of U-Fe and U-Ga alloys, and wetting study of yttrium oxide by uranium are presented. High temperature mass spectrometry coupled to a Knudsen effusion multi-cell allows to measure iron activity in U-Fe alloys and of gallium in U-Ga alloys, the U activity is deduced from Gibbs-Duhem equation. Wetting of the system U/Y_2O_3_-_x is studied between 1413 K and 1973 K by the put drop method visualized by X-rays. This technique also furnishes density, surface tension of U and of U-Fe alloys put on Y_2O_3_-_x. A new model of the interfacial oxygen action on wetting is done for the system U/Y_2O_3_-_x. (A.B.)
38 CFR 3.363 - Bar to benefits under 38 U.S.C. 1151.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Bar to benefits under 38... Purposes § 3.363 Bar to benefits under 38 U.S.C. 1151. (a) Claims subject to this section. This section.... (b) Administrative award, compromises, or settlements, or judgments that bar benefits under 38 U.S.C...
2010-01-01
...) Sunburn; and (18) Other means. (d) For tolerances see § 51.1151. (e) Internal quality: Lots meeting the internal requirements for “U.S. Grade AA Juice (Double A)” or “U.S. Grade A Juice” may be so specified in... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...
Laser-time resolved fluorimetric determination of trace of boron in U3O8
International Nuclear Information System (INIS)
Xu Yongyuan; Wang Yulong; Wang Qin
1988-01-01
In this work, a laser-time resolved fluorimetric determinatin of trace of boron in U 3 O 8 had been developed. The boron complex with dibenzoyl methane (DBM) in a suitable medium is excited by a small nitrogen laser and emits the delay fluorescence with lifetime of 2 ms which is much longer than that of the fluorescence of uranium. Since the fluorescence of uranium doesn't interfere with determination of boron in the time resolved fluorimetric method boron need not be separated from uranium in advance. Thus the determination is very rapid and simple. The limit of determination is 0.02 ngB/ml. When 10 mgU is taken, 0.01 ppm of boron in uranium can be determined. Several samples of U 3 O 8 with boron content from 0.04 to 0.5 ppm have been determined by using this method. The results of determination have been accordant with other methods
7 CFR 51.2541 - U.S. Fancy, U.S. Extra No. 1, U.S. No. 1 And U.S. Select Grades.
2010-01-01
... PRODUCTS 1,2 (INSPECTION, CERTIFICATION, AND STANDARDS) United States Standards for Grades of Pistachio.... Fancy,” “U.S. Extra No. 1,” “U.S. No. 1,” and “U.S. Select” consists of pistachio nuts in the shell...
Neutrinoless double beta decay in an SU(3)L x U(1)N model
International Nuclear Information System (INIS)
Pleitez, V.; Tonasse, M.D.
1993-01-01
A model for the electroweak interactions with SU (3) L x U(1) N gauge symmetry is considered. It is shown that, it is the conservation of F = L + B which forbids massive neutrinos and the neutrinoless double beta decay, (β β) On u. Explicit and spontaneous breaking of F imply that the neutrinos have an arbitrary mass and (β β) On u proceeds also with some contributions that do not depend explicitly on the neutrino mass. (author)
International Nuclear Information System (INIS)
Paquet, F.; Chazel, V.; Houpert, P.; Guilmette, R.; Muggenburg, B.
2003-01-01
This study aimed to assess the efficacy of 3,4,3-LI(1,2-HOPO) for reducing uranium, plutonium and americium in rats after intramuscular injection of (U-Pu)O 2 particles (MOX). Sixteen rats were contaminated by intramuscular injection of a 1 mg MOX suspension and then treated daily for 7 d with LIHOPO (30 or 200 μmol kg -1 ) or DTPA (30 μmol kg -1 ). LIHOPO was inefficient for removing Pu, Am and U from the wound site. However, it reduced Pu retention in carcass and liver by factors of 2 and 6 respectively, and Am retention in carcass and liver by factors of 10 and 30. In contrast, the effect of LIHOPO on U was to decrease the retention in kidneys by a factor of 75. These results confirm that LIHOPO is a good candidate for use after contamination with MOX, in combination with localised wound lavage or surgical treatment aimed at removing most of the contaminant at the wound site. (author)
International Nuclear Information System (INIS)
Biedenharn, L.C.; Lohe, M.A.; Louck, J.D.
1975-01-01
The multiplicity problem for tensor operators in U(3) has a unique (canonical) resolution which is utilized to effect the explicit construction of all U(3) Wigner and Racah coefficients. Methods are employed which elucidate the structure of the results; in particular, the significance of the denominator functions entering the structure of these coefficients, and the relation of these denominator functions to the null space of the canonical tensor operators. An interesting feature of the denominator functions is the appearance of new, group theoretical, polynomials exhibiting several remarkable and quite unexpected properties. (U.S.)
Comparison of U-Pu-Mo, U-Pu-Nb, U-Pu-Ti and U-Pu-Zr alloys
International Nuclear Information System (INIS)
Boucher, R.; Barthelemy, P.
1964-01-01
The data concerning the U-Pu, U-Pu-Mo and U-Pu-Nb are recalled. The results obtained with U-Pu-Ti and U-Pu-Zr alloys containing 15-20 per cent Pu and 10 wt. per cent ternary element are reported. The transformation temperatures, the expansion coefficients, the nature of phases, the thermal cycling behaviour have been determined. A list of the principal properties of these different alloys is presented and the possibilities of their use as fast reactor's fuel element are considered. The U-Pu-Ti alloys seem to be quite promising: easiness of fabrication, large thermal stability, excellent behaviour in air, small quantity of zeta phase, temperature of solidus superior to 1100 deg. C. (authors) [fr
Accurate 238U(n , 2 n )237U reaction cross-section measurements from 6.5 to 14.8 MeV
Krishichayan, Bhike, M.; Tornow, W.; Tonchev, A. P.; Kawano, T.
2017-10-01
The cross section for the 238U(n ,2 n )237U reaction has been measured in the incident neutron energy range from 6.5 to 14.8 MeV in small energy steps using an activation technique. Monoenergetic neutron beams were produced via the 2H(d ,n )3He and 3H(d ,n )4He reactions. 238U targets were activated along with Au and Al monitor foils to determine the incident neutron flux. The activity of the reaction products was measured in TUNL's low-background counting facility using high-resolution γ -ray spectroscopy. The results are compared with previous measurements and latest data evaluations. Statistical-model calculations, based on the Hauser-Feshbach formalism, have been carried out using the CoH3 code and are compared with the experimental results. The present self-consistent and high-quality data are important for stockpile stewardship and nuclear forensic purposes as well as for the design and operation of fast reactors.
Inhibition of bacterial U(VI) reduction by calcium
International Nuclear Information System (INIS)
Brooks, Scott C.; Fredrickson, Jim K.; Carroll, S. L.; Kennedy, David W.; Zachara, John M.; Plymale, Andrew E.; Kelly, S. D.; Kemner, K. M.; Fendorf, S.
2003-01-01
The rapid kinetics of bacterial U(VI) reduction and low solubility of uraninite (UO2,cr) make this process an attractive option for removing uranium from groundwater. Nevertheless, conditions that may promote or inhibit U(VI) reduction are not well-defined. Recent descriptions of Ca-UO2-CO3 complexes indicate that these species may dominate the aqueous speciation of U(VI) in many environments. We monitored the bacterial reduction of U(VI) in bicarbonate-buffered solution in the presence and absence of Ca. XAFS measurements confirmed the presence of a Ca-U(VI)-CO3 complex in the initial solutions containing calcium. Calcium, at millimolar concentrations (0.45-5 mM), caused a significant decrease in the rate and extent of bacterial U(VI) reduction. Both facultative (Shewanella putrefaciens strain CN32) and obligate (Desulfovibrio desulfuricans, Geobacter sulfurreducens) anaerobic bacteria were affected by the presence of calcium. Reduction of U(VI) ceased when the calculated system Eh re ached -0.046+/- 0.001 V, based on the Ca2UO2(CO3)(3) -- > UO2,cr couple. The results are consistent with the hypothesis that U is a less energetically favorable electron acceptor when the Ca-UO2-CO3 complexes are present. The results do not support Ca inhibition caused by direct interactions with the cells or with the electron donor as the reduction of fumarate or Tc(VII)O-4(-) under identical conditions was unaffected by the presence of Ca
U3 snoRNP associates with fibrillarin a component of the scleroderma clumpy nucleolar domain
DEFF Research Database (Denmark)
Herrera-Esparza, Rafael; Kruse, Lars; von Essen, Marina
2002-01-01
by ELISA was recognized by the clumpy scleroderma serum from the majority of patients. In situ hybridization assays showed that the fibrillarin tagged by the elicited antibodies was colocalized with U3 snoRNP in the nucleolus in a clumpy manner and coprecipitated the U3 snoRNP. In conclusion...
International Nuclear Information System (INIS)
Roger, Mathieu; Barros, Noemi; Arliguie, Therese; Thuery, Pierre; Maron, Laurent; Ephritikhine, Michel
2006-01-01
Reaction of U(NEt 2 ) 4 with HS-2,4,6- t Bu 3 C 6 H 2 (HSMes*) gave U(SMes*) 3 (NEt 2 )(py) (1), whereas similar treatment of U[N(SiMe 3 )SiMe 2 CH 2 ][N(SiMe 3 ) 2 ] 2 afforded U(SMes*)[N(SiMe 3 ) 2 ] 3 (2) and U(SMes*) 3 [N(SiMe 3 ) 2 ]. The first neutral homoleptic uranium(IV) thiolate to have been crystallographically characterized, U(SMes*) 4 (4), was isolated from the reaction of U(BH 4 ) 4 and KSMes*. The first homoleptic thiolate complex of uranium(III), U(SMes*) 3 (5), was synthesized by proton-lysis of U[N(SiMe 3 ) 2 ] 3 with HSMes* in cyclohexane. The crystal structure of 5 exhibits the novel η 3 ligation mode for the aryl-thiolate ligand. Comparison of the crystal structure of 5 with those of the isomorphous lanthanide congeners Ln(SMes*) 3 (Ln) La, Ce, Pr, and Nd) indicates that the U-S, U-C ipso , and U-C ortho bond lengths are shorter than the corresponding ones in the 4f-element analogues, when taking into account the variation in the ionic radii of the metals. The distance between the uranium and the carbon atoms involved in the U center dot center dot center dot H-C ε agostic interaction of each thiolate ligand is shorter, by ∼ 0.05 angstrom, than that expected from a purely ionic bonding model. The lanthanide( III)/actinide(III) differentiation was analyzed by density functional theory (DFT). The nature of the M-S bond is shown to be ionic strongly polarized at the sulfur for M) U and ion-covalent (i.e. strongly ionic with low orbital interaction), for M) Ln. The strength of the U center dot center dot center dot H-C ε agostic interaction is proposed to be controlled by the maximization of the interaction between U + and S - under steric constraints. The η 3 ligation mode of the aryl-thiolate ligand is also obtained from DFT. (authors)
International Nuclear Information System (INIS)
Xia Dechang; Liu Chao
2012-01-01
On the basis of discussing the influence of single factor on maximum uranium concentration in digestion solution,the influence degree of some factors such as U content, H 2 O content, mass ratio of P and U was compared and analyzed. The results indicate that the relationship between U content and maximum uranium concentration in digestion solution was direct ratio, while the U content increases by 1%, the maximum uranium concentration in digestion solution increases by 4.8%-5.7%. The relationship between H 2 O content and maximum uranium concentration in digestion solution was inverse ratio, the maximum uranium concentration in digestion solution decreases by 46.1-55.2 g/L while H 2 O content increases by 1%. The relationship between mass ratio of P and U and maximum uranium concentration in digestion solution was inverse ratio, the maximum uranium concentration in digestion solution decreases by 116.0-181.0 g/L while the mass ratio of P and U increase 0.1%. When U content equals 62.5% and the influence of mass ratio of P and U is no considered, the maximum uranium concentration in digestion solution equals 1 578 g/L; while mass ratio of P and U equals 0.35%, the maximum uranium concentration decreases to 716 g/L, the decreased rate is 54.6%, so the mass ratio of P and U in U 3 O 8 type uranium ore concentrate is the main controlling factor. (authors)
Matmor, M.; Cohen, S.; Rafailov, G.; Vaknin, M.; Shamir, N.; Gouder, T.; Zalkind, S.
2018-02-01
Surface characterization and the interactions of U(AlxSi1-x)3 alloy (x = 0.57) with oxygen and water vapor were studied, utilizing X-Ray Photoelectron Spectroscopy and Direct Recoil Spectrometry, at room temperature. The U 4f spectrum of U(AlxSi1-x)3 alloy exhibits weak correlation satellites, suggesting an itinerant description of the U 5f states for this compound. The Al and Si 2p lines are chemically shifted to lower binding energies. Exposing the alloy to oxygen and water vapor results in oxidation of mainly the uranium and aluminum components, while silicon is only slightly oxidized. Oxygen was found to be a stronger oxidizer than water vapor and the trend is consistent with the more negative enthalpies of formation of metal oxides produced by the O2 reaction, as compared to H2O. During oxygen exposure, fast oxidation occurs by oxide islands nucleation and lateral growth, followed by oxidation of the sub-surface, up to ∼4 nm, at 1000 L exposure. Water initially reacts with the surface by full dissociation and oxide islands formation, which is then covered by hydroxides. Only a minor increase in the oxide thickness of up to ∼2.5 nm, was observed after coalescence.
Fabrication of high-uranium-loaded U{sub 3}O{sub 8}-Al developmental fuel plates
Energy Technology Data Exchange (ETDEWEB)
Copeland, G L; Martin, M M [Oak Ridge National Laboratory, TN (United States)
1983-08-01
A common plate-type fuel for Research and Test Reactors (RERTR) is U{sub 3}0{sub 8} dispersed in aluminum and clad with an aluminum alloy. There is an impetus to reduce the {sup 235}U enrichment from above 90% to below 20% for these fuels to lessen the risk of diversion of the uranium for non-peaceful uses. Thus, the uranium content of the fuel plates has to be increased to maintain the performance of the reactors. This paper describes work at ORNL to determine the maximal uranium loading for these fuels that can be fabricated with commercially proven materials and techniques and that can be expected to perform satisfactorily in service. We fabricated developmental fuel plates with cores containing from 60 to 100 wt U{sub 3}0{sub 8} in aluminum encapsulated in 6061 aluminum alloy and evaluated them for aspects of fabricability, nondestructive testing, and expected performance. We recommend 75 wt U{sub 3}0{sub 8}-Al 3.1 Mg U/m{sup 3}) as the highest loading in the initial irradiation test. This upper limit is based on a qualitative assessment of the mechanical integrity of the core made by using current fabrication techniques and materials. As the oxide loading is increased beyond this point, planar areas and extensive stringers of oxide and voids develop, which leave little strength in the thickness direction. Fuel plates may then blister over these areas as fission gases collect during irradiation. Current size plates are easily fabricable to the 75 wt % U{sub 3}0{sub 8}-Al core loading by current fabrication techniques. Dogboning is a potential problem at this loading for some applications; however, this can be easily solved by using tapered compact ends. Current nondestructive radiography and transmission x-ray scanning are applicable to the highly loaded plates. Ultrasonic testing for non-bonds is marginal because of the abrupt change in conductance at the cladding-core interface. Plate thickness can be increased if desired; we fabricated 75 wt % plates with
U2 laulusõnade tundmine lennutab Hawaile
2006-01-01
Iiri bänd U2 algatas oma uue albumi "U2 18 Singles väljatuleku puhul internetis võistluse "Hunt The Lyric", kus fännidel on võimalus võita reis Hawaile (reisi paketis ka U2 "Vertigo" tuuri kontsert 9. dets.)
Energy Technology Data Exchange (ETDEWEB)
Ristic, M M [Institute of Nuclear Sciences Vinca, Laboratorija za reaktorske materijale, Beograd (Serbia and Montenegro)
1962-10-15
The objectives of the study of U-O powder system were: detailed characterization of the UO{sub 2} powder which will be used for studying the sintering process, and more detailed properties of the U-O system (thermodynamic aspects of oxidation kinetics). Study of the physical and chemical properties of UO{sub 2} powder were performed and then oxidation kinetics of UO{sub 2} {yields}U{sub 3}O{sub 7} was investigated. Detailed qualitative DDK analysis was done. Owing to the TGA equipment there was a possibility to obtain U{sub 3}O{sub 7} study of U{sub 3}O{sub 7} {yields} U{sub 3}O{sub 8} oxidation was possible.
LEU fuel development at CERCA. Status as of October 1996: U5Si4: A new phase in the U/Si diagram
International Nuclear Information System (INIS)
Durand, J.P.; Olagnon, G.; Colomb, P.; Lavastre, Y.; Grasse, M.; Noel, H.; Queneau, V.
1996-01-01
A fundamental study has been carried out by CERCA and the French CNRS (National Scientific Research Center) as a partner in order to get a better understanding of the U 3 Si 2 casting process. On the occasion of this study, a new binary phase, U 5 Si 4 , has been discovered in the USi phase equilibrium diagram. Synthesis conditions of U 5 Si 4 have been determined and the impact of such a discovery is evaluated regarding the production process of U 3 Si 2 ingots. It can be concluded that keeping the CERCA's casting tools and within the allowed limits of production parameters, the U 3 Si 2 ingots are homogenous without any detectable trace of U 5 Si 4 even if a long term heat treatment at the hot rolling temperature is carried out. On the production point of view, perfect knowledge of both metallurgical phase synthesis and the casting process guarantee the quality of U 3 Si 2 ingots and powder produced by CERCA. (author)
Energy Technology Data Exchange (ETDEWEB)
Kawano, Toshihiko [Kyushu Univ., Fukuoka (Japan); Matsunobu, Hiroyuki [Data Engineering, Inc. (Japan); Murata, Toru [AITEL Corporation, Tokyo (JP)] [and others
2000-02-01
A simultaneous evaluation code SOK (Simultaneous evaluation on KALMAN) has been developed, which is a least-squares fitting program to absolute and relative measurements. The SOK code was employed to evaluate the fission cross sections of {sup 233}U, {sup 235}U, {sup 238}U, {sup 239}Pu, {sup 240}Pu, and {sup 241}Pu for the evaluated nuclear data library JENDL-3.3. Procedures of the simultaneous evaluation and the experimental database of the fission cross sections are described. The fission cross sections obtained were compared with evaluated values given in JENDL-3.2 and ENDF/B-VI. (author)
International Nuclear Information System (INIS)
Watamura, S.
1983-01-01
Solutions of ten-dimensional Maxwell-Einstein theory and a bosonic part of N = 2, D = 10 supergravity theory are examined. It is shown that there is a solution for which six-dimensional internal space is compactified into CP 2 x S 2 . The gauge symmetry of the effective four-dimensional theory is SU(3) x SU(2) x U(1). The introduction of fermions is also considered. The requirement of consistency in introducing a spinsup(C) structure on CP 2 results in a U(1) charge quantization condition. (orig.)
Miyazaki, Saori; Sato, Yutaka; Asano, Tomoya; Nagamura, Yoshiaki; Nonomura, Ken-Ichi
2015-10-01
Post-transcriptional gene regulation by RNA recognition motif (RRM) proteins through binding to cis-elements in the 3'-untranslated region (3'-UTR) is widely used in eukaryotes to complete various biological processes. Rice MEIOSIS ARRESTED AT LEPTOTENE2 (MEL2) is the RRM protein that functions in the transition to meiosis in proper timing. The MEL2 RRM preferentially associated with the U-rich RNA consensus, UUAGUU[U/A][U/G][A/U/G]U, dependently on sequences and proportionally to MEL2 protein amounts in vitro. The consensus sequences were located in the putative looped structures of the RNA ligand. A genome-wide survey revealed a tendency of MEL2-binding consensus appearing in 3'-UTR of rice genes. Of 249 genes that conserved the consensus in their 3'-UTR, 13 genes spatiotemporally co-expressed with MEL2 in meiotic flowers, and included several genes whose function was supposed in meiosis; such as Replication protein A and OsMADS3. The proteome analysis revealed that the amounts of small ubiquitin-related modifier-like protein and eukaryotic translation initiation factor3-like protein were dramatically altered in mel2 mutant anthers. Taken together with transcriptome and gene ontology results, we propose that the rice MEL2 is involved in the translational regulation of key meiotic genes on 3'-UTRs to achieve the faithful transition of germ cells to meiosis.
Examination of U3Si2-Al fuel elements from the Oak Ridge Research Reactor
International Nuclear Information System (INIS)
Copeland, G.L.; Snelgrove, J.L.; Hofman, G.L.
1986-01-01
The results of postirradiation examination of low-enriched U 3 Si 2 fuel elements from the Oak Ridge Research Reactor are presented. The elements replaced standard high-enriched elements and were handled routinely except that the burnup of half the elements was extended beyond normal limits up to about 98% peak. The elements were manufactured by commercial fuel suppliers. The performance was completely satisfactory for all the elements
Assembly and dynamics of the U4/U6 di-snRNP by single-molecule FRET
Hardin, John W.; Warnasooriya, Chandani; Kondo, Yasushi; Nagai, Kiyoshi; Rueda, David
2015-01-01
In large ribonucleoprotein machines, such as ribosomes and spliceosomes, RNA functions as an assembly scaffold as well as a critical catalytic component. Protein binding to the RNA scaffold can induce structural changes, which in turn modulate subsequent binding of other components. The spliceosomal U4/U6 di-snRNP contains extensively base paired U4 and U6 snRNAs, Snu13, Prp31, Prp3 and Prp4, seven Sm and seven LSm proteins. We have studied successive binding of all protein components to the snRNA duplex during di-snRNP assembly by electrophoretic mobility shift assay and accompanying conformational changes in the U4/U6 RNA 3-way junction by single-molecule FRET. Stems I and II of the duplex were found to co-axially stack in free RNA and function as a rigid scaffold during the entire assembly, but the U4 snRNA 5′ stem-loop adopts alternative orientations each stabilized by Prp31 and Prp3/4 binding accounting for altered Prp3/4 binding affinities in presence of Prp31. PMID:26503251
Splitting Fermi Surfaces and Heavy Electronic States in Non-Centrosymmetric U3Ni3Sn4
Maurya, Arvind; Harima, Hisatomo; Nakamura, Ai; Shimizu, Yusei; Homma, Yoshiya; Li, DeXin; Honda, Fuminori; Sato, Yoshiki J.; Aoki, Dai
2018-04-01
We report the single-crystal growth of the non-centrosymmetric paramagnet U3Ni3Sn4 by the Bridgman method and the Fermi surface properties detected by de Haas-van Alphen (dHvA) experiments. We have also investigated single-crystal U3Ni3Sn4 by single-crystal X-ray diffraction, magnetization, electrical resistivity, and heat capacity measurements. The angular dependence of the dHvA frequencies reveals many closed Fermi surfaces, which are nearly spherical in topology. The experimental results are in good agreement with local density approximation (LDA) band structure calculations based on the 5f-itinerant model. The band structure calculation predicts many Fermi surfaces, mostly with spherical shape, derived from 12 bands crossing the Fermi energy. To our knowledge, the splitting of Fermi surfaces due to the non-centrosymmetric crystal in 5f-electron systems is experimentally detected for the first time. The temperature dependence of the dHvA amplitude reveals a large cyclotron effective mass of up to 35 m0, indicating the heavy electronic state of U3Ni3Sn4 due to the proximity of the quantum critical point. From the field dependence of the dHvA amplitude, a mean free path of conduction electrons of up to 1950 Å is detected, reflecting the good quality of the grown crystal. The small splitting energy related to the antisymmetric spin-orbit interaction is most likely due to the large cyclotron effective mass.
International Nuclear Information System (INIS)
Mbarki, Mohammed; Touzani, Rachid St.; Fokwa, Boniface P.T.
2013-01-01
The new ternary metal-rich boride, Nb 2 OsB 2 , was synthesized by arc-melting the elements in a water-cooled copper crucible under an argon atmosphere. The compound was characterized from single-crystal X-ray data and EDX measurements. It crystallizes as a new superstructure (space group P4/mnc, no. 128) of the tetragonal U 3 Si 2 -structure type with lattice parameters a=5.922(1) Å and c=6.879(2) Å. All of the B atoms are involved in B 2 dumbbells with B–B distances of 1.89(4) Å. Structure relaxation using VASP (Vienna ab intio Simulation Package) has confirmed the space group and the lattice parameters. According to electronic structure calculations (TB–LMTO–ASA), the homoatomic B–B interactions are optimized and very strong, but relatively strong heteroatomic Os–B, Nb–B and Nb–Os bonds are also found: These interactions, which together build a three-dimensional network, are mainly responsible for the structural stability of this new phase. The density of state at the Fermi level predicts metallic behavior, as expected, from this metal-rich boride. - Graphical abstract: Nb 2 OsB 2 is, to the best of our knowledge, the first fully characterized phase in the ternary Nb–Os–B system. It crystallizes (space group P4/mnc, 128) with a new twofold superstructure of the U 3 Si 2 structure type (space group P4/mbm, 127), and is therefore the first boride in this structure family crystallizing with a superstructure of the U 3 Si 2 structure type. We show that the distortions leading to this superstructure occurs mainly in the Nb-layer, which tries to accommodate the large osmium atoms. The consequence of this puckering is the building osmium dumbbells instead of chains along [001]. - Highlights: • First compound in the Nb–Os–B system. • New twofold superstructure of U 3 Si 2 structure type. • Puckering of Nb-layer responsible for superstructure occurrence. • Chemical bonding studied by density functional theory
Directory of Open Access Journals (Sweden)
Sang-Hun Kang
Full Text Available BACKGROUND: The aim of this study is to determine anti-cancer effect of Icariside II purified from the root of Epimedium koreanum Nakai on human acute myeloid leukemia (AML cell line U937. METHODOLOGY/PRINCIPAL FINDINGS: Icariside II blocked the growth U937 cells in a dose- and time-dependent manner. In this anti-proliferation process, this herb compound rendered the cells susceptible to apoptosis, manifested by enhanced accumulation of sub-G1 cell population and increased the terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL-positive cells. Icariside II was able to activate caspase-3 and cleaved poly (ADP-ribose polymerase (PARP in a time-dependent manner. Concurrently, the anti-apoptotic proteins, such as bcl-x(L and survivin in U937 cells, were downregulated by Icariside II. In addition, Icariside II could inhibit STAT3 phosphorylation and function and subsequently suppress the activation of Janus activated kinase 2 (JAK2, the upstream activators of STAT3, in a dose- and time-dependent manner. Icariside II also enhanced the expression of protein tyrosine phosphatase (PTP SH2 domain-containing phosphatase (SHP-1, and the addition of sodium pervanadate (a PTP inhibitor prevented Icariside II-induced apoptosis as well as STAT3 inactivation in STAT3 positive U937 cells. Furthermore, silencing SHP-1 using its specific siRNA significantly blocked STAT3 inactivation and apoptosis induced by Icariside II in U937 cells. CONCLUSIONS/SIGNIFICANCE: Our results demonstrated that via targeting STAT3-related signaling, Icariside II sensitizes U937 cells to apoptosis and perhaps serves as a potent chemotherapeutic agent for AML.
