WorldWideScience

Sample records for u2 u3 u2

  1. Tank 241-U-102, Grab Samples 2U-99-1, 2U-99-2 and 2U-99-3 Analytical Results for the Final Report

    International Nuclear Information System (INIS)

    STEEN, F.H.

    1999-01-01

    This document is the final report for tank 241-U-102 grab samples. Five grab samples were collected from riser 13 on May 26, 1999 and received by the 222-S laboratory on May 26 and May 27, 1999. Samples 2U-99-3 and 2U-99-4 were submitted to the Process Chemistry Laboratory for special studies. Samples 2U-99-1, 2U-99-2 and 2U-99-5 were submitted to the laboratory for analyses. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler 1995, Mulkey and Miller 1998). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP

  2. Quantification of "2"3"2Th, "2"3"4U, "2"3"5U and "2"3"8U in river mollusks by magnetic sector mass spectrometry with inductively coupled plasma source (Icp-SFMS)

    International Nuclear Information System (INIS)

    Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N.; Alfaro de la T, M. C.

    2016-09-01

    The present work deals with the methodology established for the quantification of "2"3"2Th, "2"3"4U, "2"3"8U and "2"3"5U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO_3 minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of "2"3"2Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ("2"3"2Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of "2"3"2Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)

  3. Metallographic analysis of irradiated U3Si2/Al fuel element plate of 2.96 gU/cm3 density

    International Nuclear Information System (INIS)

    Maman Kartaman Ajiriyanto; Aslina Br Ginting; Junaedi

    2018-01-01

    Metallographic analysis of U 3 Si 2 /Al fuel element plate has been performed in hot cell. The purpose of metallographic analysis is to study changes in PEB U 3 Si 2 /Al microstructure and AlMg 2 cladding thickness after irradiation in reactor until burn up of 56 %. The fuel element plate of irradiated U 3 Si 2 /Al was cut in top, middle and bottom positions with each size around 5 x 5 x 1.37 mm. Metallographic preparation starts from sample cutting using cutting machine with low speed and sample mounting, grinding and polishing in hot cell 104–105. Sample mounting was done by using resin for more than 10 hours followed by grinding with sand papers up to grit size of 2400 and polishing with diamond paste of size 3 to 1 micron at a rotational speed of 150 rpm for 5 minutes. Microstructure observation was performed with optical microscope in hot cell 107 at 200 times magnification. Microstructure examination reveals U 3 Si 2 particles with inverse forms and sizes, Al matrix and AlMg 2 cladding were spread along the U 3 Si 2 /Al side. Microstructure observation of irradiated U 3 Si 2 /Al has not shown good result because only topography observation of U 3 Si 2 /Al meat, Al matrix and AlMg 2 cladding can be done due to limited capability of the optical microscope in hot cell, where maximum magnification can be attained only at 200 times so that the phenomenon of interaction layer and small gas bubble can not be observed. However, U 3 Si 2 /Al microstructure of 56 % burnup, if compared to the microstructure of U 3 Si 2 /Al fuel element plate of 60 % burnup from previous researcher, shows interaction between U 3 Si 2 meat with Al matrix and the existence of layers with a thickness about 5 up to 20 microns. Meanwhile, the observed thickness of AlMg 2 cladding is greater than 0.25 mm, which indicates that irradiation does not significantly change the thickness of AlMg 2 cladding so that the overall irradiated U 3 Si 2 -Al still has good integrity and stability. (author)

  4. A contribution to the kinetic study of the metatectic reaction U+U{sub 3}Si{sub 2}{yields}U{sub 3}Si; Contribucion al Estudio cinetico de la Reaccion Metatectica U+U{sub 3}Si{sub 2} U{sub 3}Si

    Energy Technology Data Exchange (ETDEWEB)

    Arroyo Ruiperez, J; Esteban Hernandez, J A

    1962-07-01

    An experimental study has been made to decide upon the advantages and drawbacks of the different methods and reagents employed in the metallography of U-Si alloys. It has been observed that all samples thermally treated to form the epsilon-phase undergo from the beginning a coalescence of the U{sub 3}Si{sub 2} particles, which makes practically useless any fine state of dispersion that might be present originally, as recommended by some authors. The coalescence of the U{sub 3}Si{sub 2} particle decreases the surface available for reaction and consequently the reaction rate. (Author) 7 refs.

  5. Multichannel interactions in the (1σ/sub g/)2(1σ/sub u/)nsσ, ndλ(3Σ+/sub u/,3Σ+/sub u/,3Pi/sub u/,3Δ/sub u/) Rydberg structures of He2

    International Nuclear Information System (INIS)

    Ginter, D.S.; Ginter, M.L.

    1988-01-01

    We show that a minimal parameter coupled channel model based on eigenquantum defect theory can reproduce quantitatively the known Rydberg structures associated with six channels of nsσ,ndλ( 3 Σ + /sub u/, 3 Σ + /sub u/, 3 Pi/sub u/, 3 Δ/sub u/) v = 0 ancestry in He 2 . Except for a few levels affected by accidental perturbations, these extensive level structures can be reproduced to within average experimental uncertainties. Previously unreported spectral analyses for transitions to the b 3 Pi/sub g/ state from rotational levels in the nl channel segments with n = 12--18 are included in this work. These spectral transitions were predicted and observed in the early stages of this investigation and were used to determine a number of new energy levels for the n = 3--18 data base used in subsequent calculations. The model uses a U matrix modified slightly from a Hund's case (b) to case (d) transformation and energy dependent eigenquantum defects μ/sub α/. Discussed in detail is a specific 14 parameter representation for ∼500 energy levels in which 2 parameters modify U to include interactions between ns and nd and 12 parameters describe the variation of the μ/sub α/'s with energy

  6. A contribution to the kinetic study of the metatectic reaction U+U3Si2U3Si

    International Nuclear Information System (INIS)

    Arroyo Ruiperez, J.; Esteban Hernandez, J. A.

    1962-01-01

    An experimental study has been made to decide upon the advantages and drawbacks of the different methods and reagents employed in the metallography of U-Si alloys. It has been observed that all samples thermally treated to form the epsilon-phase undergo from the beginning a coalescence of the U 3 Si 2 particles, which makes practically useless any fine state of dispersion that might be present originally, as recommended by some authors. The coalescence of the U 3 Si 2 particle decreases the surface available for reaction and consequently the reaction rate. (Author) 7 refs

  7. Karakterisasi Paduan AlMgSi Untuk Kelongsong Bahan Bakar U3Si2/Al Dengan Densitas Uranium 5,2 gU/cm3

    Directory of Open Access Journals (Sweden)

    Aslina Br. Ginting

    2018-03-01

    Full Text Available Meningkatnya densitas uranium dari 2,96 gU/cm3 menjadi 5,2 gU/cm3 bahan bakar U3Si2/Al harus diikuti dengan penggunaan kelongsong yang kompatibel. Bahan bakar berdensitas tinggi mempunyai kekerasan yang tinggi, sehingga bila menggunakan paduan AlMg2 sebagai kelongsong dapat menyebabkan terjadi dogbone pada saat perolan. Selain fenomena dogbone, pada saat bahan bakar tersebut digunakan di reaktor dapat terjadi swelling karena meningkatnya hasil fisi maupun burn up. Oleh karena itu, perlu dicari pengganti bahan kelongsong untuk bahan bakar U3Si2/Al densitas tinggi. Pada penelitian ini telah dilakukan karakterisasi paduan AlMgSi sebagai kandidat pengganti kelongsong AlMg2. Karakterisasi yang dilakukan meliputi analisis termal, kekerasan, mikrostruktur dan laju korosi. Analisis termal dilakukan menggunakan DTA (Differential Thermal Analysis dan DSC (Differential Scanning Calorimetry. Analisis kekerasan menggunakan alat uji kekerasan mikro, mikrostruktur menggunakan SEM (Scanning Electron Microscope dan analisis laju korosi dilakukan dengan pemanasan pada temperatur 150 oC selama 77 jam di dalam autoclave. Hasil analisis menunjukkan bahwa kelongsong AlMgSi maupun AlMg2 mempunyai kompatibilitas panas dengan bahan bakar U3Si2/Al cukup stabil hingga temperatur 650 oC. Kelongsong AlMgSi mempunyai kekerasan sebesar 115 HVN dan kelongsong AlMg2 sebesar 70,1 HVN. Sementara itu, analisis mikrostruktur menunjukkan bahwa morfologi ikatan antarmuka (interface bonding kelongsong AlMgSi lebih baik dari kelongsong AlMg2, demikian halnya dengan laju korosi bahwa kelongsong AlMgSi mempunyai laju korosi lebih kecil dibanding kelongsong AlMg2. Hasil karakterisasi termal, kekerasan, mikrostruktur dan laju korosi menunjukkan bahwa PEB U3Si2/Al densitas 5,2 gU/cm3 menggunakan kelongsong AlMgSi lebih baik dibanding PEB U3Si2/Al  densitas 5,2 gU/cm3  menggunakan kelongsong AlMg2. Kata kunci: U3Si2/Al, densitas 5,2 gU/cm3, kelongsong AlMgSi dan AlMg2.

  8. Atomization of U3Si2/U3Si for research reactor fuel

    International Nuclear Information System (INIS)

    Kuk, Il Hiun

    2004-01-01

    Instead of comminuting, U 3 Si 2 /U 3 Si powders are produced by atomizating directly from the molten alloys. Many benefits are introduced by applying the atomization technique: reduction of the process, homogeneous alloy composition within a particle and between particles, increase of the thermal conductivity and decrease of the chemical reactivity with aluminium due to particle's spherical shape. (author)

  9. Assessing Hubbard-corrected AM05+U and PBEsol+U density functionals for strongly correlated oxides CeO_2 and Ce_2O_3

    International Nuclear Information System (INIS)

    Weck, Philippe F.; Kim, Eunja

    2016-01-01

    The structure–property relationships of bulk CeO_2 and Ce_2O_3 have been investigated using AM05 and PBEsol exchange–correlation functionals within the frameworks of Hubbard-corrected density functional theory (DFT+U) and density functional perturbation theory (DFPT+U). Compared with conventional PBE+U, RPBE+U, PW91+U and LDA+U functionals, AM05+U and PBEsol+U describe experimental crystalline parameters and properties of CeO_2 and Ce_2O_3 with superior accuracy, especially when +U is chosen close to its value derived by the linear-response approach. Lastly, the present findings call for a reexamination of some of the problematic oxide materials featuring strong f- and d-electron correlation using AM05+U and PBEsol+U.

  10. Excess of "2"3"6U in the northwest Mediterranean Sea

    International Nuclear Information System (INIS)

    Chamizo, E.; López-Lora, M.; Bressac, M.; Levy, I.; Pham, M.K.

    2016-01-01

    In this work, we present first "2"3"6U results in the northwestern Mediterranean. "2"3"6U is studied in a seawater column sampled at DYFAMED (Dynamics of Atmospheric Fluxes in the Mediterranean Sea) station (Ligurian Sea, 43°25′N, 07°52′E). The obtained "2"3"6U/"2"3"8U atom ratios in the dissolved phase, ranging from about 2 × 10"−"9 at 100 m depth to about 1.5 × 10"−"9 at 2350 m depth, indicate that anthropogenic "2"3"6U dominates the whole seawater column. The corresponding deep-water column inventory (12.6 ng/m"2 or 32.1 × 10"1"2 atoms/m"2) exceeds by a factor of 2.5 the expected one for global fallout at similar latitudes (5 ng/m"2 or 13 × 10"1"2 atoms/m"2), evidencing the influence of local or regional "2"3"6U sources in the western Mediterranean basin. On the other hand, the input of "2"3"6U associated to Saharan dust outbreaks is evaluated. An additional "2"3"6U annual deposition of about 0.2 pg/m"2 based on the study of atmospheric particles collected in Monaco during different Saharan dust intrusions is estimated. The obtained results in the corresponding suspended solids collected at DYFAMED station indicate that about 64% of that "2"3"6U stays in solution in seawater. Overall, this source accounts for about 0.1% of the "2"3"6U inventory excess observed at DYFAMED station. The influence of the so-called Chernobyl fallout and the radioactive effluents produced by the different nuclear installations allocated to the Mediterranean basin, might explain the inventory gap, however, further studies are necessary to come to a conclusion about its origin. - Highlights: • First "2"3"6U results in the northwest Mediterranean Sea are reported. • Anthropogenic "2"3"6U dominates the whole seawater column at DYFAMED station. • "2"3"6U deep-water column inventory exceeds by a factor of 2.5 the global fallout one. • Saharan dust intrusions are responsible for an annual "2"3"6U flux of 0.02 pg/m"2. • Further studies are necessary to explain the

  11. Structure and Lamb shift of 2s1/2-2p3/2 levels in lithiumlike U89+ through neonlike U82+

    International Nuclear Information System (INIS)

    Beiersdorfer, P.; Knapp, D.; Marrs, R.E.; Elliott, S.R.; Chen, M.H.

    1993-01-01

    The first Doppler-shift-free crystal-spectrometer measurement of stationary highly stripped uranium ions from a high-energy electron beam ion trap is presented. Thirteen 2s 1/2- 2p 3/2 transitions in eight ionization states bteween Li-like U 89+ and Ne-like U 82+ are identified and measured with an accuracy as high as 37 ppm, providing benchmarks for testing relativistic correlation and quantum electrodynamic effects in highly charged multielectron ions. A value of 47.39±0.35 eV is found for the 2s 1/2 Lamb shift in Li-like U 89+ , in excellent agreement with theory

  12. Structure and lamb shift of 2s1/2-2p3/2 levels in lithiumlike U89+ through neonlike U82+

    International Nuclear Information System (INIS)

    Beiersdorfer, P.; Knapp, D.; Marrs, R.E.; Elliott, S.; Chen, M.H.

    1993-01-01

    The first Doppler-shift-free crystal- spectrometer measurements from stationary highly stripped uranium ions are presented. Eleven 2s 1/2 -2p 3/2 transitions in eight ionization stages between Li-like U 89+ and Ne-like U 82+ are identified and measured with an accuracy as high as 45 ppm, providing benchmarks for testing relativistic correlation and quantum electrodynamical effects in highly charged multi-electron ions. A value of 47.38 ± 0.35 eV is found for the 2s 1/2 Lamb shift in Li-like U 89+ , in excellent agreement with the theoretical value of 47.58 eV

  13. The [U{sub 2}F{sub 12}]{sup 2-} anion of Sr[U{sub 2}F{sub 12}

    Energy Technology Data Exchange (ETDEWEB)

    Scheibe, Benjamin; Pietzonka, Clemens; Conrad, Matthias; Kraus, Florian [Fachbereich Chemie, Philipps-Universitaet Marburg (Germany); Mustonen, Otto; Karppinen, Maarit; Karttunen, Antti J. [Department of Chemistry, Aalto University (Finland); Atanasov, Mihail; Neese, Frank [Max-Planck Institute for Chemical Energy Conversion, Muelheim an der Ruhr (Germany)

    2018-03-05

    The D{sub 2h}-symmetric dinuclear complex anion [U{sub 2}F{sub 12}]{sup 2-} of pastel green Sr[U{sub 2}F{sub 12}] shows a hitherto unknown structural feature: The coordination polyhedra around the U atoms are edge-linked monocapped trigonal prisms, the U{sup V} atoms are therefore seven-coordinated. This leads to a U-U distance of 3.8913(6) Aa. A weak U{sup V}-U{sup V} interaction is observed for the dinuclear [U{sub 2}F{sub 12}]{sup 2-} complex and described by the antiferromagnetic exchange J{sub exp} of circa -29.9 cm{sup -1}. The crystalline compound can be easily prepared from SrF{sub 2} and β-UF{sub 5} in anhydrous hydrogen fluoride (aHF) at room temperature. It was studied by means of single crystal X-ray diffraction, IR, Raman and UV/VIS spectroscopy, magnetic measurements, and by molecular as well as by solid-state quantum chemical calculations. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  14. Determination of uranium concentrations and "2"3"4U/"2"3"8U activity ratio in some granitic rock samples by alpha spectrometry: application of a radiochemical procedure

    International Nuclear Information System (INIS)

    Khattab, Mahmoud R.

    2016-01-01

    The present study is an application of a radiochemical procedure using alpha spectrometry technique for determination of uranium isotopes "2"3"8U, "2"3"4U and "2"3"5U on 13 granitic samples. These samples were collected from Gabal Gattar area, Northeastern Desert, Egypt. The collected samples were digested using microwave technique with aqua regia and spiked with "2"3"2U for chemical yield and activity calculation. Separation of uranium isotopes from the samples was done by Dowex 1 x 4 (50-100 mesh) resin followed by source preparation using microprecipitation technique. The concentrations of "2"3"8U were ranged between 28.9±0.9 and 134.8±1.8 Bq/g, and the "2"3"4U concentrations were between 24±0.6 and 147.7±2.2 Bq/g. For the "2"3"5U, the activity concentrations were between 1.3±0.2 and 6.7±1.2 Bq/g. The activity ratio of "2"3"4U/"2"3"8U was calculated and varied from 0.80 to 1.30. (author)

  15. Path integral for coherent states of the dynamical U2 group and U2/1 supergroup

    International Nuclear Information System (INIS)

    Kochetov, E.A.

    1992-01-01

    A part-integral formulation in the representation of coherent states for the unitary U 2 group and U 2/1 supergroup is introduced. U 2 and U 2/1 path integrals are shown to be defined on the coset spaces U 2 /U 1 xU 1 and U 2/1 /U 1/1 xU 1 , respectively. These coset appears as curved classical phase spaces. Partition functions are expressed as path integrals over these spaces. In the case when U 2 and U 2/1 are the dynamical groups, the corresponding path integrals are evaluated with the help of linear fractional transformations that appear as the group (supergroup) action in the coset space (superspace). Possible applications for quantum models are discussed. 9 refs

  16. Vector coherent state representations of SO5 contains SU2 + SU2 contains U1 + U1 and SO5 contains U1 + U1

    International Nuclear Information System (INIS)

    Pan Feng

    1991-01-01

    VCS representations of SO 5 contains SU 2 + SU 2 contains U 1 + U 1 and SO 5 contains U 1 + U 1 are discussed. Reduced matrix elements for SO 5 contains SU 2 + SU 2 are derived. The multiplicity of a weight for SO 5 is determined by using the K-matrix technique

  17. Nu2U

    DEFF Research Database (Denmark)

    Sørensen, Hans Eibe; Williamson, Trevor

    Abstract In September 2014, nine months after launching a major growth opportunity, Jenny Dunne, managing director of Nu2U, called for an extraordinary status meeting with her COO and CMO. A fast-growing online retailer of refurbished household appliances, Nu2U planned to acquire market share...... by improving internal logistics and delivery services, aided by a new, fully integrated software system. The company's gross profit had been increasing steadily, but recent accounts revealed a fall in net profit margins. It became apparent that implementation of the business plan for the project...... was problematic because of loose governance and poor communication across Nu2U's different specialist functions during planning and implementation. The Nu2U case illustrates how executives' cognition and span of control/overview may be hampered in fast-growing firms and how this ...

  18. Postirradiation examination of high-U-loaded, low-enriched U3O8, UAl2, and U3Si test fuel plates

    International Nuclear Information System (INIS)

    Gomez, J.; Morando, R.; Perez, E.E.; Giorsetti, D.R.; Copeland, G.L.; Hofman, G.L.; Snelgrove, J.L.

    1985-01-01

    The scope of this work is to present an evaluation of the postirradiation examination of the second set of high-U-loaded, low-enriched U 3 O 8 , UAl 2 and U 3 Si miniature plates manufactured by the Comision Nacional de Energia Atomica (CNEA) of Argentina, and irradiated and examined, within the framework of the Reduced Enrichment Research and Test Reactor (RERTR) Program, at Oak Ridge National Laboratory and Argonne National Laboratory. This paper includes fabrication details of the plates, their irradiation history and the results of postirradiation examination which are compared to those of the previous test and to present results from other laboratories participating in the RERTR Program. Postirradiation examination of these plates showed satisfactory performance for the oxides, aluminides and silicides (except for the highest-loaded U 3 Si plate) with the only indication of detrimental behavior being the slight bowing of some plates at about 80% burnup

  19. Postirradiation examination of high-U-loaded, low-enriched U3O8, UAl2, and U3Si test fuel plates

    International Nuclear Information System (INIS)

    Gomez, J.; Morando, R.; Perez, E.E.; Giorsetti, D.R.; Copeland, G.L.; Hofman, G.L.; Snelgrove, J.L.

    1985-01-01

    The scope of this work is to present an evaluation of the postirradiation examination of the second set of high-U-loaded, low-enriched U 3 O 8 , UAl 2 and U 3 Si miniature plates manufactured by the Comision Nacional de Energia Atomica (CNEA) of Argentina, and irradiated and examined, within the framework of the Reduced Enrichment Research and Test Reactor (RERTR) Program, at Oak Ridge National Laboratory and Argonne National Laboratory. This paper includes fabrication details of the plates, their irradiation history and the results of postirradiation examination which are compared to those of the previous test and to present results from other laboratories participating in the REM Program. Postirradiation examination of these plates showed satisfactory performance for the oxides, aluminides and silicides (except for the highest-loaded U 3 Si plate) with the only indication of detrimental behavior being the slight bowing of some plates at about 80% burnup. (author)

  20. Postirradiation examination of high-U-loaded low-enriched U3O8, UAl2, and U3Si test fuel plates

    International Nuclear Information System (INIS)

    Gomez, J.; Morando, R.; Perez, E.E.; Giorsetti, D.R.; Copeland, G.L.; Hofmann, G.; Snelgrove, J.L.

    1984-01-01

    The scope of this work is to present an evaluation of the postirradiation examination of the second set of high-U-loaded low-enriched U 3 O 8 , UAl 2 and U 3 Si miniature plates manufactured by the Comision Nacional de Energia Atomica (CNEA) of Argentina, and irradiated and examinated, within the framework of the Reduced Enrichment Research and Test Reactor (RERTR) Program, at Oak Ridge National Laboratory and Argonne National Laboratory. This paper includes fabrication details of the plates, their irradiation history and the results of postirradiation examination which are compared to those of the previous test and to present results from other laboratories participating in the RERTR Program. Postirradiation examination of these plates showed satisfactory poerformance for the oxides, aluminides and silicides (except for the highest-loaded U 3 Si plate) with the only indication of detrimental behavior during the slight bowing of some plates at about 80% burnup

  1. Thermal and x-ray studies on Tl2U(MoO4)3 and Tl4U(MoO4)4

    International Nuclear Information System (INIS)

    Dahale, N.D.; Keskar, Meera; Kulkarni, N.K.; Singh Mudher, K.D.

    2006-01-01

    In the quaternary Tl-U(IV)-Mo-O system, two new compounds namely Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 were prepared and characterized by powder X-ray diffraction and thermal methods. These compounds were prepared by solid state reactions of Tl 2 MoO 4 , UMoO 5 and MoO 3 in the required stoichiometric ratio at 500 deg C in evacuated sealed quartz ampoule. The XRD data of Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 were indexed on orthorhombic cell. TG curves of Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 did not show any weight change up to 700 deg C in an inert atmosphere. During heating in an inert atmosphere, Tl 2 U(MoO 4 ) 3 and Tl 4 U(MoO 4 ) 4 showed endothermic Dta peaks due to melting of the compounds at 519 and 565 deg C, respectively. (author)

  2. Diffraction study on the nonstoichiometric α-U2N3+x phase

    International Nuclear Information System (INIS)

    Serizawa, H.; Fukuda, K.; Ishii, Y.; Funahashi, S.; Katsura, M.

    1993-01-01

    X-ray and neutron diffraction studies were performed on nonstoichiometric α-U 2 N 3+ x having a composition range 1.68 2 N 3+x in this composition range was distorted Mn 2 O 3 -type. Structure parameters of U and N atoms were determined. The results showed that positions of U atoms varied continuously with nitrogen content. No evidence of the modification from bcc to fcc could be obtained. Interatomic distances of U-U and U-N were determined. The position parameter of N atoms showed that N atoms were slightly deviated from the tetrahedral site. (author)

  3. Redox equilibrium of U4+/U3+ in molten NaCl-2CsCl by UV-Vis spectrophotometry and cyclic voltammetry

    International Nuclear Information System (INIS)

    Nagai, Takayuki; Uehara, Akihiro; Fujii, Toshiyuki; Shirai, Osamu; Yamana, Hajimu; Sato, Nobuaki

    2005-01-01

    In order to investigate the redox equilibrium of uranium ions in molten NaCl-2CsCl, UV-Vis absorption spectro-photometry measurements were performed for U 4+ and U 3+ in molten NaCl-2CsCl at 923 K under simultaneous electrolytic control of their ratio. Prominent absorption bands at 480 and 570 nm were assigned to U 3+ , and their molar absorptivities were determined to be 1,260±42 and 963±32 mol -1 ·l·cm -1 respectively. From the dependence of the rest potential of the melt on the spectrophotometrically determined ratio of [U 4+ ]/[U 3+ ], the standard redox potential of the couple U 4+ /U 3+ at 923 K was determined to be -1.481±0.004 V vs. Cl 2 /Cl - . Cyclic voltammetry measurements were carried out for the couple U 4+ /U 3+ , and the results agreed well with this standard redox potential value. By the results of cyclic voltammetry, a temperature dependence of the standard redox potential was found to be -2.094+6.639 x 10 -4 T (T=823-923K). (author)

  4. Positron attachment to the H2(A 3Σu) state

    International Nuclear Information System (INIS)

    Mitroy, J.; Zhang, J. Y.

    2011-01-01

    The stochastic variational method is used to compute the binding energy for positrons attached to the repulsive H 2 (A 3 Σ u ) state. Attachment occurs for internuclear separations between 1.616 a 0 and 1.818 a 0 . At these distances the vertical ionization potential for the H 2 (A 3 Σ u ) state is close to the positronium binding energy of 0.250 a.u. The maximum attachment energy occurs at 1.67 a 0 and is 0.003532 a.u.

  5. Microstructure of the irradiated U 3Si 2/Al silicide dispersion fuel

    Science.gov (United States)

    Gan, J.; Keiser, D. D.; Miller, B. D.; Jue, J.-F.; Robinson, A. B.; Madden, J. W.; Medvedev, P. G.; Wachs, D. M.

    2011-12-01

    The silicide dispersion fuel of U 3Si 2/Al is recognized as the best performance fuel for many nuclear research and test reactors with up to 4.8 gU/cm 3 fuel loading. An irradiated U 3Si 2/Al dispersion fuel ( 235U ˜ 75%) from the high-flux side of a fuel plate (U0R040) from the Reduced Enrichment for Research and Test Reactors (RERTR)-8 test was characterized using transmission electron microscopy (TEM). The fuel was irradiated in the Advanced Test Reactor (ATR) for 105 days. The average irradiation temperature and fission density of the U 3Si 2 fuel particles for the TEM sample are estimated to be approximately 110 °C and 5.4 × 10 27 f/m 3. The characterization was performed using a 200-kV TEM. The U/Si ratio for the fuel particle and (Si + Al)/U for the fuel-matrix-interaction layer are approximately 1.1 and 4-10, respectively. The estimated average diameter, number density and volume fraction for small bubbles (<1 μm) in the fuel particle are ˜94 nm, 1.05 × 10 20 m -3 and ˜11%, respectively. The results and their implication on the performance of the U 3Si 2/Al silicide dispersion fuel are discussed.

  6. Properties of U3Si2-Al dispersion fuel element and its application

    International Nuclear Information System (INIS)

    Yin Changgeng

    2001-01-01

    The properties of U 3 Si 2 fuel and U 3 Si 2 -Al dispersion fuel element are introduced, which include U-loading; the banding quality, U-homogeneity and 'dog-bone' phenomenon, the minimum thickness of cladding and the corrosion performances. The fabrication technique of fuel elements, NDT for fuel plates, assemble technique of fuel elements and the application of U 3 Si 2 -Al dispersion fuel elements in the world are introduced

  7. Convergence of exterior solutions to radial Cauchy solutions for $\\partial_t^2U-c^2\\Delta U=0$

    Directory of Open Access Journals (Sweden)

    Helge Kristian Jenssen

    2016-09-01

    Full Text Available Consider the Cauchy problem for the 3-D linear wave equation $\\partial_t^2U-c^2\\Delta U=0$ with radial initial data $U(0,x=\\Phi(x=\\varphi(|x|$, $U_t(0,x=\\Psi(x=\\psi(|x|$. A standard result states that $U$ belongs to $C([0,T];H^s(\\mathbb{R}^3$ whenever $(\\Phi,\\Psi\\in H^s\\times H^{s-1}(\\mathbb{R}^3$. In this article we are interested in the question of how U can be realized as a limit of solutions to initial-boundary value problems on the exterior of vanishing balls $B_\\varepsilon$ about the origin. We note that, as the solutions we compare are defined on different domains, the answer is not an immediate consequence of $H^s$ well-posedness for the wave equation.