Phase stability, crystal structure and magnetism in (U1-xNbx)2 Ni21B6 and (UyNb1-y)3Ni20B6
Provino, Alessia; Bhattacharya, Amitava; Dhar, Sudesh K.; Pani, Marcella; Gatti, Flavio; Paudyal, Durga; Manfrinetti, Pietro
Ternary phases with composition T2M21X6 and T3M20X6 (T = transition metal; M = 3 d metal; X = B, C, P) are reported to crystallize with the W2Cr21C6-type and Mg3Ni20B6-type, respectively (ternary ordered derivatives of the cubic Cr23C6-type, cF116). They attract interest due to their refractory, mechanical, and peculiar magnetic properties. Literature data on these compounds only concern apparently stoichiometric 2:21:6 and 3:20:6 phases. Often only nominal composition has been reported, with few structural refinements and no measurements of physical properties. Lack of detailed stoichiometry and crystallographic data does not allow sufficient understanding of the crystal chemistry and properties of these compounds. We studied stability, crystal structure and magnetism of (U1-xNbx)2 Ni21B6 and (UyNb1-y)3Ni20B6; stable phases are U2Ni21B6 and Nb3Ni20B6, as also confirmed by theoretical calculations. The two pristine compounds solubilize Nb and U, respectively, up to a given extent. The substitution of U by Nb leads to a structural change from the W2Cr21C6- to the Mg3Ni20B6-type. While U2Ni21B6 is a Pauli paramagnet (itinerant non-magnetic state of U-5 f electrons), in agreement with literature, magnetization data for (UyNb1-y)3 Ni20B6 show itinerant ferromagnetism with TC >300 K.
The Influence of Uranium Content and PVA/U Ratio on Physical Propertiesof PVA-U Gel and Its Oxide
International Nuclear Information System (INIS)
Damunir; W, Bangun; Indra-Suryawan; Endang-Nawangsih
2000-01-01
The influence of uranium content and PVA/U ratio on physical propertiesof PVA-U gel and its oxide has been investigated. Fifty milliliters of uranylnitrate solution containing 100 g U/l was neutralized using 1M NH 4 0H. Thesolution was converted into PVA-U sol by adding 9.18 % PVA while mixed andheated at 80 o C for 20 minutes. In order to find spherical gel, the solsolution was dropped into a 5 M NH 4 0H solution at room temperature. Theshape formed of the gels small spherical, shape of the formed gels werefiltered, washed and heated at 120 o C. After that the gels were calcined at800 o C for 4 hours. The formed U 3 O 8 particles. Under a similar method, theinfluence of uranium content from 150-400 g/l and the influence of PVA/Uratio of 6.5-12.5 % in 100 g U/l were studied. Characterization of the resultwas obtained from physical properties of the gel and its oxide in the form ofdensity using pycnometer, surface area using surface areameter with N 2 asabsorbent and particle size/ shape using a loop and optical microscope. Theexperimental results showed that both uranium content and PVA/U ratioaffected the physical properties of the kernel properties. The best resultoccurred at uranium content of 100 g/l and PVA/U 9.18 %. The resulted gelwith solid content of 89.17 %, density of 3.36 g/l and size of 124 μm. Theresulted oxide U 3 0 8 had density of 7.98 g U/l, surface area of specific of0.449 m 2 /g and grain size of 810 μm. (author)
Dicty_cDB: Contig-U10837-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI
Zhang, Yachao; Yang, Yang; Jiang, Hong
2013-12-12
The 3d-4f exchange interaction plays an important role in many lanthanide based molecular magnetic materials such as single-molecule magnets and magnetic refrigerants. In this work, we study the 3d-4f magnetic exchange interactions in a series of Cu(II)-Gd(III) (3d(9)-4f(7)) dinuclear complexes based on the numerical atomic basis-norm-conserving pseudopotential method and density functional theory plus the Hubbard U correction approach (DFT+U). We obtain improved description of the 4f electrons by including the semicore 5s5p states in the valence part of the Gd-pseudopotential. The Hubbard U correction is employed to treat the strongly correlated Cu-3d and Gd-4f electrons, which significantly improve the agreement of the predicted exchange constants, J, with experiment, indicating the importance of accurate description of the local Coulomb correlation. The high efficiency of the DFT+U approach enables us to perform calculations with molecular crystals, which in general improve the agreement between theory and experiment, achieving a mean absolute error smaller than 2 cm(-1). In addition, through analyzing the physical effects of U, we identify two magnetic exchange pathways. One is ferromagnetic and involves an interaction between the Cu-3d, O-2p (bridge ligand), and the majority-spin Gd-5d orbitals. The other one is antiferromagnetic and involves Cu-3d, O-2p, and the empty minority-spin Gd-4f orbitals, which is suppressed by the planar Cu-O-O-Gd structure. This study demonstrates the accuracy of the DFT+U method for evaluating the 3d-4f exchange interactions, provides a better understanding of the exchange mechanism in the Cu(II)-Gd(III) complexes, and paves the way for exploiting the magnetic properties of the 3d-4f compounds containing lanthanides other than Gd.
Directory of Open Access Journals (Sweden)
Ramaprasada Rao Kotipatruni
Full Text Available Medulloblastoma is a highly invasive cancer of central nervous system diagnosed mainly in children. Matrix metalloproteinase-9 (MMP-9 and urokinase plasminogen activator receptor (uPAR are over expressed in several cancers and well established for their roles in tumor progression. The present study is aimed to determine the consequences of targeting these molecules on medulloblastoma progression.Radiation is one of the foremost methods applied for treating cancer and considerable evidence showed that radiation elevated uPAR and MMP-9 expression in medulloblastoma cell. Therefore efforts are made to target these molecules in non-irradiated and irradiated medulloblastoma cells. Our results showed that siRNA-mediated knockdown of uPAR and MMP-9, either alone or in combination with radiation modulated a series of events leading to apoptosis. Down regulation of uPAR and MMP-9 inhibited the expression of anti-apoptotic molecules like Bcl-2, Bcl-xL, survivin, XIAP and cIAPI; activated BID cleavage, enhanced the expression of Bak and translocated cyctochrome C to cytosol. Capsase-3 and -9 activities were also increased in uPAR- and MMP-9-downregulated cells. The apoptosis induced by targeting MMP-9 and uPAR was initiated by inhibiting epidermal growth factor receptor (EGFR mediated activation of STAT3 and NF-κB related signaling molecules. Silencing uPAR and MMP-9 inhibited DNA binding activity of STAT3 and also reduced the recruitment of STAT3 protein at the promoter region of Bcl-2 and survivin genes. Our results suggest that inhibiting uPAR and MMP-9 reduced the expression of anti-apoptotic molecules by inactivating the transcriptional activity of STAT3. In addition, treating pre-established medulloblastoma with siRNAs against uPAR and MMP-9 both alone or in combination with radiation suppressed uPAR, MMP-9, EGFR, STAT3 expression and induced Bak activation leading to apoptosis.Taken together, our results illustrated that RNAi mediated targeting of
Kondo Effect of U Impurities in Dilute (YU)2Zn17
Takagi, Shigeru; Suzuki, Hiroyuki; Anzai, Kousuke
2001-10-01
Extending previous work on single-site properties of U ions in (LaU)2Zn17, we have investigated, from ρ(T), χ(T) and Cp(T) on single crystals, (Y1-xUx)2Zn17 with x=0.025 and 0.050, which has almost the same unit-cell volume as an antiferromagnetic heavy-electron compound U2Zn17. Remarkable features in the dilute-impurity limit have been clarified, which include Kondo behavior of ρ(T), large and almost isotropic χimp(T), and strongly enhanced Cimp(T)/T with gigantic γimp=2.02 2.05 J/K2·mole-U as T→0 due to a low characteristic energy-scale of the system. It is shown that gross features of the data are explained in terms of the conventional Kondo effect in the presence of the crystal field with the U3+ \\varGamma6 doublet ground state. It is also shown that the variation of γ with the unit-cell volume in related systems is not explained as a volume effect on TK and that even the behavior of fictitious “paramagnetic” U2Zn17 is not described as a collection of U impurities in dilute (YU)2Zn17.
International Nuclear Information System (INIS)
Solis, Diego; Taboada, Horacio; Rest, Jeffrey
1998-01-01
The DART code is based upon a thermochemical model that can predict swelling, recrystallization, fuel-meat interdiffusion and other issues related with MTR dispersed FE behavior under irradiation. As a part of a common effort to develop an optimized version of DART, a comparison between DART predictions and CNEA miniplates irradiation experimental data was made. The irradiation took place during 1981-82 for U3O8 miniplates and 1985-86 for U 3 Si x at Oak Ridge Research Reactor. (author)
Investigation of phase transformations of U2.5Zr7.5Nb and U3Zr9Nb alloys aging at 600 deg C
International Nuclear Information System (INIS)
Cantagalli, Natalia Mattar; Tanure, Leandro Paulo de Almeida Reis; Braga, Daniel Martins; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa
2009-01-01
Investigation has been made of the effects of high-temperature aging (600 deg C) on the phase transformations in the U2.5Zr7.5Nb and U3Zr9Nb alloys. These alloys have been produced with vacuum induction melting (VIM) furnace in cast ingots. The ingots were homogenized at 1000 deg C for 24 hours in vacuum of -4 torr, and cooled to room temperature at a rate of 3 deg C/min. Specimens from these homogeneous materials, cut in 3 mm high and 10 mm diameter, were reheated to γ phase at 850 deg C, for 1 hour, and aging at 600 deg C at different times from 0.5 to 24 hours. The phases decomposition were characterized by X-ray diffraction (XRD), metallographic, micro-probe analyze by energy dispersive spectrometry (EDS) and microhardness methods. It was verified that the decomposition of the δ phase proceeds in two steps. The first is a discontinuous precipitation of a lamellar two-phase aggregate composed of alpha solid solution and a metastable gamma phase. The metastable gamma phase has a constant composition at given temperature. After longer annealing, it decomposes eutectoidally into the equilibrium (α + δ 2 ) phases mixture. During this process a modification of the original lamellar microstructure takes place. The obtained metastable phases of these alloys of different compositions were analyzed in relation to their constitution, heat treatability and micrographic features and the results confronted with available distinct uranium alloys data from literature. (author)
Quantum phase transition in the U(4) vibron model and the E(3) symmetry
International Nuclear Information System (INIS)
Zhang Yu; Hou Zhanfeng; Chen Huan; Wei Haiqing; Liu Yuxin
2008-01-01
We study the details of the U(3)-O(4) quantum phase transition in the U(4) vibron model. Both asymptotic analysis in the classical limit and rigorous calculations for finite boson number systems indicate that a second-order phase transition is still there even for the systems with boson number N ranging from tens to hundreds. Two kinds of effective order parameters, including E1 transition ratios B(E1:2 1 →1 1 )/B(E1:1 1 →0 1 ) and B(E1:0 2 →1 1 )/B(E1:1 1 →0 1 ), and the energy ratios E 2 1 /E 0 2 and E 3 1 /E 0 2 are proposed to identify the second-order phase transition in experiments. We also found that the critical point of phase transition can be approximately described by the E(3) symmetry, which persists even for moderate N∼10 protected by the scaling behaviors of quantities at the critical point. In addition, a possible empirical example exhibiting roughly the E(3) symmetry is discussed
Thermal reactions of uranium metal, UO 2, U 3O 8, UF 4, and UO 2F 2 with NF 3 to produce UF 6
McNamara, Bruce; Scheele, Randall; Kozelisky, Anne; Edwards, Matthew
2009-11-01
This paper demonstrates that NF 3 fluorinates uranium metal, UO 2, UF 4, UO 3, U 3O 8, and UO 2F 2·2H 2O to produce the volatile UF 6 at temperatures between 100 and 550 °C. Thermogravimetric and differential thermal analysis reaction profiles are described that reflect changes in the uranium fluorination/oxidation state, physiochemical effects, and instances of discrete chemical speciation. Large differences in the onset temperatures for each system investigated implicate changes in mode of the NF 3 gas-solid surface interaction. These studies also demonstrate that NF 3 is a potential replacement fluorinating agent in the existing nuclear fuel cycle and in actinide volatility reprocessing.
A mixed-valent uranium phosphonate framework containing U{sup IV}, U{sup V}, and U{sup VI}
Energy Technology Data Exchange (ETDEWEB)
Chen, Lanhua; Zheng, Tao; Wang, Yaxing; Diwu, Juan; Chai, Zhifang; Wang, Shuao [School for Radiological and interdisciplinary Sciences (RAD-X), Soochow University, Suzhou (China); Collaborative Innovation Center of Radiation Medicine, Jiangsu Higher Education Institutions, Suzhou (China); Bao, Songsong; Zheng, Limin [State Key Laboratory of Coordination Chemistry, School of Chemistry and Chemical Engineering, Collaborative Innovation Center of Advanced Microstructures, Nanjing University (China); Zhang, Linjuan; Wang, Jianqiang [Shanghai Institute of Applied Physics and, Key Laboratory of Nuclear Radiation and Nuclear Energy Technology, Chinese Academy of Sciences, Shanghai (China); Liu, Hsin-Kuan [Department of Chemistry, National Central University, Jhongli (China); Albrecht-Schmitt, Thomas E. [Department of Chemistry and Biochemistry, Florida State University, Tallahassee, FL (United States)
2016-08-16
It is shown that U{sup V}O{sub 2}{sup +} ions can reside at U{sup VI}O{sub 2}{sup 2+} lattice sites during mild reduction and crystallization process under solvothermal conditions, yielding a complicated and rare mixed-valent uranium phosphonate compound that simultaneously contains U{sup IV}, U{sup V}, and U{sup VI}. The presence of uranium with three oxidation states was confirmed by various characterization techniques, including X-ray crystallography, X-ray photoelectron, electron paramagnetic resonance, FTIR, UV/Vis-NIR absorption, and synchrotron radiation X-ray absorption spectroscopy, and magnetism measurements. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Stopping powers of havar for 1.6, 2.3 and 3.2 MeV/u heavy ions
Energy Technology Data Exchange (ETDEWEB)
Alanko, T. E-mail: tommi.alanko@phys.jyu.fi; Hyvoenen, J.; Kylloenen, V.; Raeisaenen, J.; Virtanen, A
2000-03-01
Stopping powers of havar for {sup 28,30}Si-, {sup 36}Ar-, {sup 54,56}Fe- and {sup 80,84}Kr-ions with energies of 1.6, 2.3 and 3.2 MeV/u have been determined by a transmission technique. Sample foils are exposed to the direct beams. No previous data for havar with these ions have been published. The obtained results are brought together with literature havar data for {sup 1}H-, {sup 4}He-, {sup 7}Li-, {sup 11}B-, {sup 12}C-, {sup 14}N-, {sup 16}O- and {sup 127}I-ions at the same ion velocity. The experimental data are compared with the values predicted by the SRIM-2000 parametrization using Bragg's rule. A systematic underestimation, by 6-23%, of the experimental stopping powers was observed. The empirical correction scheme of Thwaites has been applied to the stopping power values obtained by the parametrization. The corrected values agree well with the present results. Also, the effective charge values of the various ions were deduced from the experimental set of data.
5 CFR 2640.302 - Waivers issued pursuant to 18 U.S.C. 208(b)(3).
2010-01-01
... actual or potential profit or loss or cost of the matter to the company issuing the stock, the change in...) Requirements for issuing an individual waiver under 18 U.S.C. 208(b)(3). Pursuant to 18 U.S.C. 208(b)(3), an...) The type of interest that is creating the disqualification (e.g. stock, bonds, real estate, other...
Search for negative U in the Ba1-xKxBi1-yPbyO3 system using constrained density-functional theory
International Nuclear Information System (INIS)
Vielsack, G.; Weber, W.
1996-01-01
Calculations using constrained density-functional theory have been carried out for the Ba 1-x K x Bi 1-y Pb y O 3 system, using a full-potential linearized-augmented-plane-wave method and employing fcc supercell geometries with two formula units. The results have been mapped onto Hubbard-type models in order to extract values of interaction parameters U at the Bi sites. Two different mapping procedures have been utilized. The first one is the standard method, based on the comparison of total-energy curvatures. The second method, proposed in the present work, relies on the analysis of single particle energies and yields much smaller numerical errors. For BaBiO 3 interaction parameters are obtained for the following models: (i) s and p orbitals at Bi and p orbitals at O sites. Here, U s =3.1±0.4 eV, U sp =1.4±0.2 eV, U p =2.2±0.4 eV are found, (ii) s(Bi) and p(O) orbitals, yielding U s =1.9±0.7 eV, and (iii) an effective one-band model, leading to U s =0.6±0.4 eV. Further studies have been performed for breathing distorted BaBiO 3 and for various Ba 1-x K x Bi 1-y Pb y O 3 alloys using virtual crystal approximations. The resulting U values are somewhat larger than for pure BaBiO 3 . Thus, in all cases, the values of Bi U parameters are found to be positive. There is no indication of a negative U of electronic origin. copyright 1996 The American Physical Society
Recovery and recrystallization of U3Si
International Nuclear Information System (INIS)
Caillibot, P.F.; Wyatt, B.S.
1969-10-01
The recovery and recrystallization temperatures of U 3 Si were determined for an alloy of uranium-3.98 wt% silicon containing 600 ppm carbon. Small specimens, deformed by compression, were isothermally and isochronally annealed at temperatures between 350 and 700 o C and their recovery and recrystallization temperatures determined using hardness, grain size and X-ray measurements. For small amounts of strain and an annealing time of 6 hours both recovery and recrystallization begin at 400-450 o C. Complete recrystallization is achieved at 650-700 o C. The effect of small changes in silicon and carbon concentration were determined by examining two further alloys containing 3.27 wt% silicon and 600 ppm carbon, and 4.02 wt% silicon and 140 ppm carbon respectively. A small change in silicon concentration does not affect recovery and recrystallization but decreasing the carbon concentration from 600 to 140 ppm decreases the recovery and recrystallization temperatures. (author)
U.S. Korean Youth's Ideas and Experience of U.S. Education, U.S. Society, and U.S. History
An, Sohyun
2009-01-01
Drawing on and conversing with the large body of research and literature on young people's historical understanding, Asian American education, transnational migration, and Korean American studies, this dissertation research explored contemporary U.S. Korean youth's ideas and experiences of U.S. education, U.S. society and U.S. history.…
International Nuclear Information System (INIS)
Souza, Francisca de
2006-01-01
Activity concentrations of ( 234 U) and ( 238 U) were determined in groundwaters drawn from three deep wells drilled in rocks from Itu Intrusive Suite (SP), two located in Salto town (S and SY wells) and the other one in Itu (I well). Sampling was done from September, 2004 to December, 2005, and twelve samples of each well were collected monthly. For those determinations alpha spectrometry technique was used, providing high precision results, as shown by the very good agreement of the data obtained in the analyses of 23 duplicates. The waters from the three wells presented a considerable enrichment of 234 U in relation to 238 U, indicating an important radioactive disequilibrium of these isotopes. In well I, the activity concentrations of ( 238 U) varied from (1,06 +- 0,03) to (2,1+- 0,2) mBq/L and those of ( 234 U) spanned from (3,1 +- 0,2) to (6,0 +- 0,4) mBq/L, whereas ( 234 U/ 238 U) activity ratios did not present significant variation, during the sampling time interval, presenting an average of 2,8 +- 0,1. The S waters showed the lowest uranium concentrations and the largest diversity of ( 238 U) and ( 234 U) activity concentrations, which varied from (0,26 +- 0,02) to (1,07+- 0,08) mBq/L and from (1,8 +- 0,1) to (7,0 +- 0,5) mBq/L, respectively, and also presented variable ( 234 U/ 238 U) activity ratios, spanning from (2,79 +- 0,07) to (8,1+- 0,3). In SY well, ( 238 U) activities varied between (0,8 +- 0,1) and (4,2 +- 0,3) mBq/L and those ones of ( 234 U) from (14 +- 1) to (53 +- 4) mBq/L, whereas ( 234 U/ 238 U) ratios fell in the interval from 12,6 +- 0,3 to 18,3 +- 0,4, with the highest activities of both radioisotopes registered during the dry season and the lowest ones in the rainy time period. The ( 234 U/ 238 U) activity ratios, which were invariable during sampling period of well I, indicated the contribution of rainfall to recharge the aquifer. The observed correlation between those ratios and uranium concentrations, for S and SY wells, showed
Energy Technology Data Exchange (ETDEWEB)
Radtke, M; Boberg, M; Pleiss, U [Inst. of Pharmacokinetics, Bayer AG, Wuppertal (Germany); Rosentreter, U [Pharma Production, Bayer AG. Wuppertal (Germany)
1994-12-01
The title compound [{sup 14}C]BAY u 3405 (1) was synthesized as part of 8-step sequence. Starting from [U-{sup 14}C]aniline hydrogensulfate the final product 1 was obtained with a specific activity of 741 MBq/mmol (20 mCi/mmol) and a radiochemical purity of > 98 % in an overall yield of 6 and 10 % depending on the method. (author).
Study on Utilization of Super Grade Plutonium in Molten Salt Reactor FUJI-U3 using CITATION Code
Wulandari, Cici; Waris, Abdul; Pramuditya, Syeilendra; Asril, Pramutadi AM; Novitrian
2017-07-01
FUJI-U3 type of Molten Salt Reactor (MSR) has a unique design since it consists of three core regions in order to avoid the replacement of graphite as moderator. MSR uses floride as a nuclear fuel salt with the most popular chemical composition is LiF-BeF2-ThF4-233UF4. ThF4 and 233UF4 are the fertile and fissile materials, respectively. On the other hand, LiF and BeF2 working as both fuel and heat transfer medium. In this study, the super grade plutonium will be utilized as substitution of 233U since plutonium is easier to be obtained compared to 233U as main fuel. Neutronics calculation was performed by using PIJ and CITATION modules of SRAC 2002 code with JENDL 3.2 as nuclear data library.
Structure and dynamics of molecular complex He2*(a3Σu+) in condensed phases of helium
International Nuclear Information System (INIS)
Kafanov, S.G.; Parshin, A.Ya.; Tadoshchenko, I.A.
2000-01-01
The absorption spectra of the helium triplet metastable molecules in the a 3 Σ u + states in the liquid 4 He and 3 He by various pressures and in the 3 He dense gas are studied. The analysis of the spectrum, corresponding to the a 3 Σ u + → c 3 Σ g + transition, proves the conclusion on the availability of a microscopic bubble, surrounding the molecule in the liquid helium. Simple approximation of the wave function of the molecule valent electron is proposed and the bubble parameters under various experimental conditions are determined. The coefficient conditions are determined. The coefficient of the molecular recombination in the liquid 3 He and 4 He by different pressures and in the 3 He cold gas is experimentally determined. The obtained results agree well with the mutual recombination theory. It is shown, that molecular polarization in the helium condensed phases under the magnetic field effect does not lead to their mutual recombination [ru
Fuel elements based on U3O8 dispersions in aluminium
International Nuclear Information System (INIS)
Haydt, H.M.
1990-01-01
A review of the Nuclear Metallurgy Division, now Nuclear and Energetic Research Institute, to the national Know-how development of fuel elements fabrication from U 3 O 8 dispersions in aluminium, during 1962 to 1977, are described. (C.G.C.)
Energy Technology Data Exchange (ETDEWEB)
Cao, Lei; Lei, Hui; Chang, Ming-Ze; Liu, Zhi-Qin [Department of Neurological Disease, Xi' an Central Hospital, Xi' an Jiaotong University, Xi' an, Shaanxi 710000 (China); Bie, Xiao-Hua, E-mail: biexiaohua_xjtu@126.com [Department of Functional Neurosurgery, Xi' an Red Cross Hospital, Xi' an Jiaotong University, Xi' an, Shaanxi 710054 (China)
2015-07-10
We previously identified 14-3-3β as a tumor-specific isoform of 14-3-3 protein in astrocytoma, but its functional role in glioma cells and underlying mechanisms are poorly understood. In the present study, we investigated the effects of 14-3-3β inhibition in human glioma U87 cells using specific targeted small interfering RNA (siRNA). The results showed that 14-3-3β is highly expressed in U87 cells but not in normal astrocyte SVGp12 cells. Knockdown of 14-3-3β by Si-14-3-3β transfection significantly decreased the cell viability but increased the LDH release in a time-dependent fashion in U87 cells, and these effects were accompanied with G0/G1 cell cycle arrest and apoptosis. In addition, 14-3-3β knockdown induced ER stress in U87 cells, as evidenced by ER calcium release, increased expression of XBP1S mRNA and induction of ER related pro-apoptotic factors. Down-regulation of 14-3-3β significantly decreased the nuclear localization of β-catenin and inhibited Topflash activity, which was shown to be reversely correlated with CHOP. Furthermore, Si-CHOP and sFRP were used to inhibit CHOP and Wnt, respectively. The results showed that the anti-cancer effects of 14-3-3β knockdown in U87 cells were mediated by increased expression of CHOP and followed inhibition of Wnt/β-catenin pathway. In summary, the remarkable efficiency of 14-3-3β knockdown to induce apoptotic cell death in U87 cells may find therapeutic application for the treatment of glioma patients. - Highlights: • Knockdown of 14-3-3β leads to cytotoxicity in human glioma U87 cells. • Knockdown of 14-3-3β induces cell cycle arrest and apoptosis in U87 cells. • Knockdown of 14-3-3β results in ER stress in U87 cells. • Knockdown of 14-3-3β inhibits Wnt/β-catenin pathway via CHOP activation.
International Nuclear Information System (INIS)
Cao, Lei; Lei, Hui; Chang, Ming-Ze; Liu, Zhi-Qin; Bie, Xiao-Hua
2015-01-01
We previously identified 14-3-3β as a tumor-specific isoform of 14-3-3 protein in astrocytoma, but its functional role in glioma cells and underlying mechanisms are poorly understood. In the present study, we investigated the effects of 14-3-3β inhibition in human glioma U87 cells using specific targeted small interfering RNA (siRNA). The results showed that 14-3-3β is highly expressed in U87 cells but not in normal astrocyte SVGp12 cells. Knockdown of 14-3-3β by Si-14-3-3β transfection significantly decreased the cell viability but increased the LDH release in a time-dependent fashion in U87 cells, and these effects were accompanied with G0/G1 cell cycle arrest and apoptosis. In addition, 14-3-3β knockdown induced ER stress in U87 cells, as evidenced by ER calcium release, increased expression of XBP1S mRNA and induction of ER related pro-apoptotic factors. Down-regulation of 14-3-3β significantly decreased the nuclear localization of β-catenin and inhibited Topflash activity, which was shown to be reversely correlated with CHOP. Furthermore, Si-CHOP and sFRP were used to inhibit CHOP and Wnt, respectively. The results showed that the anti-cancer effects of 14-3-3β knockdown in U87 cells were mediated by increased expression of CHOP and followed inhibition of Wnt/β-catenin pathway. In summary, the remarkable efficiency of 14-3-3β knockdown to induce apoptotic cell death in U87 cells may find therapeutic application for the treatment of glioma patients. - Highlights: • Knockdown of 14-3-3β leads to cytotoxicity in human glioma U87 cells. • Knockdown of 14-3-3β induces cell cycle arrest and apoptosis in U87 cells. • Knockdown of 14-3-3β results in ER stress in U87 cells. • Knockdown of 14-3-3β inhibits Wnt/β-catenin pathway via CHOP activation
Energy Technology Data Exchange (ETDEWEB)
Komar Varela, Carolina; Arico, Sergio; Mirandou, Marcela; Balart, Silvia; Gribaudo, Luis [Comision Nacional de Energia Atomica, General San Martin (Argentina). Dept. de Materiales; com, carolinakomar@gmail
2007-07-01
Out-of-pile diffusion experiments were performed between U-7 wt.% Mo-1 wt.% Zr and Al or Al A356 (7,1 wt.% Si) at 550 C degrees. In this work morphological characterization and phase identification on both interaction layers are presented. They were carried out by the use of different techniques: optical and scanning electron microscopy, X-ray diffraction and WDS microanalysis. In the interaction layer U-7 wt.% Mo-1 wt.% Zr/Al, the phases UAl{sub 3}, UAl{sub 4}, Al{sub 20}Mo{sub 2}U and Al{sub 43}Mo{sub 4}U{sub 6} were identified. Similar results in the interaction layer of the U-7 % Mo/Al at 580 C degrees were previously obtained. In the interaction layer U-7 wt.% Mo-1 wt.% Zr/Al A356, the phases U(Al,Si){sub 3} with 25 at.% Si and Si{sub 5}U{sub 3} were identified. This last phase, with a higher Si concentration, was identified with X-ray diffraction synchrotron radiation performed at the National Synchrotron Light Laboratory, Campinas, Brazil. (author) [Spanish] Se realizaron experiencias fuera de reactor en pares de difusion quimica U-7 % Mo-1 % Zr/Al y U-7 % Mo-1 % Zr/Al A356. En este trabajo se presentan los resultados de la caracterizacion morfologica e identificacion de fases presentes en la zona de interaccion que se forma al ser sometidos a un tratamiento isotermico de 1,5 h a 550 grados C. Las tecnicas utilizadas fueron: microscopia optica y electronica de barrido, difraccion de rayos X y microanalisis cuantitativo por sonda electronica. En la zona de interaccion correspondiente al par U-7 % Mo-1 % Zr/Al se identificaron las fases UAl{sub 3}, UAl{sub 4}, Al{sub 20}Mo{sub 2}U y Al{sub 43}Mo{sub 4}U{sub 6}. Estas cuatro fases fueron identificadas en pares U-7 % Mo/Al a 580 grados C en trabajos anteriores. En la zona de interaccion correspondiente al par U-7 % Mo-1 % Zr/Al A356 se identificaron las fases U(Al,Si){sub 3} (con una concentracion de 25 %at.Si) y Si{sub 5}U{sub 3}. Este compuesto rico en Si solo pudo ser identificado mediante la utilizacion de
Superconductivity and spin fluctuations in the actinoid-platinum metal borides {Th, U}Pt3 B
Czech Academy of Sciences Publication Activity Database
Bauer, E.; Royanian, E.; Michor, H.; Sologub, O.; Scheidt, E.-W.; Goncalves, A.P.; Buršík, Jiří; Wolf, W.; Reith, D.; Blass-Schenner, C.; Moser, R.; Podloucky, R.; Rogl, P.
2015-01-01
Roč. 92, č. 2 (2015), Art. num. 024511 ISSN 1098-0121 Institutional support: RVO:68081723 Keywords : {Th, U}Pt3 B * x-ray diffraction * TEM Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.736, year: 2014
Study on the irradiation swelling of U3Si2-Al dispersion fuel
International Nuclear Information System (INIS)
Xing Zhonghu; Ying Shihao
2001-01-01
The dominant modeling mechanisms on irradiation swelling of U 3 Si 2 -Al dispersion fuel are introduced. The core of dispersion fuel is looked to as micro-fuel elements of continuous matrix. The formation processes of gas bubbles in the fuel phase are described through the behavior mechanisms of fission gases. The swelling in the fuel phase causes the interaction between fuel particles and metal matrix, and the metal matrix can restrain the irradiation swelling of fuel particles. The developed code can predict irradiation-swelling values according to the parameters of fuel elements and irradiation conditions, and the predicted values are in agreement with the measured results
U(IV) chalcogenolates synthesized via oxidation of uranium metal by dichalcogenides.
Gaunt, Andrew J; Scott, Brian L; Neu, Mary P
2006-09-04
Treatment of uranium metal with dichalcogenides in the presence of a catalytic amount of iodine in pyridine affords molecular U(IV) chalcogenolates that do not require stabilizing ancillary ligands. Oxidation of U(0) by PhEEPh yields monomeric seven-coordinate U(EPh)4(py)3 (E = S(1), Se(2)). The dimeric eight-coordinate complexes [U(EPh)2(mu2-EPh)2(CH3CN)2]2 (E = S(3), Se(4)) are obtained by crystallization from solutions of 1 and 2 dissolved in acetonitrile. Oxidation of U(0) by pySSpy and crystallization from thf yields nine-coordinate U(Spy)4(thf) (5). Incorporation of elemental selenium into the oxidation of U(0) by PhSeSePh results in the isolation of [U(py)2(SePh)(mu3-Se)(mu2-SePh)]4.4py (6), a tetrameric cluster in which each U(IV) ion is eight-coordinate and the U4Se4 core forms a distorted cube. The compounds were analyzed spectroscopically and the single-crystal X-ray structures of 1 and 3-6 were determined. The isolation of 1-6 represents six new examples of actinide chalcogenolates and allows insight into the nature of "hard" actinide ion-"soft" chalcogen donor interactions.
Directory of Open Access Journals (Sweden)
Jie Ma
Full Text Available It is known that βig-h3 is involved in the invasive process of many types of tumors, but its mechanism in glioma cells has not been fully clarified. Using immunofluorescent double-staining and confocal imaging analysis, and co-immunoprecipitation assays, we found that βig-h3 co-localized with integrin α5β1 in U87 cells. We sought to elucidate the function of this interaction by performing cell invasion assays and gelatin zymography experiments. We found that siRNA knockdowns of βig-h3 and calpain-2 impaired cell invasion and MMP secretion. Moreover, βig-h3, integrins and calpain-2 are known to be regulated by Ca(2+, and they are also involved in tumor cell invasion. Therefore, we further investigated if calpain-2 was relevant to βig-h3-integrin α5β1 interaction to affect U87 cell invasion. Our data showed that βig-h3 co-localized with integrin α5β1 to enhance the invasion of U87 cells, and that calpain-2, is involved in this process, acting as a downstream molecule.
The Accident Analysis Due to Reactivity Insertion of RSG GAS 3.55 g U/cc Silicide Core
International Nuclear Information System (INIS)
Endiah Puji-Hastuti; Surbakti, Tukiran
2004-01-01
The fuels of RSG-GAS reactor was changed from uranium oxide with 250 g U of loading or 2.96 g U/cc of fuel loading to uranium silicide with the same loading. The silicide fuels can be used in higher density, staying longer in the reactor core and hence having a longer cycle length. The silicide fuel in RSG-GAS core was made up in step-wise by using mixed up core Firstly, it was used silicide fuel with 250 g U of loading and then, silicide fuel with 300 g U of loading (3.55 g U/cc of fuel loading). In every step-wise of fuel loading, it must be analyzed its safety margin. In this occasion, the reactivity accident of RSG-GAS core with 300 g U of silicide fuel loading is analyzed. The calculation was done using EUREKA-2/RR code available at P2TRR. The calculation was done by reactivity insertion at start up and power rangers. The worst case accident is transient due to control rod with drawl failure at start up by means of lowest initial power (0.1 W), either in power range. From all cases which have been done, the results of analysis showed that there is no anomaly and safety margin break at RSG-GAS core with 300 g U silicide fuel loading. (author)
International Nuclear Information System (INIS)
Bretscher, M.M.; Deen, J.R.; Hanan, N.A.; Matos, E.
2000-01-01
U-Mo alloys dispersed in an Al matrix offer the potential for high-density uranium fuels needed for the LEU conversion of many research reactors. On-going fuel qualification tests by the US RERTR Program show good irradiation properties of U-Mo alloy dispersion fuel containing 7-10 weight percent molybdenum. For the neutronic studies in this paper the alloy was assumed to contain 9 wt % Mo (U-9Mo) with a uranium density in the fuel meat of 5.00 gU/cm 3 which corresponds to 32.5 volume % U-9Mo. Fuels containing U-9Mo have been used in Russian reactors since the 1950's. For the three research reactors analyzed here, LEU fuel element thicknesses are the same as those for the Russian-fabricated HEU reference fuel elements. Relative to the reference fuels containing 80-90% enriched uranium, LEU U-9Mo Al-dispersion fuel with 5.00 gU/cm 3 doubles the cycle length of the MARIA reactor and increases the IR-8 cycle length by about 11%. For the WWR-SM reactor, the cycle length, and thus the number of fuel assemblies used per year, is nearly unchanged. To match the cycle length of the 36% enriched fuel currently used in the WWR-SM reactor will require a uranium density in the LEU U-9Mo Al-dispersion fuel of about 5.4 gU/cm 3 . The 5.00 gU/cm 3 LEU fuel causes thermal neutron fluxes in water holes near the edge of the core to decrease by (6-8)% for all three reactors. (author)
Mass spectrometric 230Th-234U-238U dating of the Devils Hole calcite vein
International Nuclear Information System (INIS)
Ludwig, K.R.; Simmons, K.R.; Szabo, B.J.; Riggs, A.C.; Winograd, I.J.; Landwehr, J.M.; Hoffman, R.J.
1992-01-01
The Devils Hole calcite vein contains a long-term climatic record, but requires accurate chronologic control for its interpretation. Mass-spectrometric U-series ages for samples from core DH-11 yielding 230 Th ages with precisions ranging from less than 1,000 years (2σ) for samples younger than ∼140 ka (thousands of years ago) to less than 50,000 years for the oldest samples (∼566 ka). The 234 U/ 238 U ages could be determined to a precision of ∼20,000 years for all ages. Calcite accumulated continuously from 566 ka until ∼60 ka at an average rate of 0.7 millimeter per 10 3 years. The precise agreement between replicate analyses and the concordance of the 230 Th/ 238 U and 234 U/ 238 U ages for the oldest samples indicate that the DH-11 samples were closed systems and validate the dating technique in general
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Edward U Lorenz. Articles written in Resonance – Journal of Science Education. Volume 20 Issue 3 March 2015 pp 260-263 Classics. Predictability: Does the Flap of a Butterfly's Wings in Brazil Set off a Tornado in Texas? Edward U Lorenz · More Details Fulltext ...
Study of the U3O8-Al thermite reaction and strength of reactor fuel tubes
International Nuclear Information System (INIS)
Peacock, H.B.
1984-01-01
Research and test reactors are presently operated with aluminum-clad fuel elements containing highly enriched uranium-aluminum alloy cores. To lower the enrichment and still maintain reactivity, the uranium content of the fuel element will need to be higher than currently achievable with alloy fuels. This will necessitate conversion to other forms such as U 3 O 8 -aluminum cermets. Above the aluminum melting point, U 3 O 8 and aluminum undergo an exothermic thermite reaction and cermet fuel cores tend to keep their original shape. Both factors could affect the course and consequences of a reactor accident, and therefore prompted an investigation of the behavior of cermet fuels at elevated temperatures. Tests were carried out using pellets and extruded tube sections with 53 wt % U 3 O 8 in aluminum. This content corresponds to a theoretical uranium density of 1.9 g/cc. Results indicate that the thermite reaction occurs at about 900 0 C in air without a violent effect. The heat of reaction was approximately 123 cal/g of U 3 O 8 -aluminum fuel. Tensile and compressive strength of the fuel tube section is low above 660 0 C. In tension, sections failed at about the aluminum melting point. In compression with 2 psi average axial stress, failure occurred at 917 0 C, while 7 psi average axial stress produced failure at 669 0 C. (author)
Study of the U3O8-Al thermite reaction and strength of reactor fuel tubes
International Nuclear Information System (INIS)
Peacock, H.B.
1983-01-01
Research and test reactors are presently operated with aluminum-clad fuel elements containing highly enriched uranium-aluminum alloy cores. To lower the enrichment and still maintain reactivity, the uranium content of the fuel element will need to be higher than currently achievable with alloy fuels. This will necessitate conversion to other forms such as U 3 O 8 -aluminum cermets. Above the aluminum melting point, U 3 O 8 and aluminum undergo an exothermic thermite reaction and cermet fuel cores tend to keep their original shape. Both factors could affect the course and consequences of a reactor accident, and prompted an investigation of the behavior of cermet fuels at elevated temperatures. Tests were carried out using pellets and extruded tube-sections with 53 wt % U 3 O 8 in aluminum. This content corresponds to a theoretical uranium density of 1.9 g/cc. Results indicate that the thermite reaction occurs at about 900 0 C in air without a violent effect. The heat of reaction was approximately 123 cal/g of U 3 O 8 -aluminum fuel. Tensile and compressive strength of the fuel tube section is low above 660 0 C. In tension, sections failed at about the aluminum melting point. In compression with 2-psi average axial stress, failure occurred at 917 0 C, while 7 psi average axial stress produced failure at 669 0 C
Cvetic, Mirjam; Piragua, Hernan; Taylor, Washington
2015-01-01
We construct the general form of an F-theory compactification with two U(1) factors based on a general elliptically fibered Calabi-Yau manifold with Mordell-Weil group of rank two. This construction produces broad classes of models with diverse matter spectra, including many that are not realized in earlier F-theory constructions with U(1)xU(1) gauge symmetry. Generic U(1)xU(1) models can be related to a Higgsed non-Abelian model with gauge group SU(2)xSU(2)xSU(3), SU(2)^3xSU(3), or a subgroup thereof. The nonlocal horizontal divisors of the Mordell-Weil group are replaced with local vertical divisors associated with the Cartan generators of non-Abelian gauge groups from Kodaira singularities. We give a global resolution of codimension two singularities of the Abelian model; we identify the full anomaly free matter content, and match it to the unHiggsed non-Abelian model. The non-Abelian Weierstrass model exhibits a new algebraic description of the singularities in the fibration that results in the first expl...
Non stoichiometry in U3O(8±x), its temperature and oxygen pressure dependence
International Nuclear Information System (INIS)
Rodriguez De Sastre, M.S.; Philippot, J.; Moreau, C.
1967-01-01
The deviation from stoichiometry in uranium oxide U 3 O 8 obtained by oxidation of UO 2 , has been studied with respect to its dependence on temperature and oxygen pressure. It is shown that the ratio r = O/U increases with oxygen pressure up to 200 mm Hg at any temperature. At higher pressures, this ratio tends toward a limit which decreases with increasing temperatures. The curve r = f(P) suggest a chemisorption phenomenon as the reaction limiting mechanism. (authors) [fr
Energy Technology Data Exchange (ETDEWEB)
Singh, G., E-mail: gitendars@barctara.gov.in [Advanced Fuel Fabrication Facility (AFFF), Bhabha Atomic Research Centre, Tarapur, 401 502 (India); Kumar, Pradeep [Integrated Fuel Fabrication Facility, Bhabha Atomic Research Centre, Mumbai, 400 085 (India); Aher, S.; Purohit, P.; Khot, P.M. [Advanced Fuel Fabrication Facility (AFFF), Bhabha Atomic Research Centre, Tarapur, 401 502 (India); Prakash, Amrit [Radio-Metallurgy Division, Bhabha Atomic Research Centre, Mumbai, 400 085 (India); Das, D.K.; Behere, P.G.; Afzal, Mohd [Advanced Fuel Fabrication Facility (AFFF), Bhabha Atomic Research Centre, Tarapur, 401 502 (India)
2016-10-15
We report a process for stoichiometric reduction of U{sub 3}O{sub 8} and (U{sub 3}O{sub 8},PuO{sub 2}) mixed oxide powders using an indigenously developed 2.4 GHz microwave processing system. The process parameters were optimized by interpreting reduction kinetic curves at a temperature which is 150 °C lower than the conventional reduction. The process improved the sinterability of the powder which was evaluated in terms of average particle size, BET specific surface area and bulk density. A quick method for controlled oxidation of the reduced powder to incorporate a controlled amount of hyper-stoichiometry was demonstrated by modifying the same reduction process. The percent reduction was measured experimentally using O:(U + Pu) ratio. The X-ray diffraction analysis confirmed the various phases present. The process is novel considering shorter processing cycle, lower temperature processing, improved powder properties, energy efficiency and cost effectiveness. - Highlights: • A process for stoichiometric reduction of (U{sub 3}O{sub 8},PuO{sub 2}) was demonstrated using 2.4 GHz microwave. • A simple and quick method for obtaining controlled hyper-stoichiometry in the reduced powder was successfully demonstrated. • The process is novel relative to conventional methods in terms of time and energy economy and sinter-activity.
Enzymatic U(VI) reduction by Desulfosporosinus species
International Nuclear Information System (INIS)
Suzuki, Y.; Kelly, S.D.; Kemner, K.M.; Banfield, J.F.
2004-01-01
Here we tested U(VI) reduction by a Desulfosporosinus species (sp.) isolate and type strain (DSM 765) in cell suspensions (pH 7) containing 1 mM U(VI) and lactate, under an atmosphere containing N 2 -CO 2 -H 2 (90: 5: 5). Although neither Desulfosporosinus species (spp.) reduced U(VI) in cell suspensions with 0.25% Na-bicarbonate or 0.85% NaCl, U(VI) was reduced in these solutions by a control strain, desulfovibrio desulfuricans (ATCC 642). However, both Desulfosporosinus strains reduced U(VI) in cell suspensions depleted in bicarbonate and NaCl. No U(VI) reduction was observed without lactate and H 2 electron donors or with heat-killed cells, indicating enzymatic U(VI) reduction. Uranium(VI) reduction by both strains was inhibited when 1 mM CuCl 2 was added to the cell suspensions. Because the Desulfosporosinus DSM 765 does not contain cytochrome c 3 used by Desulfovibrio spp. to reduce U(VI), Desulfosporosinus species reduce uranium via a different enzymatic pathway. (orig.)
Yeon, Jeongho; Smith, Mark D.; Tapp, Joshua; Möller, Angela; zur Loye, Hans-Conrad
2016-04-01
Two new uranium(IV) fluorides, Na3.13Mg1.43U6F30 (1) and Na2.50Mn1.75U6F30 (2), were synthesized through an in situ mild hydrothermal route, and were structurally characterized by single crystal X-ray diffraction. The compounds exhibit complex crystal structures composed of corner- or edge-shared UF9 and MF6 (M=Mg, Mn) polyhedra, forming hexagonal channels in the three-dimensional framework, in which ordered or disordered divalent metal and sodium atoms reside. The large hexagonal voids contain the nearly regular M(II)F6 octahedra and sodium ions, whereas the small hexagonal cavities include M(II) and sodium ions on a mixed-occupied site. Magnetic susceptibility measurements yielded effective magnetic moments of 8.36 and 11.6 μB for 1 and 2, respectively, confirming the presence and oxidation states of U(IV) and Mn(II). The large negative Weiss constants indicate the spin gap between a triplet and a singlet state in the U(IV). Magnetization data as a function of applied fields revealed that 2 exhibits paramagnetic behavior due to the nonmagnetic singlet ground state of U(IV) at low temperature. UV-vis diffuse reflectance and X-ray photoelectron spectroscopy data were also analyzed.
International Nuclear Information System (INIS)
Thomas, J.T.
1984-10-01
The KENO-Va improved Monte Carlo criticality program is used to calculate the neutron multiplication factor for TMI-U2 fuel compositions in a variety of configurations and to display parametric regions giving rise to maximum reactivity contributions. The lattice pitch of UO 2 fuel pins producing a maximum k/sub eff/ is determined as a function of boron concentrations in the coolant for infinite and finite systems. The characteristics of U 3 O 8 -coolant mixtures of interest to modeling the rubble region of the core are presented. Several disrupted core configurations are calculated and comparisons made. The results should be useful to proposed defueling of the TMI-U2 reactor
Energy Technology Data Exchange (ETDEWEB)
Gao Liang; Sun Jizhong; Feng Chunlei; Bai Jing; Ding Hongbin [School of Physics and Optical Electronic Technology, Key Laboratory of Materials Modification by Laser, Ion, and Electron Beams, Chinese Ministry of Education, Dalian University of Technology, Dalian 116024 (China)
2012-01-15
A particle-in-cell plus Monte Carlo collisions method has been employed to investigate the nitrogen discharge driven by a nanosecond pulse power source. To assess whether the production of the metastable state N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) can be efficiently enhanced in a nanosecond pulsed discharge, the evolutions of metastable state N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) density and electron energy distribution function have been examined in detail. The simulation results indicate that the ultra short pulse can modulate the electron energy effectively: during the early pulse-on time, high energy electrons give rise to quick electron avalanche and rapid growth of the metastable state N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) density. It is estimated that for a single pulse with amplitude of -9 kV and pulse width 30 ns, the metastable state N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) density can achieve a value in the order of 10{sup 9} cm{sup -3}. The N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) density at such a value could be easily detected by laser-based experimental methods.
U-Mo/Al-Si interaction: Influence of Si concentration
International Nuclear Information System (INIS)
Allenou, J.; Palancher, H.; Iltis, X.; Cornen, M.; Tougait, O.; Tucoulou, R.; Welcomme, E.; Martin, Ph.; Valot, C.; Charollais, F.; Anselmet, M.C.; Lemoine, P.
2010-01-01
Within the framework of the development of low enriched nuclear fuels for research reactors, U-Mo/Al is the most promising option that has however to be optimised. Indeed at the U-Mo/Al interfaces between U-Mo particles and the Al matrix, an interaction layer grows under irradiation inducing an unacceptable fuel swelling. Adding silicon in limited content into the Al matrix has clearly improved the in-pile fuel behaviour. This breakthrough is attributed to an U-Mo/Al-Si protective layer around U-Mo particles appeared during fuel manufacturing. In this work, the evolution of the microstructure and composition of this protective layer with increasing Si concentrations in the Al matrix has been investigated. Conclusions are based on the characterization at the micrometer scale (X-ray diffraction and energy dispersive spectroscopy) of U-Mo7/Al-Si diffusion couples obtained by thermal annealing at 450 deg. C. Two types of interaction layers have been evidenced depending on the Si content in the Al-Si alloy: the threshold value is found at about 5 wt.% but obviously evolves with temperature. It has been shown that for Si concentrations ranging from 2 to 10 wt.%, the U-Mo7/Al-Si interaction is bi-layered and the Si-rich part is located close to the Al-Si for low Si concentrations (below 5 wt.%) and close to the U-Mo for higher Si concentrations. For Si weight fraction in the Al alloy lower than 5 wt.%, the Si-rich sub-layer (close to Al-Si) consists of U(Al, Si) 3 + UMo 2 Al 20 , when the other sub-layer (close to U-Mo) is silicon free and made of UAl 3 and U 6 Mo 4 Al 43 . For Si weight concentrations above 5 wt.%, the Si-rich part becomes U 3 (Si, Al) 5 + U(Al, Si) 3 (close to U-Mo) and the other sub-layer (close to Al-Si) consists of U(Al, Si) 3 + UMo 2 Al 20 . On the basis of these results and of a literature survey, a scheme is proposed to explain the formation of different types of ILs between U-Mo and Al-Si alloys (i.e. different protective layers).
U.S. Economic Assistance to Colombia: A Model for U.S. Economic Assistance to Mexico?
2013-12-01
chronologically and territorially speaking); with Plan Colombia (2000– 2006) as the major program for U.S.-Colombia relations and the Merida Initiative...Ecuador 24.3 19.8 21.3 Peru 96.6 83.6 73.7 Venezuela 5.0 5.0 3.0 Total 621.0 519.7 452.0 Table 2. U.S. assistance to the Andean Region, FY2011–FY2013...Office of National Drug Control (ONDC) policy, Colombia’s potential cocaine production capabilities have once again fallen below those of Peru and
Energy Technology Data Exchange (ETDEWEB)
Lu, Erli; Tuna, Floriana; Kaltsoyannis, Nikolas; Liddle, Stephen T. [School of Chemistry, The University of Manchester (United Kingdom); Lewis, William [School of Chemistry, The University of Nottingham (United Kingdom)
2016-08-08
We report uranium(IV)-carbene-imido-amide metalla-allene complexes [U(BIPM{sup TMS})(NCPh{sub 3})(NHCPh{sub 3})(M)] (BIPM{sup TMS}=C(PPh{sub 2}NSiMe{sub 3}){sub 2}; M=Li or K) that can be described as R{sub 2}C=U=NR' push-pull metalla-allene units, as organometallic counterparts of the well-known push-pull organic allenes. The solid-state structures reveal that the R{sub 2}C=U=NR' units adopt highly unusual cis-arrangements, which are also reproduced by gas-phase theoretical studies conducted without the alkali metals to remove their potential structure-directing roles. Computational studies confirm the double-bond nature of the U=NR' and U=CR{sub 2} interactions, the latter increasingly attenuated by potassium then lithium when compared to the hypothetical alkali-metal-free anion. Combined experimental and theoretical data show that the push-pull effect induced by the alkali metal cations and amide auxiliary gives a fundamental and tunable structural influence over the C=U{sup IV}=N units. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Dicty_cDB: Contig-U04768-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U04768-1 no gap 762 6 2607190 2606476 MINUS 3 3 U04768 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U04768-1 Contig ID Contig-U04768-1 Contig update 2001. 8.29 Contig sequence >Contig-U04768-1 (Contig...-U04768-1Q) /CSM_Contig/Contig-U04768-1Q.Seq.d AAAGTCTTATTTGTTTAAAAAAAAAAAAAAAAAATAAAAAACTTTATTCT...AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Gap no gap Contig length 762 Chromosome number (1..6, M...lknf*KMVMMHDEYISPTKLQFGFMIAVAFLG TIGVMGFCQNVFDILLGVISILSIYIGMRGVWKRKKRWLFVFMWLMMGMGFLHLVSFAVV VILHHKNPTKNTVF
Dicty_cDB: Contig-U12765-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA
The use of Taka-diastase in a [3H]poly(A) hybridization assay of oligo(U) sequences in RNA
International Nuclear Information System (INIS)
De Herdt, E.; Kondo, M.; Slegers, H.
1981-01-01
A reliable assay for uridylate sequences longer than 10 is described. The procedure is based on the hybridization of [ 3 H]poly(A) with poly(U) or oligo(U) sequences in high ionic conditions and a subsequent degradation of single stranded polynucleotides with purified Taka-diastase. A 1:2 complex between poly(A) and poly(U) is formed on which one poly(U) strand is digested by Taka-diastase. The procedure is especially suitable for the detection and quantitation of Usub(n) (n > 10) in RNA preparations. (Auth.)
Geology of the U12n.07 UG-3 drill hole, area 12, Nevada Test Site
International Nuclear Information System (INIS)
Terry, S.S.; Cunningham, M.J.
1975-11-01
The U12n.07 UG-3 horizontal drill hole, located near the eastern edge of the center of Rainier Mesa, Nevada Test Site, was drilled to a total depth of 809 m (2,653 ft). This hole was drilled to further evaluate the tunnel-level stratigraph, and structure southwest of the U12n tunnel complex. The drill hole is collared in the middle of Tertiary tunnel bed 3A and penetrates upsection through tunnel beds 3 and 4 and terminates in subunit 4K, all of Tertiary age. Stratigraphy, structure, engineering geology, and physical properties and their relation to tunnel engineering are discussed
International Nuclear Information System (INIS)
Piyakis, K.N.; Gagne, J.
1989-01-01
An efficient method of identifying 235 U III (in natural-U samples), with the help of the optogalvanic effect in a hollow-cathode discharge, is presented. The use of this method enabled us to carry out the measurement of isotope shifts and the preliminary investigation of hyperfine structures of U III. The 238 U-- 235 U shifts for the 591.313-, 586.045-, and 610.497-nm U III lines are found to be 921(3), 417(6), and 392(12) mK, respectively
International Nuclear Information System (INIS)
Ortiz, J.V.; Hay, P.J.; Martin, R.L.