  8. Transformation temperatures γU → δUZr2 Y γU →αU in U-Zr-Nb alloys

    International Nuclear Information System (INIS)

    Komar Varela, Carolina L.; Arico, Sergio F.; Gribaudo, Luis M.; Comision Nacional de Energia Atomica, General San Martin

    2009-01-01

    The international RERTR program has as primary objective the development of new fuels for research and test reactors to satisfy the requirement of low enrichment in 235 U (lower than 20 %). It is known that the cubic-phase (γU) has an excellent behaviour under irradiation. In this context, in the Materials Department (GIDAT-GAEN-CNEA) U-Zr-Nb alloys are considered candidates for the development of a high-density monolithic-type nuclear fuel. It is necessary to evaluate the thermodynamic parameters that allow to obtain a range of concentrations of the U-Zr-Nb system in which this phase can be retained in the metastable condition with the required 235 U density. In this work, eight U alloys with concentrations ranging from 13.9 to 43.7 wt.% Zr and from 0 to 6.4 wt.% Nb, were fabricated. Dynamical measurements of electrical resistivity, with a cooling rate of 4 o C/min, were performed and the results were analyzed. Considering this cooling rate, a Nb concentration of at least 17.8 wt. % would inhibit the transformation γU→ δUZr 2 and a concentration of al least 23.3 wt % would inhibit the γU → αU transformation. (author)

  9. Comparative investigation of the solution species [U(CO3)5]6- and the crystal structure of Na6[U(CO3)5].12H2O.

    Science.gov (United States)

    Hennig, Christoph; Ikeda-Ohno, Atsushi; Emmerling, Fanziska; Kraus, Werner; Bernhard, Gert

    2010-04-21

    The limiting U(IV) carbonate species in aqueous solution was investigated by comparing its structure parameters with those of the complex preserved in a crystal structure. The solution species prevails in aqueous solution of 0.05 M U(IV) and 1 M NaHCO(3) at pH 8.3. Single crystals of Na(6)[U(CO(3))(5)].12H(2)O were obtained directly from this mother solution. The U(IV) carbonate complex in the crystal structure was identified as a monomeric [U(CO(3))(5)](6-) anionic complex. The interatomic distances around the U(IV) coordination polyhedron show average distances of U-O = 2.461(8) A, U-C = 2.912(4) A and U-O(dist) = 4.164(6) A. U L(3)-edge EXAFS spectra were collected from the solid Na(6)[U(CO(3))(5)].12H(2)O and the corresponding solution. The first shell of the Fourier transforms (FTs) revealed, in both samples, a coordination of ten oxygen atoms at an average U-O distance of 2.45 +/- 0.02 A, the second shell originates from five carbon atoms with a U-C distance of 2.91 +/- 0.02 A, and the third shell was fit with single and multiple scattering paths of the distal oxygen at 4.17 +/- 0.02 A. These data indicate the identity of the [U(CO(3))(5)](6-) complex in solid and solution state. The high negative charge of the [U(CO(3))(5)](6-) anion is compensated by Na(+) cations. In solid state the Na(+) cations form a bridging network between the [U(CO(3))(5)](6-) units, while in liquid state the Na(+) cations seem to be located close to the anionic complex. The average metal-oxygen distances of the coordination polyhedron show a linear correlation to the radius contraction of the neighbouring actinide(IV) ions and indicate the equivalence of the [An(CO(3))(5)](6-) coordination within the series of thorium, uranium, neptunium and plutonium.

  10. Equilibrium electrode U(4)-U and redox U(4)-U(3) potentials in molten alkali metal chlorides medium

    Energy Technology Data Exchange (ETDEWEB)

    Smirnov, M V; Kudyakov, V Ya; Komarov, V E; Salyulev, A B [AN SSSR, Sverdlovsk. Inst. Ehlektrokhimii

    1979-02-01

    Conditional standard electrode potentials of uranium are determined for diluted solutions of its tetrachloride in alkali metal chloride melts (LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl) when using U(4) ion activity coefficient values experimentally found by the tensimetric method. These potentials shift to the electronegative side at the temperature decrease and alkali cation radius increase rsub(Msup(+)) according to the empiric ratio E*U(4)-U= -3.06+6.87x10/sup -4/ T-(1.67-10/sup -4/T-0.44) 1/rsub(Msup(+)) +-0.01. The temperature dependences of formal conditional redox potentials of the U(4)-U(3) system for above melted chlorides are estimated. The E*U(4)-U(3) value also becomes more electronegative in the series LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl. This alternation is satisfactorily described by the empiric expression E*U(4)-U(3)= -1.74+1.74x10/sup -4/T-(0.71x10/sup -4/T-0.20) 1rsub(Msup(+)) +-0.05. The calculated values Eu*(4)-U(3) are compared with those directly measured for the NaCl-KCl equimolar mixture and 3LiCl-2KCl eutectic mixture. A satisfactory confirmity has been observed.

  11. Equilibrium electrode U(4)-U and redox U(4)-U(3) potentials in molten alkali metal chlorides medium

    International Nuclear Information System (INIS)

    Smirnov, M.V.; Kudyakov, V.Ya.; Komarov, V.E.; Salyulev, A.B.

    1979-01-01

    Conditional standard electrode potentials of uranium are determined for diluted solutions of its tetrachloride in alkali metal chloride melts (LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl) when using U(4) ion activity coefficient values experimentally found by the tensimetric method. These potentials shift to the electronegative side at the temperature decrease and alkali cation radius increase rsub(Msup(+)) according to the empiric ratio E*U(4)-U= -3.06+6.87x10 -4 T-(1.67-10 -4 T-0.44) 1/rsub(Msup(+)) +-0.01. The temperature dependences of formal conditional redox potentials of the U(4)-U(3) system for above melted chlorides are estimated. The E*U(4)-U(3) value also becomes more electronegative in the series LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl. This alternation is satisfactorily described by the empiric expression E*U(4)-U(3)= -1.74+1.74x10 -4 T-(0.71x10 -4 T-0.20) 1rsub(Msup(+)) +-0.05. The calculated values Eu*(4)-U(3) are compared with those directly measured for the NaCl-KCl equimolar mixture and 3LiCl-2KCl eutectic mixture. A satisfactory confirmity has been observed

  12. Contribution to the U$_2$C$_3$ formation by the synthetic reaction and by the decomposition of UC$_2$; Beitrag zur U$_2$C$_3$-bildung nach der synthetischen reaktion und durch zerfall von UC$_2$

    Energy Technology Data Exchange (ETDEWEB)

    Buschinelli, A. J.A.

    1974-06-01

    This work is a contribution to the study of the mechanism and of the kinetics of the U$_2$C$_3$ formation by the synthetic reaction. The influences of a mechanical and a thermical pre-treatment of the samples on the reaction kinetics were investigated and discussed taking into account other information from the literature. The relative increasing of the U$_2$C$_3$ nucleation rate due to the pulverization corresponds approximately to the surface enlargement of the pulverized material. The activation energy for the synthetic reaction in powder was found to be 94 +- 7 kcal/mol. The negative influence of nitrogen, oxygen and tungsten on the U$_2$C$_3$ formation was reported. In the decomposition of UC$_2$ to U$_2$C$_3$ and graphite, the influences of the morphology of the graphite precipitate and the fast neutron irradiation on the beginning of the U$_2$C$_3$ formation were also investigated.

  13. Oxidation behaviour of plutonium rich (U, Pu)C and (U, Pu)O{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Sali, S.K., E-mail: sksali@barc.gov.in [Fuel Chemistry Division (India); Kulkarni, N.K.; Phatak, Rohan [Fuel Chemistry Division (India); Agarwal, Renu [Product Development Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India)

    2016-10-15

    Oxidation behaviour of (U{sub 0.3}Pu{sub 0.7})C{sub 1.06} was investigated in air by heating samples up to 1073 K and 1273 K. Thermogravimetry (TG) of the samples and X-ray powder diffraction (XRD) of the intermediate products were used to understand the phenomenon taking place during this process. Theoretical calculations were carried out to understand the multiple phase changes taking place during oxidation of carbide. Theoretical results were validated by XRD analysis of the products obtained at different stages of oxidation. The final oxidized products were found to be a single FCC phase with O/M = 2.15 (M = U + Pu). Oxidation kinetic studies of (U{sub 0.3}Pu{sub 0.7})O{sub 2} and (U{sub 0.47}Pu{sub 0.53})O{sub 2} were carried out in dry air, using thermogravimetry, under non-isothermal conditions. The activation energy of oxidation was found to be 49 and 70 kJ/mol, respectively. Lattice parameter dependence on Pu/M and O/M of plutonium rich mixed oxide (MOX) was established using combined results of XRD and TG analysis of (U{sub 0.3}Pu{sub 0.7})O{sub 2+x} and (U{sub 0.47}Pu{sub 0.53})O{sub 2+x}.

  14. Grain Size and Phase Purity Characterization of U3Si2 Pellet Fuel

    Energy Technology Data Exchange (ETDEWEB)

    Hoggan, Rita E. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Tolman, Kevin R. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Cappia, Fabiola [Idaho National Lab. (INL), Idaho Falls, ID (United States); Wagner, Adrian R. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Harp, Jason M. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2018-05-01

    Characterization of U3Si2 fresh fuel pellets is important for quality assurance and validation of the finished product. Grain size measurement methods, phase identification methods using scanning electron microscopes equipped with energy dispersive spectroscopy and x-ray diffraction, and phase quantification methods via image analysis have been developed and implemented on U3Si2 pellet samples. A wide variety of samples have been characterized including representative pellets from an initial irradiation experiment, and samples produced using optimized methods to enhance phase purity from an extended fabrication effort. The average grain size for initial pellets was between 16 and 18 µm. The typical average grain size for pellets from the extended fabrication was between 20 and 30 µm with some samples exhibiting irregular grain growth. Pellets from the latter half of extended fabrication had a bimodal grain size distribution consisting of coarsened grains (>80 µm) surrounded by the typical (20-30 µm) grain structure around the surface. Phases identified in initial uranium silicide pellets included: U3Si2 as the main phase composing about 80 vol. %, Si rich phases (USi and U5Si4) composing about 13 vol. %, and UO2 composing about 5 vol. %. Initial batches from the extended U3Si2 pellet fabrication had similar phases and phase quantities. The latter half of the extended fabrication pellet batches did not contain Si rich phases, and had between 1-5% UO2: achieving U3Si2 phase purity between 95 vol. % and 98 vol. % U3Si2. The amount of UO2 in sintered U3Si2 pellets is correlated to the length of time between U3Si2 powder fabrication and pellet formation. These measurements provide information necessary to optimize fabrication efforts and a baseline for future work on this fuel compound.

  15. Hydrogen absorption in U{sub 3}Si{sub 2} and its impact on electronic properties

    Energy Technology Data Exchange (ETDEWEB)

    Mašková, Silvie, E-mail: maskova@mag.mff.cuni.cz [Department of Condensed Matter Physics, Charles University, Prague 2, The Czech Republic (Czech Republic); Miliyanchuk, Khrystyna [Department of Inorganic Chemistry, Ivan Franko National University of Lviv, Lviv (Ukraine); Havela, Ladislav [Department of Condensed Matter Physics, Charles University, Prague 2, The Czech Republic (Czech Republic)

    2017-04-15

    U{sub 3}Si{sub 2} reversibly absorbs hydrogen at very low H{sub 2} pressures (kPa range), yielding U{sub 3}Si{sub 2}H{sub 1.8}. One characteristic desorption temperature implies that there is only one type of H sites. U{sub 3}Si{sub 2} is a weak Pauli paramagnet (χ < 2·10{sup −8} m{sup 3}/mol U) with the shortest inter-uranium distances between the U atoms in different sheets (d{sub U-U} = 332 pm). The volume-expanded (10%) hydride is a spin fluctuator with temperature dependent magnetic susceptibility and a weak ferromagnetic component gradually arising below T = 100 K. The location of U{sub 3}Si{sub 2}H{sub 1.8} at the verge of magnetic ordering is evidenced by the low temperature specific heat with an upturn in C/T and a dramatic enhancement of the Sommerfeld coefficient of electronic specific heat γ, which reaches 500 mJ/mol f.u. K{sup 2}. - Highlights: •U{sub 3}Si{sub 2} can be hydrogenated at very low H{sub 2} pressure, yielding U{sub 3}Si{sub 2}H{sub 1.8}. •The H absorption to a single H-site is reversible. •Hydrogenation leads to the expansion of the unit cell by 10%. •U{sub 3}Si{sub 2} is a weak Pauli paramagnet. •The hydride is a spin fluctuator with temperature dependent magnetic susceptibility.

  16. U3Si2 behavior in H2O: Part I, flowing steam and the effect of hydrogen

    Science.gov (United States)

    Wood, E. Sooby; White, J. T.; Grote, C. J.; Nelson, A. T.

    2018-04-01

    Recent interest in U3Si2 as an advanced light water reactor fuel has driven assessment of numerous properties, but characterization of its response to H2O environments is absent from the literature. The behavior of U3Si2 in H2O containing atmospheres is investigated and presented in a two-part series of articles aimed to understand the degradation mechanism of U3Si2 in H2O. Reported here are thermogravimetric data for U3Si2 exposed to flowing steam at 250-470 °C. Additionally the response of U3Si2 to flowing Ar-6% H2 from 350 to 400 °C is presented. Microstructural degradation is observed following hours of exposure at 350 °C in steam. U3Si2 undergoes pulverization on the timescale of minutes when temperatures are increased above 400 °C. This mechanism is accelerated in flowing Ar-H2 at the same temperatures.

  17. The Recovery of Uranium From The Rejected Fuel Plate Dispersion Type of U3O8-Al and U3Si2Al by NaOH

    International Nuclear Information System (INIS)

    Widodo, G; Aji, D

    1998-01-01

    The recovery of uranium from the rejected fuel plate dispersion type of U 3 O 8 -AI And U 3 Si 2 -AI with a dissolution has been performed.Each of 5 fragment of fuel plate dispersion of U 3 O 8 -AI or U 3 Si 2 Al of 1x4 cm size was put in the distilled glass content of 250 ml NaOH solution whit The concentration variation 10,15,20,25,and 30%,and than was heated at temperature of 102 o C and was stirred constantly by magnetic stirred.Uranium in the form of U 3 O 8 or U 3 Si 2 was separated by filtration and Either residu and filtrate was analyzed by potentiometry using modified Devies Gray method. From the experiment data it was found in the residu that presentation of uranium was 83.99-84.05% and 84.67-86.556% while in filtrate it was found 53.90 ppm and 69.3 ppm

  18. Nightglow vibrational distributions in the A3Σu+ and A'3Δu states of O2 derived from astronomical sky spectra

    Directory of Open Access Journals (Sweden)

    T. G. Slanger

    2004-09-01

    Full Text Available Astronomical sky spectra from the Keck I telescope on Mauna Kea have been used to obtain vibrational distributions in the O2A3Σu+ and O2(A'3Δu states from rotationally-resolved Herzberg I and Chamberlain band emissions in the terrestrial nightglow. The A3Σu+ distribution is similar to that presented in earlier publications, with the exception that there is significant population in the previously undiscerned v=0 level. The vibrational distributions of the A'3Δu and A3Σu+ states are essentially the same when comparison is made in terms of the level energies. The intensity of Chamberlain band emission at the peak of the distribution is about one-fourth that of the Herzberg I emission, as previously shown, and may be related primarily to radiative efficiency. The peaks in both population distributions are about 0.25eV below the O(3P+O(3P dissociation limit. We compare these Herzberg state distributions with that of the O2(b1Σg+ state, concurring with others that the intense nightglow emission associated with b1Σg+(v=0 is a reflection of direct transfer from the Herzberg states. This process takes place following O2 collisions, with simultaneous production of very high a1Δg and b1Σg+ vibrational levels.

  19. The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms

    KAUST Repository

    Park, Hyo-Young

    2017-04-21

    The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms. These proteins also move rapidly and continuously in the nuclei, and their movements are affected by ATP depletion. The U2AF65 proteins are splicing factors that interact with SF1 and U2AF35 proteins to promote U2snRNP for the recognition of the pre-mRNA 3\\' splice site during early spliceosome assembly. We have determined the subcellular localization and movement of these proteins\\' Arabidopsis homologs. It was found that Arabidopsis U2AF65 homologs, AtU2AF65a, and AtU2AF65b proteins interact with AtU2AF35a and AtU2AF35b, which are Arabidopsis U2AF35 homologs. We have examined the mobility of these proteins including AtSF1 using fluorescence recovery after photobleaching and fluorescence loss in photobleaching analyses. These proteins displayed dynamic movements in nuclei and their movements were affected by ATP depletion. We have also demonstrated that these proteins shuttle between nuclei and cytoplasms, suggesting that they may also function in cytoplasm. These results indicate that such splicing factors show very similar characteristics to their human counterparts, suggesting evolutionary conservation.

  20. The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms

    KAUST Repository

    Park, Hyo-Young; Lee, Keh Chien; Jang, Yun Hee; Kim, SoonKap; Thu, May Phyo; Lee, Jeong Hwan; Kim, Jeong-Kook

    2017-01-01

    The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms. These proteins also move rapidly and continuously in the nuclei, and their movements are affected by ATP depletion. The U2AF65 proteins are splicing factors that interact with SF1 and U2AF35 proteins to promote U2snRNP for the recognition of the pre-mRNA 3' splice site during early spliceosome assembly. We have determined the subcellular localization and movement of these proteins' Arabidopsis homologs. It was found that Arabidopsis U2AF65 homologs, AtU2AF65a, and AtU2AF65b proteins interact with AtU2AF35a and AtU2AF35b, which are Arabidopsis U2AF35 homologs. We have examined the mobility of these proteins including AtSF1 using fluorescence recovery after photobleaching and fluorescence loss in photobleaching analyses. These proteins displayed dynamic movements in nuclei and their movements were affected by ATP depletion. We have also demonstrated that these proteins shuttle between nuclei and cytoplasms, suggesting that they may also function in cytoplasm. These results indicate that such splicing factors show very similar characteristics to their human counterparts, suggesting evolutionary conservation.

  1. Walls of massive K\\"ahler sigma models on SO(2N)/U(N) and Sp(N)/U(N)

    OpenAIRE

    Arai, Masato; Shin, Sunyoung

    2011-01-01

    We study the Bogomol'nyi-Prasad-Sommerfield wall solutions in massive K\\"ahler nonlinear sigma models on SO(2N)/U(N) and Sp(N)/U(N) in three-dimensional spacetime. We show that SO(2N)/U(N) and Sp(N)/U(N) models have 2^{N-1} and 2^N discrete vacua, respectively. We explicitly construct the exact BPS multiwall solutions for N\\le 3.

  2. Quantum algebra U{sub qp}(u{sub 2}) and application to the rotational collective dynamics of the nuclei; Algebre quantique U{sub qp}(u{sub 2}) et application a la dynamique collective de rotation dans les noyaux

    Energy Technology Data Exchange (ETDEWEB)

    Barbier, R

    1995-09-22

    This thesis concerns some aspects of new symmetries in Nuclear Physics. It comprises three parts. The first one is devoted to the study of the quantum algebra U{sub qp}(u{sub 2}). More precisely, we develop its Hopf algebraic structure and we study its co-product structure. The bases of the representation theory of U{sub qp}(u{sub 2}) are introduced. On one hand, we construct the finite-dimensional irreducible representations of U{sub qp}(u{sub 2}). On the other hand, we calculate the Clebsch-Gordan coefficients with the projection operator method. To complete our study, we construct some deformed boson mappings of the quantum algebras U{sub qp}(u{sub 2}), U{sub q{sup 2}}(su{sub 2}) and U{sub qp}(u{sub 1,1}). The second part deals with the construction of a new phenomenological model of the non rigid rotator. This model is based on the quantum algebra U{sub qp}(u{sub 2}). The rotational energy and the E2 reduced transition probabilities are obtained. They depend on the two deformation parameters q and p of the quantum algebra. We show how the use of the two-parameter deformation of the algebra U{sub qp}(u{sub 2}) leads to a generalization of the U{sub q}(su{sub 2})-rotator model. We also introduce a new model of the anharmonic oscillator on the basis of the quantum algebra U{sub qp}(u{sub 2}). We show that the system of the U{sub q}(su{sub 2})-rotator and of the anharmonic oscillator can be coupled with the use of the deformation parameters of U{sub qp}(u{sub 2}). A ro-vibration energy formula and expansion `a la` Dunham are obtained. The aim of the last part is to apply our non rigid rotator model to the rotational collective dynamics of the superdeformed nuclei of the A{approx}130 - 150 and A{approx}190 mass regions and deformed nuclei of the actinide and rare earth series. We adjust the free parameters of our model and compare our results with those from four other models of the non rigid rotator. A comparative analysis is given in terms of transition energies.

  3. Higgs phenomenology in the minimal S U (3 )L×U (1 )X model

    Science.gov (United States)

    Okada, Hiroshi; Okada, Nobuchika; Orikasa, Yuta; Yagyu, Kei

    2016-07-01

    We investigate the phenomenology of a model based on the S U (3 )c×S U (3 )L×U (1 )X gauge theory, the so-called 331 model. In particular, we focus on the Higgs sector of the model which is composed of three S U (3 )L triplet Higgs fields and is the minimal form for realizing a phenomenologically acceptable scenario. After the spontaneous symmetry breaking S U (3 )L×U (1 )X→S U (2 )L×U (1 )Y , our Higgs sector effectively becomes that with two S U (2 )L doublet scalar fields, in which the first- and the second-generation quarks couple to a different Higgs doublet from that which couples to the third-generation quarks. This structure causes the flavor-changing neutral current mediated by Higgs bosons at the tree level. By taking an alignment limit of the mass matrix for the C P -even Higgs bosons, which is naturally realized in the case with the breaking scale of S U (3 )L×U (1 )X much larger than that of S U (2 )L×U (1 )Y, we can avoid current constraints from flavor experiments such as the B0-B¯ 0 mixing even for the Higgs bosons masses that are O (100 ) GeV . In this allowed parameter space, we clarify that a characteristic deviation in quark Yukawa couplings of the Standard Model-like Higgs boson is predicted, which has a different pattern from that seen in two Higgs doublet models with a softly broken Z2 symmetry. We also find that the flavor-violating decay modes of the extra Higgs boson, e.g., H /A →t c and H±→t s , can be dominant, and they yield the important signature to distinguish our model from the two Higgs doublet models.

  4. Synthesis of (R)-5-(Di[2,3-3H2]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one-([3H]U-86170) and (R)-5-([2,3-3H2]propylamino)-5,6-dihydro-4H-imidazo(4,5,1-ij) quinolin-2(1H)-one ([3H]U-91356)

    International Nuclear Information System (INIS)

    Moon, M.W.; Hsi, R.S.P.

    1992-01-01

    (R)-5-(diallylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one (12b) was prepared in 9% overall yield from 3-aminoquinoline. Reaction of 12b in ethyl acetate with tritium gas in presence of a 5% platinum on carbon catalyst afforded a mixture of (R)-5-(di[2,3- 3 H 2 ]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]-quinolin-2(1H)-one ([ 3 H]U-86170, 69 Ci/mmol) and (R)-5-([2,3- 3 H 2 ]-propylamino)5,6-dihydro-4H-imidazo-[4,5,1-ij]quinolin-2(1H)-one ( [ 3 H]U-91356, 34 Ci/mmol) which was separated by preparative reverse-phase chromatography. U-86170 and U-91356 are potent dopamine D2 agonists. The labelled compounds are useful for drug disposition studies. [ 3 H]U-86170 is also useful as a dopamine D2 agonist radioligand for receptor binding studies. (author)

  5. Reaction kinetics aspect of U3O8 kernel with gas H2 on the characteristics of activation energy, reaction rate constant and O/U ratio of UO2 kernel

    International Nuclear Information System (INIS)

    Damunir

    2007-01-01

    The reaction kinetics aspect of U 3 O 8 kernel with gas H 2 on the characteristics of activation energy, reaction rate constant and O/U ratio of UO 2 kernel had been studied. U 3 O 8 kernel was reacted with gas H 2 in a reduction furnace at varied reaction time and temperature. The reaction temperature was varied at 600, 700, 750 and 850 °C with a pressure of 50 mmHg for 3 hours in gas N 2 atmosphere. The reation time was varied at 1, 2, 3 and 4 hours at a temperature of 750 °C using similar conditions. The reaction product was UO 2 kernel. The reaction kinetic aspect between U 3 O 8 and gas H 2 comprised the minimum activation energy (ΔE), the reaction rate constant and the O/U ratio of UO 2 kernel. The minimum activation energy was determined from a straight line slope of equation ln [{D b . R o {(1 - (1 - X b ) ⅓ } / (b.t.Cg)] = -3.9406 x 10 3 / T + 4.044. By multiplying with the straight line slope -3.9406 x 10 3 , the ideal gas constant (R) 1.985 cal/mol and the molarity difference of reaction coefficient 2, a minimum activation energy of 15.644 kcal/mol was obtained. The reaction rate constant was determined from first-order chemical reaction control and Arrhenius equation. The O/U ratio of UO 2 kernel was obtained using gravimetric method. The analysis result of reaction rate constant with chemical reaction control equation yielded reaction rate constants of 0.745 - 1.671 s -1 and the Arrhenius equation at temperatures of 650 - 850 °C yielded reaction rate constants of 0.637 - 2.914 s -1 . The O/U ratios of UO 2 kernel at the respective reaction rate constants were 2.013 - 2.014 and the O/U ratios at reaction time 1 - 4 hours were 2.04 - 2.011. The experiment results indicated that the minimum activation energy influenced the rate constant of first-order reaction and the O/U ratio of UO 2 kernel. The optimum condition was obtained at reaction rate constant of 1.43 s -1 , O/U ratio of UO 2 kernel of 2.01 at temperature of 750 °C and reaction time of 3

  6. U3Si2 Fabrication and Testing for Implementation into the BISON Fuel Performance Code

    Energy Technology Data Exchange (ETDEWEB)

    Knight, Travis W.

    2018-04-23

    A creep test stand was designed and constructed for compressive creep testing of U3Si2 pellets. This is described in Chapter 3.

    • Creep testing of U3Si2 pellets was completed. In total, 13 compressive creep tests of U3Si2 pellets was successfully completed. This is reported in Chapter 3.
    • Secondary creep model of U3Si2 was developed and implemented in BISON. This is described in Chapter 4.
    • Properties of U3Si2 were implemented in BISON. This is described in Chapter 4.
    • A resonant frequency and damping analyzer (RFDA) using impulse excitation technique (IET) was setup, tested, and used to analyze U3Si2 samples to measure Young’s and Shear Moduli which were then used to calculate the Poisson ratio for U3Si2. This is described in Chapter 5.
    • Characterization of U3Si2 samples was completed. Samples were prepared and analyzed by XRD, SEM, and optical microscopy. Grain size analysis was conducted on images.
    SEM with EDS was used to analyze second phase precipitates. Impulse excitation technique was used to determine the Young’s and Shear Moduli of a tile specimen which allowed for the determination of the Poisson ratio. Helium pycnometry and mercury intrusion porosimetry was performed and used with image analysis to determine porosity size distribution. Vickers microindentation characterization method was used to evaluate the mechanical properties of U3Si2 including toughness, hardness, and Vickers hardness. Electrical resistivity measurement was done using the four-point probe method. This is reported in Chapter 5.

  7. U2 laulusõnade tundmine lennutab Hawaile

    Index Scriptorium Estoniae

    2006-01-01

    Iiri bänd U2 algatas oma uue albumi "U2 18 Singles väljatuleku puhul internetis võistluse "Hunt The Lyric", kus fännidel on võimalus võita reis Hawaile (reisi paketis ka U2 "Vertigo" tuuri kontsert 9. dets.)

  8. Single crystal structures and theoretical calculations of uranium endohedral metallofullerenes (U@C2n , 2n = 74, 82) show cage isomer dependent oxidation states for U.

    Science.gov (United States)

    Cai, Wenting; Morales-Martínez, Roser; Zhang, Xingxing; Najera, Daniel; Romero, Elkin L; Metta-Magaña, Alejandro; Rodríguez-Fortea, Antonio; Fortier, Skye; Chen, Ning; Poblet, Josep M; Echegoyen, Luis

    2017-08-01

    Charge transfer is a general phenomenon observed for all endohedral mono-metallofullerenes. Since the detection of the first endohedral metallofullerene (EMF), La@C 82 , in 1991, it has always been observed that the oxidation state of a given encapsulated metal is always the same, regardless of the cage size. No crystallographic data exist for any early actinide endohedrals and little is known about the oxidation states for the few compounds that have been reported. Here we report the X-ray structures of three uranium metallofullerenes, U@ D 3h -C 74 , U@ C 2 (5)-C 82 and U@ C 2v (9)-C 82 , and provide theoretical evidence for cage isomer dependent charge transfer states for U. Results from DFT calculations show that U@ D 3h -C 74 and U@ C 2 (5)-C 82 have tetravalent electronic configurations corresponding to U 4+ @ D 3h -C 74 4- and U 4+ @ C 2 (5)-C 82 4- . Surprisingly, the isomeric U@ C 2v (9)-C 82 has a trivalent electronic configuration corresponding to U 3+ @ C 2v (9)-C 82 3- . These are the first X-ray crystallographic structures of uranium EMFs and this is first observation of metal oxidation state dependence on carbon cage isomerism for mono-EMFs.