1992-01-01
While organoactinide compounds are traditionally characterized by high oxidation states and coordination numbers, the synthesis, chemistry, and electronic properties of low-valent actinide complexes have been receiving greater attention in recent years. Specific examples of complexes in the AnL family are represented by U[N(SiMe 3 ) 2 ] 3 , U[CH(SiMe 3 ) 2 ] 3 , and Np and Pu analogues, for which cases the ligands adopt a pyramidal arrangement around the actinide. In this communication, the authors report the results of one of the first studies of such low-valent complexes to be carried out using ab initio electronic structure techniques. Related molecules include lanthanide species of the form LnX 3 , which also adopt pyramidal geometries and which have been the subject of semi-empirical theoretical investigations. Transition metal MX 3 species, by contrast, can exhibit either planar or pyramidal forms, depending on the nature of the metal and the ligand. 12 refs., 1 fig., 1 tab
Directory of Open Access Journals (Sweden)
Supardjo Supardjo
2015-07-01
Full Text Available PENGARUH SERBUK U-Mo HASIL PROSES MEKANIK DAN HYDRIDE – DEHYDRIDE – GRINDING MILL TERHADAP KUALITAS PELAT ELEMEN BAKAR U-Mo/Al. Penelitian bahan bakar U-7Mo/Al tipe pelat dilakukan dalam rangka pengembangan bahan bakar U3Si2/Al untuk mendapatkan bahan bakar baru yang memiliki densitas uranium lebih tinggi, stabil selama digunakan sebagai bahan bakar di dalam reaktor dan mudah dilakukan proses olah ulangnya. Lingkup penelitian meliputi pembuatan: paduan U-7Mo dengan teknik peleburan, pembuatan serbuk U-7Mo dengan dikikir dan hydride - dehydride - grinding mill, IEB U-7Mo/Al dengan teknik kompaksi pada tekanan 20 bar, dan PEB U-7Mo/Al dengan teknik pengerolan panas pada temperatur 425oC. Paduan U-7Mo hasil proses peleburan cukup homogen, berat jenis 16,34 g/cm3 dan bersifat ulet, kemudian dibuat menjadi serbuk dengan cara dikikir dan hydride - dehydride - grinding mill. Serbuk U-7Mo hasil proses kikir berbentuk pipih, kontaminan Fe cukup tinggi, sedangkan serbuk hasil proses hydride - dehydride - grinding mill, cenderung equiaxial dengan kontaminan yang rendah. Kedua jenis serbuk U-7Mo tersebut digunakan sebagai bahan baku pembuatan IEB U-7Mo/Al dan PEB U-7Mo/Al dengan densitas uranium 7 gU/cm3 dan diperoleh produk dengan kualitas yang hampir sama. Hasil uji IEB U-7Mo/Al berukuran 25 x 15 x 3,15±0,05 mm, tidak terdapat cacat/retak, distribusi U-7Mo di dalam matriks cukup homogen dan tidak terdapat pengelompokan/aglomerasi U-7Mo yang berdimensi >1 mm. PEB U-7Mo/Al hasil pengerolan dengan tebal akhir 1,45 mm, memiliki ketebalan meat rerata 0,60 mm dan tebal kelongsong 0,4 mm dan terdapat 1 titik pengukuran kelongsong dengan ketebalan 0,15 mm. Dengan membandingkan penggunaan kedua jenis serbuk U-7Mo tersebut, IEB U-7Mo/Al dan PEB U-7Mo/Al yang dihasilkan memiliki kualitas hampir sama. Namun demikian penggunaan serbuk U- 7Mo hasil proses hydride - dehydride - grinding mill lebih baik karena proses pengerjaannya lebih cepat dan impuritas dalam
Dicty_cDB: Contig-U12086-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig
Prokopy, L. S.; Widhalm, M.
2014-12-01
There is a close connection between weather and climate patterns and successful agricultural production. Therefore, incorporating climate information into farm management is likely to reduce the risk of economic losses and increase profitability. While weather and climate information is becoming ever more abundant and accessible, the use of such information in the agricultural community remains limited. Useful to Usable (U2U): Transforming Climate Variability and Change Information for Cereal Crop Producers is a USDA-NIFA funded research and extension project focused on improving the use of climate information for agricultural production in the Midwestern United States by developing user-driven decision tools and training resources. The U2U team is a diverse and uniquely qualified group of climatologists, crop modelers, agronomists, and social scientists from 9 Midwestern universities and two NOAA Regional Climate Centers. Together, we strive to help producers make better long-term plans on what, when and where to plant and also how to manage crops for maximum yields and minimum environmental damage. To ensure relevance and usability of U2U products, our social science team is using a number of techniques including surveys and focus groups to integrate stakeholder interests, needs, and concerns into all aspects of U2U research. It is through this coupling of physical and social science disciplines that we strive to transform existing climate information into actionable knowledge.
Dicty_cDB: Contig-U09822-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS
International Nuclear Information System (INIS)
Borghoff, S.J.; Miller, A.B.; Bowen, J.P.; Swenberg, J.A.
1991-01-01
alpha 2u-Globulin (alpha 2u) has been shown to accumulate in the kidneys of male rats treated with 2,2,4-trimethylpentane (TMP). 2,4,4-Trimethyl-2-pentanol (TMP-2-OH), a metabolite of TMP, is found reversibly bound to alpha 2u isolated from the kidneys of these treated rats. The objectives of the following study were to characterize the ability of [3H]TMP-2-OH to bind to alpha 2u in vitro and to determine whether other compounds that cause this protein to accumulate have the same binding characteristics. Although compounds that have been shown to cause the accumulation of alpha 2u in male rat kidneys compete in vitro with [3H]TMP-2-OH for binding to alpha 2u, they do so to varying degrees. The binding affinity (Kd) of the [3H]TMP-2-OH-alpha 2u complex was calculated to be on the order of 10(-7) M. The inhibition constant values (Ki) determined for d-limonene, 1,4-dichlorobenzene, and 2,5-dichlorophenol were all in the range 10(-4) M, whereas the Ki values for isophorone, 2,4,4- or 2,2,4-trimethyl-1-pentanol, and d-limonene oxide were determined to be in the range 10(-6) and 10(-7) M, respectively. TMP and 2,4,4- and 2,2,4-trimethylpentanoic acid did not compete for binding. This suggests that other factors, besides binding, are involved in the accumulation of alpha 2u. In this study the ability of a chemical to bind to alpha 2u was used as a measure of biological activity to assess structure-activity relationships among the chemicals tested and known to cause the accumulation of alpha 2u. The results so far suggest that binding is dependent on both hydrophobic interactions and hydrogen bonding
Compositional characterization of sintered (U,Th)O2 pellets by EDXRF using fused bead specimens
International Nuclear Information System (INIS)
Sanjay Kumar, S.; Dhara, Sangita; Misra, N.L.; Aggarwal, S.K.
2015-01-01
Fused bead specimens were used for analyzing sintered (U,Th)O 2 pellets by Energy Dispersive X-Ray Fluorescence (EDXRF) spectrometry. The bead specimens of calibration mixtures U 3 O 8 and ThO 2 were made by fusing them in Lithium Tetraborate/Metaborate fusion mixtures using a fusion bead machine. The EDXRF spectra of these beads were used for making calibration plot for U% determination in (U+Th) amounts. Using these calibration plots and EDXRF spectra of bead of sintered (U,Th)O 2 pellets, U% in these pellets was successfully determined. (author)
Cyberinfrastructure for the collaborative development of U2U decision support tools
Directory of Open Access Journals (Sweden)
Larry L. Biehl
2017-01-01
Full Text Available This paper describes the use of cyberinfrastructure to create interactive applications as part of the Useful to Usable (U2U project. These applications transform historical climate data, knowledge, and models into decision support tools for end users such as crop farmers, university Extension educators, and other agricultural advisors. In creating a cyberinfrastructure to support the U2U project, four major challenges have been addressed: designing and developing highly usable web applications with frequent feedback, establishing a software engineering environment to support iterative development, integrating and synthesizing historical and current datasets from a variety of sources (local vs. remote, different access methods, and formats, and supporting project collaboration needs of data and document sharing, project management, and public outreach. The overall goals of the cyberinfrastructure and its architecture design are described. Methods for data retrieval and synthesis, as well as the various software components utilized are discussed. The development and integration of tools into the collaborative HUBzero framework are highlighted, including the use of HUBzero’s core features to share ideas, algorithms, and results. A highly iterative development process that includes feedback from experts and end-users to feed requirement definition, design and application updates are also examined.
Ito, Hisatoshi
2015-04-01
Guillong et al. (2015) mentioned that corrections for abundance sensitivity for 232Th and molecular zirconium sesquioxide ions (Zr2O3+) are critical for reliable determination of 230Th abundances in zircon for LA-ICP-MS analyses. There is no denying that more rigorous treatments are necessary to obtain more reliable ages than those in Ito (2014). However, as shown in Fig. 2 in Guillong et al. (2015), the uncorrected (230Th)/(238U) for reference zircons except for Mud Tank are only 5-20% higher than unity. Since U abundance of Toya Tephra zircons that have U-Pb ages Ito (2014) obtained U-Th ages of the Toya Tephra by comparison with Fish Canyon Tuff (FCT) data. Because both the FCT and the Toya Tephra have similar trends of overestimation of 230Th, the effect of overestimation of 230Th to cause overestimation of U-Th age should be cancelled out or negligible. Therefore the pivotal conclusion in Ito (2014) that simultaneous U-Pb and U-Th dating using LA-ICP-MS is possible and useful for Quaternary zircons holds true.
Voltametric determination of O:U relation in uranium oxide
International Nuclear Information System (INIS)
Carvalho, F.M.S. de; Abrao, A.
1988-07-01
Uranium oxide samples are dissolved in hot concentrated H 3 PO 4 - H 2 SO 4 mixture and the solution diluted with 1M H 2 SO 4 . One aliquot of such solution (A) is used to record the first voltamogram which gives the U(VI) content. To a second aliquot HNO 3 and H 2 O 2 is added to oxidise uranium to the hexavalent state (B) and the second voltamogram is recorded from 0.0 to 0.4 V X SCE. The O:U ratio in the original sample is calculated by the expression: O/U = 2.000 + [U (VI) soln.A/% U(VI) soln. B]. The method provides an accurate means for determining O to U ratios in high-purity uranium dioxide, fuel pellets and a variety of oxides prepared for developmental work on ceramic fuel materials. (author) [pt
Dicty_cDB: Contig-U11195-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN
Energy Technology Data Exchange (ETDEWEB)
Evarestov, R A; Panin, A I; Bandura, A V; Losev, M V [Department of Quantum Chemistry, St. Petersburg State University, University Prospect 26, Stary Peterghof, St. Petersburg, 198504 (Russian Federation)], E-mail: re1973@re1973.spb.edu
2008-06-01
The results of LCAO DFT calculations of lattice parameters, cohesive energy and bulk modulus of the crystalline uranium nitrides UN, U{sub 2}N{sub 3} and UN{sub 2} are presented and discussed. The LCAO computer codes Gaussian03 and Crystal06 are applied. The calculations are made with the uranium atom relativistic effective small core potential by Stuttgart-Cologne group (60 electrons in the core). The calculations include the U atom basis set optimization. Powell, Hooke-Jeeves, conjugated gradient and Box methods are implemented in the author's optimization package, being external to the codes for molecular and periodic calculations. The basis set optimization in LCAO calculations improves the agreement of the lattice parameter and bulk modulus of UN crystal with the experimental data, the change of the cohesive energy due to the optimization is small. The mixed metallic-covalent chemical bonding is found both in LCAO calculations of UN and U{sub 2}N{sub 3} crystals; UN{sub 2} crystal has the semiconducting nature.
2011-11-16
The U.S. Fish and Wildlife Service (FWS) and the U.S. Department of Transportation (DOT) Volpe Center (Volpe Center) conducted a regional alternative transportation evaluation (RATE) in Region 3, which is comprised of Illinois, Indiana, Iowa, Michiga...
Geochemical control on the reduction of U(VI) to mononuclear U(IV) species in lacustrine sediments
Stetten, L.; Mangeret, A.; Brest, J.; Seder-Colomina, M.; Le Pape, P.; Ikogou, M.; Zeyen, N.; Thouvenot, A.; Julien, A.; Alcalde, G.; Reyss, J. L.; Bombled, B.; Rabouille, C.; Olivi, L.; Proux, O.; Cazala, C.; Morin, G.
2018-02-01
Contaminated systems in which uranium (U) concentrations slightly exceed the geochemical background are of particular interest to identify natural processes governing U trapping and accumulation in Earth's surface environments. For this purpose, we examined the role of early diagenesis on the evolution of U speciation and mobility in sediments from an artificial lake located downstream from a former mining site. Sediment and pore water chemistry together with U and Fe solid state speciation were analyzed in sediment cores sampled down to 50 cm depth at four locations in the lake. These organic-rich sediments (∼12% organic C) exhibited U concentrations in the 40-80 mg kg-1 range. The sediment columns were anoxic 2-3 mm below the sediment-water interface and pore waters pH was circumneutral. Pore water chemistry profiles showed that organic carbon mineralization was associated with Fe and Mn reduction and was correlated with a decrease in dissolved U concentration with depth. Immobilization of U in the sediment was correlated with the reduction of U(VI) to U(IV) at depth, as shown by U LIII-edge XANES spectroscopic analysis. XANES and EXAFS spectroscopy at the Fe K-edge showed the reduction of structural Fe(III) to Fe(II) in phyllosilicate minerals with depth, coincident with U(VI) to U(IV) reduction. Thermodynamic modeling suggests that Fe(II) could act as a major reducing agent for U(VI) during early diagenesis of these sediments, leading to complete U reduction below ∼30 cm depth. Shell-by-shell and Cauchy-Wavelet analysis of U LIII-EXAFS spectra indicates that U(VI) and U(IV) are mainly present as mononuclear species bound to C, P or Si ligands. Chemical extractions confirmed that ∼60-80% of U was present as non-crystalline species, which emphasizes that such species should be considered when evaluating the fate of U in lacustrine environments and the efficiency of sediment remediation strategies.
Pusaudžu trauksmes, pašcieņas un viņu māšu audzināšanas stilu saistība.
Valere, Linda
2007-01-01
Bakalaura darba tēma ir „Pusaudžu trauksmes, pašcieņas un viņu māšu audzināšanas stilu saistība”. Pusaudžu trauksme ir ļoti aktuāla problēma. Trauksmes traucējumu izplatība pusaudžiem svārstās no 12% līdz 17,3 % (Vasey & Ollendick, 2000 kā minēts Fraire, 2006), un tie rada lielu risku atkārtotiem trauksmes traucējumiem jau pieaugušā vecumā (Pine, Cohen, Gurley, Brook & Ma, 1998). Pētījuma mērķis ir noskaidrot, vai pastāv saistība starp pusaudžu trauksmi, pašcieņu un viņu māšu audzināšanas sti...
Renormalization group aspects of 3-dimensional Pure U(1) lattice gauge theory
International Nuclear Information System (INIS)
Gopfert, M.; Mack, G.
1983-01-01
A few surprises in a recent study of the 3-dimensional pure U(1) lattice gauge theory model, from the point of view of the renormalization group theory, are discussed. Since the gauge group U(1) of this model is abelian, the model is subject to KramersWannier duality transformation. One obtains a ferromagnet with a global symmetry group Z. The duality transformation shows that the surface tension alpha of the model equals the strong tension of the U(1) gauge model. A theorem to represent the true asymptotic behaviour of alpha is derived. A second theorem considers the correlation functions. Discrepiancies between the theorems result in a solution that ''is regarded as a catastrophe'' in renormalization group theory. A lesson is drawn: To choose a good block spin in a renormalization group procedure, know what the low lying excitations of the theory are, to avoid integrating some of them by mischief
Directory of Open Access Journals (Sweden)
Vadim Shchepachev
2012-10-01
Full Text Available Clericuzio-type poikiloderma with neutropenia (PN is a rare genodermatosis associated with mutations in the C16orf57 gene, which codes for the uncharacterized protein hMpn1. We show here that, in both fission yeasts and humans, Mpn1 processes the spliceosomal U6 small nuclear RNA (snRNA posttranscriptionally. In Mpn1-deficient cells, U6 molecules carry 3′ end polyuridine tails that are longer than those in normal cells and lack a terminal 2′,3′ cyclic phosphate group. In mpn1Δ yeast cells, U6 snRNA and U4/U6 di-small nuclear RNA protein complex levels are diminished, leading to precursor messenger RNA splicing defects, which are reverted by expression of either yeast or human Mpn1 and by overexpression of U6. Recombinant hMpn1 is a 3′-to-5′ RNA exonuclease that removes uridines from U6 3′ ends, generating terminal 2′,3′ cyclic phosphates in vitro. Finally, U6 degradation rates increase in mpn1Δ yeasts and in lymphoblasts established from individuals affected by PN. Our data indicate that Mpn1 promotes U6 stability through 3′ end posttranscriptional processing and implicate altered U6 metabolism as a potential mechanism for PN pathogenesis.
International Nuclear Information System (INIS)
Rodriguez-Alvarez, M.J.; Sanchez, F.
1995-01-01
The uranium concentration and the 234 U/ 238 U, 235 U/ 238 U activity ratios were studied in water samples from Jucar River, using low-level α-spectrometry. The effects of pH, temperature and salinity were considered and more detailed sampling was done in the neighbourhood of Cofrentes Nuclear Plant (Valencia, Spain). Changes were observed in the uranium concentration with the salinity and the 234 U/ 238 U activity ratio was found to vary with pH. Leaching and dilution, which depend on pH and salinity, are the probable mechanisms for these changes in the concentration of uranium and the activity ratios. (author) 25 refs.; 4 figs.; 1 tab
Disagregation of (U, Pu)O2 fuels in molten sodium nitrate and oxides system
International Nuclear Information System (INIS)
Chou, T.S.
1976-01-01
An oxidation process based on the use of an alkali-nitrate melt has been considered as a possible head end step for the reprocessing of FBR spent fuels. The total alkali solubility in the nitrate melt was examined. It is influenced by the temperature. At 500 degC the alkali solubility in the sodium nitrate melt is about 17 mol %. Examining solidified mixture of sodium and nitrate or sodium oxides and nitrite by X-ray diffraction has revealed five unknown lattices. NaNO 3 .xNa 2 O 2 is cubic (a=8.71A), NaNO 2 .xNa 2 O 2 is tetragonal (a=5.939A, c=9.997A), NaNO 2 .xNa 2 O is cubic (a=10.586A). The structure of NaNO 3 .xNa 2 O and NaNO 3 .xNaO 2 could not be determined. The solubility of barium and ruthenium was briefly investigated. The reaction (U,Pu)O 2 with the alkaline sodium nitrate melt proceeds along the grain boundaries of the solid solution. Two steps have been recognized. First (U,Pu)O 2 is oxidized to (U,Pu)Osub(2+x) and in a subsequent step (U,Pu)Osub(2+x) reacts with sodium peroxide to form (U,Pu) 2 O 5 .xNa 2 O 2 . Disaggregation efficiency is a function of temperature, alkali concentration and physical properties of the pellets. High temperature and low alkali concentration lead to high efficiency. The structure of the reaction products (U,Pu)O 2 with alkaline NaNO 3 melt was shown to depend mainly on the alkali concentration. As the alkali concentration is lower than 2 mole % (U,Pu) 2 O 5 . Na 2 O 2 is the dominate phase. (U,Pu) 2 O 5 .3Na 2 O 2 corresponds to 6 mole % and over 11 mole % alkali, (U,Pu) 2 O 5 .xNa 2 O 2 becomes the main product. The solubility of the fuel (U,Pu) in the alkali sodium nitrate melt increases with the alkali concentration up to 6000-8000 ppm for uranium and 1200-1700 ppm for plutonium at 500 degC with only 5 mole % alkali. As a result of high losses of fissile material in the salt bath molten salt process must regarded as uneligible for a general head end step in fuel reprocessing. Nevertheless its application can still be
Radiation Resistance of the U(Al, Si)3 Alloy: Ion-Induced Disordering
Yaniv, Gili; Horak, Pavel; Vacik, Jiri; Mykytenko, Natalia; Rafailov, Gennady; Dahan, Itzchak; Fuks, David; Kiv, Arik
2018-01-01
During the exploitation of nuclear reactors, various U-Al based ternary intermetallides are formed in the fuel-cladding interaction layer. Structure and physical properties of these intermetallides determine the radiation resistance of cladding and, ultimately, the reliability and lifetime of the nuclear reactor. In current research, U(Al, Si)3 composition was studied as a potential constituent of an interaction layer. Phase content of the alloy of an interest was ordered U(Al, Si)3, structure of which was reported earlier, and pure Al (constituting less than 20 vol % of the alloy). This alloy was investigated prior and after the irradiation performed by Ar ions at 30 keV. The irradiation was performed on the transmission electron microscopy (TEM, JEOL, Japan) samples, characterized before and after the irradiation process. Irradiation induced disorder accompanied by stress relief. Furthermore, it was found that there is a dose threshold for disordering of the crystalline matter in the irradiated region. Irradiation at doses equal or higher than this threshold resulted in almost solely disordered phase. Using the program “Stopping and Range of Ions in Matter” (SRIM), the parameters of penetration of Ar ions into the irradiated samples were estimated. Based on these estimations, the dose threshold for ion-induced disordering of the studied material was assessed. PMID:29393870
System for uranium superficial density measurement in U3Si2 MTR fuel plates using radiography
International Nuclear Information System (INIS)
Hey, Martin A.; Gomez Marlasca, Fernando
2003-01-01
The paper describes a method for measuring uranium superficial density in high density uranium silicide (U 3 Si 2 ) MTR fuel plates, through the use of industrial radiography, a set of patterns built for this purpose, a transmission optical densitometer, and a quantitative model of analysis and measurement. Our choice for this particular method responds to its high accuracy, low cost and easy implementation according to the standing quality control systems. (author)
RLIM interacts with Smurf2 and promotes TGF-β induced U2OS cell migration
International Nuclear Information System (INIS)
Huang, Yongsheng; Yang, Yang; Gao, Rui; Yang, Xianmei; Yan, Xiaohua; Wang, Chenji; Jiang, Sirui; Yu, Long
2011-01-01
Highlights: → RLIM directly binds to Smurf2. → RLIM enhances TGF-β responsiveness in U2OS cells. → RLIM promotes TGF-β driven migration of osteosarcoma U2OS cells. -- Abstract: TGF-β (transforming growth factor-β), a pleiotropic cytokine that regulates diverse cellular processes, has been suggested to play critical roles in cell proliferation, migration, and carcinogenesis. Here we found a novel E3 ubiquitin ligase RLIM which can directly bind to Smurf2, enhancing TGF-β responsiveness in osteosarcoma U2OS cells. We constructed a U2OS cell line stably over-expressing RLIM and demonstrated that RLIM promoted TGF-β-driven migration of U2OS cells as tested by wound healing assay. Our results indicated that RLIM is an important positive regulator in TGF-β signaling pathway and cell migration.
U-Th Burial Dates on Ostrich Eggshell
Sharp, W. D.; Fylstra, N. D.; Tryon, C. A.; Faith, J. T.; Peppe, D. J.
2015-12-01
Obtaining precise and accurate dates at archaeological sites beyond the range of radiocarbon dating is challenging but essential for understanding human origins. Eggshells of ratites (large flightless birds including ostrich, emu and others) are common in many archaeological sequences in Africa, Australia and elsewhere. Ancient eggshells are geochemically suitable for the U-Th technique (1), which has about ten times the range of radiocarbon dating (>500 rather than 50 ka), making eggshells attractive dating targets. Moreover, C and N isotopic studies of eggshell provide insights into paleovegetation and paleoprecipitation central to assessing past human-environment interactions (2,3). But until now, U-Th dates on ratite eggshell have not accounted for the secondary origin of essentially all of their U. We report a novel approach to U-Th dating of eggshell that explicitly accounts for secondary U uptake that begins with burial. Using ostrich eggshell (OES) from Pleistocene-Holocene east African sites, we have measured U and 232Th concentration profiles across OES by laser ablation ICP-MS. U commonly peaks at 10s to 100s of ppb and varies 10-fold or more across the ~2 mm thickness of OES, with gradients modulated by the layered structure of the eggshell. Common Th is high near the shell surfaces, but low in the middle "pallisade" layer of OES, making it optimal for U-Th dating. We determine U-Th ages along the U concentration gradient by solution ICP-MS analyses of two or more fractions of the pallisade layer. We then estimate OES burial dates using a simple model for diffusive uptake of uranium. Comparing such "U-Th burial dates" with radiocarbon dates for OES calcite from the same shells, we find good agreement in 7 out of 9 cases, consistent with rapid burial and confirming the accuracy of the approach. The remaining 2 eggshells have anomalous patterns of apparent ages that reveal they are unsuitable for U-Th dating, thereby providing reliability criteria innate
Spencer, Liam P; Yang, Ping; Minasian, Stefan G; Jilek, Robert E; Batista, Enrique R; Boland, Kevin S; Boncella, James M; Conradson, Steven D; Clark, David L; Hayton, Trevor W; Kozimor, Stosh A; Martin, Richard L; MacInnes, Molly M; Olson, Angela C; Scott, Brian L; Shuh, David K; Wilkerson, Marianne P
2013-02-13
Synthetic routes to salts containing uranium bis-imido tetrahalide anions [U(NR)(2)X(4)](2-) (X = Cl(-), Br(-)) and non-coordinating NEt(4)(+) and PPh(4)(+) countercations are reported. In general, these compounds can be prepared from U(NR)(2)I(2)(THF)(x) (x = 2 and R = (t)Bu, Ph; x = 3 and R = Me) upon addition of excess halide. In addition to providing stable coordination complexes with Cl(-), the [U(NMe)(2)](2+) cation also reacts with Br(-) to form stable [NEt(4)](2)[U(NMe)(2)Br(4)] complexes. These materials were used as a platform to compare electronic structure and bonding in [U(NR)(2)](2+) with [UO(2)](2+). Specifically, Cl K-edge X-ray absorption spectroscopy (XAS) and both ground-state and time-dependent hybrid density functional theory (DFT and TDDFT) were used to probe U-Cl bonding interactions in [PPh(4)](2)[U(N(t)Bu)(2)Cl(4)] and [PPh(4)](2)[UO(2)Cl(4)]. The DFT and XAS results show the total amount of Cl 3p character mixed with the U 5f orbitals was roughly 7-10% per U-Cl bond for both compounds, which shows that moving from oxo to imido has little effect on orbital mixing between the U 5f and equatorial Cl 3p orbitals. The results are presented in the context of recent Cl K-edge XAS and DFT studies on other hexavalent uranium chloride systems with fewer oxo or imido ligands.
Dicty_cDB: Contig-U01204-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN
International Nuclear Information System (INIS)
Li Shulan; He Fengqi; Wang Qingheng; Han Jingquan
1993-04-01
The NDT method for determining the surface contamination by uranium on U 3 Si 2 -Al plate-type fuel elements, the process of standard specimen preparation and the graduation curve are described. The measurement results of U 3 Si 2 -Al plate-type fuel elements show that the alpha counting method to measure the surface contamination by uranium on fuel plate is more reliable. The UB-1 type surface contamination meter, which was recently developed, has many advantages such as high sensitivity to determine the uranium pollution, short time in measuring, convenience for operation, and the minimum detectable amount of uranium is 5 x 10 -10 g/cm 2 . The measuring device is controlled by a microcomputer. Besides data acquisition and processing, it has functions of statistics, output data on terminal or to printer and alarm. The procedures of measurement are fully automatic. All of these will meet the measuring needs in batch process
Symmetry breaking of u(6/2j+1) supersymmetric models
International Nuclear Information System (INIS)
Baake, M.; Reinicke, P.
1985-09-01
In this paper, we present the group theory of models with broken u(6/2j+1) supersymmetry described by the chain u(6/2j+1) contains usub(B)(6) x usub(F)(2j+1) contains usub(B)(6) x spsub(F)(2j+1) contains ... contains sosub(B)(3) x susub(F)(2) contains susub(B+F)(2) which has recently been suggested for application to nuclear physics. We present all invariants that are needed for the construction of the general Hamiltonian for this model. (orig.)
Synthesis and X-ray Crystallography of [Mg(H2O)6][AnO2(C2H5COO)3]2 (An = U, Np, or Pu).
Serezhkin, Viktor N; Grigoriev, Mikhail S; Abdulmyanov, Aleksey R; Fedoseev, Aleksandr M; Savchenkov, Anton V; Serezhkina, Larisa B
2016-08-01
Synthesis and X-ray crystallography of single crystals of [Mg(H2O)6][AnO2(C2H5COO)3]2, where An = U (I), Np (II), or Pu (III), are reported. Compounds I-III are isostructural and crystallize in the trigonal crystal system. The structures of I-III are built of hydrated magnesium cations [Mg(H2O)6](2+) and mononuclear [AnO2(C2H5COO)3](-) complexes, which belong to the AB(01)3 crystallochemical group of uranyl complexes (A = AnO2(2+), B(01) = C2H5COO(-)). Peculiarities of intermolecular interactions in the structures of [Mg(H2O)6][UO2(L)3]2 complexes depending on the carboxylate ion L (acetate, propionate, or n-butyrate) are investigated using the method of molecular Voronoi-Dirichlet polyhedra. Actinide contraction in the series of U(VI)-Np(VI)-Pu(VI) in compounds I-III is reflected in a decrease in the mean An═O bond lengths and in the volume and sphericity degree of Voronoi-Dirichlet polyhedra of An atoms.
Peculiarities of U-based Laves phases
Energy Technology Data Exchange (ETDEWEB)
Goncalves, A P; Henriques, M S; Waerenborgh, J C; Pereira, L C J; Lopes, E B; Almeida, M [Department of Chemistry, Instituto Tecnologico e Nuclear/CFMCUL, Estrada Nacional 10, 2686-953 Sacavem (Portugal); Maskova, S; Havela, L [Department of Condensed Matter Physics, Faculty of Mathematics and Physics, Charles University, Ke Karlovu 5, 12116, Prague (Czech Republic); Shick, A; Arnold, Z [Institute of Physics, Academy of Sciences of the Czech Republic, Prague 8 (Czech Republic); Berthebaud, D; Tougait, O; Noel, H, E-mail: apg@itn.pt [Sciences Chimiques de Rennes- Equipe Chimie du Solide et Materiaux. UMR CNRS 6226, Universite de Rennes 1, Avenue de General Leclerc, 35042 Rennes (France)
2010-03-15
This contribution focuses on the structural and physical properties of U-based Laves phases. It starts with the structural description of the different type of Laves phases, followed by a brief description of the factors that affect their stability. The majority of the uranium Laves phases show a weakly paramagnetic behaviour. The reason is the compact structure of the phases that leads to small a U-U spacing as well as very high coordination numbers, regarding both the uranium and the ligands sublattices, which brings a strong hybridization with non-f states. However, there are some exceptions of uranium Laves phases that do order magnetically (UFe{sub 2}, UNi{sub 2} and the recently discovered U{sub 2}Fe{sub 3}Ge compound). These exceptions are discussed in more detail in the present manuscript.
Dicty_cDB: Contig-U10335-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG
International Nuclear Information System (INIS)
Hayashi, M.; Dolezal, H.
1979-01-01
The Bureau of Mines estimated the cost for a uranium ion-exchange recovery system using five grades of U 3 O 8 leach solution producing 815,570 pounds of U 3 O 8 per year from an ammonium bicarbonate in situ leach solution. The system flowsheet consisted of four unit operations: (1) Multiple-compartment ion-exchange (MCIX) absorption; (2) MCIX elution; (3) precipitation of the uranium as yellow cake, filtering, calcining, and packaging; and (4) waste disposal. The total fixed capital cost of a system treating 2,000 gallons per minute of 0.1-gram-per-liter-U 3 O 8 leach solution was estimated as $6,888,000. For a basic case of an MCIX system depreciating in 9 years, unit production cost of U 3 O 8 was $3.51 per pound. A decrease in feed solution grade from 0.4 to 0.03 gram per liter increased the production cost exponentially. Shorter depreciating periods significantly increased the production cost particularly for the lower grade feed solutions
Energy Technology Data Exchange (ETDEWEB)
Schelter, Eric John [Los Alamos National Laboratory; Wu, Ruilian [Los Alamos National Laboratory; Scott, Brian L [Los Alamos National Laboratory; Thompson, Joe D [Los Alamos National Laboratory; Batista, Enrique R [Los Alamos National Laboratory; Morris, David E [Los Alamos National Laboratory; Kiplinger, Jaqueline L [Los Alamos National Laboratory
2008-01-01
Actinide complexes of the redox-active ligand dpp-BIAN{sup 2-} (dpp-BIAN = bis(2,6-diisopropylphenyl)acenaphthylene), An(dpp-BIAN){sub 2}(THF){sub n} (An = Th, n = 1; An = U, n = 0, 1) have been prepared. Solid-state magnetic and single-crystal X-ray data for U(dpp-BIAN){sub 2}(THF){sub n} show when n = 0, the complex exists in an f{sup 2}-{pi}*{sup 4} configuration; whereas an intramolecular electron transfer occurs for n = 1, resulting in an f{sup 3}-{pi}*{sup 3} ground configuration. The magnetic data also indicate that interconversion between the two forms of the complex is possible, limited only by the ability of THF vapor to penetrate the solid on cooling of the sample. Spectroscopic data indicate the complex exists solely in the f{sup 2}-{pi}*{sup 4} form in solution, evidenced by the appearance of only small changes in the electronic absorption spectra of the U(dpp-BIAN){sub 2} complex on titration with THF and by measurement of the solution magnetic moment m d{sub 8}-tetrahydrofuran using Evans method. Electrochemistry of the complexes is reported, with small differences observed in wave potentials between metals and in the presence of THF. These data represent the first example of a well-defined, reversible intramolecular electron transfer in an f-element complex and the second example of oxidation state change through dative interaction with a metal ion.
Dicty_cDB: Contig-U01997-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l
Closing the SU(3)LxU(1)X symmetry at the electroweak scale
International Nuclear Information System (INIS)
Dias, Alex G.; Montero, J. C.; Pleitez, V.
2006-01-01
We show that some models with SU(3) C xSU(3) L xU(1) X gauge symmetry can be realized at the electroweak scale and that this is a consequence of an approximate global SU(2) L+R symmetry. This symmetry implies a condition among the vacuum expectation value of one of the neutral Higgs scalars, the U(1) X 's coupling constant, g X , the sine of the weak mixing angle sinθ W , and the mass of the W boson, M W . In the limit in which this symmetry is valid it avoids the tree level mixing of the Z boson of the standard model with the extra Z ' boson. We have verified that the oblique T parameter is within the allowed range indicating that the radiative corrections that induce such a mixing at the 1-loop level are small. We also show that a SU(3) L+R custodial symmetry implies that in some of the models we have to include sterile (singlets of the 3-3-1 symmetry) right-handed neutrinos with Majorana masses, since the seesaw mechanism is mandatory to obtain light active neutrinos. Moreover, the approximate SU(2) L+R subset of SU(3) L+R symmetry implies that the extra nonstandard particles of these 3-3-1 models can be considerably lighter than it had been thought before so that new physics can be really just around the corner
The status of 232Th and 233U for CENDL-3.0
International Nuclear Information System (INIS)
Liu Ping
2003-01-01
The new version CENDL-3.0 of China: Evaluated nuclear data library has been updated, and contains about 200 nuclides. Among them, the data of following nuclides have been newly evaluated or reevaluated: fissile nuclides 15, structure materials 18, light nuclides 3, fission products 116. The 232 Th and 233 U are newly evaluated
Adamczyk, L.
2016-12-15
We present a measurement of the inclusive production of Upsilon mesons in U+U collisions at 193 GeV at mid-rapidity (|y| < 1). Previous studies in central Au+Au collisions at 200 GeV show a suppression of Upsilon(1S+2S+3S) production relative to expectations from the Upsilon yield in p+p collisions scaled by the number of binary nucleon-nucleon collisions (Ncoll), with an indication that the Upsilon(1S) state is also suppressed. The present measurement extends the number of participant nucleons in the collision (Npart) by 20% compared to Au+Au collisions, and allows us to study a system with higher energy density. We observe a suppression in both the Upsilon(1S+2S+3S) and Upsilon(1S) yields in central U+U data, which consolidates and extends the previously observed suppression trend in Au+Au collisions.
Chemical, physical and isotopic characterization of U3Si2, for nuclear forensics purposes
International Nuclear Information System (INIS)
Rosa, Daniele Scarpim
2011-01-01
In the early 1990's, the first illicit trafficking of nuclear and radioactive materials was observed mainly in Europe. A decade marked by numerous cases of seizures of these materials. As a result, these events have become the subject of criminal forensic investigations and develop from there, nuclear forensics. In Brazil there are no illicit trafficking official records of nuclear material, however, is widely known the extraction and illegal transportation of radioactive geological materials, and the materials pieces attachment used as shielding for radioactive sources. One of the main tools used in nuclear forensics is the nuclear materials databases establishment. These documents must contain the most information as possible about the physical, chemical and nuclear material seized, allowing the identification of their origin, manufacturing process or age. Thus, it sets characteristic composition standards of each material, called 'chemical signatures' (chemical finger print). In this work nuclear forensic protocol was adopted as well as the three stages of assessment suggested by International Atomic Energy Agency (IAEA) in identifying the origin of uranium silicide (U 3 Si 2 ). Assays were performed in order to make physical, chemical and isotopic characterization of the studied materials and compared the data with those obtained for other uranium compounds (Uranium tetrafluoride, UF 4 ; uranium oxide, UO 2 and U 3 O 8 ; Yellow cake) by establishing a characteristic signature for each one. Through the assays the uranium compounds were classify by origin groups, as far as they are from different manufactured process and/ or origin. It was also possible to show the importance of a nuclear forensic database during an investigation of a nuclear forensic event. (author)
Dicty_cDB: Contig-U08397-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 6 |pid:none) Polaromonas sp. JS666, complete... 43 1e-06 U40031_3( U40031 |pid:none) Reithrodontomys megalot...ogena... 53 1e-06 U83832_3( U83832 |pid:none) Reithrodontomys fulvescens NADH dehydr... 52 1e-06 U83822_3( U...83822 |pid:none) Sigmodon ochrognathus NADH dehydrogena... 51 1e-06 U83831_3( U83831 |pid:none) Reithrodon...tomys megalotis NADH dehydro... 52 1e-06 AP009385_2172( AP009385 |pid:none) Burkhol
Directory of Open Access Journals (Sweden)
Lemieux Bruno
2010-12-01
Full Text Available Abstract Background In cancer cells the three-dimensional (3D telomere organization of interphase nuclei into a telomeric disk is heavily distorted and aggregates are found. In Hodgkin's lymphoma quantitative FISH (3D Q-FISH reveals a major impact of nuclear telomere dynamics during the transition form mononuclear Hodgkin (H to diagnostic multinuclear Reed-Sternberg (RS cells. In vitro and in vivo formation of RS-cells is associated with the increase of very short telomeres including "t-stumps", telomere loss, telomeric aggregate formation and the generation of "ghost nuclei". Results Here we analyze the 3D telomere dynamics by Q-FISH in the novel Hodgkin cell line U-HO1 and its non-receptor protein-tyrosine phosphatase N1 (PTPN1 stable transfectant U-HO1-PTPN1, derived from a primary refractory Hodgkin's lymphoma. Both cell lines show equally high telomerase activity but U-HO1-PTPN differs from U-HO1 by a three times longer doubling time, low STAT5A expression, accumulation of RS-cells (p As expected, multinuclear U-HO1-RS-cells and multinuclear U-HO1-PTPN1-RS-cells differ from their mononuclear H-precursors by their nuclear volume (p Conclusion Abundant RS-cells without additional very short telomeres including "t-stumps", high rate of apoptosis, but low STAT5A expression, are hallmarks of the U-HO1-PTPN1 cell line. These characteristics are independent of telomerase activity. Thus, PTPN1 induced dephosphorylation of STAT5 with consecutive lack of Akt/PKB activation and cellular arrest in G2, promoting induction of apoptosis, appears as a possible pathogenetic mechanism deserving further experimental investigation.
Ion microprobe U-Pb dating of a dinosaur tooth
International Nuclear Information System (INIS)
Sano, Yuji; Terada, Kentaro; Ly, Chi V.; Park, Eun Ju
2006-01-01
Ion microprobe U-Pb dating of apatite is applied to a fossil tooth of a Allosaurid derived from the Hasandong Formation in the Gyeongsang basin, southeastern Korea. Twelve spots on a single fragment of the fossil dentine yield a Tera-Wasserburg concordia intercept age of 115±10 Ma (2σ, MSWD=0.59) on a 238 U/ 206 Pb- 207 Pb/ 206 Pb- 204 Pb/ 206 Pb diagram. The age provides a constraint on the depositional age of the fossil in its host Hassandong Formation as Early Aptian. The success of the ion microprobe dating depends on the heterogeneities of diagenetically incorporated U and Pb at the few hundred μm scale, the consequent variations in Pb isotopic compositions due to radioactive decay and the closed-system behavior of U and Pb. There are at least three end-members to explain the variations of minor chemical components such as FeO, SiO 2 and Al 2 O 3 , and trace elements as Th, U and rare earth elements (REE) in the sample by a simple mixing model. They are (1) very low minor and REE, very high common Pb with variable U abundances, (2) low common Pb, high minor, REE, and U abundances, and (3) low minor, common Pb, and U with intermediate REE abundances, even though groups (2) and (3) may consist of a larger group. Various contributions of the three (and/or two) end-members during diagenetic processes may cause the elemental fractionation of U and Pb in a fossil tooth. (author)
International Nuclear Information System (INIS)
Komar Varela, Carolina; Arico, Sergio; Mirandou, Marcela; Balart, Silvia; Gribaudo, Luis
2007-01-01
Out-of-pile diffusion experiments were performed between U-7 wt.% Mo-1 wt.% Zr and Al or Al A356 (7,1 wt.% Si) at 550 C degrees. In this work morphological characterization and phase identification on both interaction layers are presented. They were carried out by the use of different techniques: optical and scanning electron microscopy, X-ray diffraction and WDS microanalysis. In the interaction layer U-7 wt.% Mo-1 wt.% Zr/Al, the phases UAl 3 , UAl 4 , Al 20 Mo 2 U and Al 43 Mo 4 U 6 were identified. Similar results in the interaction layer of the U-7 % Mo/Al at 580 C degrees were previously obtained. In the interaction layer U-7 wt.% Mo-1 wt.% Zr/Al A356, the phases U(Al,Si) 3 with 25 at.% Si and Si 5 U 3 were identified. This last phase, with a higher Si concentration, was identified with X-ray diffraction synchrotron radiation performed at the National Synchrotron Light Laboratory, Campinas, Brazil. (author) [es
Primary and secondary structure of U8 small nuclear RNA
International Nuclear Information System (INIS)
Reddy, R.; Henning, D.; Busch, H.
1985-01-01
U8 small nuclear RNA is a new, capped, 140 nucleotides long RNA species found in Novikoff hepatoma cells. Its sequence is: m3GpppAmUmCGUCAGGA GGUUAAUCCU UACCUGUCCC UCCUUUCGGA GGGCAGAUAG AAAAUGAUGA UUGGAGCUUG CAUGAUCUGC UGAUUAUAGC AUUUCCGUGU AAUCAGGACC UGACAACAUC CUGAUUGCUU CUAUCUGAUUOH. This RNA is present in approximately 25,000 copies/cell, and it is enriched in nucleolar preparations. Like U1, U2, U4/U6, and U5 RNAs, U8 RNA was also present as a ribonucleoprotein associated with the Sm antigen. The rat U8 RNA was highly homologous (greater than 90%) to a recently characterized 5.4 S RNA from mouse cells infected with spleen focus-forming virus. In addition to the U8 RNA, three other U small nuclear RNAs were found in anti-Sm antibody immunoprecipitates from labeled rat and HeLa cells. Each of these contained a m3GpppAm cap structure; their apparent chain lengths were 60, 130, and 65 nucleotides. These U small nuclear RNAs are designated U7, U9, and U10 RNAs, respectively
U-234/U-238 ratio: Qualitative estimate of groundwater flow in Rocky Flats monitoring wells
International Nuclear Information System (INIS)
Laul, J.C.
1994-01-01
Groundwater movement through various pathways is the primary mechanism for the transport of radionuclides and trace elements in a water/rock interaction. About three dozen wells, installed in the Rocky Flats Plant (RFP) Solar Evaporation Ponds (SEP) area, are monitored quarterly to evaluate the extent of any lateral and downgradient migration of contaminants from the Solar Evaporation Ponds: 207-A; 207-B North, 207-B Center, and 207-B South; and 207-C. The Solar Ponds are the main source for the various contaminants: radionuclides (U-238, U-234, Pu-239, 240 and Am-241); anions; and trace metals to groundwaters. The U-238 concentrations in Rocky Flats groundwaters vary from 2 (CO 3 ) 2 2- , because of the predominant bicarbonate medium
Dicty_cDB: Contig-U15036-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG
Compact toroid injection into C-2U
Roche, Thomas; Gota, H.; Garate, E.; Asai, T.; Matsumoto, T.; Sekiguchi, J.; Putvinski, S.; Allfrey, I.; Beall, M.; Cordero, M.; Granstedt, E.; Kinley, J.; Morehouse, M.; Sheftman, D.; Valentine, T.; Waggoner, W.; the TAE Team
2015-11-01
Sustainment of an advanced neutral beam-driven FRC for a period in excess of 5 ms is the primary goal of the C-2U machine at Tri Alpha Energy. In addition, a criteria for long-term global sustainment of any magnetically confined fusion reactor is particle refueling. To this end, a magnetized coaxial plasma-gun has been developed. Compact toroids (CT) are to be injected perpendicular to the axial magnetic field of C-2U. To simulate this environment, an experimental test-stand has been constructed. A transverse magnetic field of B ~ 1 kG is established (comparable to the C-2U axial field) and CTs are fired across it. As a minimal requirement, the CT must have energy density greater than that of the magnetic field it is to penetrate, i.e., 1/2 ρv2 >=B2 / 2μ0 . This criteria is easily met and indeed the CTs traverse the test-stand field. A preliminary experiment on C-2U shows the CT also capable of penetrating into FRC plasmas and refueling is observed resulting in a 20 - 30% increase in total particle number per single-pulsed CT injection. Results from test-stand and C-2U experiments will be presented.
SU(2) x U(1) x U'(1) models which are slightly different from the Weinberg-Salam model
International Nuclear Information System (INIS)
Gao, C.; Wu, D.
1981-01-01
We discuss SU(2) x U(1) x U'(1) models by a uniform formula which is convenient for their comparison with the standard Weinberg-Salam model. As examples, we give three interesting models which are based on different grand unification models. In one model, U'(1) does not contribute to the electromagnetic interaction; in the other two, both U(1) and U'(1) do contribute to the electromagnetic interaction. Also, the first two models can approach the standard Weinberg-Salam model as close as one wants; but the third model has limitations on it
International Nuclear Information System (INIS)
Uozumi, Koichi; Kato, Tetsuya; Iizuka, Masatoshi; Inoue, Tadashi; Iwai, Takashi; Shirai, Osamu; Arai, Yasuo
2003-01-01
In order to study behaviors of U and Pu at simultaneous recoveries into liquid cadmium cathodes (LCCs) in the electrorefining of pyrometallurgical reprocessing, several experiments were conducted to recover U and Pu into LCCs at different U/Pu ratios in the salt phase. The major results were as follows: (1) The weight ratios of U and Pu in 120 g LCCs reached 10 wt.% (the tentative target), with current efficiencies higher than 80 %. (2) Under the conditions of U/Pu ratios in the initial salt phase less than 1/4.3, the amounts of recovered U and Pu were proportional to the passed electric charges, with the separation factors of U to Pu (= (U/Pu ration in the recovered product)/(U/Pu ratio in the salt)) between 1.2 and 2.0. (3) On the other hand, under the condition of U/Pu ratio in the initial salt phase at 1/1.73, only U was recovered into the LCC after the saturation of LCC with U and Pu. Accordingly, there will be a threshold in the U/Pu ratio of the salt phase for the simultaneous recovery of U and Pu. (4) Am showed a similar behavior to Pu. The separation factors of Am to Pu (=(AM/Pu ratio in the recovered product)/(Am/Pu ratio in the salt)) was 0.78, which means that Am is co-recovered with Pu into LCC. (author)
Introduction: U.S. Homophile Internationalism.
Stein, Marc
2017-01-01
This article introduces "U.S. Homophile Internationalism," a special issue of the Journal of Homosexuality. The introduction provides a broad overview of the "U.S. Homophile Internationalism" archive and exhibit, which was published on the Outhistory Web site in 2015. The archive and exhibit consists of more than 800 U.S. homophile magazine articles, letters, and other items that referenced non-U.S. regions of the world from 1953 to 1964. The essays in the special issue focus on (1) Africa; (2) Asia and the Pacific; (3) Canada; (4) Latin America and the Caribbean; (5) the Middle East; and (6) Russia, the Soviet Union, and Eastern Europe. There is also an article that addresses the public history and digital humanities dimensions of the project. The introduction concludes by discussing the essays' common goals, themes, and concerns.
U-Mo fuel qualification program in HANARO
International Nuclear Information System (INIS)
Lee, K.H.; Lee, C.S.; Kim, H.R.; Kuk, I.H.; Kim, C.K.
2000-01-01
Atomized U-Mo fuel has shown good performance from the results of previous out-of-pile tests and post-irradiation examinations. A qualification program of rod type U-Mo fuel is in progress and the fuel will be irradiated in HANARO. 6 gU/cm 3 U-7Mo, U-8Mo and U-9Mo are considered in this program. The laboratory test results of porosity, mechanical property, thermal conductivity, and thermal compatibility test are discussed in this paper. In parallel with this qualification program, the feasibility study on the core conversion from the present U 3 Si fuel to U-Mo in HANARO will be initiated to provide technical bases for the policy making. Several options of core conversion for HANARO are proposed and each option will be addressed briefly in terms of the operation policy, fuel management, and licensing of HANARO. (author)
Zero Action on Perfect Crystals for U_q(G_2^{(1}
Directory of Open Access Journals (Sweden)
Kailash C. Misra
2010-03-01
Full Text Available The actions of 0-Kashiwara operators on the U_q(G_2^{(1}-crystal B_l in [Yamane S., J. Algebra 210 (1998, 440-486] are made explicit by using a similarity technique from that of a U_q'(D_4^{(3}-crystal. It is shown that {B_l}_{l ≥ 1} forms a coherent family of perfect crystals.
Effect of anthropogenic organic complexants on the solubility of Ni, Th, U(IV) and U(VI)
Energy Technology Data Exchange (ETDEWEB)
Felipe-Sotelo, M., E-mail: m.felipe-sotelo@lboro.ac.uk [Department of Chemistry, Loughborough University, LE11 3TU Loughborough, Leicestershire (United Kingdom); Edgar, M. [Department of Chemistry, Loughborough University, LE11 3TU Loughborough, Leicestershire (United Kingdom); Beattie, T. [MCM Consulting. Täfernstrasse 11, CH 5405 Baden-Dättwil (Switzerland); Warwick, P. [Enviras Ltd., LE11 3TU Loughborough, Leicestershire (United Kingdom); Evans, N.D.M.; Read, D. [Department of Chemistry, Loughborough University, LE11 3TU Loughborough, Leicestershire (United Kingdom)
2015-12-30
Highlights: • Citrate increases the solubility of Ni, Th and U between 3 and 4 orders of magnitude. • Theophrastite is the solubility controlling phase of Ni in 95%-saturated Ca(OH){sub 2}. • U(VI) and Ni may form Metal-citrate-OH complexes stabilised by the presence of Ca{sup 2+}. - Abstract: The influence of anthropogenic organic complexants (citrate, EDTA and DTPA from 0.005 to 0.1 M) on the solubility of nickel(II), thorium(IV) and uranium (U(IV) and U(VI)) has been studied. Experiments were carried out in 95%-saturated Ca(OH){sub 2} solutions, representing the high pH conditions anticipated in the near field of a cementitious intermediate level radioactive waste repository. Results showed that Ni(II) solubility increased by 2–4 orders of magnitude in the presence of EDTA and DTPA and from 3 to 4 orders of magnitude in the case of citrate. Citrate had the greatest effect on the solubility of Th(IV) and U(IV)/(VI). XRD and SEM analyses indicate that the precipitates are largely amorphous; only in the case of Ni(II), is there some evidence of incipient crystallinity, in the form of Ni(OH){sub 2} (theophrastite). A study of the effect of calcium suggests that U(VI) and Ni(II) may form metal-citrate-OH complexes stabilised by Ca{sup 2+}. Thermodynamic modelling underestimates the concentrations in solution in the presence of the ligands for all the elements considered here. Further investigation of the behaviour of organic ligands under hyperalkaline conditions is important because of the use of the thermodynamic constants in preparing the safety case for the geological disposal of radioactive wastes.
The manufacture process and properties of (U, Gd)O2 burnable poisonous fuel pellets
International Nuclear Information System (INIS)
Yi Wei; Tang Yueming; Dai Shengping; Yang Youqing; Zuo Guoping; Wu Shihong; Gu Xiaofei; Gu Mingfei
2006-03-01
The main properties of important raw powder materials used in the (U, Gd)O 2 burnable poisonous fuel pellets production line of NPIC are presented. The powders included UO 2 , Gd 2 O 3 , (U, Gd) 3 O 8 and necessary additives, such as ammonium oxalate and zinc stearate. And the main properties of (U, Gd)O 2 burnable poisonous fuel pellets and the manufacture processes, such as ball-milling blending, granulation, pressing, sintering and grinding are also described. Moreover, the main effect of the process parameters controlled in the manufacture process have been discussed. (authors)
Dicty_cDB: Contig-U01750-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig
Stopping powers of havar and effective charge for 1.4-3.2 MeV/u {sup 127}I-ions
Energy Technology Data Exchange (ETDEWEB)
Alanko, T. E-mail: tommi.alanko@phys.jyu.fi; Hyvoenen, J.; Kylloenen, V.; Raeisaenen, J.; Virtanen, A
2000-06-01
Stopping powers of havar for 1.4-3.2 MeV/u {sup 127}I-ions have been determined by the transmission technique using two geometrical arrangements. No previous data have been published for havar with this ion. The experimental data are compared with predictions obtained by using Bragg's additivity rule with various parametrizations of the stopping power found in the literature. The values obtained by the parametrizations underestimate the experimental data by 5-11%. The empirical correction scheme of Thwaites yields values in rather good agreement with the present results, especially at energies above 1.9 MeV/u. The effective charges of the {sup 127}I ions were also deduced from the experimental data.
Electromagnetic mass differences in the SU(3) x U(1) gauge model
International Nuclear Information System (INIS)
Maharana, K.; Sastry, C.V.
1975-01-01
In this note we point out that the electromagnetic mass differences of the pion and kaon in the SU(3) times U(1) model are the same as in Weinberg's model except for the differences in the masses of the gauge bosons
The U.S. Market For Broadband Over Powerline, 3. edition
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-15
The report provides a study of the potential market for BPL technology in the U.S. including a look at the past, present, and future state of Broadband Over Powerline (BPL) in the U.S. The Scope of the report includes the following topics: a description of the history of powerline communications (PLC) and broadband over powerline (BPL) technology; an analysis of key drivers of BPL within the electric utility and internet access industries; an overview of BPL technology and architecture; a comparison of BPL with alternative broadband access methods; an analysis of technological, regulatory, and business barriers to BPL's success; identification of the key applications and markets for BPL; a description of business models for BPL; an analysis of key market trends in broadband internet access; a review of the market development of cable modem broadband access; profiles of major U.S. BPL market participants; and, profiles of major U.S. BPL projects.