  9. Determination of U{sub 3}O{sub 8} in UO{sub 2} by infrared spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Liliane Aparecida; Lameiras, Fernando Soares; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa; Barbosa, Joao Batista Santos, E-mail: lasfisica@gmail.com, E-mail: sl@cdtn.br, E-mail: amms@cdtn.br, E-mail: ferrazw@cdtn.br, E-mail: jbsb@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN), Belo Horizonte, MG (Brazil)

    2017-01-15

    The oxygen-uranium (O-U) system has various oxides, such as UO{sub 2}, U{sub 4}O{sub 9}, U{sub 3}O{sub 8}, and UO{sub 3}. Uranium dioxide is the most important one because it is used as nuclear fuel in nuclear power plants. UO{sub 2} can have a wide stoichiometric variation due to excess or deficiency of oxygen in its crystal lattice, which can cause significant modifications of its proprieties. O/U relation determination by gravimetry cannot differentiate a stoichiometric deviation from contents of other uranium oxides in UO{sub 2}. The presence of other oxides in the manufacturing of UO{sub 2} powder or sintered pellets is a critical factor. Fourier Transform Infrared Spectroscopy (FTIR) was used to identify U{sub 3}O{sub 8} in samples of UO{sub 2} powder. UO{sub 2} can be identified by bands at 340 cm{sup -1} and 470 cm{sup -1}, and U{sub 3}O{sub 8} and UO{sub 3} by bands at 735 cm{sup -1}, 910 cm{sup -1}, respectively. The methodology for sample preparation for FTIR spectra acquisition is presented, as well as the calibration for quantitative measurement of U{sub 3}O{sub 8} in UO{sub 2}. The content of U{sub 3}O{sub 8} in partially calcined samples of UO{sub 2} powder was measured by FTIR with good agreement with X-rays diffractometry (XRD). (author)

  10. Thermal Characteristic Of AIMg2 Cladding And Fuel Plates Of U3Si2-Al With Various Uranium Loading

    International Nuclear Information System (INIS)

    Aslina, Br. G.; Suparjo; Aggraini, D.; Hasbullah, N.

    1998-01-01

    Thermal characteristic analyzed in this paper included linear expansion value, coefficient expansion, and enthalpy of cladding material fuel core and fuel plate of U 3 Si 2 -AI. Before analyzing, the fresh cladding of AIMg2 (without treatment) and the rolled AIMg2 were annealed at temperature of 425 o C for 1 hour, and the fuel plates of U 3 Si 2 -AI was prepared for various uranium loading of 0.9 - 3.6 - 4.2 - 4.8 and 5.2 g/cm 3 . Linear expansion nominal value and expansion coefficient were analyzed by using Dilatometer whereas enthalpy determination used Differential Thermal Analysis (DTA). The linear expansion and expansion coefficient analysis was performed to study the dimension cladding and of fuel plates during their stay in the reactor core, whereas determination of enthalpy was carried out to estimate the energy absorbed and released by fuel meat of U 3 Si 2 -AI to the cooling water through AlMg2 as a cladding. The result showed that the linear expansion and expansion coefficient of fresh AIMg2 cladding, rolled AIMg2 and fuel plates of U 3 Si 2 -AI are increased with the increase of temperature as well as the increase of uranium loading. The enthalpy measure showed that the enthalpy of fresh AIMg2 is smaller than that of rolled AIMg2 but melting temperature of fresh AIMg2 is greater than that of rolled AIMg2. The enthalpy of fuel plates and meat of U 3 Si 2 -AI is less than that of plates of U 3 Si 2 -AI. The enthalpy of fuel platers and meat of U 3 Si 2 -AI decrease with the increase of uranium loading. It is concluded that the fuel meat more reactive than fuel plates of U 3 Si 2 -AI

  11. The effect of U3O-8 addition on the UO2 pellet

    International Nuclear Information System (INIS)

    Indrati, Y.T.; Syarif, D. G.; Handayani, A.

    1998-01-01

    The purpose of varied U 3 O 8 addition on the UO 2 pellet fabrication is to from 1-3 mu pores. The green pellets, compacted with 3 ton/cm 2 , are a mixture powder of UO 2 , TiO 2 (0.1% weight) and varied U 3 O 8 (0-12.5% weight). The green pellets were presintered by H2 atmosphere. The presintered pellets were put on the ceramic crucibles and than those were put on the SS 316 tube with argon atmosphere. The 1400 o C sintering was hold with the soaking time 3 hr and the same rate of heating and cooling 150 o C/hr. The UO 2 pellet with 5% (weight) U 3 O 8 addition has 95.17% of theoretic density and 548.4 ±6.57 VH. Based on the identification of microstructure of pellet, it is not acceptable for nuclear fuel although pellet has 10.02 mu on grain size and 1.3 mu on closed pore size. By the diffractometer X-ray, crystal structure of pellet is face centered cubic (FCC) with the O/U ratio is 2.08

  12. Investigation for thermal stability of U3Si2 and protection methods

    International Nuclear Information System (INIS)

    Zhang Huiying; Sun Jichang; Sun Rongxian

    1994-08-01

    The thermal stability of U 3 Si 2 in Ar, N 2 and air, and the interaction between U 3 Si 2 and Al, Zr have been investigated by thermal analysis method. According to the results of thermal analysis, protection measures for various procedures have been improved. From the practice, it shows that the protection measures can ensure the safety of production and raise the product quality as well as reduce the cost effectively

  13. Radiation-induced grain subdivision and bubble formation in U3Si2 at LWR temperature

    Science.gov (United States)

    Yao, Tiankai; Gong, Bowen; He, Lingfeng; Harp, Jason; Tonks, Michael; Lian, Jie

    2018-01-01

    U3Si2, an advanced fuel form proposed for light water reactors (LWRs), has excellent thermal conductivity and a high fissile element density. However, limited understanding of the radiation performance and fission gas behavior of U3Si2 is available at LWR conditions. This study explores the irradiation behavior of U3Si2 by 300 keV Xe+ ion beam bombardment combining with in-situ transmission electron microscopy (TEM) observation. The crystal structure of U3Si2 is stable against radiation-induced amorphization at 350 °C even up to a very high dose of 64 displacements per atom (dpa). Grain subdivision of U3Si2 occurs at a relatively low dose of 0.8 dpa and continues to above 48 dpa, leading to the formation of high-density nanoparticles. Nano-sized Xe gas bubbles prevail at a dose of 24 dpa, and Xe bubble coalescence was identified with the increase of irradiation dose. The volumetric swelling resulting from Xe gas bubble formation and coalescence was estimated with respect to radiation dose, and a 2.2% volumetric swelling was observed for U3Si2 irradiated at 64 dpa. Due to extremely high susceptibility to oxidation, the nano-sized U3Si2 grains upon radiation-induced grain subdivision were oxidized to nanocrystalline UO2 in a high vacuum chamber for TEM observation, eventually leading to the formation of UO2 nanocrystallites stable up to 80 dpa.

  14. Progress in the development of uranium silicide (U3Si2) fuel at BATAN

    International Nuclear Information System (INIS)

    Suripto, A.; Soentono, S.

    1995-01-01

    After successful fabrication of two full-size prototype fuel elements containing ∼3.0 gU/cm 3 in the form of U 3 Si 2 -Al dispersion now undergoing irradiation in the Reaktor Serba Guna G.A. Siwabessy (RSG-GAS) core since 1990, further development in U 3 Si 2 -A2 dispersion fuel element manufacturing has been pursued, whose progress in discussed in this paper, with a special attention on the use of much higher-loading aimed at obtaining a better understanding on the influence of higher-loading on fuel core and plate manufacturing and quality. At present, high-loading U 3 Si 2 -AI dispersion miniplates are being manufactured for preparing some mini-fuel elements to be test-irradiated in the new MTR in-pile loop of the RSG-GAS. (author)

  15. Solid state reactions of MoO3 and Na2MoO4 with (U.85,Ce.15)O2x

    International Nuclear Information System (INIS)

    Dahale, N.D.; Keskar, Meera; Singh Mudher, K.D.; Chawla, K.L.

    1999-01-01

    (U .85 ,Ce .15 )MoO 6-x was prepared by the solid state reactions of (U .85 ,Ce .15 )O 2±x with MoO 3 in air at 600 deg C. Solid state reactions of Na 2 MoO 4 with (U .85 ,Ce .15 )MoO 6.x up to 550 deg C in air led to the formation of Na 2 (U .85 ,Ce .15 )Mo 2 O 10-x and Na 2 (U .85 , Ce .15 ) 2 Mo 3 O 16-x . These compounds were characterised by x-ray and thermal methods. The x-ray powder data of (U .85 , Ce .15 ) MoO 6-x were indexed on monoclinic system whereas, data of Na 2 (U .85 ,Ce .15 ) Mo 2 O 10-x and Na 2 (U .85 ,Ce .15 ) 2 Mo 3 O 16-x were indexed on orthorhombic and monoclinic system respectively. (author)

  16. U3Si2 behavior in H2O environments: Part II, pressurized water with controlled redox chemistry

    Science.gov (United States)

    Nelson, A. T.; Migdisov, A.; Wood, E. Sooby; Grote, C. J.

    2018-03-01

    Recent interest in U3Si2 as an advanced light water reactor fuel has driven assessment of numerous properties, but characterization of its response to H2O environments is sparse in available literature. The behavior of U3Si2 in H2O containing atmospheres is investigated and presented in a two-part series of articles. This work examines the behavior of U3Si2 following exposure to pressurized H2O at temperatures from 300 to 350 °C. Testing was performed using two autoclave configurations and multiple redox conditions. Use of solid state buffers to attain a controlled water chemistry is also presented as a means to test actinide-bearing systems. Buffers were used to vary the hydrogen concentration between 1 and 30 parts per million H2. Testing included UN, U3Si5, and UO2. Both UN and U3Si5 were found to rapidly pulverize in less than 50 h at 300 °C. Uranium dioxide was included as a control for the autoclave system, and was found to be minimally impacted by exposure to pressurized water at the conditions tested for extended time periods. Testing of U3Si2 at 300 °C found reasonable stability through 30 days in 1-5 ppm H2. However, pulverization was observed following 35 days. The redox condition of testing strongly affected pulverization. Characterization of the resulting microstructures suggests that the mechanism responsible for pulverization under more strongly reducing conditions differs from that previously identified. Hydride formation is hypothesized to drive this transition. Testing performed at 350 °C resulted in rapid pulverization of U3Si2 in under 50 h.

  17. Analysis of transuranic isotopes in irradiated U3Si2-Al fuel by alpha spectrometry

    International Nuclear Information System (INIS)

    Dian Anggraini; Aslina B Ginting; Arif Nugroho

    2011-01-01

    Separation and analysis of transuranic isotopes (uranium and plutonium) in irradiated U 3 Si 2 -Al plate has been done. The analysis experiment includes sample preparation (i.e. cutting, dissolving, filtering, dilution), fission products separation from heavy elements, and analysis of transuranic isotopes content with alpha spectrometer. The separation of transuranic isotopes (U, Pu) was done by two methods, i.e. direct method and ion exchanger method with zeolite. Measurement of standard transuranic isotope (AMR 43) and standard U 3 O 8 was done in advance in order to determine percentage of 235 U recovery and detector efficiency. Recovery of 235 U isotope was obtained as much as 92,58%, which fulfills validation requirement, and the detector efficiency was 0.314. Based on the measured recovery and detector efficiency, the separation was done by direct electrodeposition method of 250 µL irradiated U 3 Si 2 -Al solution. The deposited sample was subsequently analyzed with alpha spectrometer. The separation with ion exchanger was done by mixing and shaking of 300 µL irradiated U 3 Si 2 -Al solution and 0.5 gram zeolite to separate the liquid phase from the solid phase. The liquid phase was electrodeposited and analyzed with alpha spectrometer. The analysis of transuranic isotopes (U, Pu) by both methods shows different results. Heavy element ( 238 U, 236 U, 234 U, 239 Pu) content obtained by direct method was 0.0525 g/g and 235 U= 0.0076 g/g, while the separation using zeolite ion exchanger resulted in Heavy element = 0.0253 g/g and 235 U = 0.0092 g/g. (author)

  18. 2. Interferometry and polarimetry. 2.3. Polarimetry on JT-60U

    International Nuclear Information System (INIS)

    Kawano, Yasunori

    2000-01-01

    In order to establish an electron density measurement method with high reliability and stability for magnetic-confinement fusion devices, studies on infrared polarimetry have been carried out in JT-60U. Electron density measurement based on tangential Faraday rotation has been verified using a CO 2 laser polarimeter developed for JT-60U. In this article, basic ideas of studies, results from polarimetry experiments, and suggestions for future devices are presented. (author)

  19. Fabrication and thermophysical property characterization of UN/U3Si2 composite fuel forms

    Science.gov (United States)

    White, J. T.; Travis, A. W.; Dunwoody, J. T.; Nelson, A. T.

    2017-11-01

    High uranium density composite fuels composed of UN and U3Si2 have been fabricated using a liquid phase sintering route at temperatures between 1873 K and 1973 K and spanning compositions of 10 vol% to 40 vol% U3Si2. Microstructural analysis and phase characterization revealed the formation of an U-Si-N phase of unknown structure. Microcracking was observed in the U-Si portion of the composite microstructure that likely originates from the mismatched coefficient of thermal expansion between the UN and U3Si2 leading to stresses on heating and cooling of the composite. Thermal expansion coefficient, thermal diffusivity, and thermal conductivity were characterized for each of the compositions as a function of temperature to 1673 K. Hysteresis is observed in the thermal diffusivity for the 20 vol% through 40 vol% specimens between room temperature and 1273 K, which is attributed to the microcracking in the U-Si phase. Thermal conductivity of the composites was modeled using the MOOSE framework based on the collected microstructure data. The impact of irradiation on thermal conductivity was also simulated for this class of composite materials.

  20. Hydrogen absorption-desorption properties of U2Ti

    International Nuclear Information System (INIS)

    Yamamoto, Takuya; Tanaka, Satoru; Yamawaki, Michio

    1990-01-01

    Hydrogen absorption-desorption properties of U 2 Ti intermetallic compound was examined over the temperature range of 298 to 973 K and at hydrogen pressures below 10 5 Pa. It absorbs hydrogen up to 7.6 atoms per F.U. (formula unit) by two step reactions and hence each desorption isotherm is separated into two plateau regions. In the first plateau, a newly-found ternary hydride is formed, where the hydrogen concentration, c H , reaches 2.4 H atoms/F.U. In the second plateau, UH 3 is formed and c H reaches 7.6 H atoms/F.U. The specimen is disintegrated into fine powder in the second plateau, while in the first plateau the ternary hydride which was identified to be UTi 2 H x (x=4.8 to 6.2) showed high durability against powdering. It is predicted that UTi 2 can be suitable material for tritium storage. (orig.)

  1. Thermal expansion studies on UMoO5, UMoO6, Na2U(MoO4)3 and Na4U(MoO4)4

    International Nuclear Information System (INIS)

    Keskar, Meera; Dahale, N.D.; Krishnan, K.

    2009-01-01

    In the present work, thermal expansion behavior of lower valent sodium uranium molybdates, i.e., Na 2 U(MoO 4 ) 3 and Na 4 U(MoO 4 ) 4 were studied under vacuum in the temperature range of 298-873 K using high temperature X-ray diffractometry (HTXRD). Expansion behaviors of UMoO 5 and UMoO 6 were also studied in vacuum from 298 to 873 K and 773 K, respectively. UMoO 5 was synthesized by reacting UO 2 with MoO 3 in equi-molar proportion in evacuated sealed quartz ampoule at 1173 K for 14 h. Na 2 U(MoO 4 ) 3 and Na 4 U(MoO 4 ) 4 were prepared by reacting UMoO 5 and MoO 3 with 1 and 2 moles of Na 2 MoO 4 , respectively, at 873 K in evacuated sealed quartz ampoule. XRD data of UMoO 5 and UMoO 6 were indexed on orthorhombic and monoclinic systems, respectively, whereas, the data of Na 2 U(MoO 4 ) 3 and Na 4 U(MoO 4 ) 4 were indexed on tetragonal system. The lattice parameters and cell volume of all the four compounds, fit into polynomial expression with respect to temperature, showed positive thermal expansion (PTE) up to 873 K.

  2. Thermal properties of KUO3(s) and K2U2O7 - by high temperature Calvet calorimeter

    International Nuclear Information System (INIS)

    Jayanthi, K.; Iyer, V.S.; Venugopal, V.

    1998-01-01

    The thermal properties of KUO 3 (s) and K 2 U 2 O 7 (s) were determined using a high temperature Calvet calorimeter by drop method. The enthalpy increments, (H T o - H 298.15 0 ), in kJ/mol for KUO 3 (s) and K 2 U 2 O 7 (s) can be represented by, H T o - H 298.15 0 KUO 3 (s) kJ/mol ± 0.7 = -39.15 + 0.129T + 0.1005x10 -4 T 2 (369-714K) and H T o -H 298.15 0 K 2 U 2 O 7 (s) kJ/mol ± 0.7 = -52.99 + 0.1361T + 0.146x10 -3 T 2 (391 - 683K). (author)

  3. First-principles investigations on the electronic structures of U{sub 3}Si{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Tong [College of Information & Communication, Harbin Engineering University, Harbin, 150001 (China); Qiu, Nianxiang [Engineering Laboratory of Specialty Fibers and Nuclear Energy Materials, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang, 315201 (China); Wen, Xiaodong [State Key Laboratory of Coal Conversion, Institute of Coal Chemistry, Chinese Academy of Sciences, P.O. Box 165, Taiyuan, Shanxi, 030001 (China); Synfuels China, 100195 (China); Tian, Yonghui [College of Life Science, Sichuan University, Chengdu, Sichuan, 610064 (China); He, Jian [Center for Translational Medicine, Department of Biotechnology, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian, Liaoning, 116023 (China); Luo, Kan; Zha, Xianhu; Zhou, Yuhong; Huang, Qing; Lang, Jiajian [Engineering Laboratory of Specialty Fibers and Nuclear Energy Materials, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang, 315201 (China); Du, Shiyu, E-mail: dushiyu@nimte.ac.cn [Engineering Laboratory of Specialty Fibers and Nuclear Energy Materials, Ningbo Institute of Materials Technology and Engineering, Chinese Academy of Sciences, Ningbo, Zhejiang, 315201 (China)

    2016-02-15

    U{sub 3}Si{sub 2} has been widely utilized as a high-power uranium fuel for research reactors due to its high density of uranium. However, theoretical investigations on this material are still scarce up to now. For this reason, the computational study via density functional theory (DFT) is performed on the U{sub 3}Si{sub 2} compound in this work. The properties of U{sub 3}Si{sub 2}, such as stable crystalline structures, density of states, charge distributions, formation energy of defects, as well as the mechanical properties are explored. The calculation results show that the U{sub 3}Si{sub 2} material is metallic and brittle, which is in good agreement with the previous experimental observations. The formation energy of uranium vacancy defect is predicted to be the lowest, similar with that of UN. The theoretical investigation of this work is expected to provide new insight of uranium silicide fuels.

  4. Photoassociation spectroscopy of 87Rb2 (5s1/2+5p1/2)0u+ long-range molecular states: Coupling with the (5s1/2+5p3/2)0u+ series analyzed using the Lu-Fano approach

    International Nuclear Information System (INIS)

    Jelassi, H.; Viaris de Lesegno, B.; Pruvost, L.

    2006-01-01

    We report on photoassociation of cold 87 Rb atoms providing the spectroscopy of (5s 1/2 +5p 1/2 )0 u + long-range molecular states, in the energy range of [-12.5, -0.7 cm -1 ] below the dissociation limit. A Lu-Fano approach coupled to the LeRoy-Bernstein formula is used to analyze the data. The Lu-Fano graph exhibits the coupling of the molecular series with the (5s 1/2 +5p 3/2 )0 u + one, which is due to spin effects in the molecule. A two-channel model involving an improved LeRoy-Bernstein formula allows us to characterize the molecular series, to localize (5s 1/2 +5p 3/2 )0 u + levels, to evaluate the coupling, and to predict the energy and width of the first predissociated level of (5s 1/2 +5p 3/2 )0 u + series. An experimental spectrum confirms the prediction

  5. Local U(2,2) Symmetry in Relativistic Quantum Mechanics

    OpenAIRE

    Finster, Felix

    1997-01-01

    Local gauge freedom in relativistic quantum mechanics is derived from a measurement principle for space and time. For the Dirac equation, one obtains local U(2,2) gauge transformations acting on the spinor index of the wave functions. This local U(2,2) symmetry allows a unified description of electrodynamics and general relativity as a classical gauge theory.

  6. Local U(2,2) symmetry in relativistic quantum mechanics

    Science.gov (United States)

    Finster, Felix

    1998-12-01

    Local gauge freedom in relativistic quantum mechanics is derived from a measurement principle for space and time. For the Dirac equation, one obtains local U(2,2) gauge transformations acting on the spinor index of the wave functions. This local U(2,2) symmetry allows a unified description of electrodynamics and general relativity as a classical gauge theory.

  7. Studies on some uranium oxides in the composition range U O3 -U3 O8-z. Vol. 3

    International Nuclear Information System (INIS)

    El-Fekey, S.A.; El-Mamoon Yahia, M.; Abd El-Razek, A.M.

    1996-01-01

    Four different crystallographic modifications of U O 3 designated as α, β, γ and δ, as well as the amorphous (A)-U O 3 have been prepared by calcining washed and unwashed uranium peroxide, washed ammonium uranate, uranyl nitrate crystals, and U O 3 .H 2 O at different temperatures. The U O 3 powders obtained were calcined at 650 degree C for 3 h in nitrogen atmosphere. Methanol, ethanol, benzene, toluene, hexane, pentane, acetone, petroleum ether, and kerosene were used as organic liquids for apparent density measurements and kerosene was found most appropriate. The results indicated that the different densities of α, β and A-U O 3 are inversely proportional to uranium concentration and temperature during precipitation while directly proportional with duration and final pH. The sequence of density of U O 3 powders appeared as follows: β>γ>δ>α>A-U O 3 . The porosity of the U O 3 phases was calculated using the equation P=D T - D p . The sequence of porosity appeared as follows A-U O 3 >α>δ>γ>β. The stoichiometry of the U 3 O 8 phase was determined titrimetrically. The use of O/U sequence appeared as follows: δ>γ>α>A-U O 3 >β indicating that the stoichiometry of the U 3 O 8 phase depends on the porosity of the U O 3 from which it was prepared. 1 figs., 3 tabs

  8. SU(3)_C× SU(2)_L× U(1)_Y( × U(1)_X ) as a symmetry of division algebraic ladder operators

    Science.gov (United States)

    Furey, C.

    2018-05-01

    We demonstrate a model which captures certain attractive features of SU(5) theory, while providing a possible escape from proton decay. In this paper we show how ladder operators arise from the division algebras R, C, H, and O. From the SU( n) symmetry of these ladder operators, we then demonstrate a model which has much structural similarity to Georgi and Glashow's SU(5) grand unified theory. However, in this case, the transitions leading to proton decay are expected to be blocked, given that they coincide with presumably forbidden transformations which would incorrectly mix distinct algebraic actions. As a result, we find that we are left with G_{sm} = SU(3)_C× SU(2)_L× U(1)_Y / Z_6. Finally, we point out that if U( n) ladder symmetries are used in place of SU( n), it may then be possible to find this same G_{sm}=SU(3)_C× SU(2)_L× U(1)_Y / Z_6, together with an extra U(1)_X symmetry, related to B-L.

  9. Compact toroid injection into C-2U

    Science.gov (United States)

    Roche, Thomas; Gota, H.; Garate, E.; Asai, T.; Matsumoto, T.; Sekiguchi, J.; Putvinski, S.; Allfrey, I.; Beall, M.; Cordero, M.; Granstedt, E.; Kinley, J.; Morehouse, M.; Sheftman, D.; Valentine, T.; Waggoner, W.; the TAE Team

    2015-11-01

    Sustainment of an advanced neutral beam-driven FRC for a period in excess of 5 ms is the primary goal of the C-2U machine at Tri Alpha Energy. In addition, a criteria for long-term global sustainment of any magnetically confined fusion reactor is particle refueling. To this end, a magnetized coaxial plasma-gun has been developed. Compact toroids (CT) are to be injected perpendicular to the axial magnetic field of C-2U. To simulate this environment, an experimental test-stand has been constructed. A transverse magnetic field of B ~ 1 kG is established (comparable to the C-2U axial field) and CTs are fired across it. As a minimal requirement, the CT must have energy density greater than that of the magnetic field it is to penetrate, i.e., 1/2 ρv2 >=B2 / 2μ0 . This criteria is easily met and indeed the CTs traverse the test-stand field. A preliminary experiment on C-2U shows the CT also capable of penetrating into FRC plasmas and refueling is observed resulting in a 20 - 30% increase in total particle number per single-pulsed CT injection. Results from test-stand and C-2U experiments will be presented.

  10. Determination of interstitial oxygen atom position in U2N3+xOy by near edge structure study

    Science.gov (United States)

    Jiang, A. K.; Zhao, Y. W.; Long, Z.; Hu, Y.; Wang, X. F.; Yang, R. L.; Bao, H. L.; Zeng, R. G.; Liu, K. Z.

    2018-06-01

    The determination of interstitial oxygen atom site in U2N3+xOy film could facilitate the understanding of the oxidation mechanism of α-U2N3 and the effect of U2N3+xOy on anti-oxidation. By comparing the similarities and variances between N K edge and O K edge electron energy loss spectra (EELS) for oxidized α-U2N3 and UO2, the present work looks at the local structure of nitrogen and oxygen atoms in U2N3+xOy film, identifying the most possible position of interstitial O atom.

  11. Master formula approach to broken chiral U(3)xU(3) symmetry

    Energy Technology Data Exchange (ETDEWEB)

    Hiroyuki Kamano

    2010-04-01

    The master formula approach to chiral symmetry breaking proposed by Yamagishi and Zahed is extended to the U_R(3)xU_L(3) group, in which effects of the U_A(1) anomaly and the flavor symmetry breaking m_u \

  12. DFT+U study of polaronic conduction in Li2O2 and Li2CO3

    DEFF Research Database (Denmark)

    García Lastra, Juan Maria; Myrdal, J.S.G.; Christensen, Rune

    2013-01-01

    The main discharge products formed at the cathode of nonaqueous Li-air batteries are known to be Li2O2 and residual Li2CO3. Recent experiments indicate that the charge transport through these materials is the main limiting factor for the battery performance. It has been also shown...... that the performance of the battery decreases drastically when the amount of Li2CO3 at the cathode increases with respect to Li2O2. In this work, we study the formation and transport of hole and electron polarons in Li2O2 and Li2CO3 using density functional theory (DFT) within the PBE+U approximation. For both...... materials, we find that the formation of polarons (both hole and electron) is stabilized with respect to the delocalized states for all physically relevant values of U. We find a much higher mobility for hole polarons than for the electron polarons, and we show that the poor charge transport in Li2CO3...

  13. Monte Carlo analysis of the SU(2)xU(1) and U(2) lattice gauge theories at different space-time dimensionalities

    International Nuclear Information System (INIS)

    Baig, M.; Colet, J.

    1986-01-01

    Using Monte Carlo simulations the SU(2)xU(1) lattice gauge theory has been analyzed, which is equivalent for the Wilson action to a U(2) theory, at space-time dimensionalities from d=3 to 5. It has been shown that there exist first-order phase transitions for both d=4 and d=5. A monopole-condensation mechanism seems to be responsible for these phase transitions. At d=3 no phase transitions have been detected. (orig.)

  14. Examinations of the irradiation behaviour of U3Si2 test fuel plates with low enrichment

    International Nuclear Information System (INIS)

    Muellauer, J.

    1989-01-01

    Five low-enriched (19.7% 235 U), high-density (4.7 gU/cm/ 3 ) U 3 Si 2 -test fuel plates (miniplates) with different fine grain contents have been qualified under irradiation. During the course of irradiation up to burnup of 63% 235 U depletion, no released fractions of gaseous or solid fission products from the fuel plate to the rig coolant were detected. The measured swelling rate of the fuel zone (meat) is less than 0.45% ΔV/10 20 fissions/cm 3 the blister-threshold temperature of the fuel plates is above 520 0 C. The favourable irradiation behavior of the U 3 Si 2 fuel plates was not influenced by using higher amounts of fine grained particles (40% [de

  15. Photochemistry of U(BH4)4 and U(BD4)4

    International Nuclear Information System (INIS)

    Paine, R.T.; Schonberg, P.R.; Light, R.W.; Danen, W.C.; Freund, S.M.

    1979-01-01

    U(BH 4 ) 4 and U(BD 4 ) 4 are observed to undergo complex degradation reactions promoted by broadband UV radiation. The primary products of these reactions appear to be U(BH 4 ) 3 , B 2 H 6 , H 2 , U(BD 4 ) 3 , B 2 D 6 and D 2 . Further, U(BD 4 ) 4 undergoes a related decomposition reaction under the influence of CO 2 laser irradiation at 924.97 cm -1 . (author)

  16. 238U, 234U and 232Th in seawater

    International Nuclear Information System (INIS)

    Chen, J.H.; Edwards, R.L.; Wasserburg, G.J.