Recovery and recrystallization of U{sub 3}Si
Energy Technology Data Exchange (ETDEWEB)
Caillibot, P F; Wyatt, B S
1969-10-15
The recovery and recrystallization temperatures of U{sub 3}Si were determined for an alloy of uranium-3.98 wt% silicon containing 600 ppm carbon. Small specimens, deformed by compression, were isothermally and isochronally annealed at temperatures between 350 and 700{sup o}C and their recovery and recrystallization temperatures determined using hardness, grain size and X-ray measurements. For small amounts of strain and an annealing time of 6 hours both recovery and recrystallization begin at 400-450{sup o}C. Complete recrystallization is achieved at 650-700{sup o}C. The effect of small changes in silicon and carbon concentration were determined by examining two further alloys containing 3.27 wt% silicon and 600 ppm carbon, and 4.02 wt% silicon and 140 ppm carbon respectively. A small change in silicon concentration does not affect recovery and recrystallization but decreasing the carbon concentration from 600 to 140 ppm decreases the recovery and recrystallization temperatures. (author)
Facile synthesis of magnetic Fe3O4/graphene composites for enhanced U(VI) sorption
Zhao, Donglin; Zhu, Hongyu; Wu, Changnian; Feng, Shaojie; Alsaedi, Ahmed; Hayat, Tasawar; Chen, Changlun
2018-06-01
A novel magnetic Fe3O4/graphene composite (FGC) was fabricated by a facile one-step reaction route and shown to be effective for sorbing U(VI) from aqueous solution. The structure, properties and application of the prepared FGC composite were well evaluated. The high saturation magnetization (45.6 emu/g) made FGC easier to be separated from the media within several seconds under an external magnetic. Effects of different ambient conditions (i.e., pH and ionic strength, contact time, temperatures) on sorption behaviors of U(VI) on FGC were carried out by batch experiments. According to the calculation of Langmuir model, the maximum sorption capacity of U(VI) on the FGC at pH 5.5 and 298 K was 176.47 mg/g. The sorption was correlated with the effects of pH, contact time, and temperature. X-ray photoelectron spectroscopy analysis revealed that U(VI) was sorbed on FGC via oxygen-containing functional groups. This work demonstrated that FGC could be recycled and used as an effective recyclable sorbent for sorption of U(VI).
Interdiffusion and reaction between U and Zr
Park, Y.; Newell, R.; Mehta, A.; Keiser, D. D.; Sohn, Y. H.
2018-04-01
The microstructural development and diffusion kinetics were examined for the binary U vs. Zr system using solid-to-solid diffusion couples, U vs. Zr, annealed at 580 °C for 960 h, 650 °C for 480 h, 680 °C for 240 h, and 710 °C for 96 h. Scanning and transmission electron microscopies with X-ray energy dispersive spectroscopy were employed for detailed microstructural and compositional analyses. Interdiffusion and reaction in U vs. Zr diffusion couples primarily produced: δ-UZr2 solid solution (hP3) and α‧-U at 580 °C; and (γU,βZr) solid solution (cI2) and α‧-U at 650°, 680° and 710 °C. The α‧-phase was confirmed as a reduced variant of the α-U orthorhombic structure with lattice parameters, a × b × c = 2.65 × 5.40 × 4.75 (Å) with a negligible solubility for Zr at room temperature. Concentration profiles were examined to determine interdiffusion coefficients, integrated interdiffusion coefficients, and intrinsic diffusion coefficients using Boltzmann-Matano, Wagner, and Heumann analyses, respectively. Composition-dependence of interdiffusion coefficients were documented for α-U, δ-UZr2 (at 580 °C) and (γU,βZr) solid solution (at 650°, 680° and 710 °C). U was determined to intrinsically diffuse faster than Zr, approximately by an order of magnitude, in the δ-UZr2 at 580 °C, and (γU,βZr) phases at 650°, 680° and 710 °C. Based on Darken's approach, thermodynamic data available in literature were coupled to estimate the tracer diffusion coefficients and atomic mobilities of U and Zr.
Experiences in accessing the U.S. equity markets
International Nuclear Information System (INIS)
Gosbee, G. F. J.
1998-01-01
This paper was designed to deal with three issues: (1) reasons for the difficulty of attracting U.S. capital into Canada; (2) Canadian companies' need for U.S. capital, and (3) how to successfully attract U.S. capital. As far as the reasons for the difficulties of attracting U.S. capital are concerned, intense world-wide competition for U.S. capital, the relatively small capital needs in Canada, the relatively poorly developed reporting practices, passive management and shareholders, and Canada's more stringent regulatory practices were highlighted as being most responsible. As to whether Canadian companies need U.S. capital, the answer was in the affirmative, citing multiple expansion, shareholder base diversification and the large equity raising power of the U.S. market as contributing factors. With regard to attracting U.S. capital into Canada, the advice given included differentiating the company, adopting U.S. reporting practices, addressing regulatory concerns, obtaining U.S.listings, and outperforming competitors
Split-Family SUSY, U(2)^5 Flavour Symmetry and Neutrino Physics
Jones-Pérez, Joel
2014-01-01
In split-family SUSY, one can use a U(2)^3 symmetry to protect flavour observables in the quark sector from SUSY contributions. However, attempts to extend this procedure to the lepton sector by using an analogous U(2)^5 symmetry fail to reproduce the neutrino data without introducing some form of fine-tuning. In this work, we solve this problem by shifting the U(2)^2 symmetry acting on leptons towards the second and third generations. This allows neutrino data to be reproduced without much difficulties, as well as protecting the leptonic flavour observables from SUSY. Key signatures are a $\\mu\\to e\\gamma$ branching ratio possibly observable in the near future, as well as having selectrons as the lightest sleptons.
Dicty_cDB: Contig-U09412-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U09412-1 gap included 873 3 3953072 3953946 PLUS 1 2 U09412 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09412-1 Contig ID Contig-U09412-1 Contig update 2002. 9.13 Contig sequence >Contig-U09412-1 (Contig...-U09412-1Q) /CSM_Contig/Contig-U09412-1Q.Seq.d ATTATCACAACTATTTTATAATAAACCAATTTTAAAGATTAAAGT...TGGTTCAATAAAAGAAATTAAATATAATTATCAATAAT AATAATAAATTAATTAATAAATTTAAATCAAAA Gap gap included Contig length 873 ...DCQCGFVSVVENNNNNNNNSDNENNENNENNENNE NNEDLEDFIPRKLLKKSSSTLQSRTYLVIYLGRRGILEIWGLKHRSREYFKTIG
Dicty_cDB: Contig-U10996-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG
Heterogeneity in the 238U/235U Ratios of Angrites.
Tissot, F.; Dauphas, N.; Grove, T. L.
2016-12-01
Angrites are differentiated meteorites of basaltic composition, of either volcanic or plutonic origin, that display minimal post-crystallization alteration, metamorphism, shock or impact brecciation. Because quenched angrites cooled very rapidly, all radiochronometric systems closed simultaneously in these samples. Quenched angrites are thus often used as anchors for cross-calibrating short-lived dating methods (e.g., 26Al-26Mg) and the absolute dating techniques (e.g, Pb-Pb). Due to the constancy of the 238U/235U ratio in natural samples, Pb-Pb ages have long been calculated using a "consensus" 238U/235U ratio, but the discovery of resolvable variations in the 238U/235U ratio of natural samples, means that the U isotopic composition of the material to date also has to be determined in order to obtain high-precision Pb-Pb ages. We set out (a) to measure at high-precision the 238U/235U ratio of a large array of angrites to correct their Pb-Pb ages, and (b) to identify whether all angrites have a similar U isotopic composition, and, if not, what were the processes responsible for this variability. Recently, Brennecka & Wadhwa (2012) suggested that the angrite-parent body had a homogeneous 238U/235U ratio. They reached this conclusion partly because they propagated the uncertainties of the U isotopic composition of the various U double spikes that they used onto the final 238U/235U ratio the sample. Because this error is systematic (i.e., it affects all samples similarly), differences in the δ238U values of samples corrected by the same double spike are better known than one would be led to believe if uncertainties on the spike composition are propagated. At the conference, we will present the results of the high-precision U isotope analyses for six angrite samples: NWA 4590, NWA 4801, NWA 6291, Angra dos Reis, D'Orbigny, and Sahara 99555. We will show that there is some heterogeneity in the δ238U values of the angrites and will discuss the possible processes by
IAEA CIELO Evaluation of Neutron-induced Reactions on 235U and 238U Targets
Capote, R.; Trkov, A.; Sin, M.; Pigni, M. T.; Pronyaev, V. G.; Balibrea, J.; Bernard, D.; Cano-Ott, D.; Danon, Y.; Daskalakis, A.; Goričanec, T.; Herman, M. W.; Kiedrowski, B.; Kopecky, S.; Mendoza, E.; Neudecker, D.; Leal, L.; Noguere, G.; Schillebeeckx, P.; Sirakov, I.; Soukhovitskii, E. S.; Stetcu, I.; Talou, P.
2018-02-01
Evaluations of nuclear reaction data for the major uranium isotopes 238U and 235U were performed within the scope of the CIELO Project on the initiative of the OECD/NEA Data Bank under Working Party on Evaluation Co-operation (WPEC) Subgroup 40 coordinated by the IAEA Nuclear Data Section. Both the mean values and covariances are evaluated from 10-5 eV up to 30 MeV. The resonance parameters of 238U and 235U were re-evaluated with the addition of newly available data to the existing experimental database. The evaluations in the fast neutron range are based on nuclear model calculations with the code EMPIRE-3.2 Malta above the resonance range up to 30 MeV. 235U(n,f), 238U(n,f), and 238U(n,γ) cross sections and 235U(nth,f) prompt fission neutron spectrum (PFNS) were evaluated within the Neutron Standards project and are representative of the experimental state-of-the-art measurements. The Standards cross sections were matched in model calculations as closely as possible to guarantee a good predictive power for cross sections of competing neutron scattering channels. 235U(n,γ) cross section includes fluctuations observed in recent experiments. 235U(n,f) PFNS for incident neutron energies from 500 keV to 20 MeV were measured at Los Alamos Chi-Nu facility and re-evaluated using all available experimental data. While respecting the measured differential data, several compensating errors in previous evaluations were identified and removed so that the performance in integral benchmarks was restored or improved. Covariance matrices for 235U and 238U cross sections, angular distributions, spectra and neutron multiplicities were evaluated using the GANDR system that combines experimental data with model uncertainties. Unrecognized systematic uncertainties were considered in the uncertainty quantification for fission and capture cross sections above the thermal range, and for neutron multiplicities. Evaluated files were extensively benchmarked to ensure good performance in
Laurec, J.; Adam, A.; de Bruyne, T.; Bauge, E.; Granier, T.; Aupiais, J.; Bersillon, O.; Le Petit, G.; Authier, N.; Casoli, P.
2010-12-01
The yields of more than fifteen fission products have been carefully measured using radiochemical techniques, for 235U(n,f), 239Pu(n,f) in a thermal spectrum, for 233U(n,f), 235U(n,f), and 239Pu(n,f) reactions in a fission neutron spectrum, and for 233U(n,f), 235U(n,f), 238U(n,f), and 239Pu(n,f) for 14.7 MeV monoenergetic neutrons. Irradiations were performed at the EL3 reactor, at the Caliban and Prospero critical assemblies, and at the Lancelot electrostatic accelerator in CEA-Valduc. Fissions were counted in thin deposits using fission ionization chambers. The number of fission products of each species were measured by gamma spectrometry of co-located thick deposits.
International Nuclear Information System (INIS)
Schneider, B.I.; Collins, L.A.
1985-01-01
Two-state close-coupling calculations have been performed on the X 1 Σsub(g) to b 3 Σsub(u) transition for e-H 2 scattering within the linear algebraic, effective optical potential approach. The strong orthogonality constraint between bound and continuum orbitals is relaxed by including correlation-type configurations. These correlation terms prove to be very important in the 2 Σsub(g) and 2 Σsub(u) symmetries and lead to an increase in the total cross section of a factor of two over earlier approaches, which neglected these terms. Good agreement is obtained with recent R-matrix and Schwinger variational calculations. (author)
International Nuclear Information System (INIS)
Wiblin, R.T.; Edmonds, K.; Ellner, J.J.
1986-01-01
The human macrophage-like cell line U937 spontaneously produces a factor which blocks interleukin-1 (IL-1) activity for mouse thymocytes but not mitosis of T-lymphoblastoid cells. The authors examined the effects of U937 conditioned medium (CM) on other IL-1 activities and on interleukin-2 (IL-2) production. U937 was cultured at 5 x 10 6 /ml in RPMI-1640 at 37 0 C for 5 days. The resulting CM inhibited the mitogenic response of C3H/HeJ mouse thymocytes to an IL-1 standard, with an inhibitory of activity of 6.64 U/ml (1 U = reciprocal dilution producing 50% inhibition of maximal response). Similarly, CM inhibited (10.12 U/ml) the fibroblast stimulation promoter activity of IL-1. The effect of CM on IL-2 production was assessed in a direct assay in which IL-2 production by γ-irradiated (12,000 rads) MLA-144 lymphosarcoma cells was assayed as 3 H-thymidine incorporation in CTLL-20 cells. The suppressive activity of CM was 4.95 U/ml; CM did not interfere with the response of CTLL-20 to IL-2. These studies establish that U937 produces factors with multiple, related biological activities; U937 CM blocks IL-2 dependent (thymocyte mitogenesis) and IL-2 independent (fibroblast proliferation) IL-1 activities and interferes with production of, but not response to, IL-2. U937 is an excellent model to study growth inhibitory properties of mononuclear phagocytes
Complete braided adsorbent for marine testing to demonstrate 3g-U/kg-adsorbent
Energy Technology Data Exchange (ETDEWEB)
Janke, Chris [ORNL; Yatsandra, Oyola [ORNL; Mayes, Richard [ORNL; none,; Gill, Gary [PNNL; Li-Jung, Kuo [PNNL; Wood, Jordana [PNNL; Sadananda, Das [ORNL
2014-04-30
ORNL has manufactured four braided adsorbents that successfully demonstrated uranium adsorption capacities ranging from 3.0-3.6 g-U/kg-adsorbent in marine testing at PNNL. Four new braided and leno woven fabric adsorbents have also been prepared by ORNL and are currently undergoing marine testing at PNNL.
Preparation of 235mU targets for 235U(n,n')235mU cross section measurements
International Nuclear Information System (INIS)
Bond, E.M.; Vieira, D.J.; Rundberg, R.S.; Glover, S.; Hynek, D.; Jansen, Y.; Becker, J.; Macri, R.
2008-01-01
This paper describes the preparation of samples for an experiment to measure the cross-section for 235 U(n,n') 235m U in a fast fission spectrum of neutrons provided by a fast pulsed reactor/critical assembly. Samples of 235m U have been prepared for the calibration of the internal conversion electron detector that is used for the 235m U measurement. Two methods are described for the preparation of 235 mU. The first method used a U-Pu chemical separation based on anion-exchange chromatography and the second method used an alpha recoil collection method. Thin, uniform samples of 235m U+ 235 U were prepared for the experiment using electrodeposition. (author)
Dicty_cDB: Contig-U12399-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL
2010-09-08
...'s guide titled, ``ICLUS v1.3 User's Manual: ArcGIS Tools and Datasets for Modeling U.S. Housing...: ``ICLUS v1.3 User's Manual: ArcGIS Tools and Datasets for Modeling U.S. Housing Density Growth'' and the... final document title, ``ICLUS v1.3 User's Manual: ArcGIS Tools and Datasets for Modeling U.S. Housing...
A thermal conductivity model for U-Si compounds
Energy Technology Data Exchange (ETDEWEB)
Zhang, Yongfeng [Idaho National Lab. (INL), Idaho Falls, ID (United States); Andersson, Anders David Ragnar [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-02-02
U3Si2 is a candidate for accident tolerant nuclear fuel being developed as an alternative to UO2 in commercial light water reactors (LWRs). One of its main benefits compared to UO2 is higher thermal conductivity that increases with temperature. This increase is contrary to UO2, for which the thermal conductivity decreases with temperature. The reason for the difference is the electronic origin of thermal conductivity in U3Si2, as compared to the phonon mechanism responsible for thermal transport in UO2. The phonon thermal conductivity in UO2 is unusually low for a fluorite oxide due to the strong interaction with the spins in the paramagnetic phase. The thermal conductivity of U3Si2 as well as other U-Si compounds has been measured experimentally [1-4]. However, for fuel performance simulations it is also critical to model the degradation of the thermal conductivity due to damage and microstructure evolution caused by the reactor environment (irradiation and high temperature). For UO2 this reduction is substantial and it has been the topic of extensive NEAMS research resulting in several publications [5, 6]. There are no data or models for the evolution of the U3Si2 thermal conductivity under irradiation. We know that the intrinsic thermal conductivities of UO2 (semi-conductor) and U3Si2 (metal) are very different, and we do not necessarily expect the dependence on damage to be the same either, which could present another advantage for the silicide fuel. In this report we summarize the first step in developing a model for the thermal conductivity of U-Si compounds with the goal of capturing the effect of damage in U3Si2. Next year, we will focus on lattice damage. We will also attempt to assess the impact of fission gas bubbles.
Dicty_cDB: Contig-U12545-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s
Ducassou, Lionel; Dhers, Laura; Jonasson, Gabriella; Pietrancosta, Nicolas; Boucher, Jean-Luc; Mansuy, Daniel; André, François
2017-09-01
Human cytochrome P450 2U1 (CYP2U1) is an orphan CYP that exhibits several distinctive characteristics among the 57 human CYPs with a highly conserved sequence in almost all living organisms. We compared its protein sequence with those of the 57 human CYPs and constructed a 3D structure of a full-length CYP2U1 model bound to a POPC membrane. We also performed docking experiments of arachidonic acid (AA) and N-arachidonoylserotonin (AS) in this model. The protein sequence of CYP2U1 displayed two unique characteristics when compared to those of the human CYPs, the presence of a longer N-terminal region upstream of the putative trans-membrane helix (TMH) containing 8 proline residues, and of an insert of about 20 amino acids containing 5 arginine residues between helices A' and A. Its N-terminal part upstream of TMH involved an additional short terminal helix, in a manner similar to what was reported in the crystal structure of Saccharomyces cerevisiae CYP51. Our model also showed a specific interaction between the charged residues of insert AA' and phosphate groups of lipid polar heads, suggesting a possible role of this insert in substrate recruitment. Docking of AA and AS in this model showed these substrates in channel 2ac, with the terminal alkyl chain of AA or the indole ring of AS close to the heme, in agreement with the reported CYP2U1-catalyzed AA and AS hydroxylation regioselectivities. This model should be useful to find new endogenous or exogenous CYP2U1 substrates and to interpret the regioselectivity of their hydroxylation. Copyright © 2017 Elsevier B.V. and Société Française de Biochimie et Biologie Moléculaire (SFBBM). All rights reserved.
DENSITY-FUNCTIONAL STUDY OF U-Mo AND U-Zr ALLOYS
Energy Technology Data Exchange (ETDEWEB)
Landa, A; Soderlind, P; Turchi, P A
2010-11-01
Density-functional theory previously used to describe phase equilibria in U-Zr alloys [A. Landa, P. Soederlind, P.E.A. Turchi, J. Alloys Comp. 478 (2009) 103-110] is extended to investigate the ground-state properties of U-Mo solid solutions. We discuss how the heat of formation in both alloys correlates with the charge transfer between the alloy components, and how the specific behavior of the density of states in the vicinity of the Fermi level promotes the stabilization of the U{sub 2}Mo compound. Our calculations prove that, due to the existence of a single {gamma}-phase over the typical fuel operation temperatures, {gamma}-U-Mo alloys should indeed have much lower constituent redistribution than {gamma}-U-Zr alloys for which binodal decomposition causes a high degree of constituent redistribution.
Influence of the chemical composition and temperature in the mechanical behaviour of U3O8-Al cermets
International Nuclear Information System (INIS)
Ferreira, P.I.; Figueredo, A.M. de
1982-01-01
U 3 O 8 -Al nuclear cermets, with U 3 O 8 content varying from zero to 80 wt%, were prepared by rotary swaging of U 3 O 8 -Al compacts at 500 0 C. Specimens were fabricated from these materials and tensile tested at the temperatures 25 0 , 200 0 , 300 0 and 400 0 C at a strain rate of 4.3 x 10 - 5 s - 1 . The yield stress σ sub(E) and the ultimate tensile strength σ sub(R), were analysed as a function of the test temperature and cermet composition. The results show that the dependence of σ sub(E) and σ sub(R) on composition can be explained in terms of the variation of the minimum load bearing cross-sectional area of the aluminum matrix with U 3 O 8 concentration. The temperature dependence of σ sub(R) and σ sub(E) of the cermets was seen to be similar to the temperature dependence of these parameters of the aluminum matrix. (Author) [pt
Directory of Open Access Journals (Sweden)
Gorev Vasily
2018-01-01
Full Text Available A time-saving approach to perform technical calculations of thermal conditions of orbital motion of 3U CubeSat nanosatellite was applied, which made it possible to make the thermal calculations of a satellite with simple structure geometry using MatLab and SolidWorks Simulation. Passive thermal regulation facilities are sufficient for a 3U CubeSat to provide thermal conductivity of the case’s structural elements and to remove heat from the lighted surface and internal components to the satellite’s shadowed surface. Application of spectrally selective coatings allows narrowing the range of surface temperatures of 3U CubeSat.
Directory of Open Access Journals (Sweden)
Igor Salom
2017-07-01
Full Text Available We construct the three-body permutation symmetric hyperspherical harmonics to be used in the non-relativistic three-body Schrödinger equation in three spatial dimensions (3D. We label the state vectors according to the S3⊗SO(3rot⊂O(2⊗SO(3rot⊂U(3⋊S2⊂O(6 subgroup chain, where S3 is the three-body permutation group and S2 is its two element subgroup containing transposition of first two particles, O(2 is the “democracy transformation”, or “kinematic rotation” group for three particles; SO(3rot is the 3D rotation group, and U(3,O(6 are the usual Lie groups. We discuss the good quantum numbers implied by the above chain of algebras, as well as their relation to the S3 permutation properties of the harmonics, particularly in view of the SO(3rot⊂SU(3 degeneracy. We provide a definite, practically implementable algorithm for the calculation of harmonics with arbitrary finite integer values of the hyper angular momentum K, and show an explicit example of this construction in a specific case with degeneracy, as well as tables of K≤6 harmonics. All harmonics are expressed as homogeneous polynomials in the Jacobi vectors (λ,ρ with coefficients given as algebraic numbers unless the “operator method” is chosen for the lifting of the SO(3rot⊂SU(3 multiplicity and the dimension of the degenerate subspace is greater than four – in which case one must resort to numerical diagonalization; the latter condition is not met by any K≤15 harmonic, or by any L≤7 harmonic with arbitrary K. We also calculate a certain type of matrix elements (the Gaunt integrals of products of three harmonics in two ways: 1 by explicit evaluation of integrals and 2 by reduction to known SU(3 Clebsch–Gordan coefficients. In this way we complete the calculation of the ingredients sufficient for the solution to the quantum-mechanical three-body bound state problem.
Intenzitet stresa kod učitelja u osnovnim školama
Tomašević, Suzana; Horvat, Gordana; Leutar, Zdravka; Horvat, Gordana
2016-01-01
Cilj ovog rada bio je istražiti intenzitet stresa kod učitelja razredne i predmetne nastave u seoskim i gradskim osnovnim školama. Ovim istraživanjem želi se utvrditi postoji li statistički značajna razlika u intenzitetu stresa između učitelja razredne nastave i učitelja predmetne nastave s obzirom na mjesto rada, selo ili grad. U istraživanju je korišten psihologijski instrument za mjerenje percepcije stresa (PerceivedStressScale) (Cohen, S., Kamarck, T, Mermelstein, R. 1983). Istraživanj...
Nitridation of U and Pu recovered in liquid Cd cathode by molten salt electrorefining of (U,Pu)N
Energy Technology Data Exchange (ETDEWEB)
Satoh, Takumi; Iwai, Takashi; Arai, Yasuo [Japan Atomic Energy Agency (Japan)
2009-06-15
Solid solutions of actinide mono-nitrides have been proposed as a candidate fuel of the accelerator-driven system (ADS) and Gen.IV-type fast reactors because the thermal conductivity and metal density are higher than those of actinide oxides and also they have high melting temperature. Pyrochemical process has several advantages over conventional wet process in treating of spent nitride fuel. One of the key technologies of the pyrochemical reprocessing of nitride fuel is the formation of the nitrides from actinides in the liquid Cd cathode. The nitridation-distillation combined method was developed and has been adopted to convert the actinides to the nitrides. In this method, the nitridation of actinides and the distillation of Cd occurred simultaneously by heating the actinide-Cd alloys in N{sub 2} gas stream. In the present study, the nitride formation behavior of U and Pu recovered in Cd cathode by molten salt electrorefining of (U,Pu)N was experimentally investigated. In addition, the nitride pellet was prepared form the powder obtained by the nitridation of U and Pu recovered in Cd cathode. (U,Pu)N (PuN = 80 mol %) was used as the starting material in the experiment. Molten salt electrorefining of (U,Pu)N pellet was carried out in the LiCl-KCl eutectic salt with 1.2 wt% PuCl{sub 3} and 0.3 wt% UCl{sub 3} of about 110 g at the constant anodic potential of -0.60 to -0.55 V vs. Ag/AgCl for about 9 hours at 773 K. After the electrorefining, about 42 % of U and Pu in the starting (U,Pu)N pellet was dissolved at the anode and recovered into the liquid Cd cathode. The recovered U-Pu-Cd alloy was heated in an alumina crucible at 973 K for 10 hours under N{sub 2} gas (99.999 %) stream (0.015 L/min). Fine black powder was recovered after heating the U-Pu-Cd alloy. The powder was identified as the single phase solid solution of (U,Pu)N by the XRD analysis. After milling in the agate mortar for 1 hour, the powder was compacted into green pellet under a pressure of about
A COMPARISON OF (PuU)C AND (PuU)O$sub 2$ FUELED FAST BREEDER REACTORS
Energy Technology Data Exchange (ETDEWEB)
Kazi, A. Halim; Rosen, Stanley
1963-11-15
BS>A conceptual evaluation is presented of a (PuU)C 500Mw(e) reactor which uses a moderate power generation of 40 kw/ft and a maximum fuel temperature of 2900 deg F, well below the 4500 deg F melting point of Pu/sub 0.2/U/sub 0.8/C. The principal design characteristics and fuel cycle costs are tabulated together with those of a (PuU)O/sub 2/ design of equal power. The comparison shows that the carbide core has significant economic and safety advantages over the oxide core. (D.L.C.)
Dicty_cDB: Contig-U16457-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U16457-1 no gap 1065 3 996438 997502 PLUS 6 5 U16457 0 0 1 0 1 0 2 0 0 0 0 0 1 1 Show Contig...-U16457-1 Contig ID Contig-U16457-1 Contig update 2004. 6.11 Contig sequence >Contig-U16457-1 (Contig...-U16457-1Q) /CSM_Contig/Contig-U16457-1Q.Seq.d ACAATTGGTGTTGCTGCTCTATTCGGTCTTCCAGCTATGGCACGTTCCGC A...TTTAACAAGATTGGAAGAC CAAAAAGAAAAAAAA Gap no gap Contig length 1065 Chromosome numb... Translated Amino Acid sequence TIGVAALFGLPAMARSAAMSLVFLIPFMWIVFSVHYPINSVVADICMSYNNNTGSIEQQL ANYTNPIVSEIFGTC
Dicty_cDB: Contig-U10709-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT
Environmental control of U concentration and 234U/238U in speleothems at subannual resolution
Hu, C.; Henderson, G. M.