    1986-01-01

    We have developed techniques to determine 238 U, 234 U and 232 Th concentrations in seawater by isotope dilution mass spectrometry. Using these techniques, we have measured 238 U, 234 U and 232 Th in vertical profiles of unfiltered, acidified seawater from the Atlantic and 238 U and 234 U in vertical profiles from the Pacific. Determinations of 234 U/ 238 U at depths ranging from 0 to 4900 m in the Atlantic (7 0 44'N, 40 0 43'W) and the Pacific (14 0 41'N, 160 0 01'W) Oceans are the same within experimental error (±5per mille, 2σ). The average of these 234 U/ 238 U measurements is 144±2per mille (2σ) higher than the equilibrium ratio of 5.472 x 10 -5 . U concentrations, normalized to 35per mille salinity, range from 3.162 to 3.281 ng/g, a range of 3.8%. The average concentration of the Pacific samples (31 0 4'N, 159 0 1'W) is ∝1% higher than that of the Atlantic (7 0 44'N, 40 0 43'W and 31 0 49'N, 64 0 6'W). 232 Th concentrations from an Atlantic profile range from 0.092 to 0.145 pg/g. The observed constancy of the 234 U/ 238 U ratio is consistent with the predicted range of 234 U/ 238 U using a simple two-box model and the residence time of deep water in the ocean determined from 14 C. The variation in salinity-normalized U concentrations suggests that U may be much more reactive in the marine environment than previously thought. (orig./WB)

  17. Evaluation of covariances for resolved resonance parameters of 235U, 238U, and 239Pu in JENDL-3.2

    International Nuclear Information System (INIS)

    Kawano, Toshihiko; Shibata, Keiichi

    2003-02-01

    Evaluation of covariances for resolved resonance parameters of 235 U, 238 U, and 239 Pu was carried out. Although a large number of resolved resonances are observed for major actinides, uncertainties in averaged cross sections are more important than those in resonance parameters in reactor calculations. We developed a simple method which derives a covariance matrix for the resolved resonance parameters from uncertainties in the averaged cross sections. The method was adopted to evaluate the covariance data for some important actinides, and the results were compiled in the JENDL-3.2 covariance file. (author)

  18. Atomization of U3Si2 for research reactor fuel

    International Nuclear Information System (INIS)

    Kim, C.K.; Kim, K.H.; Lee, C.T.; Kuk, I.H.

    1995-01-01

    Rotating disk atomization technique is applied to KMRR (Korea Multi-purpose Research Reactor) fuel fabrication. A rotating disk atomizer is designed and manufactured locally and U-4.0 wt. % Si alloy powders are produced. The atomized powders are heat-treated to transform into U 3 Si and the mixture of U 3 Si and Al are extruded to fuel meat. Most of the atomized powders are spherical in shape. The microstructure of the powder is fine due to the rapid solidification. The time required for peritectoid reaction is reduced due to the fine microstructures and the resultant U 3 Si grain size is finer than ever obtained from ingot process. The mechanical properties of the fuel meat are improved: yield strength about 30 %, tensile strength 10% and elongation 250 % increased. (author)

  19. U-isotopes and "2"2"6Ra as tracers of hydrogeochemical processes in carbonated karst aquifers from arid areas

    International Nuclear Information System (INIS)

    Guerrero, José Luis; Vallejos, Ángela; Cerón, Juan Carlos; Sánchez-Martos, Francisco; Pulido-Bosch, Antonio; Bolívar, Juan Pedro

    2016-01-01

    Sierra de Gádor is a karst macrosystem with a highly complex geometry, located in southeastern Spain. In this arid environment, the main economic activities, agriculture and tourism, are supported by water resources from the Sierra de Gádor aquifer system. The aim of this work was to study the levels and behaviour of some of the most significant natural radionuclides in order to improve the knowledge of the hydrogeochemical processes involved in this groundwater system. For this study, 28 groundwater and 7 surface water samples were collected, and the activity concentrations of the natural U-isotopes ("2"3"8U, "2"3"5U and "2"3"4U) and "2"2"6Ra by alpha spectrometry were determined. The activity concentration of "2"3"8U presented a large variation from around 1.1 to 65 mBq L"−"1. Elevated groundwater U concentrations were the result of oxidising conditions that likely promoted U dissolution. The PHREEQC modelling code showed that dissolved U mainly existed as uranyl carbonate complexes. The "2"3"4U/"2"3"8U activity ratios were higher than unity for all samples (1.1–3.8). Additionally, these ratios were in greater disequilibrium in groundwater than surface water samples, the likely result of greater water-rock contact time. "2"2"6Ra presented a wide range of activity concentrations, (0.8 up to about 4 × 10"2 mBq L"−"1); greatest concentrations were detected in the thermal area of Alhama. Most of the samples showed "2"2"6Ra/"2"3"4U activity ratios lower than unity (median = 0.3), likely the result of the greater mobility of U than Ra in the aquifer system. The natural U-isotopes concentrations were strongly correlated with dissolution of sulphate evaporites (mainly gypsum). "2"2"6Ra had a more complex behaviour, showing a strong correlation with water salinity, which was particularly evident in locations where thermal anomalies were detected. The most saline samples showed the lowest "2"3"4U/"2"3"8U activity ratios, probably due to fast uniform bulk

  20. Influence of Fuel Meat Porosity on Heat Capacities of Fuel Element Plate U3Si2-Al

    International Nuclear Information System (INIS)

    Ginting, Aslina Br.; Supardjo; Sutri Indaryati

    2007-01-01

    Analyze of heat capacities of Al powder, AIMg 2 cladding, U 3 Si 2 powder and PEB U 3 Si 2 -Al with the meat porosity of 4.9; 5.53 ; 6.25 ; 6.95 %; 7.90; 8.66% have been done. Analysis was conducted by using Differential Scanning Calorimeter (DSC) at temperature 30℃ to 450℃ with heating rate 1℃ /minute in Argon gas media. The purpose of analyze is to know the influence of increasing of fuel meat porosity on heat capacities because increasing of percentage of meat porosity will cause degradation the of heat capacities of PEB U 3 Si 2 -Al. Result of analysis showed that the heat capacities of Al powder, AIMg 2 cladding increase by temperature, while heat capacities of U 3 Si 2 powder was stable with increasing of temperature up to 450℃. Analysis of heat capacities toward PEB U 3 Si 2 -Al indicate that increasing of fuel meat porosity of caused degradation of the heat capacities of PEB U 3 Si 2 -Al. Data obtained were expected to serve the purpose of input to fabricator of research reactor fuel in for design of fuel element type silicide with high loading. (author)

  1. Physico-chemical properties of (U,Ce)O2

    International Nuclear Information System (INIS)

    Yamada, K.; Yamanaka, S.; Katsura, M.

    1998-01-01

    The high-temperature X-ray diffraction analysis of (U,Ce)O 2 with CeO 2 contents ranging from 0 to 20 mol.% CeO 2 was performed to obtain the variation of the linear thermal expansion coefficient with the CeO 2 content. Ultrasonic pulse-echo measurements were also carried out from room temperature to 673 K to estimate the change in the mechanical properties of (U,Ce)O 2 with the CeO 2 content. The variation in the linear thermal expansion coefficient at the low CeO 2 content region is more steep than that expected from the linear thermal expansion coefficient of UO 2 and CeO 2 . The Young's and shear moduli of all (U,Ce)O 2 were found to decrease with rising temperature. This was due to the increase of the bond length accompanied by the thermal expansion. Although the lattice parameter decreased with CeO 2 content, the moduli of (U,Ce)O 2 were found to decrease with increasing CeO 2 content at room temperature. These results show that in the range from 0 to 20 mol.% of CeO 2 , as CeO 2 content increases, the bottom of the potential energy in (U,Ce)O 2 is shallower and broader. (orig.)

  2. Ceramic grade (U,Pu)O2 powder fabrication

    International Nuclear Information System (INIS)

    Cristallini, O.A.; Villegas de Maroto, Marina; De Pino, J.I.; Osuna, H.A.

    1980-01-01

    Ceramic grade UO 2 powder was obtained by the homogeneous precipitation method. This procedure was afterwards applied to the fabrication of ceramic grade (U,Pu)O 2 powders, and mixed oxide powders with Pu content ranging from 0.7 to 16% were obtained. The obtainment of mixed ceramic oxides as well as the recuperation of fabrication scraps were developed in three steps: 1)study of the process of homogeneous precipitation of ammonium diuranate (ADU); 2) co-precipitation of ADU/PuO 2 .H 2 O for Pu concentrations of 0.6 and 6.8; 3) the thermal conditioning to mixed oxide (U,Pu)O 2 powders. The experimental procedure involves the following steps: preparation of the PuO 2 (NO 3 ) 4 solution; co-precipitation of the PuO 2 (NO 3 ) 2 solution with an UO 2 (NO 3 ) 2 solution; filtration and drying of the precipitate, thermal treatment and finally, mixing, pressing and sintering of the (U,Pu)O 2 and Nukem UO 2 powder with a 0. of zinc stearate. Different controls were made by means of physical, chemical and ceramographic tests. This method can be used for the fabrication of fast reactor fuels or, previous mechanical dispersion in UO 2 powder, for the fabrication of thermal reactors fuels. (M.E.L.) [es

  3. Reduction of U3O8 to U by a metallic reductant, Li

    International Nuclear Information System (INIS)

    Jin-Mok Hur; Sun-Seok Hong; Hansoo Lee

    2010-01-01

    Reduction of U 3 O 8 was investigated for the recycling of spent oxide fuel from a commercial nuclear power plant. The possible reduction methods were proposed and compared. Based on the thermodynamic analysis, Li metal was selected as a reductant. The optimum reaction temperature for the reduction of U 3 O 8 was investigated at the wider reaction temperature range. The adverse oxidation of U metal by Li 2 O at 1,000 deg C was experimentally verified. Ellingham diagram was constructed to investigate the extent of the uranium oxides reduction when the reaction was carried out above melting point of U metal. (author)

  4. Spark plasma sintering and microstructural analysis of pure and Mo doped U3Si2 pellets

    Science.gov (United States)

    Lopes, Denise Adorno; Benarosch, Anna; Middleburgh, Simon; Johnson, Kyle D.

    2017-12-01

    U3Si2 has been considered as an alternative fuel for Light Water Reactors (LWRs) within the Accident Tolerant Fuels (ATF) initiative, begun after the Fukushima-Daiichi Nuclear accidents. Its main advantages are high thermal conductivity and high heavy metal density. Despite these benefits, U3Si2 presents an anisotropic crystallographic structure and low solubility of fission products, which can result in undesirable effects under irradiation conditions. In this paper, spark plasma sintering (SPS) of U3Si2 pellets is studied, with evaluation of the resulting microstructure. Additionally, exploiting the short sintering time in SPS, a molybdenum doped pellet was produced to investigate the early stages of the Mo-U3Si2 interaction, and analyze how this fission product is accommodated in the fuel matrix. The results show that pellets of U3Si2 with high density (>95% TD) can be obtained with SPS in the temperature range of 1200°C-1300 °C. Moreover, the short time employed in this technique was found to generate a unique microstructure for this fuel, composed mainly of closed nano-pores (uranium with small quantities of dissolved Si and Mo at the front of the reaction.

  5. Post-irradiation examination of prototype Al-64 wt% U3Si2 fuel rods from NRU

    International Nuclear Information System (INIS)

    Sears, D.F.; Primeau, M.F.; Buchanan, C.; Rose, D.

    1997-01-01

    Three prototype fuel rods containing Al-64 wt% U 3 Si 2 (3.15 gU/cm 3 ) have been irradiated to their design burnup in the NRU reactor without incident. The fuel was fabricated using production-scale equipment and processes previously developed for Al-U 3 Si fuel fabrication at Chalk River Laboratories, and special equipment developed for U 3 Si 2 powder production and handling. The rods were irradiated in NRU up to 87 at% U-235 burnup under typical driver fuel conditions; i.e., nominal coolant inlet temperature 37 degrees C, inlet pressure 654 kPa, mass flow 12.4 L/s, and element linear power ratings up to 73 kW/m. Post-irradiation examinations showed that the fuel elements survived the irradiation without defects. Fuel core diametral increases and volumetric swelling were significantly lower than that of Al-61 wt% U 3 Si fuel irradiated under similar conditions. This irradiation demonstrated that the fabrication techniques are adequate for full-scale fuel manufacture, and qualified the fuel for use in AECL's research reactors

  6. Hidden U$_{q}$(sl(2)) x U$_{q}$(sl(2)) quantum group symmetry in two dimensional gravity

    CERN Document Server

    Cremmer, E; Schnittger, J

    1997-01-01

    In a previous paper, we proposed a construction of U_q(sl(2)) quantum group symmetry generators for 2d gravity, where we took the chiral vertex operators of the theory to be the quantum group covariant ones established in earlier works. The basic idea was that the covariant fields in the spin 1/2 representation themselves can be viewed as generators, as they act, by braiding, on the other fields exactly in the required way. Here we transform this construction to the more conventional description of 2d gravity in terms of Bloch wave/Coulomb gas vertex operators, thereby establishing for the first time its quantum group symmetry properties. A U_q(sl(2))\\otimes U_q(sl(2)) symmetry of a novel type emerges: The two Cartan-generator eigenvalues are specified by the choice of matrix element (bra/ket Verma-modules); the two Casimir eigenvalues are equal and specified by the Virasoro weight of the vertex operator considered; the co-product is defined with a matching condition dictated by the Hilbert space structure of...

  7. 7 CFR 51.2732 - U.S. No. 2 Spanish.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 2 Spanish. 51.2732 Section 51.2732... STANDARDS) United States Standards for Grades of Shelled Spanish Type Peanuts Grades § 51.2732 U.S. No. 2 Spanish. “U.S. No. 2 Spanish” consists of shelled Spanish type peanut kernels which may be split or broken...

  8. Yeast endoribonuclease stimulated by Novikoff Hepatoma small nuclear RNAS U1 and U2

    International Nuclear Information System (INIS)

    Stevens, A.

    1982-01-01

    Using [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) from yeast as a substrate, an endoribonuclease has been detected in enzyme fractions derived from a high salt wash of ribonucleoprotein particles of Saccharomyces cerevisiae. The [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) seems to be a preferred substrate since other polyribonucleotides are hydrolyzed more slowly, if at all. The enzyme is inhibited by ethidium bromide, but fully double-stranded polyribonucleotides are not hydrolyzed. The hydrolysis of [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) is stimulated about 2.5-fold by the addition of small nuclear RNAs U1 and U2 of Novikoff hepatoma cells. Results show that the stimulation involves an interaction of the labeled RNA with the small nuclear RNA

  9. Preparations of high density (Th,U)O2 pellets

    International Nuclear Information System (INIS)

    Akabori, Mitsuo; Ikawa, Katsuichi

    1986-07-01

    Preparations of high density and homogeneous (Th,U)O 2 pellets by a powder metallurgy method were examined. (Th,U)O 2 powders were prepared by calcining coprecipitates of ammonium uranate and thorium hydroxide derived from nitrates and mixed sols, and by calcining mixed oxalates precipitated from nitrates. (Th,U)O 2 pellets were characterized with respect to sinterability, lattice parameter, microstructure, homogeneity and stoichiometry. Sintering atmospheres had a significant effect upon all the properties of the derived pellets. The sinterability of (Th,U)O 2 was most favourable in oxidizing and reducing atmospheres for ThO 2 -rich and UO 2 -rich compositions, respectively, and can be enhanced by presence of water vapour in sintering atmospheres. In addition, highly homogeneous (Th,U)O 2 pellets with 99 % in theoretical density were derived from the sol powders. (author)

  10. Cyberinfrastructure for the collaborative development of U2U decision support tools

    Directory of Open Access Journals (Sweden)

    Larry L. Biehl

    2017-01-01

    Full Text Available This paper describes the use of cyberinfrastructure to create interactive applications as part of the Useful to Usable (U2U project. These applications transform historical climate data, knowledge, and models into decision support tools for end users such as crop farmers, university Extension educators, and other agricultural advisors. In creating a cyberinfrastructure to support the U2U project, four major challenges have been addressed: designing and developing highly usable web applications with frequent feedback, establishing a software engineering environment to support iterative development, integrating and synthesizing historical and current datasets from a variety of sources (local vs. remote, different access methods, and formats, and supporting project collaboration needs of data and document sharing, project management, and public outreach. The overall goals of the cyberinfrastructure and its architecture design are described. Methods for data retrieval and synthesis, as well as the various software components utilized are discussed. The development and integration of tools into the collaborative HUBzero framework are highlighted, including the use of HUBzero’s core features to share ideas, algorithms, and results. A highly iterative development process that includes feedback from experts and end-users to feed requirement definition, design and application updates are also examined.

  11. Thermal compatibility of U-2wt.%Mo and U-10wt.%Mo fuel prepared by centrifugal atomization for high density research reactor fuels

    International Nuclear Information System (INIS)

    Kim Ki Hwan; Lee Don Bae; Kim Chang Kyu; Kuk Il Hyun; Hofman, G.E.

    1997-01-01

    Research on the intermetallic compounds of uranium was revived in 1978 with the decision by the international research reactor community to develop proliferation-resistant fuels. The reduction of 93% 235 U (HEU) to 20% 235 U (LEU) necessitates the use of higher U-loading fuels to accommodate the addition 238 U in the LEU fuels. While the vast majority of reactors can be satisfied with U 3 Si 2 -Al dispersion fuel, several high performance reactors require high loadings of up to 8-9 g U cm -3 . Consequently, in the renewed fuel development program of the Reduced Enrichment for Research and Test Reactors (RERTR) Program, attention has shifted to high density uranium alloys. Early irradiation experiments with uranium alloys showed promise of acceptable irradiation behavior, if these alloys can be maintained in their cubic γ-U crystal structure. It has been reported that high density atomized U-Mo powders prepared by rapid cooling have metastable isotropic γ-U phase saturated with molybdenum, and good γ-U phase stability, especially in U-10wt.%Mo alloy fuel. If the alloy has good thermal compatibility with aluminium, and this metastable gamma phase can be maintained during irradiation, U-Mo alloy would be a prime candidate for dispersion fuel for research reactors. In this paper, U-2w.%Mo and U-10w.%Mo alloy powder which have high density (above 15 g-U/cm 3 ), are prepared by centrifugal atomization. The U-Mo alloy fuel meats are made into rods extruding the atomized powders. The characteristics related to the thermal compatibility of U-2w.%Mo and U-10w.%Mo alloy fuel meat at 400 o C for time up to 2000 hours are examined. (author)

  12. A Realistic $U(2)$ Model of Flavor arXiv

    CERN Document Server

    Linster, Matthias

    We propose a simple $U(2)$ model of flavor compatible with an $SU(5)$ GUT structure. All hierarchies in fermion masses and mixings arise from powers of two small parameters that control the $U(2)$ breaking. In contrast to previous $U(2)$ models this setup can be realized without supersymmetry and provides an excellent fit to all SM flavor observables including neutrinos. We also consider a variant of this model based on a $D_6 \\times U(1)_F$ flavor symmetry, which closely resembles the $U(2)$ structure, but allows for Majorana neutrino masses from the Weinberg operator. Remarkably, in this case one naturally obtains large mixing in the lepton sector from small mixing in the quark sector. The model also offers a natural option for addressing the Strong CP Problem and Dark Matter by identifying the Goldstone boson of the $U(1)_F$ factor as the QCD axion.

  13. Useful to Usable (U2U): Transforming climate information into usable tools to support Midwestern agricultural production

    Science.gov (United States)

    Prokopy, L. S.; Widhalm, M.

    2014-12-01

    There is a close connection between weather and climate patterns and successful agricultural production. Therefore, incorporating climate information into farm management is likely to reduce the risk of economic losses and increase profitability. While weather and climate information is becoming ever more abundant and accessible, the use of such information in the agricultural community remains limited. Useful to Usable (U2U): Transforming Climate Variability and Change Information for Cereal Crop Producers is a USDA-NIFA funded research and extension project focused on improving the use of climate information for agricultural production in the Midwestern United States by developing user-driven decision tools and training resources. The U2U team is a diverse and uniquely qualified group of climatologists, crop modelers, agronomists, and social scientists from 9 Midwestern universities and two NOAA Regional Climate Centers. Together, we strive to help producers make better long-term plans on what, when and where to plant and also how to manage crops for maximum yields and minimum environmental damage. To ensure relevance and usability of U2U products, our social science team is using a number of techniques including surveys and focus groups to integrate stakeholder interests, needs, and concerns into all aspects of U2U research. It is through this coupling of physical and social science disciplines that we strive to transform existing climate information into actionable knowledge.

  14. Drosophila SMN complex proteins Gemin2, Gemin3, and Gemin5 are components of U bodies

    International Nuclear Information System (INIS)

    Cauchi, Ruben J.; Sanchez-Pulido, Luis; Liu, Ji-Long

    2010-01-01

    Uridine-rich small nuclear ribonucleoproteins (U snRNPs) play key roles in pre-mRNA processing in the nucleus. The assembly of most U snRNPs takes place in the cytoplasm and is facilitated by the survival motor neuron (SMN) complex. Discrete cytoplasmic RNA granules called U bodies have been proposed to be specific sites for snRNP assembly because they contain U snRNPs and SMN. U bodies invariably associate with P bodies, which are involved in mRNA decay and translational control. However, it remains unknown whether other SMN complex proteins also localise to U bodies. In Drosophila there are four SMN complex proteins, namely SMN, Gemin2/CG10419, Gemin3 and Gemin5/Rigor mortis. Drosophila Gemin3 was originally identified as the Drosophila orthologue of human and yeast Dhh1, a component of P bodies. Through an in silico analysis of the DEAD-box RNA helicases we confirmed that Gemin3 is the bona fide Drosophila orthologue of vertebrate Gemin3 whereas the Drosophila orthologue of Dhh1 is Me31B. We then made use of the Drosophila egg chamber as a model system to study the subcellular distribution of the Gemin proteins as well as Me31B. Our cytological investigations show that Gemin2, Gemin3 and Gemin5 colocalise with SMN in U bodies. Although they are excluded from P bodies, as components of U bodies, Gemin2, Gemin3 and Gemin5 are consistently found associated with P bodies, wherein Me31B resides. In addition to a role in snRNP biogenesis, SMN complexes residing in U bodies may also be involved in mRNP assembly and/or transport.

  15. Drosophila SMN complex proteins Gemin2, Gemin3, and Gemin5 are components of U bodies

    Energy Technology Data Exchange (ETDEWEB)

    Cauchi, Ruben J.; Sanchez-Pulido, Luis [MRC Functional Genomics Unit, Department of Physiology, Anatomy and Genetics, University of Oxford, Oxford OX1 3QX (United Kingdom); Liu, Ji-Long, E-mail: jilong.liu@dpag.ox.ac.uk [MRC Functional Genomics Unit, Department of Physiology, Anatomy and Genetics, University of Oxford, Oxford OX1 3QX (United Kingdom)

    2010-08-15

    Uridine-rich small nuclear ribonucleoproteins (U snRNPs) play key roles in pre-mRNA processing in the nucleus. The assembly of most U snRNPs takes place in the cytoplasm and is facilitated by the survival motor neuron (SMN) complex. Discrete cytoplasmic RNA granules called U bodies have been proposed to be specific sites for snRNP assembly because they contain U snRNPs and SMN. U bodies invariably associate with P bodies, which are involved in mRNA decay and translational control. However, it remains unknown whether other SMN complex proteins also localise to U bodies. In Drosophila there are four SMN complex proteins, namely SMN, Gemin2/CG10419, Gemin3 and Gemin5/Rigor mortis. Drosophila Gemin3 was originally identified as the Drosophila orthologue of human and yeast Dhh1, a component of P bodies. Through an in silico analysis of the DEAD-box RNA helicases we confirmed that Gemin3 is the bona fide Drosophila orthologue of vertebrate Gemin3 whereas the Drosophila orthologue of Dhh1 is Me31B. We then made use of the Drosophila egg chamber as a model system to study the subcellular distribution of the Gemin proteins as well as Me31B. Our cytological investigations show that Gemin2, Gemin3 and Gemin5 colocalise with SMN in U bodies. Although they are excluded from P bodies, as components of U bodies, Gemin2, Gemin3 and Gemin5 are consistently found associated with P bodies, wherein Me31B resides. In addition to a role in snRNP biogenesis, SMN complexes residing in U bodies may also be involved in mRNP assembly and/or transport.

  16. Comparison of U(VI) adsorption onto nanoscale zero-valent iron and red soil in the presence of U(VI)–CO_3/Ca–U(VI)–CO_3 complexes

    International Nuclear Information System (INIS)

    Zhang, Zhibin; Liu, Jun; Cao, Xiaohong; Luo, Xuanping; Hua, Rong; Liu, Yan; Yu, Xiaofeng; He, Likai

    2015-01-01

    Highlights: • NZVI can be used for adsorbing U(VI)–CO_3 complexes. • Use of NZVI is feasible for remediation of uranium-contaminated soils. • The mechanism of U(VI)–CO_3 complexes adsorbing onto NZVI has been explained. - Abstract: The influence of U(VI)–CO_3 and Ca–U(VI)–CO_3 complexes on U(VI) adsorption onto red soil and nanoscale zero-valent iron (NZVI) was investigated using batch adsorption and fixed-bed column experiments to simulate the feasibility of NZVI as the reactive medium in permeable- reactive barriers (PRB) for in situ remediation of uranium-contaminated red soils. The adsorption capacity (q_e) and distribution constant (K_d) of NZVI and red soil decreased with increasing pH, dissolved carbonate and calcium concentrations, but the q_e and K_d values of NZVI were 5–10 times higher than those of red soil. The breakthrough pore volume (PV) values increased with the decrease of pH, dissolved carbonate and calcium concentration; however, the breakthrough PV values of the PRB column filled with 5% NZVI were 2.0–3.5 times higher than the 100% red soil column. The U(VI)–CO_3 complexes adsorbed onto the surface of red soil/NZVI (≡SOH) to form SO–UO_2CO_3"− or SO–UO_2 (CO_3)_2"3"−. XPS and XRD analysis further confirmed the reduction of U(VI) to U(IV) and the formation of FeOOH on NZVI surfaces. The findings of this study are significant to the remediation of uranium-contaminated red soils and the consideration of practical U(VI) species in the natural environment.

  17. Kondo Effect of U Impurities in Dilute (YU)2Zn17

    Science.gov (United States)

    Takagi, Shigeru; Suzuki, Hiroyuki; Anzai, Kousuke

    2001-10-01

    Extending previous work on single-site properties of U ions in (LaU)2Zn17, we have investigated, from ρ(T), χ(T) and Cp(T) on single crystals, (Y1-xUx)2Zn17 with x=0.025 and 0.050, which has almost the same unit-cell volume as an antiferromagnetic heavy-electron compound U2Zn17. Remarkable features in the dilute-impurity limit have been clarified, which include Kondo behavior of ρ(T), large and almost isotropic χimp(T), and strongly enhanced Cimp(T)/T with gigantic γimp=2.02 2.05 J/K2·mole-U as T→0 due to a low characteristic energy-scale of the system. It is shown that gross features of the data are explained in terms of the conventional Kondo effect in the presence of the crystal field with the U3+ \\varGamma6 doublet ground state. It is also shown that the variation of γ with the unit-cell volume in related systems is not explained as a volume effect on TK and that even the behavior of fictitious “paramagnetic” U2Zn17 is not described as a collection of U impurities in dilute (YU)2Zn17.

  18. Study of new U(VI) and Pu(VI) coprecipitation methods for the preparation of (U,Pu)O2

    International Nuclear Information System (INIS)

    Sanoit, J. de.

    1990-01-01

    Two U(VI) and Pu(VI) coprecipitation methods have been studied, for the definition of new processes to prepare (U,Pu)O 2 mixed oxides suitable for making MoX fuels or fast breeder reactor fuels. The first system is based on the coprecipitation of a new U(VI), Pu(VI) compound; ammonium uranoplutonate, where as a second system is related to the precipitation of uranyl plutonyl monocarbonate. Experimental conditions to optimize the precipitation and the filtration steps of these two systems have been determined. After calcination under reducing conditions, the mixed oxides obtained are characterized according to different techniques: granulometry, thermogravimetry, solubility in boiling HNO 3 solutions. The properties of such oxides are excellent. The possible processes for preparing (U, Pu)O 2 using these new routes are compared with those actually exploited [fr

  19. RLIM interacts with Smurf2 and promotes TGF-β induced U2OS cell migration

    International Nuclear Information System (INIS)

    Huang, Yongsheng; Yang, Yang; Gao, Rui; Yang, Xianmei; Yan, Xiaohua; Wang, Chenji; Jiang, Sirui; Yu, Long

    2011-01-01

    Highlights: → RLIM directly binds to Smurf2. → RLIM enhances TGF-β responsiveness in U2OS cells. → RLIM promotes TGF-β driven migration of osteosarcoma U2OS cells. -- Abstract: TGF-β (transforming growth factor-β), a pleiotropic cytokine that regulates diverse cellular processes, has been suggested to play critical roles in cell proliferation, migration, and carcinogenesis. Here we found a novel E3 ubiquitin ligase RLIM which can directly bind to Smurf2, enhancing TGF-β responsiveness in osteosarcoma U2OS cells. We constructed a U2OS cell line stably over-expressing RLIM and demonstrated that RLIM promoted TGF-β-driven migration of U2OS cells as tested by wound healing assay. Our results indicated that RLIM is an important positive regulator in TGF-β signaling pathway and cell migration.

  20. U2AF1 mutations alter splice site recognition in hematological malignancies.

    Science.gov (United States)

    Ilagan, Janine O; Ramakrishnan, Aravind; Hayes, Brian; Murphy, Michele E; Zebari, Ahmad S; Bradley, Philip; Bradley, Robert K

    2015-01-01

    Whole-exome sequencing studies have identified common mutations affecting genes encoding components of the RNA splicing machinery in hematological malignancies. Here, we sought to determine how mutations affecting the 3' splice site recognition factor U2AF1 alter its normal role in RNA splicing. We find that U2AF1 mutations influence the similarity of splicing programs in leukemias, but do not give rise to widespread splicing failure. U2AF1 mutations cause differential splicing of hundreds of genes, affecting biological pathways such as DNA methylation (DNMT3B), X chromosome inactivation (H2AFY), the DNA damage response (ATR, FANCA), and apoptosis (CASP8). We show that U2AF1 mutations alter the preferred 3' splice site motif in patients, in cell culture, and in vitro. Mutations affecting the first and second zinc fingers give rise to different alterations in splice site preference and largely distinct downstream splicing programs. These allele-specific effects are consistent with a computationally predicted model of U2AF1 in complex with RNA. Our findings suggest that U2AF1 mutations contribute to pathogenesis by causing quantitative changes in splicing that affect diverse cellular pathways, and give insight into the normal function of U2AF1's zinc finger domains. © 2015 Ilagan et al.; Published by Cold Spring Harbor Laboratory Press.