2003-12-01
Trace element and isotope variability in speleothems encodes a range of information about the past environment, although its interpretation is often problematic. U concentration and isotopes have frequently been analysed in speleothems in order to provide chronology, but their use as environmental proxies in their own right has not been comprehensively investigated. In this study, we have investigated the environmental controls of U in a stalagmite from the Central Yangtze Valley in China. This stalagmite grew rapidly throughout the Holocone and contains visible annual layers about 300microns thick. Analysis of a portion of the stalagmite corresponding to the 1970s by electron probe, LA-ICP-MS, and by physical subsampling indicate clear annual cycles in Sr/Ca, Mg/Ca, and Ba/Ca. The reasonably open cave structure and the correlation of Sr/Ca with Mg/Ca suggest that temperature exerts considerable control over these trace element variations. U/Ca also varies seasonally by up to 42 % and shows a clear anti-correlation with Mg/Ca (correlation coefficient -0.64). Based on the inverse relationship between U/Ca and temperature exhibited in other carbonates (e.g. corals) the speleothem U/Ca is suggested to be controlled primarily by temperature and may provide a paleo cave thermometer with less rainfall influence than Mg/Ca. Ongoing monitoring of the cave temperature and humidity will assess the robustness of this conclusion and the sensitivity of speleothem U/Ca to temperature. (234U/238U) in this stalagmite range from 1.733 to 1.872 during the Holocene. The U concentration is high enough (typically 0.48 ppm) and growth rate fast enough, that (234U/238U) can also be measured at a subannual resolution. The expected alpha-recoil control of excess 234U supply suggests that these measurements may provide a measure of the transit time of recharge waters to the stalagmite during the seasonal cycle. Such a proxy would enable deconvolution of temperature and recharge-rate control
A Realistic $U(2)$ Model of Flavor arXiv
Linster, Matthias
We propose a simple $U(2)$ model of flavor compatible with an $SU(5)$ GUT structure. All hierarchies in fermion masses and mixings arise from powers of two small parameters that control the $U(2)$ breaking. In contrast to previous $U(2)$ models this setup can be realized without supersymmetry and provides an excellent fit to all SM flavor observables including neutrinos. We also consider a variant of this model based on a $D_6 \\times U(1)_F$ flavor symmetry, which closely resembles the $U(2)$ structure, but allows for Majorana neutrino masses from the Weinberg operator. Remarkably, in this case one naturally obtains large mixing in the lepton sector from small mixing in the quark sector. The model also offers a natural option for addressing the Strong CP Problem and Dark Matter by identifying the Goldstone boson of the $U(1)_F$ factor as the QCD axion.
Dicty_cDB: Contig-U04334-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U04334-1 no gap 399 4 3746420 3746021 MINUS 3 3 U04334 0 0 0 0 0 0 3 0 0 0 0 0 0 0 Show Contig...-U04334-1 Contig ID Contig-U04334-1 Contig update 2001. 8.29 Contig sequence >Contig-U04334-1 (Contig...-U04334-1Q) /CSM_Contig/Contig-U04334-1Q.Seq.d CAAAAAAAAAAAAGTAAAACAATAAATTATATAAAAAAAATAAAAAAAAT...CTAATTTCA AACAATATCAATAAAATGTTATATAATTACTATTAAAATGAAAAAAAAA Gap no gap Contig len...ce QKKKSKTINYIKKIKKMSIINTISKLSLSNSLKSNITIGNLNGTTVNNYTHNETSSKFTE FFYKII*qnkrwf*kvkelnkkkrkkdyiissfcklysiyfvfs
Grbeša, Dubravka; Ivandić, Ante; Jovanovac, Marija; Prpić, Ivana; Kuveždić, Marija
1989-01-01
Ispitivali smo dinamiku sekrecije insulina i C-peptida, te lipoproteinski status u 43 bolesnika (27 pretilih i 16 normalne tjelesne mase) sa insulin neovisnom šećernom bolešću. Našli smo signifikantno više vrijednosti kolesterola i triglicerida, dok je HDL2 bio signifikantno niži u pretilih bolesnika. Nije bilo statistički značajnijih razlika u koncentracijama LDL a, HDL-a i HDL3. Koncentracije insulina, i bazalnog i stimuliranog, bile su nesignifikantno, a C-peptida signifikantno povišene u ...
Assessment of semi-empirical potentials for the U-Si system
Energy Technology Data Exchange (ETDEWEB)
Baskes, Michael I. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Andersson, Anders David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2016-02-03
Accident tolerant fuels (ATF) are being developed in response to the Fukushima Daiichi accident in Japan. One of the options being pursued is U-Si fuels, such as the U3Si2 and U3Si5 compounds, which benefit from high thermal conductivity (metallic) compared to the UO2 fuel (semi-conductor) used in current Light Water Reactors (LWRs). The U-Si fuels also have higher fissile density. In order to perform meaningful engineering scale nuclear fuel performance simulations, the material properties of the fuel, including the response to irradiation environments, must be known. Unfortunately, the data available for U-Si fuels are rather limited, in particular for the temperature range where LWRs would operate. The ATF HIP is using multi-scale modeling and simulations to address this knowledge gap. Even though Density Functional Theory (DFT) calculations can provide useful answers to a subset of problems, they are computationally too costly for many others, including properties governing microstructure evolution and irradiation effects. For the latter, semi-empirical potentials are typically used. Unfortunately, there is currently no potential for the U-Si system. In this brief report we present initial results from the development of a U-Si semi-empirical potential based on the Modified Embedded Atom Method (MEAM). The potential should reproduce relevant parts of the U-Si phase diagram as well as defect properties important in irradiation environments. This work also serves as an assessment of the general challenges associated with the U-Si system, which will be valuable for the efforts to develop a U-Si Tersoff potential undertaken by Idaho National Laboratory (also part of the ATF HIP). Going forward the main potential development activity will reside at INL and the work presented here is meant to provide input data and guidelines for that activity. The main focus of our work is on the U3Si2 and U3Si5
Paramagnetic properties of the (U1-xTbx)Co2Ge2 solid solutions
International Nuclear Information System (INIS)
Kuznietz, Moshe; Pinto, Haim; Ettedgui, Hanania
1995-01-01
Polycrystalline (U 1-x Tb x )Co 2 Ge 2 solid solutions have the ThCr 2 Si 2 -type crystal structure and order antiferromagnetically. AC-susceptibility at 80-295 K yields paramagnetic Curie temperatures θ=-350±50, -15±5, -50±15, -12±5, and -80±5 K, and effective magnetic moments μ eff =4.5, 5.9, 7.3, 8.5, and 12.0 (±0.5)μ B , for samples with x=0, 0.25, 0.50, 0.75 and 1, respectively. The high μ eff values are related to occurrence of paramagnetic moments on U, Tb and Co, of which only U and Tb moments order magnetically. ((orig.))
U.S., U.S.S.R. Marine Expedition
Wainger, Lisa A.
An historic expedition involving U.S. and U.S.S.R. scientists may open a new era of cooperation in marine research. A University of California, San Diego/Scripps Institution of Oceanography ship carrying a team that includes two Soviet scientists is on an expedition that will take the R/V Thomas Washington into the Exclusive Economic Zone (EEZ) of the U.S.S.R. For the first time in a decade a U.S. research vessel has been given permission to operate in the Soviet Union's EEZ, according to Department of State representative Tom Cocke, who worked with Scripps on this project. The ship will also operate in the U.S. EEZ and international waters.
Informacioni sistemi u upravljanju rizicima u životnoj sredini
Directory of Open Access Journals (Sweden)
Dejan Inđić
2013-02-01
Full Text Available Normal 0 MicrosoftInternetExplorer4 Sažetak: Zemljotresi, poplave, nuklearni i hemijski akcidenti, zagađivanje vazduha, zemljišta i voda, ukazuju na sve veće prisustvo nesreća nastalih intenzivnim razvojem i često nekontrolisanom primenom tehnološkog razvoja. Pred društvo se postavlja problem kako se što bolje pripremiti, kako obezbediti veću usklađenost i funkcionisanje aktivnosti i mera za sprečavanje nastanka akcidentnih situacija i kako uneti promene u društveni i tehnološki razvoj koje će ići u korist prirode, ali i za dobrobit budućih generacija. U radu je prikazano korišćenje različitih informacionih sistema (IS u upravljanju rizicima u životnoj sredini i predlog za izradu jedinstvenog IS u Republici Srbiji.
q-deformation of ''W3'', Virasoro and U(1)-Kac-Moody algebras
International Nuclear Information System (INIS)
El Hassouni, A.; Tahri, E.H.; Zakkari, M.
1995-07-01
A deformation of the algebra of infinite matrices gl(∞, C) is given. We show that this operation leads to the realization of a deformed ''W 3 '' like algebra. The central extension of the q-U(1) Kac-Moody and the q-Virasoro algebra is performed. (author). 10 refs
Υ production in U + U collisions at √{sN N}=193 GeV measured with the STAR experiment
Adamczyk, L.; Adkins, J. K.; Agakishiev, G.; Aggarwal, M. M.; Ahammed, Z.; Alekseev, I.; Anderson, D. M.; Aoyama, R.; Aparin, A.; Arkhipkin, D.; Aschenauer, E. C.; Ashraf, M. U.; Attri, A.; Averichev, G. S.; Bai, X.; Bairathi, V.; Bellwied, R.; Bhasin, A.; Bhati, A. K.; Bhattarai, P.; Bielcik, J.; Bielcikova, J.; Bland, L. C.; Bordyuzhin, I. G.; Bouchet, J.; Brandenburg, J. D.; Brandin, A. V.; Bunzarov, I.; Butterworth, J.; Caines, H.; Calderón de la Barca Sánchez, M.; Campbell, J. M.; Cebra, D.; Chakaberia, I.; Chaloupka, P.; Chang, Z.; Chatterjee, A.; Chattopadhyay, S.; Chen, J. H.; Chen, X.; Cheng, J.; Cherney, M.; Christie, W.; Contin, G.; Crawford, H. J.; Das, S.; De Silva, L. C.; Debbe, R. R.; Dedovich, T. G.; Deng, J.; Derevschikov, A. A.; Didenko, L.; Dilks, C.; Dong, X.; Drachenberg, J. L.; Draper, J. E.; Du, C. M.; Dunkelberger, L. E.; Dunlop, J. C.; Efimov, L. G.; Engelage, J.; Eppley, G.; Esha, R.; Esumi, S.; Evdokimov, O.; Eyser, O.; Fatemi, R.; Fazio, S.; Federic, P.; Fedorisin, J.; Feng, Z.; Filip, P.; Finch, E.; Fisyak, Y.; Flores, C. E.; Fulek, L.; Gagliardi, C. A.; Garand, D.; Geurts, F.; Gibson, A.; Girard, M.; Greiner, L.; Grosnick, D.; Gunarathne, D. S.; Guo, Y.; Gupta, A.; Gupta, S.; Guryn, W.; Hamad, A. I.; Hamed, A.; Haque, R.; Harris, J. W.; He, L.; Heppelmann, S.; Heppelmann, S.; Hirsch, A.; Hoffmann, G. W.; Horvat, S.; Huang, H. Z.; Huang, B.; Huang, T.; Huang, X.; Huck, P.; Humanic, T. J.; Igo, G.; Jacobs, W. W.; Jentsch, A.; Jia, J.; Jiang, K.; Jowzaee, S.; Judd, E. G.; Kabana, S.; Kalinkin, D.; Kang, K.; Kauder, K.; Ke, H. W.; Keane, D.; Kechechyan, A.; Khan, Z.; Kikoła, D. P.; Kisel, I.; Kisiel, A.; Kochenda, L.; Koetke, D. D.; Kosarzewski, L. K.; Kraishan, A. F.; Kravtsov, P.; Krueger, K.; Kumar, L.; Lamont, M. A. C.; Landgraf, J. M.; Landry, K. D.; Lauret, J.; Lebedev, A.; Lednicky, R.; Lee, J. H.; Li, Y.; Li, C.; Li, X.; Li, W.; Li, X.; Lin, T.; Lisa, M. A.; Liu, F.; Liu, Y.; Ljubicic, T.; Llope, W. J.; Lomnitz, M.; Longacre, R. S.; Luo, X.; Luo, S.; Ma, G. L.; Ma, R.; Ma, L.; Ma, Y. G.; Magdy, N.; Majka, R.; Manion, A.; Margetis, S.; Markert, C.; Matis, H. S.; McDonald, D.; McKinzie, S.; Meehan, K.; Mei, J. C.; Miller, Z. W.; Minaev, N. G.; Mioduszewski, S.; Mishra, D.; Mohanty, B.; Mondal, M. M.; Morozov, D. A.; Mustafa, M. K.; Nandi, B. K.; Nasim, Md.; Nayak, T. K.; Nigmatkulov, G.; Niida, T.; Nogach, L. V.; Nonaka, T.; Novak, J.; Nurushev, S. B.; Odyniec, G.; Ogawa, A.; Oh, K.; Okorokov, V. A.; Olvitt, D.; Page, B. S.; Pak, R.; Pan, Y. X.; Pandit, Y.; Panebratsev, Y.; Pawlik, B.; Pei, H.; Perkins, C.; Pile, P.; Pluta, J.; Poniatowska, K.; Porter, J.; Posik, M.; Poskanzer, A. M.; Pruthi, N. K.; Przybycien, M.; Putschke, J.; Qiu, H.; Quintero, A.; Ramachandran, S.; Ray, R. L.; Reed, R.; Rehbein, M. J.; Ritter, H. G.; Roberts, J. B.; Rogachevskiy, O. V.; Romero, J. L.; Roth, J. D.; Ruan, L.; Rusnak, J.; Rusnakova, O.; Sahoo, N. R.; Sahu, P. K.; Sakrejda, I.; Salur, S.; Sandweiss, J.; Sarkar, A.; Schambach, J.; Scharenberg, R. P.; Schmah, A. M.; Schmidke, W. B.; Schmitz, N.; Seger, J.; Seyboth, P.; Shah, N.; Shahaliev, E.; Shanmuganathan, P. V.; Shao, M.; Sharma, M. K.; Sharma, A.; Sharma, B.; Shen, W. Q.; Shi, Z.; Shi, S. S.; Shou, Q. Y.; Sichtermann, E. P.; Sikora, R.; Simko, M.; Singha, S.; Skoby, M. J.; Smirnov, D.; Smirnov, N.; Solyst, W.; Song, L.; Sorensen, P.; Spinka, H. M.; Srivastava, B.; Stanislaus, T. D. S.; Stepanov, M.; Stock, R.; Strikhanov, M.; Stringfellow, B.; Sugiura, T.; Sumbera, M.; Summa, B.; Sun, Y.; Sun, Z.; Sun, X. M.; Surrow, B.; Svirida, D. N.; Tang, Z.; Tang, A. H.; Tarnowsky, T.; Tawfik, A.; Thäder, J.; Thomas, J. H.; Timmins, A. R.; Tlusty, D.; Todoroki, T.; Tokarev, M.; Trentalange, S.; Tribble, R. E.; Tribedy, P.; Tripathy, S. K.; Tsai, O. D.; Ullrich, T.; Underwood, D. G.; Upsal, I.; Van Buren, G.; van Nieuwenhuizen, G.; Varma, R.; Vasiliev, A. N.; Vertesi, R.; Videbæk, F.; Vokal, S.; Voloshin, S. A.; Vossen, A.; Wang, G.; Wang, J. S.; Wang, F.; Wang, Y.; Wang, Y.; Webb, J. C.; Webb, G.; Wen, L.; Westfall, G. D.; Wieman, H.; Wissink, S. W.; Witt, R.; Wu, Y.; Xiao, Z. G.; Xie, G.; Xie, W.; Xin, K.; Xu, Z.; Xu, H.; Xu, N.; Xu, J.; Xu, Y. F.; Xu, Q. H.; Yang, Y.; Yang, Y.; Yang, S.; Yang, Q.; Yang, Y.; Yang, C.; Ye, Z.; Ye, Z.; Yi, L.; Yip, K.; Yoo, I.-K.; Yu, N.; Zbroszczyk, H.; Zha, W.; Zhang, J.; Zhang, Z.; Zhang, J.; Zhang, S.; Zhang, X. P.; Zhang, J. B.; Zhang, Y.; Zhang, S.; Zhao, J.; Zhong, C.; Zhou, L.; Zhu, X.; Zoulkarneeva, Y.; Zyzak, M.; STAR Collaboration
2016-12-01
We present a measurement of the inclusive production of Υ mesons in U+U collisions at √{sN N}=193 GeV at midrapidity (|y |<1 ). Previous studies in central Au+Au collisions at √{sN N}=200 GeV show a suppression of Υ (1S+2S+3S) production relative to expectations from the Υ yield in p+p collisions scaled by the number of binary nucleon-nucleon collisions (Ncoll), with an indication that the Υ (1S) state is also suppressed. The present measurement extends the number of participant nucleons in the collision (Npart) by 20% compared to Au+Au collisions, and allows us to study a system with higher energy density. We observe a suppression in both the Υ (1 S +2 S +3 S ) and Υ (1 S ) yields in central U+U data, which consolidates and extends the previously observed suppression trend in Au+Au collisions.
Kinetics of U(VI) reduction control kinetics of U(IV) reoxidation
International Nuclear Information System (INIS)
Senko, J.M.; Minyard, M.L.; Dempsey, B.A.; Roden, E.E.; Yeh, G.-T.; Burgos, W.D.
2006-01-01
For the in situ reductive immobilization of U to be an acceptable strategy for the removal of that element from groundwater, the long-term stability of U(IV) must be determined. Rates of biotransformation of Fe species influence the mineralogy of the resulting products (Fredrickson et al., 2003; Senko et al., 2005), and we hypothesize that the rate of U(VI) reduction influences the mineralogy of resultant U(IV) precipitates. We hypothesize that slower rates of U(VI) reduction will yield U(IV) phases that are more resistant to reoxidation, and will therefore be more stable upon cessation of electron donor addition. U(IV) phases formed by relatively slow reduction may be more crystalline or larger in comparison to their relatively rapidly-formed counterparts (Figure 1), thus limiting the reactivity of slowly-formed U(IV) phases toward various oxidants. The physical location of U(IV) precipitates relative to bacterial cells may also limit the reactivity of biogenic U(IV) phases. In this situation, we expect that precipitation of U(IV) within the bacterial cell may protect U(IV) from reoxidation by limiting physical contact between U(IV) and oxidants (Figure 1). We assessed the effect of U(VI) reduction rate on the subsequent reoxidation of biogenic U(IV) and are currently conducting column scale studies to determine whether U(VI) reduction rate can be manipulated by varying the electron donor concentration used to stimulate U(VI) reduction
31 CFR 800.226 - U.S. business.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false U.S. business. 800.226 Section 800... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.226 U.S. business. The term U.S. business means any entity... subsidiary is a U.S. business. Corporation A and its branch or subsidiary is each also a foreign person...
Dicty_cDB: Contig-U09615-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1
Perspektive promidžbe u XXI. stoljeću
Haramija, Predrag; Njavro, Đuro; Propat Darrer, Jagoda
2012-01-01
Otkriće i primjena novih postupaka u promidžbi ovisna je o dvjema vrstama silnica; s jedne strane, o novim tehničkim ili tehnološkim otkrićima glede sredstava komunikacije, a s druge strane o novim situacijama odnosno okolnostima u gospodarskome i društvenom okružju. U radu se prikazuje dosadašnji razvoj i istražuju moguće dominantne tendencije promidžbe u XXI. stoljeću. Početak XXI. stoljeća obilježava zasićenost potrošača mnoštvom promidžbenih poruka i sve veće nepovjerenje u njih, s...
Refractory material crucibles evaluation for U evaporation
Energy Technology Data Exchange (ETDEWEB)
Damiao, A.J.; Vasconcelos, G.; Silveira, C.A.B.; Rodrigues, N.A.S. [Centro Tecnico Aeroespacial (CTA-IEAv), Sao Jose dos Campos, SP (Brazil). Inst. de Estudos Avancados
1996-12-31
In studies that involve small amounts of U vapor generation, such as spectroscopy or thin films, most of the E-gun power is delivered to the cooling system. Normally crucibles are used as container and thermal insulator. Since liquid U is extremely reactive at evaporation temperatures, the crucibles are seriously attacked, decreasing the insulation efficiency and adding contaminants to the U vapor. There is no complete solution for the problem, however, with a careful choice of materials, one can design crucibles with extended lifetime and reduced contamination. This work reports some preliminary results we have obtained in the assessing of crucible materials and design, such as, graphite, Si C, vitreous carbon and Al{sub 2} O{sub 3}. (author) 1 refs., 3 figs.,2 tabs.
Dicty_cDB: Contig-U09694-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U09694-1 gap included 1129 1 4027135 4026071 MINUS 3 4 U09694 2 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09694-1 Contig ID Contig-U09694-1 Contig update 2002. 9.13 Contig sequence >Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U0969...TTAAATTAAAACAACAACAATTTCATAATATAAATAAT Gap gap included Contig length 1129 Chromosome number (1..6, M) 1 Chr...iklkqqqfklkqqqfhninn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig...E Sequences producing significant alignments: (bits) Value Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig
The synthesis of [U-14C phenyl] LS 840606, an agricultural fungicide
International Nuclear Information System (INIS)
Madegard, G.; Mestre, P.; Raimond, P.; Noel, J.-P.
1995-01-01
2,2',4'-Trichloro-[ring U- 14 C]acetophenone was the key intermediate of this synthesis patterned after the industrial route. An unexpected poor yield was observed during the preparation by the Friedel-Crafts reaction of chloroacetyl chloride with 1,3-dichloro-[U- 14 C]benzene, possibly the result of an isotope effect although this poor yield might be explained by other factors. Two routes were checked for the preparation of 1,3-dichloro-[U- 14 C]benzene. The action of CCl 4 with 1,3-dinitro-[U- 14 C]benzene at 280 o C was entailed with explosions. A safer route started from [U- 14 C]aniline via 2,4-dichloro-[ring U- 14 C]acetanilide. Friedel-Crafts reaction with acetyl chloride gave rise in 52% yield to 2',4'-dichloro-[ring U- 14 C]acetophenone which was brominated to 2-bromo-2',4'-dichloro-[ring U- 14 C]acetophenone; was condensed with 2,2-ethylenedioxy)etylmagnesium bromide to compound, was condensed with 1,2,4-triazole then successively treated with HCl:water:dioxane and 2,2,2-trifluoroethanol/HCl. Separation of the two diastereomers by medium pressure liquid chromatography. 7% overall radioactivity yield from [U- 14 C]aniline. Radiochemical purity 99%. (author)
U.S. ozone air quality under changing climate and anthropogenic emissions.
Racherla, Pavan N; Adams, Peter J
2009-02-01
We examined future ozone (O3) air quality in the United States (U.S.) under changing climate and anthropogenic emissions worldwide by performing global climate-chemistry simulations, utilizing various combinations of present (1990s) and future (Intergovernmental Panel on Climate Change (IPCC) Special Report on Emissions Scenarios (SRES) A2 2050s) climates, and present and future (2050s; IPCC SRES A2 and B1) anthropogenic emissions. The A2 climate scenario is employed here because it lies at the upper extreme of projected climate change for the 21st century. To examine the sensitivity of U.S. O3 to regional emissions increases (decreases), the IPCC SRES A2 and B1 scenarios, which have overall higher and lower O3-precursor emissions for the U.S., respectively, have been chosen. We find that climate change, by itself, significantly worsens the severity and frequency of high-O3 events ("episodes") over most locations in the U.S., with relatively small changes in average O3 air quality. These high-O3 increases due to climate change alone will erode moderately the gains made under a U.S. emissions reduction scenario (e.g., B1). The effect of climate change on high- and average-O3 increases with anthropogenic emissions. Insofar as average O3 air quality is concerned, changes in U.S. anthropogenic emissions will play the most important role in attaining (or not) near-term U.S. O3 air quality standards. However, policy makers must plan appropriately for O3 background increases due to projected increases in global CH4 abundance and non-U.S. anthropogenic emissions, as well as potential local enhancements that they could cause. These findings provide strong incentives for more-than-planned emissions reductions at locations that are currently O3-nonattainment.
Konstruktivistički pristup obrazovnom postignuću učenika
Gutvajn, Nikoleta
2009-01-01
U savremenoj pedagoškoj literaturi, razlike u obrazovnom postignuću učenika se, veomaretko, proučavaju iz perspektive učenika što je, verovatno, jedan od bitnih razloga zakontinuiranu egzistenciju kategorije „neuspešan učenik”. Cilj našeg istraživanja bio je dase problem školskog neuspeha razmotri iz perspektive učenika koji su pozicionirani kaoneuspešni. Umesto mnogobrojnih pretpostavki istraživača o tome zašto su neki učenicineusp...
7 CFR 51.2732 - U.S. No. 2 Spanish.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 2 Spanish. 51.2732 Section 51.2732... STANDARDS) United States Standards for Grades of Shelled Spanish Type Peanuts Grades § 51.2732 U.S. No. 2 Spanish. “U.S. No. 2 Spanish” consists of shelled Spanish type peanut kernels which may be split or broken...
Directory of Open Access Journals (Sweden)
Aslina Br. Ginting
2016-03-01
Full Text Available ABSTRAK PEMBUATAN SUMBER RADIASI GAMMA ISOTOP 137Cs DENGAN AKTIVITAS 20 mCi DARI PEB U3Si2-Al PASCA IRADIASI DALAM CONTAINER STAINLESS STEEL. Kegiatan uji pasca iradiasi pelat elemen bakar (PEB U3Si2-Al banyak menghasilkan larutan dengan keaktifan yang sangat tinggi. Larutan tersebut mengandung isotop 137Cs, uranium serta transuranium yang mempunyai waktu paroh panjang dan berbahaya bagi lingkungan. Namun larutan tersebut memiliki nilai ekonomis tinggi karena dapat dimanfaatkan sebagai bahan baku untuk pembuatan sumber radiasi sinar gamma isotop 137Cs. Hal ini dapat membantu bidang industri dalam memenuhi kebutuhan sumber radioaktif dalam negeri karena selama ini kebutuhan isotop 137Cs di Indonesia masih tergantung dari industri luar negeri. Selain itu, pengadaan dan transportasi isotop 137Cs dari luar negeri serta dalam penggunaannya memerlukan persyaratan yang cukup ketat dari Badan Pengawas Tenaga Nuklir Nasional (BAPETEN, sehingga menyebabkan harga isotop 137Cs menjadi mahal sampai di Indonesia. Dengan alasan tersebut, BATAN sebagai lembaga litbang nuklir di Indonesia perlu mempelajari pembuatan sumber radiasi gamma isotop 137Cs dari larutan hasil pengujian bahan bakar nuklir U3Si2-Al pasca iradiasi. Manfaat isotop 137Cs sangat luas antara lain digunakan dalam menganalisis sampel lingkungan, industri migas, konstruksi, radiografi, perikanan, rumah sakit dan pertambangan. Pembuatan sumber radiasi gamma isotop 137Cs dimulai dari pengumpulan larutan hasil pengujian PEB U3Si2-Al. Larutan larutan hasil pengujian mengandung isotop 137Cs dan isotop lainnya dikumpulkan menjadi satu dalam botol dengan volume 65 mL. Pemisahan isotop 137Cs dari hasil fisi lainnya dilakukan dengan metode penukar kation menggunakan zeolit Lampung dengan berat 45 gr. Hasil pemisahan diperoleh 137Cs-zeolit dalam fasa padat dan isotop lainnya berada dalam fasa cair. Padatan137Cs-zeolit kering kemudian kemudian ditimbang dan diukur aktivitasnya menggunakan spektrometer
International Nuclear Information System (INIS)
Brisset, Nicolas
2016-01-01
Two main research axes were defined for this Ph-D work: (i) studying the effect of light elements (B, C) on the stability of U-Si compounds, and (ii) identifying and physically characterizing new phases in the U-Pt-Si system. Minor additions of carbon and boron in U-Si samples revealed that the formation of U 5 Si 4 would be correlated to the presence of these light elements, questioning its existence in the U-Si system. To evaluate the boron potential as a stimulant for non-metallic light elements of the second period (C, N, O), the isothermal section of the ternary phase diagram U-Si-B has been drawn at 927 C, disclosing solid equilibrium mainly between the UB and U-Si binary axes and the existence of the novel compound U 20 Si 16 B 3 , isostructural to the carbon equivalent one. These results suggest a specific behavior for a given light element on the U-Si phase relations. The isothermal section at 900 C of the U-Pt-Si ternary system was experimentally determined, leading to the discovery of 14 new phases, among which U 3 Pt 4 Si 6 , U 3 Pt 6 Si 4 and U 3 Pt 7 Si crystallized in their own structural type. As a prerequisite for this study, the phase relations in the U-Pt binary phase diagram were re-examined for the composition range 30 at.% and 70 at.% Pt, leading to a new assessment of the phase diagram which comprises the new U 3 Pt 4 compound. The temperature of the transformations has been measured by DTA. By coupling our experimental results to the literature data, a modeling of the phase diagram by the Calphad method was performed. Physical characterizations of the new U 3 Pt 4 compound revealed a moderate heavy fermion behavior, with ferromagnetic ordering below Tc = 7(1) K. As a side project, a study of the U 3 TGe 5 family with the anti-Hf 5 CuSn 3 structural type lead to the discovery of nine new compounds for T = V, Cr, Mn, Zr, Nb, Mo, Hf, Ta and W in addition to the previously reported U 3 TiGe 5 . Their magnetic and electronic properties were
Margolskee, Elizabeth; Hasserjian, Robert P; Hassane, Duane; Tam, Wayne; Mathew, Susan; Ok, Chi Young; Wang, Sa A; Oak, Jean; Arber, Daniel A; Orazi, Attilio
2017-07-01
Three situations qualify as myelodysplastic syndrome, unclassifiable (MDS-U): (1) refractory cytopenia with dysplasia and 1% blasts in peripheral blood (BL), (2) pancytopenia with unilineage dysplasia (Pan), and (3) persistent cytopenia, less than 5% bone marrow blasts, and less than 10% dysplastic cells and presence of MDS-defining cytogenetic abnormalities (CG). We compared the clinicopathologic features and mutational profiles for these three groups. MDS-U cases were reviewed at four major academic institutions. Targeted next-generation sequencing for genes implicated in myeloid neoplasms was performed in a subset of cases. Twenty-seven patients were identified (six MDS-U BL, 13 MDS-U Pan, and eight MDS-U CG). Clonal cytogenetic abnormalities were found in six of six, seven of 13, and eight of eight cases in MDS-U BL, Pan, and CG, respectively (P > .05). Overall, four of six patients with MDS-U BL progressed to acute myeloid leukemia; no MDS-U Pan or CG patients did. The rates of progression-free survival and mortality (overall survival) were significantly higher in MDS-U BL compared with Pan and CG (P MDS-U BL is a distinct subset of MDS-U with a poor prognosis, while MDS-U Pan and CG are relatively indolent. Evaluation of peripheral blood smears in patients with MDS is essential for accurate classification and prognosis. © American Society for Clinical Pathology, 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com
Energy Technology Data Exchange (ETDEWEB)
Pais, Rafael Witter Dias
2015-07-01
Metal fuels are relevant in the nuclear area due to the versatility of its use in the nuclear fuel cycle. Among the alloys of uranium investigated with high potential for use in nuclear power reactors, U-Zr-Nb alloys appear as an important alternative because of their superior physico-chemical and metallurgical properties. These alloys have also potential for use in nuclear testing, research and production radioisotopes of high performance nuclear reactors. Therefore, the development of these alloys is strategic since they are planned to be used in national reactors as RMB (Brazilian Multipurpose Reactor) and LABGENE (Electrical Generation Core Laboratory), currently under development in Brazil. In this work it was realized a extensive study in the scope of the manufacturing, heat treatment and phase transformations of U-2,5Zr-7,5Nb (m/m%) and U-3ZR-9NB (m/m%) fuel alloys. Ingots of both alloys were produced employing a specific methodology developed in this study. This methodology comprised the melting process in a vacuum induction furnace at high temperatures (1500 °C) and thermal-mechanical processing to break the as-cast structure. Samples with typical dimensions (17 x 7 x 2.5 mm) free from macrostructural defects were homogenized at 1000 °C in vacuum of 10{sup -5} torr for 17.5 hours with a 10°C/min cooling rate until to 820 °C and, subsequently, quenched in water. The samples, randomly selected, were subjected to isothermal treatment tests under different conditions of time and temperature. Isothermal treatments for transformation and retention phases were carried out in a special assembly designed for this work. After the tests, the samples were characterized by the usual phase characterization techniques with particular emphasis for the X-ray diffraction technique. In this way, the Rietveld refinement method was applied. In the case of uranium based alloys it is quite challenging due to the lack of data in the literature. In this work a strategy for the
Mass and abundance 236U sensitivities at CIRCE
De Cesare, M.; De Cesare, N.; D'Onofrio, A.; Fifield, L. K.; Gialanella, L.; Terrasi, F.
2015-10-01
The actinides (e.g. 236U and xPu isotopes) are present in environmental samples at the ultra trace level since atmospheric tests of NWs (Nuclear Weapons) performed in the past, deliberate dumping of nuclear waste, nuclear fuel reprocessing, on a large scale and operation of NPPs (Nuclear Power Plants) on a small scale have led to the release of a wide range of radioactive nuclides in the environment. Their detection requires the most sensitive AMS (Accelerator Mass Spectrometry) techniques and at the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy, an upgraded actinide AMS system, based on a 3-MV pelletron tandem accelerator, has been operated. In this paper the progress made in order to push the 236U mass sensitivity and 236U/238U isotopic ratio down to the natural levels is reported. A uranium contamination mass of about 0.05 μg and a 236U/238U isotopic ratio sensitivities at the level of 3.2 × 10-13 are presently achievable.
Fabrication of zero power reactor fuel elements containing 233U3O8 powder
International Nuclear Information System (INIS)
Nicol, R.G.; Parrott, J.R.; Krichinsky, A.M.; Box, W.D.; Martin, C.W.; Whitson, W.R.
1982-05-01
Oak Ridge National Laboratory, under contract with Argonne National Laboratory, completed the fabrication of 1743 fuel elements for use in their Zero Power Reactor. The contract also included recovery of 20 kg of 233 U from rejected elements. This report describes the steps associated with conversion of purified uranyl nitrate (as solution) to U 3 O 8 powder (suitable for fuel) and subsequent charging, sealing, decontamination, and testing of the fuel elements (packets) preparatory to shipment. The nuclear safety, radiation exposures, and quality assurance aspects of the program are discussed
Preparations of high density (Th,U)O2 pellets
International Nuclear Information System (INIS)
Akabori, Mitsuo; Ikawa, Katsuichi
1986-07-01
Preparations of high density and homogeneous (Th,U)O 2 pellets by a powder metallurgy method were examined. (Th,U)O 2 powders were prepared by calcining coprecipitates of ammonium uranate and thorium hydroxide derived from nitrates and mixed sols, and by calcining mixed oxalates precipitated from nitrates. (Th,U)O 2 pellets were characterized with respect to sinterability, lattice parameter, microstructure, homogeneity and stoichiometry. Sintering atmospheres had a significant effect upon all the properties of the derived pellets. The sinterability of (Th,U)O 2 was most favourable in oxidizing and reducing atmospheres for ThO 2 -rich and UO 2 -rich compositions, respectively, and can be enhanced by presence of water vapour in sintering atmospheres. In addition, highly homogeneous (Th,U)O 2 pellets with 99 % in theoretical density were derived from the sol powders. (author)
A Stable U Isotopic Perspective on the U Budget and Global Extent of Modern Anoxia in the Ocean.
Tissot, F.; Dauphas, N.
2015-12-01
Isotopic fractionation between U4+ and U6+makes U stable isotopes potential tracers of global paleoredox conditions. In this work [1], we put the U-proxy up to a test against a highly constrained system: the modern ocean. We measured a large number of seawater samples from geographically diverse locations and found that the open ocean has a homogenous isotopic composition at δ238USW= -0.392 ± 0.005 ‰ (rel. to CRM-112a). From our measurement of rock samples (n=64) and compilations of literature data (n=380), we then estimated the U isotopic compositions of the various reservoirs involved in the modern oceanic U budget, as well as the fractionation factors associated with U incorporation into those reservoirs. Using a steady-state model, we compared the isotopic composition of the seawater predicted by the four most recent U oceanic budgets [2-5] to the modern seawater value we measured. Three of these budgets [2-4] predict a seawater isotopic composition in very good agreement with the observed δ238USW, which strengthens our confidence in the isotopic fractionation factors associated with each deposition environment and the fact that U is at steady-state in the modern ocean. The U oceanic budget of Henderson and Anderson (2003) does not reproduce the observed seawater composition because the U flux to anoxic/euxinic sediments relative to the total U flux out of the ocean is high in their model, which our analysis shows cannot be correct. The U isotopic composition of seawater is used to constrain the extent of anoxia in the modern ocean (% of seafloor covered by anoxic/euxinic sediments), which is 0.21 ± 0.09 %. This work demonstrates that stable isotopes of U can indeed trace the extent of anoxia in the modern global ocean, thereby validating the application of U isotope measurements to paleoredox reconstructions. Based on the above work, we will present the best estimate of the modern oceanic U budget. [1] Tissot F.L.H., Dauphas N. (2015) Geochim Cosmochim
Reactions of N2(A3Σ/sub u/+) and candidates for short wavelength lasers
International Nuclear Information System (INIS)
Setser, D.W.
1987-01-01
This proposal is a request for a one year renewal of a contract with the Univ. of California (Lawrence Livermore Laboratory). The proposed experiments are directed towards investigation of possible short-wavelength laser candidate molecules that can be pumped via excitation-transfer reactions with N 2 (A 3 Σ/sub u/ + ) molecules. We will continue our flowing-afterglow experiments to characterize the excitation-transfer collisions between N 2 (A) and promising acceptor diatomic molecules (radicals). We also will extend the studies to include excitation-transfer to Cd and to S atoms. For some chemical systems, a pulsed N 2 (A) source would be very convenient for kinetic measurements and we propose to develop a pulsed N 2 (A) source. During the first year, we have shown that the excitation-transfer reaction between N 2 (A) and SO(X) provides a possible laser candidate. Therefore, we propose to start a program to study the quenching and relaxation kinetics of the SO(A 3 PI) molecule, using pulsed laser excitation techniques to generate specific levels of SO(A 3 PI)
Online Manufacturing Training. ToolingU Review (U)
Energy Technology Data Exchange (ETDEWEB)
Montano, Joshua Daniel [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2016-03-23
The following report is a review of ToolingU, an online manufacturing training website. ToolingU provided the author with a trail account where a number of courses were taken and the overall program was evaluated. A review of the classes revealed that most of the offerings directly align with work at the Laboratory. Ease of use, effectiveness of the system and price all make ToolingU an attractive option for manufacturing training needs.
Physico-chemical properties of (U,Ce)O2
International Nuclear Information System (INIS)
Yamada, K.; Yamanaka, S.; Katsura, M.
1998-01-01
The high-temperature X-ray diffraction analysis of (U,Ce)O 2 with CeO 2 contents ranging from 0 to 20 mol.% CeO 2 was performed to obtain the variation of the linear thermal expansion coefficient with the CeO 2 content. Ultrasonic pulse-echo measurements were also carried out from room temperature to 673 K to estimate the change in the mechanical properties of (U,Ce)O 2 with the CeO 2 content. The variation in the linear thermal expansion coefficient at the low CeO 2 content region is more steep than that expected from the linear thermal expansion coefficient of UO 2 and CeO 2 . The Young's and shear moduli of all (U,Ce)O 2 were found to decrease with rising temperature. This was due to the increase of the bond length accompanied by the thermal expansion. Although the lattice parameter decreased with CeO 2 content, the moduli of (U,Ce)O 2 were found to decrease with increasing CeO 2 content at room temperature. These results show that in the range from 0 to 20 mol.% of CeO 2 , as CeO 2 content increases, the bottom of the potential energy in (U,Ce)O 2 is shallower and broader. (orig.)
Plate impact experiments on DC745U cooled to ~ -60 °C
Energy Technology Data Exchange (ETDEWEB)
Gustavsen, Richard L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Dattelbaum, Dana M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Bartram, Brian Douglas [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Gibson, Lloyd Lee [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Jones, Justin Daniel [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Goodbody, Austin Bernard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics
2016-08-11
Using gas-gun driven plate impact experiments, we have measured the US - up Hugoniot of the silicone elastomer DC745U cooled to -60 °C. In summary, the initial density changes from p0 (23°C) = 1.312 ± 0.010 g/cm3 to p0 (-60°C) = 1.447 ± 0.011 g/cm3. The linear US - up Hugoniot changes from US = 1.62 + 1.74up km/s at +23°C, to US = 2.03 ± 0.06 + (2.03 ± 0.06) up km/s at -60°C. DC745U, therefore is much stiffer at -60°C than at +23°C, probably due to the crystallization that occurs at ~ -50°C. Caveats/deficiencies: 1) This report does not provide an adequate pedigree of the DC745U used. 2) References to unpublished room temperature shock compression data on the elastomer are inadequate. 3) The report has not been fact checked by a DC745 subject matter expert.
2007-01-01
This CD presents data reported by U.S. carriers. These data are releasable after a 3 year confidentiality period and include U.S. Air Carrier foreign point to foreign point traffic. These data are often referred to as either "market" or on-flight ori...
Energy Technology Data Exchange (ETDEWEB)
Milet, C A [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires
1968-07-01
After having discussed the reasons to use (U,Pu) carbides as fast reactor fuel, we examine the influence of the addition of titanium to these carbides. A preliminary study has been done on the system of U-C-Ti and some properties have been measured such as: density, thermal expansion, electrical resistivity, atmospheric corrosion and compatibility with stainless steel. The systems U-Pu-C-Ti (Pu/U + Pu equal to 15 per cent) and U-C-Ti have been found to be very similar. There exists a two phases region (U,Pu)C + TiC, an eutectic between (U,Pu)C and TiC for approximately 15 at %. The solubilities of U + Pu in TiC and of Ti in (U,Pu)C is less than 1 % at. The addition of titanium does not markedly change thermal expansion coefficients of (U,Pu)C. However the resistance to atmospheric corrosion and compatibility with stainless steel is improved. Thermal conductivity, calculated from electrical resistivity, has increased. On the other side, the density of fissile material is lowered. The combination of (U,Pu)C + TiC seems to be the most promising alloy for application as nuclear fuel. (author) [French] Apres avoir rappele les problemes poses par un combustible pour les reacteurs a neutrons rapides et l'interet des carbures U-Pu-C comme combustible, on examine l'influence de l'addition de titane dans ces carbures. Une etude preliminaire sur le systeme U-C-Ti a ete effectuee et quelques proprietes sont indiquees: densite, coefficients de dilatation, resistivite electrique, tenue a la corrosion atmospherique, compatibilite avec l'acier inoxydable. Le systeme U-Pu-C-Ti (Pu/U + Pu egal a 15 pour cent) presente de grandes analogies avec le systeme U-C-Ti. Il existe un domaine biphase (U,Pu)C + TiC, un eutectique entre (U,Pu)C et TiC pour environ 15 at % Ti; les solubilites de U + Pu clans TiC et de Ti dans (U,Pu)C sont inferieures a 1 at %. Par rapport a la phase (U,Pu)C, l'addition de titane est sans effets importants sur les coefficients de dilatation. Par contre la tenue a
Dicty_cDB: Contig-U11323-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available AF134321 |pid:none) Dissostichus mawsoni clone Dm7m ch... 84 3e-14 AM747721_702( ...S101... 81 2e-13 U58944_1( U58944 |pid:none) Dissostichus mawsoni AFGP antifreeze g... 81 2e-13 AM182501_1( ...017194_2467( AE017194 |pid:none) Bacillus cereus ATCC 10987, com... 75 1e-11 U43149_1( U43149 |pid:none) Dissostichus mawson
International Nuclear Information System (INIS)
Silva, Jose Eduardo Rosa da
2011-01-01
IPEN/CNEN-SP manufactures fuels to be used in its nuclear research reactor - the IEA-R1. To qualify those fuels, it is necessary to check if they have a good performance under irradiation. As Brazil doesn't have nuclear research reactors with high neutron fluxes, or suitable hot cells for carrying out post-irradiation examination of nuclear fuels, IPEN/CNEN-SP has conducted a fuel qualification program based on the use of uranium compounds, internationally tested and qualified to be used in research reactors, and has gotten experience in the technological development stages for the manufacturing of fuel plates, irradiation and non-destructive post-irradiation testing. Fuel elements containing low volume fractions of fuel in the dispersion were manufactured and irradiated successfully directly in the core of the IEA-R1. However, there are plans to increase the uranium density of these fuels. The objective of this thesis work was to study and to propose a set of non-destructive methods to qualify the dispersions fuels U 3 O 8 -Al e U 3 Si 2 -Al with high uranium density produced at IPEN/CNEN-SP. For that, the irradiation resources in the IEA-R1, and the application of non-destructive methods in the reactor pool available in the Institution were considered. The proposal is to specify, manufacture and irradiate fuel mini plates in IEA-R1 at the maximum densities, qualified internationally, and to monitor their general conditions during the period of irradiation, using non-destructive methods in the reactor pool. In addition to the non-destructive visual inspection and sipping methods, already used at the Institution, the infrastructure for dimensional sub-aquatic testing to evaluate the swelling of irradiated fuel mini plates was completed. The analyses of the results will provide means to assess and decide whether or not to continue with the irradiation of mini plates, until the desired burnup for the irradiation tests at IEA-R1 are reached. (author)
International Nuclear Information System (INIS)
Dacheux, N.; Clavier, N.; Wallez, G.; Quarton, M.
2007-01-01
Three new crystal structures, isotypic with β-Zr 2 O(PO 4 ) 2 , have been resolved by the Rietveld method. All crystallize with an orthorhombic cell (S.G.: Cmca) with a = 7.1393(2) Angstroms, b = 9.2641(2) Angstroms, c 12.5262(4) Angstroms, V = 828.46(4) (Angstroms) 3 and Z = 8 for Th(OH)PO 4 ; a = 7.0100(2) Angstroms, b = 9.1200(2) Angstroms, c = 12.3665(3) Angstroms, V 790.60(4) (Angstroms) 3 and Z = 8 for U(OH)PO 4 ; a 7.1691(3) Angstroms, b 9.2388(4) Angstroms, c = 12.8204(7) Angstroms, V 849.15(7) (Angstroms) 3 and Z = 4 for Th 2 O(PO 4 ) 2 . By heating, the M(OH)PO 4 (M Th, U) compounds condense topotactically into M 2 O(PO 4 ) 2 , with a change of the environment of the tetravalent cation that lowers from 8 to 7 oxygen atoms. The lower stability of Th 2 O(PO 4 ) 2 compared to that of U 2 O(PO 4 ) 2 seems to result from this unusual environment for tetravalent thorium. (authors)
The Fabrication Problem Of U3Si2-Al Fuel With Uranium High Loading
International Nuclear Information System (INIS)
Supardjo
1996-01-01
The quality of U 3 Si 2 -Al dispersion fuel product is the main aim for each fabricator. Low loading of uranium fuel element is easily fabricated, but with the increased, uranium loading, homogeneity of uranium distribution is difficult to achieve and it always formed white spots, blister, and dogboning in the fuel plates. The problem can be eliminated by the increasing treatment of the fuel/Al powder. The precise selection of fuel/Al particles diameter is needed indeed to make easier in the homogeneous process of powder and the porosities arrangement in the fuel plates. The increasing of uranium loading at constant meat thickness will increase the meat hardness, therefore to withdraw the dogboning forming, the use of harder cladding materials is necessity
International Nuclear Information System (INIS)
Rofail, N.H.; Girgis, B.S.
1993-01-01
The fabrication of nuclear fuel generally involves the preparation of intermediate uranium oxides (UO 3 and U 3 O 8 ) which can be processed either to ceramic or to metallic nuclear fuel. Ammonium uranate (AU) was precipitated from uranyl nitrate with ammonia gas and dried without washing, or washed with water, methanol, and/or methanol-acetone, and dried. Four DTG stages of decomposition appeared. Dissociation of UO 3 to U 3 O 8 at 600 deg - 700 deg C was associated with an E diss of 355-492 kJ x mol -1 , dependent on the mode of washing the AU. For the production of U 3 O 8 , washing of AU with water and drying at 50 deg C , and/or precalcination at and beyond 350 deg C, is recommended. (author) 22 refs.; 1 fig.; 4 tabs
U.S.-GERMAN BILATERAL WORKING GROUP PHASE 3 ACTIVITIES-AN OVERVIEW
The U.S.-German Bilateral Working Group originated in 1990 in order to share and transfer information, ideas, tools and techniques regarding environmental research. The U.S. Environmental Protection Agency (EPA) and the German Federal Ministry for Education and Research (BMBF) de...
Itinerant f-electron behavior in Ce and U compounds
International Nuclear Information System (INIS)
Crabtree, G.W.
1985-04-01
The experimentally observed Fermi surface properties in URh 3 , UIr 3 , UGe 3 , CeSn 3 , CeB 6 , U 3 As 4 , U 3 P 4 , and CeSb are reviewed. For the compounds with no magnetic order, band structure models of the Fermi surface geometry are confirmed and f-ligand hybridization is found to be dominant. For CeB 6 , U 3 As 4 , and U 3 P 4 the experiments show that both local moments and f hybridization are important. In CeSb new data can be explained by a purely local model with no f-hybridization
Dicty_cDB: Contig-U15057-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( U58944 |pid:none) Dissostichus mawsoni AFGP antifreeze g... 44 0.012 C81265( C81265 )probable lipoprotein ...U43149_1( U43149 |pid:none) Dissostichus mawsoni antifreeze glycop... 36 3.2 ( P24856 ) RecName: Full=Ice-st
7 CFR 51.1147 - U.S. No. 2 Bright.
2010-01-01
...) Internal quality: Lots meeting the internal requirements for “U.S. Grade AA Juice (Double A)” or “U.S... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 2 Bright. 51.1147 Section 51.1147 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...
Precise 238U(n,2n)237U reaction cross-section measurements using the activation facility at TUNL
Krishichayan, Fnu; Bhike, M.; Tornow, W.
2014-09-01
Accurate neutron-induced 238U(n,2n)237U reaction data are required for many practical applications, especially in the field of nuclear energy, including advanced heavy water reactors, where 238U is used as the breeding material to regenerate the fissile material 239Pu. Precise (n,2n) cross-section measurements of 238U are underway at TUNL with mono-energetic neutrons in the 8.0 to 14.0 MeV energy range in steps of 0.25 MeV using the activation technique. After activation of the 0.5 inch diameter and 442 mg 238U foil, the activity of the 208 keV characteristic γ-line is tracked for 6 weeks with a high efficient HPGe clover detector to determine the initial activity needed for the cross-section determination. Results of the cross-section measurements, determined relative to 27Al and 197Au neutron activation monitor foils, and the comparison with theoretical models will be presented during the meeting.
Natural and anthropogenic {sup 236}U in environmental samples
Energy Technology Data Exchange (ETDEWEB)
Steier, Peter [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)], E-mail: peter.steier@univie.ac.at; Bichler, Max [Atominstitut der Osterreichischen Universitaeten, Technische Universitaet Wien, Stadionallee 2, Wien A-1020 (Austria); Keith Fifield, L. [Department of Nuclear Physics, RSPhysSE, Australian National University, Canberra, ACT 0200 (Australia); Golser, Robin; Kutschera, Walter; Priller, Alfred [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Quinto, Francesca [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Richter, Stephan [Euopean Commission, Directorate-General Joint Research Centre, Institute for Reference Materials and Measurements (IRMM), Retieseweg 111, B-2440 Geel (Belgium); Srncik, Michaela [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Terrasi, Philippo [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Wacker, Lukas [Institute for Particle Physics, HPK H25, Schafmattstrasse 20, CH-8093 Zuerich (Switzerland); Wallner, Anton [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Wallner, Gabriele [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Wilcken, Klaus M. [Scottish Universities Environmental Research Centre, Scottish Enterprise Technology Park, East Kilbride G75 OQF (United Kingdom); Maria Wild, Eva [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)
2008-05-15
The interaction of thermal neutrons with {sup 235}U results in fission with a probability of {approx}85% and in the formation of {sup 236}U (t{sub 1/2} = 2.3 x 10{sup 7} yr) with a probability of {approx}15%. While anthropogenic {sup 236}U is, therefore, present in spent nuclear fuel at levels of {sup 236}U/U up to 10{sup -2}, the expected natural ratios in the pre-anthropogenic environment range from 10{sup -14} to 10{sup -10}. At VERA, systematic investigations suggest a detection limit below {sup 236}U/U = 5 x 10{sup -12} for samples of 0.5 mg U, while chemistry blanks of {approx}2 x 10{sup 7} atoms {sup 236}U per sample limit the sensitivity for smaller samples. We have found natural isotopic ratios in uranium reagents separated before the onset of human nuclear activities, in uranium ores from various origins and in water from a subsurface well in Bad Gastein, Austria. Anthropogenic contamination was clearly visible in soil and rivulet samples from Salzburg, Austria, whereas river sediments from Garigliano river (Southern Italy) were close to the detection limit. Finally, our natural in-house standard Vienna-KkU was calibrated against a certified reference material (IRMM REIMEP-18 A)
International Nuclear Information System (INIS)
Sokolik, G.A.; Ovsiannikova, S.V.; Voinikava, K.V.; Ivanova, T.G.; Papenia, M.V.
2014-01-01
This work is devoted to investigation of behavior of 234 U, 238 U and 226 Ra by determining the soil to plant transfer under different natural conditions such as forest or swamped areas and meadow lands with different soil types. The paper summarizes the data on investigation of uranium and radium uptake by wild berries and natural meadow grasses in the typical conditions of Belarus. Parameters characterizing the biological availability of 234 U, 238 U and 226 Ra for bilberry (Vaccinium myrtillus), lingonberry (Vaccinium viti-idaea), blueberry (Vaccinium iliginosum) and cranberry (Vaccinium oxycoccus palustris) as well as for widely occurring mixed meadow vegetation, which belongs to the sedge-grass or grass-sedge associations and forbs, have been established. In the sites under investigation, the deposition levels of 238+239+240 Pu were less than 0.37 kBq m −2 and 137 Cs deposition ranged between less than 0.37 and 37 kBq m −2 . It was found that activity concentrations of radionuclides in berries varied in the ranges of 0.037–0.11 for 234 U, 0.036–0.10 for 238 U and 0.11–0.43 Bq kg −1 for 226 Ra, but in the mixed meadow grasses they were 0.32–4.4, 0.24–3.9 and 0.14–6.9 Bq kg −1 accordingly. The 234 U/ 238 U activity ratios were 1.02 ± 0.01 for wild berries, 1.20 ± 0.09 for underground meadow grasses and 1.02 ± 0.02 for proper soils. The concentration ratios (CRs, dry weight basis) of 234 U and 238 U for mixed meadow grasses were 0.036–0.42 and 0.041–0.46 respectively. The correspondent geometric means (GM) were 0.13 and 0.15 with geometric standard deviations (GSD) of 2.4. The CRs of 226 Ra for meadow grasses were 0.031–1.0 with GM 0.20 and GSD 2.6. The CRs of 234 U, 238 U and 226 Ra for wild berries ranged within 0.0018–0.008 (GM is 0.0034, GSD is 1.8), 0.0018–0.008 (GM is 0.0035, GSD is 1.8) and 0.005–0.033 (GM is 0.016, GSD is 2.1) accordingly. The highest CR values of uranium for mixed meadow grasses were found in the sites