  1. Global S U (3 )C×S U (2 )L×U (1 )Y linear sigma model: Axial-vector Ward-Takahashi identities and decoupling of certain heavy BSM particles due to the Goldstone theorem

    Science.gov (United States)

    Lynn, Bryan W.; Starkman, Glenn D.

    2017-09-01

    In the S U (2 )L×S U (2 )R linear sigma model with partially conserved axial-vector currents, a tower of Ward-Takahashi identities (WTI) have long been known to give relations among 1-scalar-particle-irreducible (1 -ϕ -I ) Green's functions, and among I-scalar-particle-reducible (1 -ϕ -R ) transition-matrix (T-matrix) elements for external scalars [i.e. the Brout-Englert-Higgs (BEH) scalar H , and three pseudoscalars π →]. In this paper, we extend these WTI and the resulting relations to the S U (3 )C×S U (2 )L×U (1 )Y linear sigma model including the heaviest generation of Standard Model (SM) fermions—the ungauged (i.e. global) Standard Model SMtb τ ντ G —supplemented with the minimum necessary neutrino content—right-handed neutrinos and Yukawa-coupling-induced Dirac neutrino mass—to obtain the charge-parity (C P )-conserving νDSMtb τ ντ G , and extract powerful constraints on the effective Lagrangian: e.g. showing that they make separate tadpole renormalization unnecessary, and guarantee infrared finiteness. The crucial observation is that ultraviolet quadratic divergences (UVQD), and all other relevant operators, contribute only to mπ2, a pseudo-Nambu-Goldstone boson (NGB) mass-squared, which appears in intermediate steps of calculations. A WTI between T-matrix elements (or, in this global theory equivalently the Goldstone theorem) then enforces mπ2=0 exactly for the true NGB in the spontaneous symmetry breaking (SSB) mode of the theory. The Goldstone theorem thus causes all relevant operator contributions, originating to all-loop-orders from virtual scalars H ,π → , quarks qLc;tRc;bRc and leptons lL;ντR;τR with (c =r , w , b ), to vanish identically. We show that our regularization-scheme-independent, WTI-driven results are unchanged by the addition of certain S U (3 )C×S U (2 )L×U (1 )Y heavy (MHeavy2≫|q2|,mWeak2 ) C P -conserving matter, such as originate in certain beyond the SM (BSM) models. The global axial-vector WTI

  2. Microstructure studies of interdiffusion behavior of U{sub 3}Si{sub 2}/Zircaloy-4 at 800 and 1000 °C

    Energy Technology Data Exchange (ETDEWEB)

    He, Lingfeng, E-mail: Lingfeng.He@inl.gov; Harp, Jason M., E-mail: Jason.Harp@inl.gov; Hoggan, Rita E.; Wagner, Adrian R.

    2017-04-01

    Fuel swelling during normal reactor operations could lead to unfavorable chemical interactions when in contact with its cladding. As new fuel types are developed, it is crucial to understand the interaction behavior between fuel and its cladding. Diffusion experiments between U{sub 3}Si{sub 2} and Zricaloy-4 (Zry-4) were conducted at 800 and 1000 °C up to 100 h. The microstructure of pristine U{sub 3}Si{sub 2} and U{sub 3}Si{sub 2}/Zry-4 interdiffusion products were examined using scanning electron microscopy (SEM) and transmission electron microscopy (TEM) equipped with an energy dispersive X-ray spectroscopy (EDS) system. The primary interdiffusion product observed at 800 °C is ZrSi{sub 2}, with secondary phases of U-Zr in the Zry-4, and Fe-Cr-W-Zr-Si phases at Zry-4/ZrSi{sub 2} interface and Fe-Cr-U-Si phases at ZrSi{sub 2}/U-Si interface. The primary interdiffusion products at 1000 °C were Zr{sub 2}Si, U-Zr-Fe-Ni, U, U-Zr, and a low melting point phase U{sub 6}Fe.

  3. Neutronic Analysis of the RSG-GAS Compact Core without CIP Silicide 3.55 g U/cc and 4.8 g U/cc

    International Nuclear Information System (INIS)

    Jati S; Lily S; Tukiran S

    2004-01-01

    Fuel conversion from U 3 O 8 -Al to U 3 Si 2 -Al 2.96 g U/cc density in the RSG-GAS core had done successfully step by step since 36 th core until 44 th core. So that, since the 45 th core until now (48 th core) had been using full of silicide 2.96 g U/cc. Even though utilization program of silicide fuel with high density (3.55 g U/cc and 4.8 g U/cc) and optimize operation of RSG-GAS core under research. Optimalitation of core with increasing operation cycle have been analyzing about compact core. The mean of compact core is the RSG-GAS core with decrease number of IP or CIP position irradiation. In this research, the neutronic calculation to cover RSG-GAS core and RSG-GAS core without CIP that are using U 3 Si 2 -Al 2.96 g U/cc, 3.55 g U/cc and 4.8 g U/cc had done. Two core calculation done at 15 MW power using SRAC-ASMBURN code. The calculation result show that fuel conversion from 2.96 g U/cc density to 3.55 g U/cc and 4.8 g U/cc will increasing cycle length for both RSG-GAS core and RSG-GAS compact core without CIP. However, increasing of excess reactivity exceeded from nominal value of first design that 9.2%. Change of power peaking factor is not show significant value and still less than 1.4. Core fuelled with U 3 Si 2 -Al 4.8 g U/cc density have maximum discharge burn-up which exceeded from licensing value (70%). RSG-GAS compact core without CIP fuelled U 3 Si 2 -Al 2.96 g U/cc have longer cycle operation then RSG-GAS core and fulfil limitation neutronic parameter at the first design value. (author)

  4. Short Communication on "In-situ TEM ion irradiation investigations on U3Si2 at LWR temperatures"

    Science.gov (United States)

    Miao, Yinbin; Harp, Jason; Mo, Kun; Bhattacharya, Sumit; Baldo, Peter; Yacout, Abdellatif M.

    2017-02-01

    The radiation-induced amorphization of U3Si2 was investigated by in-situ transmission electron microscopy using 1 MeV Kr ion irradiation. Both arc-melted and sintered U3Si2 specimens were irradiated at room temperature to confirm the similarity in their responses to radiation. The sintered specimens were then irradiated at 350 °C and 550 °C up to 7.2 × 1015 ions/cm2 to examine their amorphization behavior under light water reactor (LWR) conditions. U3Si2 remains crystalline under irradiation at LWR temperatures. Oxidation of the material was observed at high irradiation doses.

  5. Estimation of covariances of 16O, 23Na, Fe, 235U, 238U and 239Pu neutron nuclear data in JENDL-3.2

    International Nuclear Information System (INIS)

    Shibata, Keiichi; Nakajima, Yutaka; Kawano, Toshihiko; Oh, Soo-Youl; Matsunobu, Hiroyuki; Murata, Toru.

    1997-10-01

    Covariances of nuclear data have been estimated for 6 nuclides contained in JENDL-3.2. The nuclides considered are 16 O, 23 Na, Fe, 235 U, 238 U, and 239 Pu, which are regarded as important for the nuclear design study of fast reactors. The physical quantities for which covariances are deduced are cross sections, resolved and unresolved resonance parameters, and the first order Legendre-polynomial coefficient for the angular distribution of elastically scattered neutrons. As for 235 U, covariances were obtained also for the average number of neutrons emitted in fission. The covariances were estimated by using the same methodology that had been used in the JENDL-3.2 evaluation in order to keep a consistency between mean values and their covariances. The least-squares fitting code GMA was used in estimating covariances for reactions of which JENDL-3.2 cross sections had been evaluated by taking account of measurements. In nuclear model calculations, the covariances were calculated by the KALMAN system. The covariance data obtained were compiled in the ENDF-6 format, and will be put into the JENDL-3.2 Covariance File which is one of JENDL special purpose files. (author). 193 refs

  6. 7 CFR 51.1147 - U.S. No. 2 Bright.

    Science.gov (United States)

    2010-01-01

    ...) Internal quality: Lots meeting the internal requirements for “U.S. Grade AA Juice (Double A)” or “U.S... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 2 Bright. 51.1147 Section 51.1147 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...

  7. A review of microstructural analysis on U3Si2-Al plate-type fuel

    International Nuclear Information System (INIS)

    Ti Zhongxin; Guo Yibai

    1995-12-01

    The microstructure of U 3 Si 2 -Al plate-type fuel, that is the microstructure of fuel particles, compatibility of the fuel particles and Al matrix, fuel particles distribution, dogbone area morphology, clad and meat thickness, bone quality of clad/frame and clad/fuel core, and the effect of these factors on products quality were comprehensively investigated and analyzed by means of optical microscopy (OM), scanning electron microscopy (SEM), X-ray diffraction (XRD), energy dispersive X-ray spectrometry (EDX), image processing technique, etc.. The main results are as following: U-7.7%Si alloy contains two phases: primary U 3 Si 2 and small amount of USi (about 12%), free-uranium was not detected in fuel particles; the dogbone area is the key factor affecting fuel plate quality (1 ref., 16 figs., 4 tabs.)

  8. Application of bias correction methods to improve U3Si2 sample preparation for quantitative analysis by WDXRF

    International Nuclear Information System (INIS)

    Scapin, Marcos A.; Guilhen, Sabine N.; Azevedo, Luciana C. de; Cotrim, Marycel E.B.; Pires, Maria Ap. F.

    2017-01-01

    The determination of silicon (Si), total uranium (U) and impurities in uranium-silicide (U 3 Si 2 ) samples by wavelength dispersion X-ray fluorescence technique (WDXRF) has been already validated and is currently implemented at IPEN's X-Ray Fluorescence Laboratory (IPEN-CNEN/SP) in São Paulo, Brazil. Sample preparation requires the use of approximately 3 g of H 3 BO 3 as sample holder and 1.8 g of U 3 Si 2 . However, because boron is a neutron absorber, this procedure precludes U 3 Si 2 sample's recovery, which, in time, considering routinely analysis, may account for significant unusable uranium waste. An estimated average of 15 samples per month are expected to be analyzed by WDXRF, resulting in approx. 320 g of U 3 Si 2 that would not return to the nuclear fuel cycle. This not only impacts in production losses, but generates another problem: radioactive waste management. The purpose of this paper is to present the mathematical models that may be applied for the correction of systematic errors when H 3 BO 3 sample holder is substituted by cellulose-acetate {[C 6 H 7 O 2 (OH) 3-m (OOCCH 3 )m], m = 0∼3}, thus enabling U 3 Si 2 sample’s recovery. The results demonstrate that the adopted mathematical model is statistically satisfactory, allowing the optimization of the procedure. (author)

  9. A yeast endoribonuclease stimulated by Novikoff hepatoma small nuclear RNAs U1 and U2

    International Nuclear Information System (INIS)

    Stevens, A.

    1982-01-01

    Using [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) from yeast as a substrate, an endoribonuclease has been detected in enzyme fractions derived from a high salt wash of ribonucleoprotein particles of Saccharomyces cerevisiae. The [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) seems to be a preferred substrate since other polyribonucleotides are hydrolyzed more slowly, if at all. The enzyme is inhibited by ethidium bromide, but fully double-stranded polyribonucleotides are not hydrolyzed. The hydrolysis of [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) is stimulated about 2.5-fold by the addition of small nuclear RNAs U1 and U2 of Novikoff hepatoma cells. Results show that the stimulation involves an interaction of the labeled RNA with the small nuclear RNA

  10. Supersymmetric U boson and the old U(1) problem

    International Nuclear Information System (INIS)

    Kim, B.R.

    1983-01-01

    In the supersymmetric SU(3)xSU(2)xU(1)xUsup(')(1) model the new gauge group Usup(')(1) enforces the introduction of mirror fermions. In this note we address the inverse question. If one starts with SU(3)xSU(2)xU(1) including mirror fermions, what physical arguments other than the supersymmetric require the introduction of a new gauge group Usup(')(1). It turns out that the old U(1) problem is closely related with this question. Further we give an estimate for the upper bound for the parameter of the supersymmetric U boson r and x. (orig.)

  11. Simulation of accident-tolerant U3Si2 fuel using FRAPCON code

    International Nuclear Information System (INIS)

    Gomes, Daniel S.; Silva, Antonio T.; Abe, Alfredo Y.; Muniz, Rafael O.R.; Giovedi, Claudia

    2017-01-01

    The research on accident-tolerant fuels (ATFs) increased after the Fukushima event. This benefited risk management in nuclear operations. In this investigation, the physical properties of the materials being developed for the ATF program were compared with those of the standard UO 2 - Zr fuel system. The research efforts in innovative fuel design include rigorous characterization of thermal, mechanical, and chemical assessment, with the objectives of making the burnup cycle longer, increasing power density, and improving safety performance. Fuels must reach a high uranium density - above that supported by UO 2 - and possess coating that exhibits better oxidation resistance than Zircaloy. The uranium density and thermal conductivity of ATFs, such as U 3 Si 2 , UN, and UC, is higher than that of UO 2 ; their combination with advanced cladding provides possible fuel - cladding options. An ideal combination of fuel and cladding must increase fuel performance in loss-of-coolant scenarios. The disadvantages of U 3 Si 2 , UN, and UC are their swelling rates, which are higher than that of UO 2 . The thermal conductivities of ATFs are approximately four times higher than that of UO2. To prevent the generation of hydrogen due to oxidation of zirconium-based alloys in contact with steam, cladding options, such as ferritic alloys, were studied. It was verified that FeCrAl alloys and SiC provide better response under severe conditions because of their thermophysical properties. The findings of this study indicate that U 3 Si 2 and the FeCrAl fuel cladding concept should replace UO 2 - Zr as the fuel system of choice. (author)

  12. 7 CFR 51.3052 - U.S. No. 2.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... Standards for Florida Avocados Grades § 51.3052 U.S. No. 2. “U.S. No. 2” consists of avocados of similar...

  13. Crystal structure of U2+xCo2Ga1-x

    International Nuclear Information System (INIS)

    Zelinskii, A.V.; Fedorchuk, A.A.

    1995-01-01

    In studies of phase equilibria in the U-Co-Ga system at 600 degrees C, the authors found a ternary compound close in composition to U 2 Co 2 Ga. A sample of composition U 42 Co 40 Ga 18 was prepared by arc-melting a mixture of high-purity U (99.4%), Co (99.99%), and Ga (99.99%) in a purified argon atmosphere. The sample was homogenized at 600 degrees C for 720 h in an evacuated quartz tube and then quenched in cold water. In structure determination, the authors used a DRON-4-07 powder X-ray diffractometer (CuK α radiation, 0.02 degrees 2θ scan step) and the CSD software package. The X-ray diffraction pattern showed tetragonal symmetry, with lattice parameters obtained from least-squares refinements a = 0.707729(5) and c = 0.34707(4) nm

  14. Comparison of U(VI) adsorption onto nanoscale zero-valent iron and red soil in the presence of U(VI)–CO{sub 3}/Ca–U(VI)–CO{sub 3} complexes

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhibin [Key Laboratory of Radioactive Geology and Exploration Technology Fundamental Science for National Defense, East China Institute of Technology, Nanchang 330013 (China); State Key Laboratory Breeding Base of Nuclear Resources and Environment (East China Institute of Technology), Ministry of Education, Nanchang 330013 (China); Chemistry, Biological and Materials Sciences Department, East China Institute of Technology, Nanchang 330013 (China); Liu, Jun [State Key Laboratory Breeding Base of Nuclear Resources and Environment (East China Institute of Technology), Ministry of Education, Nanchang 330013 (China); Cao, Xiaohong, E-mail: xhcao@ecit.cn [Key Laboratory of Radioactive Geology and Exploration Technology Fundamental Science for National Defense, East China Institute of Technology, Nanchang 330013 (China); State Key Laboratory Breeding Base of Nuclear Resources and Environment (East China Institute of Technology), Ministry of Education, Nanchang 330013 (China); Chemistry, Biological and Materials Sciences Department, East China Institute of Technology, Nanchang 330013 (China); Luo, Xuanping [Chemistry, Biological and Materials Sciences Department, East China Institute of Technology, Nanchang 330013 (China); Hua, Rong; Liu, Yan [Key Laboratory of Radioactive Geology and Exploration Technology Fundamental Science for National Defense, East China Institute of Technology, Nanchang 330013 (China); State Key Laboratory Breeding Base of Nuclear Resources and Environment (East China Institute of Technology), Ministry of Education, Nanchang 330013 (China); Chemistry, Biological and Materials Sciences Department, East China Institute of Technology, Nanchang 330013 (China); Yu, Xiaofeng; He, Likai [Chemistry, Biological and Materials Sciences Department, East China Institute of Technology, Nanchang 330013 (China); and others

    2015-12-30

    Highlights: • NZVI can be used for adsorbing U(VI)–CO{sub 3} complexes. • Use of NZVI is feasible for remediation of uranium-contaminated soils. • The mechanism of U(VI)–CO{sub 3} complexes adsorbing onto NZVI has been explained. - Abstract: The influence of U(VI)–CO{sub 3} and Ca–U(VI)–CO{sub 3} complexes on U(VI) adsorption onto red soil and nanoscale zero-valent iron (NZVI) was investigated using batch adsorption and fixed-bed column experiments to simulate the feasibility of NZVI as the reactive medium in permeable- reactive barriers (PRB) for in situ remediation of uranium-contaminated red soils. The adsorption capacity (q{sub e}) and distribution constant (K{sub d}) of NZVI and red soil decreased with increasing pH, dissolved carbonate and calcium concentrations, but the q{sub e} and K{sub d} values of NZVI were 5–10 times higher than those of red soil. The breakthrough pore volume (PV) values increased with the decrease of pH, dissolved carbonate and calcium concentration; however, the breakthrough PV values of the PRB column filled with 5% NZVI were 2.0–3.5 times higher than the 100% red soil column. The U(VI)–CO{sub 3} complexes adsorbed onto the surface of red soil/NZVI (≡SOH) to form SO–UO{sub 2}CO{sub 3}{sup −} or SO–UO{sub 2} (CO{sub 3}){sub 2}{sup 3−}. XPS and XRD analysis further confirmed the reduction of U(VI) to U(IV) and the formation of FeOOH on NZVI surfaces. The findings of this study are significant to the remediation of uranium-contaminated red soils and the consideration of practical U(VI) species in the natural environment.

  15. Tensile mechanical properties of U3Si2-Al fuel plate

    International Nuclear Information System (INIS)

    Xu Yong; Hu Huawei; Zhuang Hongquan; Wang Xishu

    2003-01-01

    The fuel plate made of fuel meat, with the U 3 Si 2 -Al dispersion fuel center, and 6061 Al alloy cladding, is a new kind of fuel used in research reactors. The mechanical property data of the fuel meat is the basic data in the design of fuel group, but the mechanical property of this fuel meat has not been studied all over the world till now. In this paper, the mechanical properties of U 3 Si 2 -Al fuel meats of different sizes used in research reactors are investigated and analyzed, and at the same time the carrying capacity of tensile in different directions are also compared. In order to get more knowledge about the mechanical properties of the fuel meat, the tensile experiment has been carried out repeatedly. Considering the lower ratio of elongation and the brittleness, the microscope has been used to examine the zone of fracture after tensile test. (authors)

  16. Corrective action baseline report for underground storage tanks 0439-U, 0440-U, 2073-U, 2074-U, and 2075-U at the East End Fuel Station, Buildings 9754 and 9754-2, Oak Ridge Y-12 Plant, Oak Ridge, Tennessee, Facility ID No. 0-010117

    International Nuclear Information System (INIS)

    1994-01-01

    The purpose of this report is to provide baseline geochemical and hydrogeologic data relative to corrective action for underground storage tanks (USTs) 0439-U, 0440-U, 2073-U, 2074-U, and 2075-U at the East End Fuel Station, Buildings 9754 and 9754-2 at the Oak Ridge Y-12 Plant. Progress in support of corrective action at the East End Fuel Station has included monitoring well installation, tank removal, and baseline groundwater sampling and analysis. This document represents the baseline report for corrective action at the East End Fuel Station and is organized into three sections. Section 1 presents introductory information relative to the site, including the regulatory initiative, site description, and progress to date. Section 2 includes a summary of additional monitoring well installation activities, the results of baseline groundwater sampling, a summary of tank removal activities, and the results of confirmatory soil sampling performed during tank removal. Section 3 presents the baseline hydrogeology and planned zone of influence for groundwater remediation

  17. Irradiation behaviour of solid and hollow U{sub 3}Si fuel elements: results to 15,000 MWd/tonne U

    Energy Technology Data Exchange (ETDEWEB)

    Feraday, M A; Chalder, G H; Cotnam, K D

    1969-06-15

    U{sub 3}Si fuel elements clad in zirconium alloy sheaths have been irradiated to burnups close to 15,000 MWd/tonne U in pressurized water at 220{sup o}C, 98 bars. The results show that the external swelling can be controlled by incorporating free volume in the element. The dimensional stability of such elements is adequate to permit their use in power reactor fuel bundles. A diameter increase of 1.2% had occurred in an element initially containing 12.8% total free volume, after a burnup of 14,700 MWd/tonne U. There was no change in diameter between burnups of 5200 and 14,700 MWd/tonne U. Elements containing 3% total free volume had increased in diameter about 2.5% at 2000 MWd/tonne U compared to 0.2% at 9500 MWd/tonne U for elements containing 22% total free volume. The observed swelling in the U{sub 3}Si is discussed in terms of possible mechanisms. (author)

  18. 7 CFR 51.1148 - U.S. No. 2.

    Science.gov (United States)

    2010-01-01

    ... tolerances see § 51.1151. (e) Internal quality: Lots meeting the internal requirements for “U.S. Grade AA... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 2. 51.1148 Section 51.1148 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...

  19. Tank 241-U-103, grab samples 3U-99-1, 3u-99-2 and 3U-99-3

    Energy Technology Data Exchange (ETDEWEB)

    STEEN, F.H.

    1999-08-25

    This document is the final report for tank 241-U-103 grab samples. Three grab samples were collected from riser 13 on March 12, 1999 and received by the 222-S laboratory on March 15, 1999. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP.

  20. Analysis of the right-handed Majorana neutrino mass in an S U (4 )×S U (2 )L×S U (2 )R Pati-Salam model with democratic texture

    Science.gov (United States)

    Yang, Masaki J. S.

    2017-03-01

    In this paper, we attempt to build a unified model with the democratic texture, that has some unification between up-type Yukawa interactions Yν and Yu . Since the S3 L×S3 R flavor symmetry is chiral, the unified gauge group is assumed to be Pati-Salam type S U (4 )c×S U (2 )L×S U (2 )R. The breaking scheme of the flavor symmetry is considered to be S3 L×S3 R→S2 L×S2 R→0 . In this picture, the four-zero texture is desirable for realistic masses and mixings. This texture is realized by a specific representation for the second breaking of the S3 L×S3 R flavor symmetry. Assuming only renormalizable Yukawa interactions, type-I seesaw mechanism, and neglecting C P phases for simplicity, the right-handed neutrino mass matrix MR can be reconstructed from low energy input values. Numerical analysis shows that the texture of MR basically behaves like the "waterfall texture." Since MR tends to be the "cascade texture" in the democratic texture approach, a model with type-I seesaw and up-type Yukawa unification Yν≃Yu basically requires fine-tunings between parameters. Therefore, it seems to be more realistic to consider universal waterfall textures for both Yf and MR, e.g., by the radiative mass generation or the Froggatt-Nielsen mechanism. Moreover, analysis of eigenvalues shows that the lightest mass eigenvalue MR 1 is too light to achieve successful thermal leptogenesis. Although the resonant leptogenesis might be possible, it also requires fine-tunings of parameters.

  1. U-2 Bono sünnipäevapidu

    Index Scriptorium Estoniae

    2002-01-01

    10. mail toimub Guitar Safari pubis Estonian U Fan Clubi eestvedamisel ansambli U-2 laulja-kitarristi Bono sünnipäevakontert. Üritust soojendab DJ Zwillig ning peaesinejateks on ansamblid The Bluesyard ja Sequence

  2. Hydrogen isotope effect on storage behavior of U{sub 2}Ti and UZr{sub 2.3}

    Energy Technology Data Exchange (ETDEWEB)

    Jat, Ram Avtar; Sawant, S.G.; Rajan, M.B.; Dhanuskar, J.R. [Product Development Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Kaity, Santu [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Parida, S.C., E-mail: sureshp@barc.gov.in [Product Development Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India)

    2013-11-15

    U{sub 2}Ti and UZr{sub 2.3} alloys were prepared by arc melting method, vacuum annealed and characterized by XRD, SEM and EDX methods. Hydrogen isotope effect on the storage behavior of these alloys were studied by measuring the hydrogen/deuterium desorption pressure–composition–temperature (PCT) profiles in the temperature range of 573–678 K using a Sievert’s type volumetric apparatus. It was observed that, in the temperature and pressure range of investigation, all the isotherms show a single desorption plateau. The PCT data reveals that both U{sub 2}Ti and UZr{sub 2.3} alloys had normal isotope effects on hydrogen/deuterium desorption at all experimental temperatures. Thermodynamic parameters for dehydrogenation and dedeuteration reactions of the corresponding hydrides and deuterides of the above alloys were deduced from the PCT data.

  3. First-principles investigation of U doping in ZrO2

    International Nuclear Information System (INIS)

    Huang, H.W.; Pan, Y.; Yu, C.; Yang, J.; Wang, H.; Yi, W.; Peng, J.C.

    2014-01-01

    Highlights: • U-doped system with cubic structure is more stable than the monoclinic structure. • The elastic modulus of cubic structure is higher than the monoclinic structure. • U-doped weakens the resistance to shear deformation of ZrO 2 . • U-doped enhances the resistance to shape deformation for monoclinic structure. -- Abstract: The formation energies, elastic properties, Debye temperature and electronic structure of U-doped ZrO 2 within cubic and monoclinic structures are investigated by first-principles approach. The calculated formation energies show that the U-doped with cubic structure is more stable than that of monoclinic structure. The U-doped weakens the resistance to shear deformation whether cubic structure or monoclinic structure. However, the U-doped decreases the shape deformation of cubic structure in contrast to enhances the shape deformation for monoclinic structure. The Debye temperature of U-doped system is lower than the corresponding ZrO 2 . We found that the calculated electronic structure of these systems are consistent with the variation of formation energies

  4. Characterization of UO{sub 2}, a) Characterization of UO{sub 2} powder; b) Investigation of U-O system by DDK and TGA methods; Karakterizacija UO{sub 2}, a) Karakterizacija praha UO{sub 2}; b) Ispitivanje sistema U-O metodama DDK i TGA

    Energy Technology Data Exchange (ETDEWEB)

    Ristic, M M [Institute of Nuclear Sciences Vinca, Laboratorija za reaktorske materijale, Beograd (Serbia and Montenegro)

    1962-10-15

    The objectives of the study of U-O powder system were: detailed characterization of the UO{sub 2} powder which will be used for studying the sintering process, and more detailed properties of the U-O system (thermodynamic aspects of oxidation kinetics). Study of the physical and chemical properties of UO{sub 2} powder were performed and then oxidation kinetics of UO{sub 2} {yields}U{sub 3}O{sub 7} was investigated. Detailed qualitative DDK analysis was done. Owing to the TGA equipment there was a possibility to obtain U{sub 3}O{sub 7} study of U{sub 3}O{sub 7} {yields} U{sub 3}O{sub 8} oxidation was possible.

  5. A COMPARISON OF (PuU)C AND (PuU)O$sub 2$ FUELED FAST BREEDER REACTORS

    Energy Technology Data Exchange (ETDEWEB)

    Kazi, A. Halim; Rosen, Stanley

    1963-11-15

    BS>A conceptual evaluation is presented of a (PuU)C 500Mw(e) reactor which uses a moderate power generation of 40 kw/ft and a maximum fuel temperature of 2900 deg F, well below the 4500 deg F melting point of Pu/sub 0.2/U/sub 0.8/C. The principal design characteristics and fuel cycle costs are tabulated together with those of a (PuU)O/sub 2/ design of equal power. The comparison shows that the carbide core has significant economic and safety advantages over the oxide core. (D.L.C.)

  6. Properties measurements of (U{sub 0.7}Pu{sub 0.3})O{sub 2-x} in PO{sub 2}-controlled atmosphere

    Energy Technology Data Exchange (ETDEWEB)

    Kato, M.; Murakami, T.; Sunaoshi, T. [Advanced Nuclear System Research and Development Directorate, Japan Atomic Energy Agency, Muramatsu Tokai-mura Ibaraki, 319-1194 (Japan); Nelson, A.T.; McClellan, K.J. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States)

    2013-07-01

    The investigation of physical properties of uranium and plutonium mixed oxide (MOX) fuels is important for the development of fast reactor fuels. It is well known that MOX is a nonstoichiometric oxide, and the physical properties change drastically with the Oxygen-to-Metal (O/M) ratio. A control technique for O/M ratio was established for measurements of high temperature properties of uranium and plutonium mixed oxide fuels. Sintering behavior, thermal expansion and O/M change of (U{sub 0.7}Pu{sub 0.3})O{sub 2.00} and (U{sub 0.7}Pu{sub 0.3})O{sub 1.99} were investigated in PO{sub 2}-controlled atmosphere which was controlled by H{sub 2}/H{sub 2}O gas system. Sintering behavior changed drastically with O/M ratio, and shrinkage of (U{sub 0.7}Pu{sub 0.3})O{sub 2.00} was faster and more advanced at lower temperatures as compared with (U{sub 0.7}Pu{sub 0.3})O{sub 1.99}. Thermal expansion was observed to be slightly increased with decreasing O/M ratio. (authors)

  7. Tetrahalide complexes of the [U(NR)2]2+ ion: synthesis, theory, and chlorine K-edge X-ray absorption spectroscopy.

    Science.gov (United States)

    Spencer, Liam P; Yang, Ping; Minasian, Stefan G; Jilek, Robert E; Batista, Enrique R; Boland, Kevin S; Boncella, James M; Conradson, Steven D; Clark, David L; Hayton, Trevor W; Kozimor, Stosh A; Martin, Richard L; MacInnes, Molly M; Olson, Angela C; Scott, Brian L; Shuh, David K; Wilkerson, Marianne P

    2013-02-13

    Synthetic routes to salts containing uranium bis-imido tetrahalide anions [U(NR)(2)X(4)](2-) (X = Cl(-), Br(-)) and non-coordinating NEt(4)(+) and PPh(4)(+) countercations are reported. In general, these compounds can be prepared from U(NR)(2)I(2)(THF)(x) (x = 2 and R = (t)Bu, Ph; x = 3 and R = Me) upon addition of excess halide. In addition to providing stable coordination complexes with Cl(-), the [U(NMe)(2)](2+) cation also reacts with Br(-) to form stable [NEt(4)](2)[U(NMe)(2)Br(4)] complexes. These materials were used as a platform to compare electronic structure and bonding in [U(NR)(2)](2+) with [UO(2)](2+). Specifically, Cl K-edge X-ray absorption spectroscopy (XAS) and both ground-state and time-dependent hybrid density functional theory (DFT and TDDFT) were used to probe U-Cl bonding interactions in [PPh(4)](2)[U(N(t)Bu)(2)Cl(4)] and [PPh(4)](2)[UO(2)Cl(4)]. The DFT and XAS results show the total amount of Cl 3p character mixed with the U 5f orbitals was roughly 7-10% per U-Cl bond for both compounds, which shows that moving from oxo to imido has little effect on orbital mixing between the U 5f and equatorial Cl 3p orbitals. The results are presented in the context of recent Cl K-edge XAS and DFT studies on other hexavalent uranium chloride systems with fewer oxo or imido ligands.

  8. Decay scheme of the U{sup 2}35; Esquema de desintegracion del U-235

    Energy Technology Data Exchange (ETDEWEB)

    Gaeta, R

    1965-07-01

    A study of the Th{sup 2}31 excited levels from the alpha decay of the U{sup 2}35, is carried out. The alpha particle spectrum was measured by means of a semiconductor counter spectrometer with an effective resolution of 18 keV. Nineteen new lines were identified. The gamma-ray spectrum was measured with thin samples of U{sup 2}35, free from decay products, and in such geometrical conditions, that most of the interference effects were eliminated. The gamma-gamma coincidence spectra have made easier a better knowledge of the transition between the several levels. (Author) 110 refs.

  9. Residual Z{sub 2} symmetries and leptonic mixing patterns from finite discrete subgroups of U(3)

    Energy Technology Data Exchange (ETDEWEB)

    Joshipura, Anjan S. [Physical Research Laboratory,Navarangpura, Ahmedabad 380 009 (India); Patel, Ketan M. [Indian Institute of Science Education and Research, Mohali,Knowledge City, Sector 81, S A S Nagar, Manauli 140 306 (India)

    2017-01-30

    We study embedding of non-commuting Z{sub 2} and Z{sub m}, m≥3 symmetries in discrete subgroups (DSG) of U(3) and analytically work out the mixing patterns implied by the assumption that Z{sub 2} and Z{sub m} describe the residual symmetries of the neutrino and the charged lepton mass matrices respectively. Both Z{sub 2} and Z{sub m} are assumed to be subgroups of a larger discrete symmetry group G{sub f} possessing three dimensional faithful irreducible representation. The residual symmetries predict the magnitude of a column of the leptonic mixing matrix U{sub PMNS} which are studied here assuming G{sub f} as the DSG of SU(3) designated as type C and D and large number of DSG of U(3) which are not in SU(3). These include the known group series Σ(3n{sup 3}), T{sub n}(m), Δ(3n{sup 2},m), Δ(6n{sup 2},m) and Δ{sup ′}(6n{sup 2},j,k). It is shown that the predictions for a column of |U{sub PMNS}| in these group series and the C and D types of groups are all contained in the predictions of the Δ(6N{sup 2}) groups for some integer N. The Δ(6N{sup 2}) groups therefore represent a sufficient set of G{sub f} to obtain predictions of the residual symmetries Z{sub 2} and Z{sub m}.

  10. U enrichment and Th/U fractionation in Archean boninites: Implications for paleo-ocean oxygenation and U cycling at juvenile subduction zones

    Science.gov (United States)

    Manikyamba, C.; Said, Nuru; Santosh, M.; Saha, Abhishek; Ganguly, Sohini; Subramanyam, K. S. V.

    2018-05-01

    Phanerozoic boninites record enrichments of U over Th, giving Th/U: 0.5-1.6, relative to intraoceanic island arc tholeiites (IAT) where Th/U averages 2.6. Uranium enrichment is attributed to incorporation of shallow, oxidized fluids, U-rich but Th-poor, from the slab into the melt column of boninites which form in near-trench to forearc settings of suprasubduction zone ophiolites. Well preserved Archean komatiite-tholeiite, plume-derived, oceanic volcanic sequences have primary magmatic Th/U ratios of 4.4-3.6, and Archean convergent margin IAT volcanic sequences, having REE and HFSE compositions similar to Phanerozoic IAT equivalents, preserve primary Th/U of 4-3.6. The best preserved Archean boninites of the 3.0 Ga Olondo and 2.7 Ga Gadwal greenstone belts, hosted in convergent margin ophiolite sequences, also show relative enrichments of U over Th, with low average Th/U3 relative to coeval IAT, and Phanerozoic counterparts which are devoid of crustal contamination and therefore erupted in an intraoceanic setting, with minimal contemporaneous submarine hydrothermal alteration. Later enrichment of U is unlikely as Th-U-Nb-LREE patterns are coherent in these boninites whereas secondary effects induce dispersion of Th/U ratios. The variation in Th/U ratios from Archean to Phanerozoic boninites of greenstone belts to ophiolitic sequences reflect on genesis of boninitic lavas at different tectono-thermal regimes. Consequently, if the explanation for U enrichment in Phanerozoic boninites also applies to Archean examples, the implication is that U was soluble in oxygenated Archean marine water up to 600 Ma before the proposed great oxygenation event (GOE) at ∼2.4 Ga. This interpretation is consistent with large Ce anomalies in some hydrothermally altered Archean volcanic sequences aged 3.0-2.7 Ga.

  11. SU(2) x U(1) x U'(1) models which are slightly different from the Weinberg-Salam model

    International Nuclear Information System (INIS)

    Gao, C.; Wu, D.

    1981-01-01

    We discuss SU(2) x U(1) x U'(1) models by a uniform formula which is convenient for their comparison with the standard Weinberg-Salam model. As examples, we give three interesting models which are based on different grand unification models. In one model, U'(1) does not contribute to the electromagnetic interaction; in the other two, both U(1) and U'(1) do contribute to the electromagnetic interaction. Also, the first two models can approach the standard Weinberg-Salam model as close as one wants; but the third model has limitations on it

  12. Paramagnetic properties of the (U1-xTbx)Co2Ge2 solid solutions

    International Nuclear Information System (INIS)

    Kuznietz, Moshe; Pinto, Haim; Ettedgui, Hanania

    1995-01-01

    Polycrystalline (U 1-x Tb x )Co 2 Ge 2 solid solutions have the ThCr 2 Si 2 -type crystal structure and order antiferromagnetically. AC-susceptibility at 80-295 K yields paramagnetic Curie temperatures θ=-350±50, -15±5, -50±15, -12±5, and -80±5 K, and effective magnetic moments μ eff =4.5, 5.9, 7.3, 8.5, and 12.0 (±0.5)μ B , for samples with x=0, 0.25, 0.50, 0.75 and 1, respectively. The high μ eff values are related to occurrence of paramagnetic moments on U, Tb and Co, of which only U and Tb moments order magnetically. ((orig.))

  13. Transuranium element incorporation into the β-U3O8 uranyl sheet

    International Nuclear Information System (INIS)

    Miller, M.L.; Burns, P.C.; Ewing, R.C.; Finch, R.J.

    1997-01-01

    Spent nuclear fuel (SNF) is unstable under oxidizing conditions. Although recent studies have determined the paragenetic sequence for uranium phases that result from the corrosion of SNF, there are only limited data on the potential of alteration phases for the incorporation of transuranium elements. The crystal chemical characteristics of transuranic elements (TUE) are to a certain extent similar to uranium; thus TUE incorporation into the sheets of uranyl oxide hydrate structures can be assessed by examination of the structural details of the β-U 3 O 8 sheet type. The sheets of uranyl polyhedra observed in the crystal structure of β-U 3 O 8 also occur in the mineral billietite, where they alternate with α-U 3 O 8 type sheets. Preliminary crystal structure determinations for the minerals ianthinite, and wyartite, indicate that these phases also contain β-U 3 O 8 type sheets. The β-U 3 O 8 sheet anion topology contains triangular, rhombic, and pentagonal sites in the proportions 2:1:2. In all structures containing β-U 3 O 8 type sheets, the triangular sites are vacant. The pentagonal sites are filled with U 6+ O 2 forming pentagonal bipyramids. The rhombic dipyramids filling the rhombic sites contain U 6+ O 2 in billietite, U 4+ O 2 in β-U 3 O 8 , U 4+ (H 2 O) 2 in ianthinite, and U 4+ O 3 in wyartite-II. Interlayer species include: H 2 O (billietite, wyartite II, and ianthinite), Ba 2+ (billietite) Ca 2+ wyartite II, and Co 3 2- wyartite II; there is no interlayer in β-U 3 O 8 . The similarity of known TUE coordination polyhedra with those of U suggests that the β-U 3 O 8 sheet will accommodate TUE substitution coupled with variations in apical anion configuration and interlayer population providing the required charge balance

  14. Rate theory scenarios study on fission gas behavior of U 3 Si 2 under LOCA conditions in LWRs

    Energy Technology Data Exchange (ETDEWEB)

    Miao, Yinbin; Gamble, Kyle A.; Andersson, David; Mei, Zhi-Gang; Yacout, Abdellatif M.

    2018-01-01

    Fission gas behavior of U3Si2 under various loss-of-coolant accident (LOCA) conditions in light water reactors (LWRs) was simulated using rate theory. A rate theory model for U3Si2 that covers both steady-state operation and power transients was developed for the GRASS-SST code based on existing research reactor/ion irradiation experimental data and theoretical predictions of density functional theory (DFT) calculations. The steady-state and LOCA condition parameters were either directly provided or inspired by BISON simulations. Due to the absence of in-pile experiment data for U3Si2's fuel performance under LWR conditions at this stage of accident tolerant fuel (ATF) development, a variety of LOCA scenarios were taken into consideration to comprehensively and conservatively evaluate the fission gas behavior of U3Si2 during a LOCA.

  15. Status of U3Si2-Al fuel development in China

    International Nuclear Information System (INIS)

    Sun Rongxian; Huang Dechen; Yin Changgeng; Zhang Qindi; He Fengqi; Li Shuhua; Xiang Xingbi; Zhang Zhiyi; Wang Zhaoyue

    1995-01-01

    On the basis of the research and development work, a production line of U 3 Si 2 -Al dispersion fuel elements has been established and tens of the fuel elements have been produced. A lot of technical improvements and reliable inspection system ensure that all technical performance of the fuel elements meet International standards. (author)

  16. Theoretical investigation of the Omega(g,u)(+/-) states of K2 dissociating adiabatically up to K(4p 2P(3/2)) + K(4p 2P(3/2)).

    Science.gov (United States)

    Jraij, A; Allouche, A R; Magnier, S; Aubert-Frécon, M

    2009-06-28

    A theoretical investigation of the electronic structure of the K(2) molecule, including spin-orbit effects, has been performed. Potential energies have been calculated over a large range of R up to 75a(0) for the 88 Omega(g,u)(+/-) states dissociating adiabatically into the limits up to K(4p (2)P(3/2))+K(4p (2)P(3/2)). Equilibrium distances, transition energies, harmonic frequencies, as well as depths for wells and heights for barriers are reported for all of the bound Omega(g,u)(+/-) states. Present ab initio calculations are shown to be able to reproduce quite accurately the small structures (wells and barrier) displayed at very long-range (R>50a(0)) by the (2,3)1(u) and (2)0(g)(-) purely long-range states. As the present data could help experimentalists, we make available extensive tables of energy values versus internuclear distances in our database at the web address http://www-lasim.univ-lyon1.fr/spip.php?rubrique99.

  17. Symmetry breaking of u(6/2j+1) supersymmetric models

    International Nuclear Information System (INIS)

    Baake, M.; Reinicke, P.

    1985-09-01

    In this paper, we present the group theory of models with broken u(6/2j+1) supersymmetry described by the chain u(6/2j+1) contains usub(B)(6) x usub(F)(2j+1) contains usub(B)(6) x spsub(F)(2j+1) contains ... contains sosub(B)(3) x susub(F)(2) contains susub(B+F)(2) which has recently been suggested for application to nuclear physics. We present all invariants that are needed for the construction of the general Hamiltonian for this model. (orig.)

  18. Thorium and uranium redox-active ligand complexes; reversible intramolecular electron transfer in U(dpp-BIAN)2/ U(dpp-BIAN)2(THE)

    Energy Technology Data Exchange (ETDEWEB)

    Schelter, Eric John [Los Alamos National Laboratory; Wu, Ruilian [Los Alamos National Laboratory; Scott, Brian L [Los Alamos National Laboratory; Thompson, Joe D [Los Alamos National Laboratory; Batista, Enrique R [Los Alamos National Laboratory; Morris, David E [Los Alamos National Laboratory; Kiplinger, Jaqueline L [Los Alamos National Laboratory

    2008-01-01

    Actinide complexes of the redox-active ligand dpp-BIAN{sup 2-} (dpp-BIAN = bis(2,6-diisopropylphenyl)acenaphthylene), An(dpp-BIAN){sub 2}(THF){sub n} (An = Th, n = 1; An = U, n = 0, 1) have been prepared. Solid-state magnetic and single-crystal X-ray data for U(dpp-BIAN){sub 2}(THF){sub n} show when n = 0, the complex exists in an f{sup 2}-{pi}*{sup 4} configuration; whereas an intramolecular electron transfer occurs for n = 1, resulting in an f{sup 3}-{pi}*{sup 3} ground configuration. The magnetic data also indicate that interconversion between the two forms of the complex is possible, limited only by the ability of THF vapor to penetrate the solid on cooling of the sample. Spectroscopic data indicate the complex exists solely in the f{sup 2}-{pi}*{sup 4} form in solution, evidenced by the appearance of only small changes in the electronic absorption spectra of the U(dpp-BIAN){sub 2} complex on titration with THF and by measurement of the solution magnetic moment m d{sub 8}-tetrahydrofuran using Evans method. Electrochemistry of the complexes is reported, with small differences observed in wave potentials between metals and in the presence of THF. These data represent the first example of a well-defined, reversible intramolecular electron transfer in an f-element complex and the second example of oxidation state change through dative interaction with a metal ion.

  19. New N2(C 3Πu, v) collision quenching and vibrational relaxation rate constants: 2. PG emission diagnostics of high-pressure discharges

    International Nuclear Information System (INIS)

    Dilecce, G; Ambrico, P F; De Benedictis, S

    2007-01-01

    The present paper deals with the determination of discharge parameters using N 2 (C 3 Π u , v) populations deduced from 2.PG emission spectra, focusing on the influence of N 2 (C 3 Π u , v) collision rate coefficients on these determinations. In particular it is shown that the new set of quenching and vibrational relaxation rate coefficients of N 2 (C 3 Π u , v 0-4) vibronic levels recently measured by optical-optical double resonance laser induced fluorescence (LIF) have a large effect on discharge parameter determination in high-pressure discharges. In the present paper we explore this effect, evidencing the differences with respect to the old data set case, in both simulated and real cases of N 2 (C 3 Π u , v) vibrational distributions measured at high pressure in a dielectric barrier discharge. Finally we point out the improved potentiality of 2.PG spectroscopy as a diagnostic technique: with the new rate coefficients, and measurement of the N 2 (C 3 Π u , v) distribution up to at least v = 3, it is possible to have a quasi-independent evaluation of the electron temperature and of the first level vibrational temperature of the N 2 ground state

  20. R2U2: Monitoring and Diagnosis of Security Threats for Unmanned Aerial Systems

    Science.gov (United States)

    Schumann, Johann; Moosbruger, Patrick; Rozier, Kristin Y.

    2015-01-01

    We present R2U2, a novel framework for runtime monitoring of security properties and diagnosing of security threats on-board Unmanned Aerial Systems (UAS). R2U2, implemented in FPGA hardware, is a real-time, REALIZABLE, RESPONSIVE, UNOBTRUSIVE Unit for security threat detection. R2U2 is designed to continuously monitor inputs from the GPS and the ground control station, sensor readings, actuator outputs, and flight software status. By simultaneously monitoring and performing statistical reasoning, attack patterns and post-attack discrepancies in the UAS behavior can be detected. R2U2 uses runtime observer pairs for linear and metric temporal logics for property monitoring and Bayesian networks for diagnosis of security threats. We discuss the design and implementation that now enables R2U2 to handle security threats and present simulation results of several attack scenarios on the NASA DragonEye UAS.

  1. A charge-optimized many-body potential for the U-UO2-O2 system

    Science.gov (United States)

    Li, Yangzhong; Liang, Tao; Sinnott, Susan B.; Phillpot, Simon R.

    2013-12-01

    Building on previous charge-optimized many-body (COMB) potentials for metallic α-U and gaseous O2, we have developed a new potential for UO2, which also allows the simulation of U-UO2-O2 systems. The UO2 lattice parameter, elastic constants and formation energies of stoichiometric and non-stoichiometric intrinsic defects are well reproduced. Moreover, this is the first rigid-ion potential that produces the correct deviation of the Cauchy relation, as well as the first classical interatomic potential that is able to determine the defect energies of non-stoichiometric intrinsic point defects in UO2 with an appropriate reference state. The oxygen molecule interstitial in the α-U structure is shown to decompose, with some U-O bonds approaching the natural bond length of perfect UO2. Finally, we demonstrate the capability of this COMB potential to simulate a complex system by performing a simulation of the α-U + O2 → UO2 phase transformation. We also identify a possible mechanism for uranium oxidation and the orientation of the resulting fluorite UO2 structure relative to the coordinate system of orthorhombic α-U.

  2. Post-irradiation examination of prototype Al-64 wt% U{sub 3}Si{sub 2} fuel rods from NRU

    Energy Technology Data Exchange (ETDEWEB)

    Sears, D.F.; Primeau, M.F.; Buchanan, C.; Rose, D. [Chalk River Labs., Ontario (Canada)

    1997-08-01

    Three prototype fuel rods containing Al-64 wt% U{sub 3}Si{sub 2} (3.15 gU/cm{sup 3}) have been irradiated to their design burnup in the NRU reactor without incident. The fuel was fabricated using production-scale equipment and processes previously developed for Al-U{sub 3}Si fuel fabrication at Chalk River Laboratories, and special equipment developed for U{sub 3}Si{sub 2} powder production and handling. The rods were irradiated in NRU up to 87 at% U-235 burnup under typical driver fuel conditions; i.e., nominal coolant inlet temperature 37{degrees}C, inlet pressure 654 kPa, mass flow 12.4 L/s, and element linear power ratings up to 73 kW/m. Post-irradiation examinations showed that the fuel elements survived the irradiation without defects. Fuel core diametral increases and volumetric swelling were significantly lower than that of Al-61 wt% U{sub 3}Si fuel irradiated under similar conditions. This irradiation demonstrated that the fabrication techniques are adequate for full-scale fuel manufacture, and qualified the fuel for use in AECL`s research reactors.

  3. Characteristics of chemical binding to alpha 2u-globulin in vitro--evaluating structure-activity relationships

    International Nuclear Information System (INIS)

    Borghoff, S.J.; Miller, A.B.; Bowen, J.P.; Swenberg, J.A.

    1991-01-01

    alpha 2u-Globulin (alpha 2u) has been shown to accumulate in the kidneys of male rats treated with 2,2,4-trimethylpentane (TMP). 2,4,4-Trimethyl-2-pentanol (TMP-2-OH), a metabolite of TMP, is found reversibly bound to alpha 2u isolated from the kidneys of these treated rats. The objectives of the following study were to characterize the ability of [3H]TMP-2-OH to bind to alpha 2u in vitro and to determine whether other compounds that cause this protein to accumulate have the same binding characteristics. Although compounds that have been shown to cause the accumulation of alpha 2u in male rat kidneys compete in vitro with [3H]TMP-2-OH for binding to alpha 2u, they do so to varying degrees. The binding affinity (Kd) of the [3H]TMP-2-OH-alpha 2u complex was calculated to be on the order of 10(-7) M. The inhibition constant values (Ki) determined for d-limonene, 1,4-dichlorobenzene, and 2,5-dichlorophenol were all in the range 10(-4) M, whereas the Ki values for isophorone, 2,4,4- or 2,2,4-trimethyl-1-pentanol, and d-limonene oxide were determined to be in the range 10(-6) and 10(-7) M, respectively. TMP and 2,4,4- and 2,2,4-trimethylpentanoic acid did not compete for binding. This suggests that other factors, besides binding, are involved in the accumulation of alpha 2u. In this study the ability of a chemical to bind to alpha 2u was used as a measure of biological activity to assess structure-activity relationships among the chemicals tested and known to cause the accumulation of alpha 2u. The results so far suggest that binding is dependent on both hydrophobic interactions and hydrogen bonding

  4. Determination of the isotopic ratio 234 U/238 U and 235 U/238 U in uranium commercial reagents by alpha spectroscopy

    International Nuclear Information System (INIS)

    Iturbe G, J.L.

    1990-02-01

    In this work the determination of the isotope ratio 234 U/ 238 U and 235 U/ 238 U obtained by means of the alpha spectroscopy technique in uranium reagents of commercial marks is presented. The analyzed uranium reagents were: UO 2 (*) nuclear purity, UO 3 (*) poly-science, metallic uranium, uranyl nitrate and uranyl acetate Merck, uranyl acetate and uranyl nitrate Baker, uranyl nitrate (*) of the Refinement and Conversion Department of the ININ, uranyl acetate (*) Medi-Lab Sigma of Mexico and uranyl nitrate Em Science. The obtained results show that the reagents that are suitable with asterisk (*) are in radioactive balance among the one 234 U/ 238 U, since the obtained value went near to the unit. In the case of the isotope ratio 235 U/ 238 U the near value was also obtained the one that marks the literature that is to say 0.04347, what indicates that these reagents contain the isotope of 235 U in the percentage found in the nature of 0.71%. The other reagents are in radioactive imbalance among the 234 U/ 238 U, the found values fluctuated between 0.4187 and 0.1677, and for the quotient of activities 235 U/ 238 U its were of 0.0226, and the lowest of 0.01084. Also in these reagents it was at the 236 U as impurity. The isotope of 236 U is an isotope produced artificially, for what is supposed that the reagents that are in radioactive imbalance were synthesized starting from irradiated fuel. (Author)

  5. Relativistic U(3) symmetry and pseudo-U(3) symmetry of the Dirac Hamiltonian

    International Nuclear Information System (INIS)

    Ginocchio, Joseph N.

    2010-01-01

    The Dirac Hamiltonian with relativistic scalar and vector harmonic oscillator potentials has been solved analytically in two limits. One is the spin limit for which spin is an invariant symmetry of the the Dirac Hamiltonian and the other is the pseudo-spin limit for which pseudo-spin is an invariant symmetry of the Dirac Hamiltonian. The spin limit occurs when the scalar potential is equal to the vector potential plus a constant, and the pseudospin limit occurs when the scalar potential is equal in magnitude but opposite in sign to the vector potential plus a constant. Like the non-relativistic harmonic oscillator, each of these limits has a higher symmetry. For example, for the spherically symmetric oscillator, these limits have a U(3) and pseudo-U(3) symmetry respectively. We shall discuss the eigenfunctions and eigenvalues of these two limits and derive the relativistic generators for the U(3) and pseudo-U(3) symmetry. We also argue, that, if an anti-nucleon can be bound in a nucleus, the spectrum will have approximate spin and U(3) symmetry.

  6. Genomic organization of the rat alpha 2u-globulin gene cluster.

    Science.gov (United States)

    McFadyen, D A; Addison, W; Locke, J

    1999-05-01

    The alpha 2u-globulin are a group of similar proteins, belonging to the lipocalin superfamily of proteins, that are synthesized in a subset of secretory tissues in rats. The many alpha 2u-globulin isoforms are encoded by a multigene family that exhibits extensive homology. Despite a high degree of sequence identity, individual family members show diverse expression patterns involving complex hormonal, tissue-specific, and developmental regulation. Analysis suggests that there are approximately 20 alpha 2u-globulin genes in the rat genome. We have used fluorescence in situ hybridization (FISH) to show that the alpha 2u-globulin genes are clustered at a single site on rat Chromosome (Chr) 5 (5q22-24). Southern blots of rat genomic DNA separated by pulsed field gel electrophoresis indicated that the alpha 2u-globulin genes are contained on two NruI fragments with a total size of 880 kbp. Analysis of three P1 clones containing alpha 2u-globulin genes indicated that the alpha 2u-globulin genes are tandemly arranged in a head-to-tail fashion. The organization of the alpha 2u-globulin genes in the rat as a tandem array of single genes differs from the homologous major urinary protein genes in the mouse, which are organized as tandem arrays of divergently oriented gene pairs. The structure of these gene clusters may have consequences for the proposed function, as a pheromone transporter, for the protein products encoded by these genes.

  7. Compositional characterization of sintered (U,Th)O2 pellets by EDXRF using fused bead specimens

    International Nuclear Information System (INIS)

    Sanjay Kumar, S.; Dhara, Sangita; Misra, N.L.; Aggarwal, S.K.

    2015-01-01

    Fused bead specimens were used for analyzing sintered (U,Th)O 2 pellets by Energy Dispersive X-Ray Fluorescence (EDXRF) spectrometry. The bead specimens of calibration mixtures U 3 O 8 and ThO 2 were made by fusing them in Lithium Tetraborate/Metaborate fusion mixtures using a fusion bead machine. The EDXRF spectra of these beads were used for making calibration plot for U% determination in (U+Th) amounts. Using these calibration plots and EDXRF spectra of bead of sintered (U,Th)O 2 pellets, U% in these pellets was successfully determined. (author)

  8. Precise 238U(n,2n)237U reaction cross-section measurements using the activation facility at TUNL

    Science.gov (United States)

    Krishichayan, Fnu; Bhike, M.; Tornow, W.

    2014-09-01

    Accurate neutron-induced 238U(n,2n)237U reaction data are required for many practical applications, especially in the field of nuclear energy, including advanced heavy water reactors, where 238U is used as the breeding material to regenerate the fissile material 239Pu. Precise (n,2n) cross-section measurements of 238U are underway at TUNL with mono-energetic neutrons in the 8.0 to 14.0 MeV energy range in steps of 0.25 MeV using the activation technique. After activation of the 0.5 inch diameter and 442 mg 238U foil, the activity of the 208 keV characteristic γ-line is tracked for 6 weeks with a high efficient HPGe clover detector to determine the initial activity needed for the cross-section determination. Results of the cross-section measurements, determined relative to 27Al and 197Au neutron activation monitor foils, and the comparison with theoretical models will be presented during the meeting.

  9. Photochemistry of U(BH/sub 4/)/sub 4/ and U(BD/sub 4/)/sub 4/

    Energy Technology Data Exchange (ETDEWEB)

    Paine, R T; Schonberg, P R; Light, R W [New Mexico Univ., Albuquerque (USA). Dept. of Chemistry; Danen, W C; Freund, S M

    1979-01-01

    U(BH/sub 4/)/sub 4/ and U(BD/sub 4/)/sub 4/ are observed to undergo complex degradation reactions promoted by broadband UV radiation. The primary products of these reactions appear to be U(BH/sub 4/)/sub 3/, B/sub 2/H/sub 6/, H/sub 2/, U(BD/sub 4/)/sub 3/, B/sub 2/D/sub 6/ and D/sub 2/. Further, U(BD/sub 4/)/sub 4/ undergoes a related decomposition reaction under the influence of CO/sub 2/ laser irradiation at 924.97 cm/sup -1/.

  10. Split-Family SUSY, U(2)^5 Flavour Symmetry and Neutrino Physics

    CERN Document Server

    Jones-Pérez, Joel

    2014-01-01

    In split-family SUSY, one can use a U(2)^3 symmetry to protect flavour observables in the quark sector from SUSY contributions. However, attempts to extend this procedure to the lepton sector by using an analogous U(2)^5 symmetry fail to reproduce the neutrino data without introducing some form of fine-tuning. In this work, we solve this problem by shifting the U(2)^2 symmetry acting on leptons towards the second and third generations. This allows neutrino data to be reproduced without much difficulties, as well as protecting the leptonic flavour observables from SUSY. Key signatures are a $\\mu\\to e\\gamma$ branching ratio possibly observable in the near future, as well as having selectrons as the lightest sleptons.

  11. 7 CFR 51.1149 - U.S. No. 2 Russet.

    Science.gov (United States)

    2010-01-01

    ... tolerances see § 51.1151. (b) Internal quality: Lots meeting the internal requirements for “U.S. Grade AA... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 2 Russet. 51.1149 Section 51.1149 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...

  12. Uncertainty measurement evaluation of WDXRF and EDXRF techniques for the Si and U{sub total} determination in U{sub 3}Si{sub 2} used as nuclear fuel material

    Energy Technology Data Exchange (ETDEWEB)

    Scapin, Marcos A.; Salvador, Vera L.R.; Cotrim, Marycel E.B.; Pires, Maria Ap. F.; Sato, Ivone M., E-mail: mascapin@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP) Sao Paulo, SP (Brazil). Centro de Quimica e Meio Ambiente

    2009-07-01

    Uranium silicide (U{sub 3}Si{sub 2}), 20% {sup 235}U enriched powder, is an intermetallic compound used as nuclear fuel material; that is the state-of-the-art among nuclear fuel materials used in modern research reactors. It is produced by IPEN and used as nuclear fuel of the IEA-R1 reactor (IPEN/CNEN, Sao Paulo, Brazil); U{sub 3}Si{sub 2} has 92.3%wtU and 7.7%wtSi. The qualification of this material requires chemical and physical tests such as Si and U{sub total} content, isotope ratio, impurities, density, specific surface area and particle size determination. The Si and U{sub total} determination were made by gravimetric and volumetric procedures at the Environment Chemistry Center (CQMA-IPEN/CNEN). Usually, these classical methods require a long time for analyses and are expensive. The objective of this study was to establish a fast and efficient analytical method to meet ISO/IEC 17025:2005 requirements in the Si and U{sub total} determination. The X-ray fluorescence techniques (XRF) were chosen to allow a direct and non-destructive testing, what is a principal advantage faced to other instrumental techniques, since previous chemical treatments are not necessary. In this study, the performance of the wavelength dispersive (WDXRF) and energy dispersive (EDXRF) X- ray fluorescence techniques was evaluated. Furthermore, two different sample preparation procedures, plain powdered and pressed powdered were evaluated. Statistical tools were used to evaluate the results and a comparison between these results and the conventional methods was done. (author)

  13. Disagregation of (U, Pu)O2 fuels in molten sodium nitrate and oxides system

    International Nuclear Information System (INIS)

    Chou, T.S.

    1976-01-01

    An oxidation process based on the use of an alkali-nitrate melt has been considered as a possible head end step for the reprocessing of FBR spent fuels. The total alkali solubility in the nitrate melt was examined. It is influenced by the temperature. At 500 degC the alkali solubility in the sodium nitrate melt is about 17 mol %. Examining solidified mixture of sodium and nitrate or sodium oxides and nitrite by X-ray diffraction has revealed five unknown lattices. NaNO 3 .xNa 2 O 2 is cubic (a=8.71A), NaNO 2 .xNa 2 O 2 is tetragonal (a=5.939A, c=9.997A), NaNO 2 .xNa 2 O is cubic (a=10.586A). The structure of NaNO 3 .xNa 2 O and NaNO 3 .xNaO 2 could not be determined. The solubility of barium and ruthenium was briefly investigated. The reaction (U,Pu)O 2 with the alkaline sodium nitrate melt proceeds along the grain boundaries of the solid solution. Two steps have been recognized. First (U,Pu)O 2 is oxidized to (U,Pu)Osub(2+x) and in a subsequent step (U,Pu)Osub(2+x) reacts with sodium peroxide to form (U,Pu) 2 O 5 .xNa 2 O 2 . Disaggregation efficiency is a function of temperature, alkali concentration and physical properties of the pellets. High temperature and low alkali concentration lead to high efficiency. The structure of the reaction products (U,Pu)O 2 with alkaline NaNO 3 melt was shown to depend mainly on the alkali concentration. As the alkali concentration is lower than 2 mole % (U,Pu) 2 O 5 . Na 2 O 2 is the dominate phase. (U,Pu) 2 O 5 .3Na 2 O 2 corresponds to 6 mole % and over 11 mole % alkali, (U,Pu) 2 O 5 .xNa 2 O 2 becomes the main product. The solubility of the fuel (U,Pu) in the alkali sodium nitrate melt increases with the alkali concentration up to 6000-8000 ppm for uranium and 1200-1700 ppm for plutonium at 500 degC with only 5 mole % alkali. As a result of high losses of fissile material in the salt bath molten salt process must regarded as uneligible for a general head end step in fuel reprocessing. Nevertheless its application can still be

  14. CERCA's 25 years experience in U3Si2 fuel manufacturing

    International Nuclear Information System (INIS)

    Durand, JP.; Duban, B.; Lavastre, Y.; Perthuis, S. de

    2003-01-01

    This paper documents the experience gained at CERCA in manufacturing, testing, and inspecting U 3 Si 2 fuel elements for various Material Test Reactors (MTR) since the beginning of the RERTR Program in 1978, up to now. It emphasises how the company controls the product to insure compliance with the fuel-related safety parameters. Finally, those statements are considered in the UMo fuel production perspective. (author)

  15. İki uçlu bozukluk 1 ve iki uçlu bozukluk 2 depresyon tedavisi arasındaki farklar

    OpenAIRE

    Sayar, Kemal

    2013-01-01

    İki uçlu bozukluk 1 ve 2 depresyonları, klinik açıdan farklılıklar gösterebilmektedir. İki uçlu bozukluk 2 ve iki uçlu bozukluk 1 depresyonların tedavisi arasındaki farklar ise tartışmalı bir alandır. Henüz İki uçlu bozukluk 2 depresyon tedavisi konusunda yeterince kanıt birikmemişse de ilk veriler her iki durumun tedavisinde farklar olması gerektiğini düşündürmektedir. Özellikle antidepresan kullanımı konusunda dikkatli olmak gerekmektedir.

  16. Anti-U-like as an alloantibody in S-s-U- and S-s-U+(var) black people.

    Science.gov (United States)

    Peyrard, Thierry; Lam, Yin; Saison, Carole; Arnaud, Lionel; Babinet, Jérôme; Rouger, Philippe; Bierling, Philippe; Janvier, Daniel

    2012-03-01

    S, s, and U antigens belong to the MNS system. They are carried by glycophorin B (GPB), encoded by GYPB. Black people with the low-prevalence S-s- phenotype, either U- or U+(var), can make a clinically significant anti-U. Anti-U-like, a cold immunoglobulin G autoantibody quite commonly observed in S-s+U+ black persons, was previously described to be nonreactive with ficin-, α-chymotrypsin-, and pronase-treated red blood cells (RBCs); nonreactive or weakly reactive with papain-treated RBCs; and reactive with trypsin-treated RBCs. Here we describe, in S-s- people from different molecular backgrounds, an alloantibody to a high-prevalence GPB antigen, which presents the same pattern of reactivity with proteases as autoanti-U-like. Four S-s- patients with an alloantibody to a high-prevalence GPB antigen were investigated by serologic and molecular methods. An alloantibody was observed in two S-s-U-/Del GYPB, one S-s-U+(var)/GYPB(P2), and one S-s-U+(var)/GYPB(NY) patients. As this alloantibody showed the same pattern of reactivity with proteases as autoanti-U-like, we decided to name it "anti-U-like." Anti-U-like made by the two S-s-U- patients was reactive with the S-s-U+(var) RBCs of the two other patients. S-s-U-/Del GYPB, S-s-U+(var)/GYPB(P2), and S-s-U+(var)/GYPB(NY) patients can make an alloanti-U-like. Anti-U-like made by S-s-U- people appears reactive with GYPB(P2) and GYPB(NY) RBCs, which both express a weak and partial U-like reactivity. We recommend transfusing S-s-U- RBCs in S-s-U- patients showing alloanti-U-like. Our study contributes to a better understanding of alloimmunization to GPB in black people and confirms importance of genotyping in S-s- patients, especially those with sickle cell disease to be frequently transfused. © 2011 American Association of Blood Banks.

  17. On some factors affecting the nonstoichiometry in U 3O 8

    Science.gov (United States)

    Fujino, Takeo; Tagawa, Hiroaki; Adachi, Takeo

    1981-03-01

    The nonstoichiometry of U 3O 8 was studied under various conditions. The {O}/{U} atom ratios obtained by the oxidation of uranium metal in air followed by cooling with moderate rates (method 1) are 2.67 ± 0.01 in the temperature range 700 900°C and 2.662 ± 0.005 at 1000°C and are generally larger than the ratio by thermogravimetry. If the oxidation was carried out in a crucible with a lid, a compositional peak was observed at 900 950°C, which did not appear for the U 3O 8 samples from UO 2. The U 3O 8 made from UO 2 by method 1 have {O}/{U} ratios 2.655 ± 0.005 (700° C), 2.653 ± 0.004 (800° C), 2.648 ± 0.004 (900° C) and 2.645 ± 0.003 (1000° C). Differences were observed in the O/U ratios of heating and cooling series. X-ray diffraction analysis showed several additional peaks other than those of α-U 3O 8 for the samples which exhibited the compositional peak.

  18. 11 CFR 100.11 - State (2 U.S.C. 431(12)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false State (2 U.S.C. 431(12)). 100.11 Section 100.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) General Definitions § 100.11 State (2 U.S.C. 431(12)). State means each State of the United States, the District of...

  19. Application of bias correction methods to improve U{sub 3}Si{sub 2} sample preparation for quantitative analysis by WDXRF

    Energy Technology Data Exchange (ETDEWEB)

    Scapin, Marcos A.; Guilhen, Sabine N.; Azevedo, Luciana C. de; Cotrim, Marycel E.B.; Pires, Maria Ap. F., E-mail: mascapin@ipen.br, E-mail: snguilhen@ipen.br, E-mail: lvsantana@ipen.br, E-mail: mecotrim@ipen.br, E-mail: mapires@ipen.br [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil)

    2017-07-01

    The determination of silicon (Si), total uranium (U) and impurities in uranium-silicide (U{sub 3}Si{sub 2}) samples by wavelength dispersion X-ray fluorescence technique (WDXRF) has been already validated and is currently implemented at IPEN's X-Ray Fluorescence Laboratory (IPEN-CNEN/SP) in São Paulo, Brazil. Sample preparation requires the use of approximately 3 g of H{sub 3}BO{sub 3} as sample holder and 1.8 g of U{sub 3}Si{sub 2}. However, because boron is a neutron absorber, this procedure precludes U{sub 3}Si{sub 2} sample's recovery, which, in time, considering routinely analysis, may account for significant unusable uranium waste. An estimated average of 15 samples per month are expected to be analyzed by WDXRF, resulting in approx. 320 g of U{sub 3}Si{sub 2} that would not return to the nuclear fuel cycle. This not only impacts in production losses, but generates another problem: radioactive waste management. The purpose of this paper is to present the mathematical models that may be applied for the correction of systematic errors when H{sub 3}BO{sub 3} sample holder is substituted by cellulose-acetate {[C_6H_7O_2(OH)_3_-_m(OOCCH_3)m], m = 0∼3}, thus enabling U{sub 3}Si{sub 2} sample’s recovery. The results demonstrate that the adopted mathematical model is statistically satisfactory, allowing the optimization of the procedure. (author)

  20. Analysis of hydrogen, carbon, sulfur and volatile compounds in (U3Si2 - Al) nuclear fuel

    International Nuclear Information System (INIS)

    Moura, Sergio C.; Redigolo, Marcelo M.; Amaral, Priscila O.; Leao, Claudio; Oliveira, Glaucia A.C. de; Bustillos, Oscar V.

    2015-01-01

    Uranium silicide U 3 Si 2 is used as nuclear fuel in the research nuclear reactor IEA-R1 at IPEN/CNEN, Sao Paulo, Brazil. The U 3 Si 2 is dispersed in aluminum reaching high densities of uranium in the nucleus of the fuel, up to 4.8 gU cm -3 . This nuclear fuel must comply with a quality control, which includes analysis of hydrogen, carbon and sulfur for the U 3 Si 2 and volatile compound for the aluminum. Hydrogen, carbon and sulfur are analyzed by the method of Radio Frequency gas extraction combustion coupled with Infrared detector. Volatile compounds are analyzed by the method of heated gas extraction coupled with gravimetric measurement. These methods are recommended by the American Society for Testing Materials (ASTM) for nuclear materials. The average carbon and sulfur measurements are 30 μg g -1 and 3 μg g -1 , respectively, and 40 μg g -1 for volatile compounds. The hydrogen analyzer is a TCHEN 600 LECO, carbon and sulfur analyzer is a CS 244 LECO and the volatile compounds analyzer is a home-made apparatus that use a resistant furnace, a gas pipe measurement and a glove-box with controlled atmosphere where an analytical balance has been installed, this analyzer was made at IPEN laboratory. (author)

  1. Preparation of U-Si/U-Me (Me = Fe, Ni, Mn) aluminum-dispersion plate-type fuel (miniplates) for capsule irradiation

    International Nuclear Information System (INIS)

    Ugajin, Mitsuhiro; Itoh, Akinori; Akabori, Mitsuo

    1993-06-01

    Details of equipment installed, method adopted and final products were described on the preparation of uranium silicides and other fuels for capsule irradiation. Main emphasis was placed on the preparation of laboratory-scale aluminum-dispersion plate-type fuel (miniplates) loaded to the first and second JMTR silicide capsules. Fuels contained in the capsules are as follows: (A) uranium-silicide base alloys U 3 Si 2 , Mo- added U 3 Si 2 , U 3 Si 2 +U 3 Si, U 3 Si 2 +USi, U 3 Si, U 3 (Si 0.8 Ge 0.2 ), U 3 (Si 0.6 Ge 0.4 ) (B) U 6 Me-type alloys with higher uranium density U 6 Mn, U 6 Ni, U 6 (Fe 0.4 Ni 0.6 ), U 6 (Fe 0.6 Mn 0.4 ) The powder-metallurgical picture-frame method was adopted and laboratory-scale technique was established for the preparation of miniplates. As a result of inspection for capsule irradiation, miniplates were prepared to meet the requirements of specification. (author)

  2. Hyperpolarized [U-(2) H, U-(13) C]Glucose reports on glycolytic and pentose phosphate pathway activity in EL4 tumors and glycolytic activity in yeast cells.

    Science.gov (United States)

    Timm, Kerstin N; Hartl, Johannes; Keller, Markus A; Hu, De-En; Kettunen, Mikko I; Rodrigues, Tiago B; Ralser, Markus; Brindle, Kevin M

    2015-12-01

    A resonance at ∼181 ppm in the (13) C spectra of tumors injected with hyperpolarized [U-(2) H, U-(13) C]glucose was assigned to 6-phosphogluconate (6PG), as in previous studies in yeast, whereas in breast cancer cells in vitro this resonance was assigned to 3-phosphoglycerate (3PG). These peak assignments were investigated here using measurements of 6PG and 3PG (13) C-labeling using liquid chromatography tandem mass spectrometry (LC-MS/MS) METHODS: Tumor-bearing mice were injected with (13) C6 glucose and the (13) C-labeled and total 6PG and 3PG concentrations measured. (13) C MR spectra of glucose-6-phosphate dehydrogenase deficient (zwf1Δ) and wild-type yeast were acquired following addition of hyperpolarized [U-(2) H, U-(13) C]glucose and again (13) C-labeled and total 6PG and 3PG were measured by LC-MS/MS RESULTS: Tumor (13) C-6PG was more abundant than (13) C-2PG/3PG and the resonance at ∼181 ppm matched more closely that of 6PG. (13) C MR spectra of wild-type and zwf1Δ yeast cells showed a resonance at ∼181 ppm after labeling with hyperpolarized [U-(2) H, U-(13) C]glucose, however, there was no 6PG in zwf1Δ cells. In the wild-type cells 3PG was approximately four-fold more abundant than 6PG CONCLUSION: The resonance at ∼181 ppm in (13) C MR spectra following injection of hyperpolarized [U-(2) H, U-(13) C]glucose originates predominantly from 6PG in EL4 tumors and 3PG in yeast cells. © 2014 Wiley Periodicals, Inc.

  3. Methyl isobutyl ketone exposure-related increases in specific measures of α2u-globulin (α2u) nephropathy in male rats along with in vitro evidence of reversible protein binding

    International Nuclear Information System (INIS)

    Borghoff, S.J.; Poet, T.S.; Green, S.; Davis, J.; Hughes, B.; Mensing, T.; Sarang, S.S.; Lynch, A.M.; Hard, G.C.

    2015-01-01

    Chronic exposure to methyl isobutyl ketone (MIBK) resulted in an increase in the incidence of renal tubule adenomas and occurrence of renal tubule carcinomas in male, but not female Fischer 344 rats. Since a number of chemicals have been shown to cause male rat renal tumors through the α2u nephropathy-mediated mode of action, the objective of this study is to evaluate the ability of MIBK to induce measures of α2u nephropathy including renal cell proliferation in male and female F344 rats following exposure to the same inhalation concentrations used in the National Toxicology Program (NTP) cancer bioassay (0, 450, 900, or 1800 ppm). Rats were exposed 6 h/day for 1 or 4 weeks and kidneys excised approximately 18 h post exposure to evaluate hyaline droplet accumulation (HDA), α2u staining of hyaline droplets, renal cell proliferation, and to quantitate renal α2u concentration. There was an exposure-related increase in all measures of α2u nephropathy in male, but not female rat kidneys. The hyaline droplets present in male rat kidney stained positively for α2u. The changes in HDA and α2u concentration were comparable to D-limonene, an acknowledged inducer of α2u nephropathy. In a separate in vitro study using a two-compartment vial equilibration model to assess the interaction between MIBK and α2u, the dissociation constant (K d ) was estimated to be 1.27 × 10 −5 M. This K d is within the range of other chemicals known to bind to α2u and cause nephropathy. Together, the exposure-related increase in measures of α2u nephropathy, sustained increase in renal cell proliferation along with an indication of reversible binding of MIBK to α2u, support the inclusion of MIBK in the category of chemicals exerting renal effects through a protein droplet α2u nephropathy-mediated mode of action (MoA)

  4. Preparation of High-Density Uranium-Silicide U3Sl2-Uss: Effects of Preirradiation Heat Treatment on As-Cast Ingot Fuel Plates

    International Nuclear Information System (INIS)

    Suripto, A; Yuwono

    1998-01-01

    Heat treatment experiments upon U 3 Si 2 - U ss ingot have been cam e d out to obtain free uranium particle size improvement which is required to enhance the U-Al inter-diffusion reaction in the fuel plate meat. . Heat treatment experiments upon fuel plates containing dispersion of U 3 Si 2 - U ss in Al matrix have also been carried out to study the effect of temperature and treatment duration on the extent of inter-diffusion reaction between free uranium particle and aluminium matrix in the fuel plate meat. Both the experiments indicate that a drastic size improvement has occurred with the U 3 Si 2 as well as free uranium particles upon heat treatment at controlled temperature between the U 3 Si 2 peritectic and peritectoid temperatures and that the inter-diffusion reaction between free uranium and Al matrix occurs quite significantly at temperatures higher than that ordinarily used in the fabrication procedure

  5. Determination of carbon content of UO2, (U, Gd)O2 and (U, Pu)O2 powders and sintered pellets - Combustion in a high-frequency induction furnace -Infrared absorption spectrometry

    International Nuclear Information System (INIS)

    2008-01-01

    This International Standard describes a method for determining the carbon content in UO 2 , (U,Gd)O 2 and (U,Pu)O 2 powder and sintered pellets by combustion in an induction furnace and infrared absorption spectroscopy measurement. It is applicable for determining 10 μg/g to 500 μg/g of carbon in UO 2 , (U,Gd)O 2 and (U,Pu)O 2 powder and pellets. The sample is heated to a temperature above 1500 deg. C in an induction furnace, under pure oxygen atmosphere, to convert any carbon compounds to carbon dioxide gas. The resulting carbon dioxide gas is filtered and dried before measurement using infrared spectroscopy to measure the carbon dioxide signal at 2350 cm -1 . The result is converted into the carbon content of the material analysed

  6. 235U NMR study of the itinerant antiferromagnet USb2

    International Nuclear Information System (INIS)

    Kato, Harukazu; Sakai, Hironori; Ikushima, Kenji; Kambe, Shinsaku; Tokunaga, Yo; Aoki, Dai; Haga, Yoshinori; O-bar nuki, Yoshichika; Yasuoka, Hiroshi; Walstedt, Russell E.

    2005-01-01

    We have succeeded in resolving a 235 U antiferromagnetic nuclear magnetic resonance (AFNMR) signal using 235 U-enriched samples of USb 2 . The uranium hyperfine field and coupling constant estimated for this compound are consistent with those from other experiments. This is the first reported observation of 235 U NMR in conducting host material

  7. Application of multivariate calibration for simultaneous determination of major and minor constituents in U3Si2 by X-ray fluorescence

    International Nuclear Information System (INIS)

    Scapin, Marcos A.; Silva, Clayton P.; Cotrim, Marycel E.B.; Pires, Maria Aparecida F.

    2013-01-01

    The aim of this work is to establish and validate a methodology for a nondestructive quantitative chemical analysis method for simultaneous determination of the major constituents (U total and Si) and impurities (B, Mg, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn, Mo, Cd,etc.) present in U 3 Si 2 . The method must also meet the needs of nuclear reactors for the nuclear fuel qualification type,MTR, with low cost and analysis time, while also minimizing waste generation. For this purpose, an X-ray fluorescence technique will be applied. The technique is nondestructive,aside from sample preparation procedures that do not require previous chemical treatments (dissolving, digesting), and allows for fast chemical analysis. The fundamental parameters (FP) method was applied to corrections for spectral and matrix effects. The calibration model was obtained via principal component analysis using orthogonal decomposition by the singular value decomposition method (SVD) in U 3 O 8 and U 3 Si 2 samples. The results were compared by means of statistical tests in accordance with ISO 17025 on CRMs of U 3 O 8 from New Brunswick Laboratory (NBL) and 16 U 3 Si 2 samples provided by CCN of IPEN/CNEN-SP. Multivariate calibration is a promising method for determination of major and minor constituents inU 3 Si 2 and U 3 O 8 nuclear fuel, because the precision and accuracy are statistically equivalent to volumetric analysis (U total determination), gravimetric analysis (Si determination), and ICP-OES methods (impurities determination). (author)

  8. Determination of the isotopic ratio {sup 234} U/{sup 238} U and {sup 235} U/{sup 238} U in uranium commercial reagents by alpha spectroscopy; Determinacion de la relacion isotopica {sup 234} U/{sup 238} U y {sup 235} U/{sup 238} U en reactivos comerciales de uranio por espectrometria alfa

    Energy Technology Data Exchange (ETDEWEB)

    Iturbe G, J L

    1990-02-15

    In this work the determination of the isotope ratio {sup 234} U/{sup 238} U and {sup 235} U/{sup 238} U obtained by means of the alpha spectroscopy technique in uranium reagents of commercial marks is presented. The analyzed uranium reagents were: UO{sub 2} (*) nuclear purity, UO{sub 3} (*) poly-science, metallic uranium, uranyl nitrate and uranyl acetate Merck, uranyl acetate and uranyl nitrate Baker, uranyl nitrate (*) of the Refinement and Conversion Department of the ININ, uranyl acetate (*) Medi-Lab Sigma of Mexico and uranyl nitrate Em Science. The obtained results show that the reagents that are suitable with asterisk (*) are in radioactive balance among the one {sup 234} U/{sup 238} U, since the obtained value went near to the unit. In the case of the isotope ratio {sup 235} U/{sup 238} U the near value was also obtained the one that marks the literature that is to say 0.04347, what indicates that these reagents contain the isotope of {sup 235} U in the percentage found in the nature of 0.71%. The other reagents are in radioactive imbalance among the {sup 234} U/{sup 238} U, the found values fluctuated between 0.4187 and 0.1677, and for the quotient of activities {sup 235} U/{sup 238} U its were of 0.0226, and the lowest of 0.01084. Also in these reagents it was at the {sup 236} U as impurity. The isotope of {sup 236} U is an isotope produced artificially, for what is supposed that the reagents that are in radioactive imbalance were synthesized starting from irradiated fuel. (Author)

  9. Accurate 238U(n , 2 n )237U reaction cross-section measurements from 6.5 to 14.8 MeV

    Science.gov (United States)

    Krishichayan, Bhike, M.; Tornow, W.; Tonchev, A. P.; Kawano, T.

    2017-10-01

    The cross section for the 238U(n ,2 n )237U reaction has been measured in the incident neutron energy range from 6.5 to 14.8 MeV in small energy steps using an activation technique. Monoenergetic neutron beams were produced via the 2H(d ,n )3He and 3H(d ,n )4He reactions. 238U targets were activated along with Au and Al monitor foils to determine the incident neutron flux. The activity of the reaction products was measured in TUNL's low-background counting facility using high-resolution γ -ray spectroscopy. The results are compared with previous measurements and latest data evaluations. Statistical-model calculations, based on the Hauser-Feshbach formalism, have been carried out using the CoH3 code and are compared with the experimental results. The present self-consistent and high-quality data are important for stockpile stewardship and nuclear forensic purposes as well as for the design and operation of fast reactors.

  10. A gravimetric and an X-ray fluorescence method for the determination of rubidium in Rb2U(SO4)3

    International Nuclear Information System (INIS)

    Mudher, K.D.S.; Krishnan, K.; Jayadevan, N.C.

    1993-01-01

    Chemical characterization of rubidium uranium(IV) trisulfate, RB 2 U(SO 4 ) 3 , a new chemical assay standard for uranium requires accurate analysis of rubidium. A gravimetric and an X-ray fluorescence method (XRF) for the determination of rubidium in this compound are described. In the gravimetric method, rubidium is determined as Rb 2 Na[Co(NO 2 ) 6 ].H 2 O without separating uranium with a precision of the order of ±0.5%. In the XRF method, the concentration ratio of rubidium to uranium, C Rb /C U , is determined in the solid samples by the binary ratio method using calibration between intensity ratios (I Rb /I U ) and concentration ratios (C Rb /C U ). (author) 6 refs.; 2 figs.; 3 tabs

  11. Crystal structures of Th(OH)PO4, U(OH)PO4 and Th2O(PO4)2. Condensation mechanism of M(IV)(OH)PO4 (M= Th, U) into M2O(PO4)2

    International Nuclear Information System (INIS)

    Dacheux, N.; Clavier, N.; Wallez, G.; Quarton, M.

    2007-01-01

    Three new crystal structures, isotypic with β-Zr 2 O(PO 4 ) 2 , have been resolved by the Rietveld method. All crystallize with an orthorhombic cell (S.G.: Cmca) with a = 7.1393(2) Angstroms, b = 9.2641(2) Angstroms, c 12.5262(4) Angstroms, V = 828.46(4) (Angstroms) 3 and Z = 8 for Th(OH)PO 4 ; a = 7.0100(2) Angstroms, b = 9.1200(2) Angstroms, c = 12.3665(3) Angstroms, V 790.60(4) (Angstroms) 3 and Z = 8 for U(OH)PO 4 ; a 7.1691(3) Angstroms, b 9.2388(4) Angstroms, c = 12.8204(7) Angstroms, V 849.15(7) (Angstroms) 3 and Z = 4 for Th 2 O(PO 4 ) 2 . By heating, the M(OH)PO 4 (M Th, U) compounds condense topotactically into M 2 O(PO 4 ) 2 , with a change of the environment of the tetravalent cation that lowers from 8 to 7 oxygen atoms. The lower stability of Th 2 O(PO 4 ) 2 compared to that of U 2 O(PO 4 ) 2 seems to result from this unusual environment for tetravalent thorium. (authors)

  12. High-field magnetization studies of U2T2Sn (T=Co, Ir, Pt) compounds

    International Nuclear Information System (INIS)

    Prokes, K.; Nakotte, H.; de Boer, F.R.

    1995-01-01

    High-field magnetization measurements at 4.2 K on U 2 T 2 Sn (T = Co, Ir and Pt) compounds have been performed on free and fixed powders up to 57 T. An antiferromagnetic ground state of U 2 Pt 2 Sn is corroborated by a metamagnetic transition at 22 T with very small hysteresis going up and down with field. U 2 Co 2 Sn and U 2 Ir 2 Sn show no metamagnetic transition up to 57 T which is in agreement with the non-magnetic ground state of these compounds. In all cases, the maximum applied field is not sufficient to achieve saturation. The short-pulse measurements presented here are compared with previous results obtained in quasi-static fields up to 35 T

  13. Ribonucleoprotein organization of eukaryotic RNA. XXXII. U2 small nuclear RNA precursors and their accurate 3' processing in vitro as ribonucleoprotein particles.

    Science.gov (United States)

    Wieben, E D; Nenninger, J M; Pederson, T

    1985-05-05

    Biosynthetic precursors of U2 small nuclear RNA have been identified in cultured human cells by hybrid-selection of pulse-labeled RNA with cloned U2 DNA. These precursor molecules are one to approximately 16 nucleotides longer than mature U2 RNA and contain 2,2,7-trimethylguanosine "caps". The U2 RNA precursors are associated with proteins that react with a monoclonal antibody for antigens characteristic of small nuclear ribonucleoprotein particles. Like previously described precursors of U1 and U4 small nuclear RNAs, the pre-U2 RNAs are recovered in cytoplasmic fractions, although it is not known if this is their location in vivo. The precursors are processed to mature-size U2 RNA when cytoplasmic extracts are incubated in vitro at 37 degrees C. Mg2+ is required but ATP is not. The ribonucleoprotein structure of the pre-U2 RNA is maintained during the processing reaction in vitro, as are the 2,2,7-trimethylguanosine caps. The ribonucleoprotein organization is of major importance, as exogenous, protein-free U2 RNA precursors are degraded rapidly in the in vitro system. Two lines of evidence indicate that the conversion of U2 precursors to mature-size U2 RNA involves a 3' processing reaction. First, the reaction is unaffected by a large excess of mature U2 small nuclear RNP, whose 5' trimethylguanosine caps would be expected to compete for a 5' processing activity. Second, when pre-U2 RNA precursors are first stoichiometrically decorated with an antibody specific for 2,2,7-trimethylguanosine, the extent of subsequent processing in vitro is unaffected. These results provide the first demonstration of a eukaryotic RNA processing reaction in vitro occurring within a ribonucleoprotein particle.

  14. Simulation of accident-tolerant U{sub 3}Si{sub 2} fuel using FRAPCON code

    Energy Technology Data Exchange (ETDEWEB)

    Gomes, Daniel S.; Silva, Antonio T.; Abe, Alfredo Y.; Muniz, Rafael O.R., E-mail: dsgomes@ipen.br, E-mail: teixeira@ipen.br, E-mail: alfredo@ctmsp.mar.mil.br, E-mail: rafael.orm@gmail.com [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil); Giovedi, Claudia, E-mail: claudia.giovedi@ctmsp.mar.mil.br [Universidade de São Paulo (USP), São Paulo, SP (Brazil). Departamento de Engenharia Naval e Oceânica

    2017-07-01

    The research on accident-tolerant fuels (ATFs) increased after the Fukushima event. This benefited risk management in nuclear operations. In this investigation, the physical properties of the materials being developed for the ATF program were compared with those of the standard UO{sub 2} - Zr fuel system. The research efforts in innovative fuel design include rigorous characterization of thermal, mechanical, and chemical assessment, with the objectives of making the burnup cycle longer, increasing power density, and improving safety performance. Fuels must reach a high uranium density - above that supported by UO{sub 2} - and possess coating that exhibits better oxidation resistance than Zircaloy. The uranium density and thermal conductivity of ATFs, such as U{sub 3}Si{sub 2}, UN, and UC, is higher than that of UO{sub 2}; their combination with advanced cladding provides possible fuel - cladding options. An ideal combination of fuel and cladding must increase fuel performance in loss-of-coolant scenarios. The disadvantages of U{sub 3}Si{sub 2}, UN, and UC are their swelling rates, which are higher than that of UO{sub 2}. The thermal conductivities of ATFs are approximately four times higher than that of UO2. To prevent the generation of hydrogen due to oxidation of zirconium-based alloys in contact with steam, cladding options, such as ferritic alloys, were studied. It was verified that FeCrAl alloys and SiC provide better response under severe conditions because of their thermophysical properties. The findings of this study indicate that U{sub 3}Si{sub 2} and the FeCrAl fuel cladding concept should replace UO{sub 2} - Zr as the fuel system of choice. (author)

  15. Thermodinamic study the uranium-oxygen system within the composition range 2,61 < O/U < 2,67

    International Nuclear Information System (INIS)

    Caneiro, Alberto.

    1983-01-01

    Oxygen partial pressures (Psub(O2)) as a function of composition and temperature were studied in order to determine the thermodynamic properties of the Uranium-Oxygen (U-O) system. To measure and control Psub(O2), an electrochemical system was used, consisting of an oxygen electrochemical pump and a zirconia gauge which allowed a very accurate determination of the CO + 1/2O 2 = CO 2 reaction. In order to determine oxygen composition, a symmetrical thermogravimetric system a Cahn 1000 electrobalance was constructed and coupled to the system for controlling and measuring Psub(O2) so as to constitute an experimental set-up, which is unique in its type at the present. This facility allowed to determine the thermodynamic properties of the (U-O) system within the composition-temperature range 2,61 3 O 8 ) and of a non-stoichiometric phase (U 8 Osub(21+x)), both being separated by a narrow region of coexistence. Analytical expressions were established for the oxygen chemical potential as a function of composition and temperature, for the stable equilibrium states of the U 8 Osub(21+x) phase and for the metastable ones obtained by oxidation of U 8 Osub(21+x). (M.E.L.) [es

  16. Self-dual continuous series of representations for U{sub q}(sl(2)) and U{sub q}(osp(1 vertical stroke 2))

    Energy Technology Data Exchange (ETDEWEB)

    Hadasz, Leszek [Krakow Univ. (Poland). Inst. of Physics; Pawelkiewicz, Michal; Schomerus, Volker [DESY Hamburg (Germany). Theory Group

    2013-05-15

    We determine the Clebsch-Gordan and Racah-Wigner coefficients for continuous series of representations of the quantum deformed algebras U{sub q}(sl(2)) and U{sub q}(osp(1 vertical stroke 2)). While our results for the former algebra reproduce formulas by Ponsot and Teschner, the expressions for the orthosymplectic algebra are new. Up to some normalization factors, the associated Racah-Wigner coefficients are shown to agree with the fusing matrix in the Neveu-Schwarz sector of N=1 supersymmetric Liouville field theory.

  17. Structural instability and ground state of the U_2Mo compound

    International Nuclear Information System (INIS)

    Losada, E.L.; Garcés, J.E.

    2015-01-01

    This work reports on the structural instability at T = 0 °K of the U_2Mo compound in the C11_b structure under the distortion related to the C_6_6 elastic constant. The electronic properties of U_2Mo such as density of states (DOS), bands and Fermi surface (FS) are studied to understand the source of the instability. The C11_b structure can be interpreted as formed by parallel linear chains along the z-directions each one composed of successive U–Mo–U blocks. Hybridization due to electronic interactions inside the U–Mo–U blocks is slightly modified under the D_6 distortion. The change in distance between chains modifies the U–U interaction and produces a split of f-states. The distorted structure is stabilized by a decrease in energy of the hybridized states, mainly between d-Mo and f-U states, together with the f-band split. Consequently, an induced Peierls distortion is produced in U_2Mo due to the D_6 distortion. It is important to note that the results of this work indicate that the structure of the ground state of the U_2Mo compound is not the assumed C11_b structure. It is suggested for the ground state a structure with hexagonal symmetry (P6 #168), ∼0.1 mRy below the energy of the recently proposed Pmmn structure. - Highlights: • Structural instability of the C11b compound due to the D6 deformation. • Induced Peierls distortion due to the D6 deformation. • Distorted structure is stabilized by hybridization and split of f-Uranium state. • P6 (#168) suggested ground state for the U_2Mo compound.

  18. PPADS and suramin as antagonists at cloned P2Y- and P2U-purinoceptors.

    Science.gov (United States)

    Charlton, S J; Brown, C A; Weisman, G A; Turner, J T; Erb, L; Boarder, M R

    1996-06-01

    1. The effect of suramin and pyridoxalphosphate-6-azophenyl-2',4'-disulphonic acid (PPADS) on the stimulation of phospholipase C in 1321N1 cells transfected with the human P2U-purinoceptor (h-P2U-1321N1 cells) or with the turkey P2Y-purinoceptor (t-P2Y-1321N1 cells) was investigated. 2-Methylthioadenosine triphosphate (2MeSATP) was used as the agonist at t-P2Y-1321N1 cells and uridine triphosphate (UTP) at h-P2U-1321N1 cells. 2. Suramin caused a parallel shift to the right of the concentration-response curves for 2MeSATP in the t-P2Y-1321N1 cells, yielding a Schild plot with a slope of 1.16 +/- 0.08 and a pA2 value of 5.77 +/- 0.11. 3. Suramin also caused a shift to the right of concentration-response curves for UTP in the h-P2U-1321N1 cells, and on Schild plots gave a slope different from unity (1.57 +/- 0.19) and an apparent pA2 value of 4.32 +/- 0.13. Suramin was therefore a less potent antagonist at the P2U-purinoceptor than the P2Y-purinoceptor. 4. In the presence of the ectonucleotidase inhibitor, ARL 67156 (6-N,N-diethyl-beta,gamma-dibromomethylene-D-ATP) there was no significant difference in the EC50 or shapes of curves with either cell type, and no difference in pA2 values for suramin. 5. PPADS caused an increase in the EC50 for 2MeSATP in the t-P2Y-1321N1 cells. The Schild plot had a slope different from unity (0.55 +/- 0.15) and an X-intercept corresponding to an apparent pA2 of 5.98 +/- 0.65. 6. PPADS up to 30 microM had no effect on the concentration-response curve for UTP with the h-P2U-1321N1 cells. 7. In conclusion, suramin and PPADS show clear differences in their action at the 2 receptor types, in each case being substantially more effective as an antagonist at the P2Y-purinoceptor than at the P2U-purinoceptor. Ectonucleotidase breakdown had little influence on the nature of the responses at the two receptor types, or in their differential sensitivity to suramin.

  19. Measurement of 233U/234U ratios in contaminated groundwater using alpha spectrometry

    International Nuclear Information System (INIS)

    Harrison, Jennifer J.; Payne, Timothy E.; Wilsher, Kerry L.; Thiruvoth, Sangeeth; Child, David P.; Johansen, Mathew P.; Hotchkis, Michael A.C.

    2016-01-01

    The uranium isotope 233 U is not usually observed in alpha spectra from environmental samples due to its low natural and fallout abundance. It may be present in samples from sites in the vicinity of nuclear operations such as reactors or fuel reprocessing facilities, radioactive waste disposal sites or sites affected by clandestine nuclear operations. On an alpha spectrum, the two most abundant alpha emissions of 233 U (4.784 MeV, 13.2%; and 4.824 MeV, 84.3%) will overlap with the 234 U doublet peak (4.722 MeV, 28.4%; and 4.775 MeV, 71.4%), if present, resulting in a combined 233+234 U multiplet. A technique for quantifying both 233 U and 234 U from alpha spectra was investigated. A series of groundwater samples were measured both by accelerator mass spectrometry (AMS) to determine 233 U/ 234 U atom and activity ratios and by alpha spectrometry in order to establish a reliable 233 U estimation technique using alpha spectra. The Genie™ 2000 Alpha Analysis and Interactive Peak Fitting (IPF) software packages were used and it was found that IPF with identification of three peaks ( 234 U minor, combined 234 U major and 233 U minor, and 233 U major) followed by interference correction on the combined peak and a weighted average activity calculation gave satisfactory agreement with the AMS data across the 233 U/ 234 U activity ratio range (0.1–20) and 233 U activity range (2–300 mBq) investigated. Correlation between the AMS 233 U and alpha spectrometry 233 U was r 2  = 0.996 (n = 10). - Highlights: • Describes a technique for deconvoluting the combined 233 U and 234 U multiplet in alpha spectra. • Enables 233 U and 234 U activities and 233 U/ 234 U ratios to be quantified without requiring additional analysis and measurement. • Applicable to an environmental matrix (groundwater) using standard alpha spectrometry counting equipment, operation and set-up.

  20. U(1) x U(1) x U(1) symmetry of the Kimura 3ST model and phylogenetic branching processes

    International Nuclear Information System (INIS)

    Bashford, J D; Jarvis, P D; Sumner, J G; Steel, M A

    2004-01-01

    An analysis of the Kimura 3ST model of DNA sequence evolution is given on the basis of its continuous Lie symmetries. The rate matrix commutes with a U(1) x U(1) x U(1) phase subgroup of the group GL(4) of 4 x 4 invertible complex matrices acting on a linear space spanned by the four nucleic acid base letters. The diagonal 'branching operator' representing speciation is defined, and shown to intertwine the U(1) x U(1) x U(1) action. Using the intertwining property, a general formula for the probability density on the leaves of a binary tree under the Kimura model is derived, which is shown to be equivalent to established phylogenetic spectral transform methods. (letter to the editor)

  1. 7 CFR 51.2541 - U.S. Fancy, U.S. Extra No. 1, U.S. No. 1 And U.S. Select Grades.

    Science.gov (United States)

    2010-01-01

    ... PRODUCTS 1,2 (INSPECTION, CERTIFICATION, AND STANDARDS) United States Standards for Grades of Pistachio.... Fancy,” “U.S. Extra No. 1,” “U.S. No. 1,” and “U.S. Select” consists of pistachio nuts in the shell...

  2. Effect of pH and Fe/U ratio on the U(VI) removal rate by the synergistic effect of Fe(II) and O2

    Science.gov (United States)

    Fu, Yukui; Luo, Yingfeng; Fang, Qi; Xie, Yanpei; Wang, Zhihong; Zhu, Xiangyu

    2018-02-01

    As for the decommissioned uranium deposits of acid in-situ leaching, both of the concentrations of U(VI) and Fe(II) are relatively high in groundwater. In the presence of O2, the oxidation of Fe(II) into Fe(III) that forms Fe-hydroxides could effectively remove U(VI) in the forms of sorption or co-precipitation. In this process, pH condition and Fe content will have a significant effect on the U(VI) removal rate by the synergistic effect of Fe(II) and O2. In the present work, a series of batch experiments were carried out to investigate the effect of pH values and Fe/U mass ratio on the U(VI) removal rate by the synergistic effect of Fe(II) and O2. Experiment results show that the removal rate of U(VI) is mainly controlled by pH and secondly by Fe/U mass ratio. In the neutral conditions with pH at 7 and 8, the removal rate of U(VI) reaches up to 90% for all solutions with different initial Fe(II) concentrations. The optimal pH for the removal rate of U(VI) is above 7. In the acidic conditions with pH below 6, the effect of Fe/U mass ratio on the removal rate of U(VI) becomes more obvious and the optimal Fe/U mass ratio for U(VI) removal is 1:2.

  3. Making of U3O8 Microsphere as a Preliminary Material for Manufacturing UO2 Kernel of HTR

    International Nuclear Information System (INIS)

    Hidayati; Triyono; Endang Nawangsih

    2007-01-01

    The making of U 3 O 8 microsphere as a preliminary material for manufacturing UO 2 kernel of HTR on various feed solution with internal gelation method use of paraffin gelation medium has been done. The aim of this research is to make U 3 O 8 microsphere as preliminary material for making UO 2 kernel which has good characteristic and for knowing to some extent the feed solution influence on U 3 O 8 microsphere. Uranyl nitrate solution was used as a feed solution with acidity 1 M and some various of ADUN solution. ADUN solution was made by adding various of ammonia solution on the solution of uranyl nitrate. Each of the feed solution was added urea + HMTA solution and then it was dropped to a column containing hot paraffin solution at the temperature 95°Celsius in order to get UO 3 gel. UO 3 gel was dipped and washed with NH 4 OH, dried and calcined at the temperature of 800°Celsius . The obtained product was analyzed its surface area, radius of pore, total volume of pore and distribution of pore size of Surface Area Analyzer NOVA-1000. The density was analyzed with pycnometer and the form of microsphere was analyzed with SEM. The obtained product shows that U 3 O 8 microsphere with less ammonium nitrate gave U 3 O 8 much better and vice versa. The best U 3 O 8 obtained from the with ratio mole nitrate/uranium = 1.9, namely uranyl nitrate solution with the feed acidity of 1 N which was added by the lest amount of NH 4 OH. U 3 O 8 microsphere has density 7.06 g/cc (85.62% theoretical density), specific surface area = 6.77 m 2 /g, mean pore radius 20.52 Å, and also total pore volume 6.91x10 -3 cc/g. (author)

  4. Suppression of multiple bioactivities of interleukin-1 and interleukin-2 production by U937 conditioned medium

    International Nuclear Information System (INIS)

    Wiblin, R.T.; Edmonds, K.; Ellner, J.J.

    1986-01-01

    The human macrophage-like cell line U937 spontaneously produces a factor which blocks interleukin-1 (IL-1) activity for mouse thymocytes but not mitosis of T-lymphoblastoid cells. The authors examined the effects of U937 conditioned medium (CM) on other IL-1 activities and on interleukin-2 (IL-2) production. U937 was cultured at 5 x 10 6 /ml in RPMI-1640 at 37 0 C for 5 days. The resulting CM inhibited the mitogenic response of C3H/HeJ mouse thymocytes to an IL-1 standard, with an inhibitory of activity of 6.64 U/ml (1 U = reciprocal dilution producing 50% inhibition of maximal response). Similarly, CM inhibited (10.12 U/ml) the fibroblast stimulation promoter activity of IL-1. The effect of CM on IL-2 production was assessed in a direct assay in which IL-2 production by γ-irradiated (12,000 rads) MLA-144 lymphosarcoma cells was assayed as 3 H-thymidine incorporation in CTLL-20 cells. The suppressive activity of CM was 4.95 U/ml; CM did not interfere with the response of CTLL-20 to IL-2. These studies establish that U937 produces factors with multiple, related biological activities; U937 CM blocks IL-2 dependent (thymocyte mitogenesis) and IL-2 independent (fibroblast proliferation) IL-1 activities and interferes with production of, but not response to, IL-2. U937 is an excellent model to study growth inhibitory properties of mononuclear phagocytes

  5. Joint U. S. --U. S. S. R. test of U. S. MHD electrode systems in U. S. S. R. U-02 MHD facility (phase I). Final report

    Energy Technology Data Exchange (ETDEWEB)

    Hosler, W R [ed.

    1976-01-01

    The first (Phase I) joint U.S.-U.S.S.R. test of U.S. electrode materials was carried out in Moscow between September 25 and October 8, 1975 in the Soviet U-02 MHD facility. The test procedure followed closely a predetermined work plan designed to test five different zirconia based materials and the cathode and anode electrode wall modules under MHD operating conditions. The materials which were selected were 88Zr0/sub 2/-12Y/sub 2/0/sub 3/, 82Zr0/sub 2/-18Ce02, 50Zr0/sub 2/-50Ce0/sub 2/, 25Zr0/sub 2/-75Ce0/sub 2/ and 20Zr0/sub 2/-78Ce0/sub 2/-2Ta/sub 2/0/sub 5/. The electrode modules were constructed by Westinghouse Research and Development Laboratory. Each of the five electrode materials had four different current densities established between the anode and cathode during the experiment which lasted a total of 127 hours. There were four main phases in the test schedule: (1) start-up of the channel over a specific heating period. No seed (K/sub 2/C0/sub 3/) introduction - 18 hours. (2) Electrical tests at operating temperature to investigate electro-physical characteristics of the channel and electrodes - 6 hours. (3) Operating life test - 94 hours. (4) Shut-down of the channel over a specific cool down period - 9 hours. All except six electrode pairs performed satisfactorily during the entire test. These were the pairs which were designated to carry maximum or near maximum current density. Five pairs failed early in the life test and the sixth pair failed in the last several hours. Failure was not due to the electrode materials, however, but due to lead-out melting caused by joule heating in the platinum wires. The U-02 facility is described and the operational parameters are given for each phase of the test. The electrode and insulating walls are described and the appropriate parameters that are used to predict the performance of the module are given.

  6. Electronic structure of crystalline uranium nitrides UN, U2N3 and UN2: LCAO calculations with the basis set optimization

    International Nuclear Information System (INIS)

    Evarestov, R A; Panin, A I; Bandura, A V; Losev, M V

    2008-01-01

    The results of LCAO DFT calculations of lattice parameters, cohesive energy and bulk modulus of the crystalline uranium nitrides UN, U 2 N 3 and UN 2 are presented and discussed. The LCAO computer codes Gaussian03 and Crystal06 are applied. The calculations are made with the uranium atom relativistic effective small core potential by Stuttgart-Cologne group (60 electrons in the core). The calculations include the U atom basis set optimization. Powell, Hooke-Jeeves, conjugated gradient and Box methods are implemented in the author's optimization package, being external to the codes for molecular and periodic calculations. The basis set optimization in LCAO calculations improves the agreement of the lattice parameter and bulk modulus of UN crystal with the experimental data, the change of the cohesive energy due to the optimization is small. The mixed metallic-covalent chemical bonding is found both in LCAO calculations of UN and U 2 N 3 crystals; UN 2 crystal has the semiconducting nature

  7. Zero Action on Perfect Crystals for U_q(G_2^{(1}

    Directory of Open Access Journals (Sweden)

    Kailash C. Misra

    2010-03-01

    Full Text Available The actions of 0-Kashiwara operators on the U_q(G_2^{(1}-crystal B_l in [Yamane S., J. Algebra 210 (1998, 440-486] are made explicit by using a similarity technique from that of a U_q'(D_4^{(3}-crystal. It is shown that {B_l}_{l ≥ 1} forms a coherent family of perfect crystals.

  8. U-2g0 cyclotron operational experience and improvement

    International Nuclear Information System (INIS)

    Gigal, B.N.; Gul'bekyan, G.G.; Kozlov, S.I.; Oganesyan, R.Ts.

    1983-01-01

    Brief description of main syste's of the U-200 isochronous 2-m cyclotron put into opera ion in 1968 is given and its operational characteristics a e presented. The cyclotron is used for conducting inve tigations in the field of nuclear physics. Ions from d uterium to argon have been accelerated in the cyclotro'. Annual time of target irradiation constitutes 2000-4000. The specific features of the cyclotron are: high l vel of a magnetic field (of about 20 kOe), possibili y of acceleration of ions with different mass-to-charge ratio a low correcting winding power, simple and high-e fective beam extraction by the method of charge exchange on a thin target allowing to vary smoothly energy of extracted ons. An experience in the U-200 cyclotron development and o eration is used as the basis for designing and choosing basic parameters of the U-200P, U-250, U-400 heavy ion cyclotrons

  9. Magnetic structure of the heavy-fermion compound U2Zn17

    DEFF Research Database (Denmark)

    Cox, D. E; Shirane, G.; Shapiro, S. M.

    1986-01-01

    The phase transition of U2Zn17 at 9.7K has been investigated by neutron powder diffraction. The transition corresponds to the onset of antiferromagnetic order where the U moments are oriented antiparallel to their neighbors within the basal planes and the near neighbor along the c^ axis of this r...... of this rhombohedral compound. At 5K, the ordered moments lie within the basal planes and are of magnitude (0.8±0.1) μB, which is substantially below the paramagnetic moment of 2.25 μB/U atom given by high-temperature susceptibility data......The phase transition of U2Zn17 at 9.7K has been investigated by neutron powder diffraction. The transition corresponds to the onset of antiferromagnetic order where the U moments are oriented antiparallel to their neighbors within the basal planes and the near neighbor along the c^ axis...

  10. The manufacture process and properties of (U, Gd)O2 burnable poisonous fuel pellets

    International Nuclear Information System (INIS)

    Yi Wei; Tang Yueming; Dai Shengping; Yang Youqing; Zuo Guoping; Wu Shihong; Gu Xiaofei; Gu Mingfei

    2006-03-01

    The main properties of important raw powder materials used in the (U, Gd)O 2 burnable poisonous fuel pellets production line of NPIC are presented. The powders included UO 2 , Gd 2 O 3 , (U, Gd) 3 O 8 and necessary additives, such as ammonium oxalate and zinc stearate. And the main properties of (U, Gd)O 2 burnable poisonous fuel pellets and the manufacture processes, such as ball-milling blending, granulation, pressing, sintering and grinding are also described. Moreover, the main effect of the process parameters controlled in the manufacture process have been discussed. (authors)

  11. Theoretical Mn K-edge XANES for Li2MnO3: DFT + U study

    International Nuclear Information System (INIS)

    Tamura, Tomoyuki; Ohwaki, Tsukuru; Ito, Atsushi; Ohsawa, Yasuhiko; Kobayashi, Ryo; Ogata, Shuji

    2012-01-01

    Spectral features of Mn K-edge x-ray absorption near-edge structure (XANES) for Li 2 MnO 3 were calculated using the first-principles full projector augmented wave method with the general gradient approximation plus U method. We demonstrated that the U parameter affects the spectral features in the pre-edge region while it does not affect those in the major absorption region. From the comparison with the experimental spectra and those of reference compounds, we showed that the spectral features of Mn K-edge XANES and the differences in the valence state can be reproduced well. (paper)

  12. A mixed-valent uranium phosphonate framework containing U{sup IV}, U{sup V}, and U{sup VI}

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Lanhua; Zheng, Tao; Wang, Yaxing; Diwu, Juan; Chai, Zhifang; Wang, Shuao [School for Radiological and interdisciplinary Sciences (RAD-X), Soochow University, Suzhou (China); Collaborative Innovation Center of Radiation Medicine, Jiangsu Higher Education Institutions, Suzhou (China); Bao, Songsong; Zheng, Limin [State Key Laboratory of Coordination Chemistry, School of Chemistry and Chemical Engineering, Collaborative Innovation Center of Advanced Microstructures, Nanjing University (China); Zhang, Linjuan; Wang, Jianqiang [Shanghai Institute of Applied Physics and, Key Laboratory of Nuclear Radiation and Nuclear Energy Technology, Chinese Academy of Sciences, Shanghai (China); Liu, Hsin-Kuan [Department of Chemistry, National Central University, Jhongli (China); Albrecht-Schmitt, Thomas E. [Department of Chemistry and Biochemistry, Florida State University, Tallahassee, FL (United States)

    2016-08-16

    It is shown that U{sup V}O{sub 2}{sup +} ions can reside at U{sup VI}O{sub 2}{sup 2+} lattice sites during mild reduction and crystallization process under solvothermal conditions, yielding a complicated and rare mixed-valent uranium phosphonate compound that simultaneously contains U{sup IV}, U{sup V}, and U{sup VI}. The presence of uranium with three oxidation states was confirmed by various characterization techniques, including X-ray crystallography, X-ray photoelectron, electron paramagnetic resonance, FTIR, UV/Vis-NIR absorption, and synchrotron radiation X-ray absorption spectroscopy, and magnetism measurements. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  13. The possibility of the mixed valence state in the uranium intermetallic compounds: UCoGa5, U2Ru2Sn and U2RuGa8

    International Nuclear Information System (INIS)

    Troc, Robert

    2007-01-01

    The mixed valence (MV) phenomenon has been observed so far in a large number of various compounds but containing only lanthanides. These properties are usually associated with the mixing of the localised f-state and the band states. The usual valence state for magnetic uranium intermetallics is the trivalent state 5f 3 or hybridised 5f 2 6d 1 , both are nearly degenerate in energy and can compete for a stability of the compound. In some cases a gain in an energy minimum may be achieved by very fast fluctuating between these two states with a time of 10 -14 s, which does not allow to yield the ordered state even if the exchange interactions (favourite the U-U distances) would be able for that. The latter cases seem to concern the described here intermetallics: one ternary compound based on Co, UCoGa 5 , and the two uranium ternary compounds based on Ru, namely U 2 Ru 2 Sn and U 2 RuGa 8 which all crystallize in a tetragonal unit cell. All these compounds show a maximum in their temperature dependences of the magnetic susceptibility measured along and perpendicular to the c-axis. Such a behaviour, which is reminiscent of a number of Ce (Sm, Eu) and Yb compounds for which χ(T) has in the past been considered by Sales and Wohlleben (SW) by applying their ICF model or by Lawrance et al. following their scaling procedure. It turned out that these phenomenological models can also be applied to the considered here two Ru-based uranium ternaries from which some reliable energy parameters could be found. In order to further support the mixing valence scenario for the first such cases in uranium compounds presented here, the transport and thermodynamic properties are also discussed. However, some of the most important results confirming the MV state, e.g., in U 2 RuGa 8 , has recently been achieved from the inelastic neutron scattering performed in the Rutherford Appleton Laboratory on the ISIS facility. From these measurements a characteristic gap of 60 meV has been

  14. mTORC2 activation is regulated by the urokinase receptor (uPAR) in bladder cancer.

    Science.gov (United States)

    Hau, Andrew M; Leivo, Mariah Z; Gilder, Andrew S; Hu, Jing-Jing; Gonias, Steven L; Hansel, Donna E

    2017-01-01

    Mammalian target of rapamycin complex 2 (mTORC2) has been identified as a major regulator of bladder cancer cell migration and invasion. Upstream pathways that mediate mTORC2 activation remain poorly defined. Urokinase-type plasminogen activator receptor (uPAR) is a GPI-anchored membrane protein and known activator of cell-signaling. We identified increased uPAR expression in 94% of invasive human bladder cancers and in 54-71% of non-invasive bladder cancers, depending on grade. Normal urothelium was uPAR-immunonegative. Analysis of publicly available datasets identified uPAR gene amplification or mRNA upregulation in a subset of bladder cancer patients with reduced overall survival. Using biochemical approaches, we showed that uPAR activates mTORC2 in bladder cancer cells. Highly invasive bladder cancer cell lines, including T24, J82 and UM-UC-3 cells, showed increased uPAR mRNA expression and protein levels compared with the less aggressive cell lines, UROtsa and RT4. uPAR gene-silencing significantly reduced phosphorylation of Serine-473 in Akt, an mTORC2 target. uPAR gene-silencing also reduced bladder cancer cell migration and Matrigel invasion. S473 phosphorylation was observed by immunohistochemistry in human bladder cancers only when the tumors expressed high levels of uPAR. S473 phosphorylation was not controlled by uPAR in bladder cancer cell lines that are PTEN-negative; however, this result probably did not reflect altered mTORC2 regulation. Instead, PTEN deficiency de-repressed alternative kinases that phosphorylate S473. Our results suggest that uPAR and mTORC2 are components of a single cell-signaling pathway. Targeting uPAR or mTORC2 may be beneficial in patients with bladder cancer. Copyright © 2016. Published by Elsevier Inc.

  15. Synthesis of [3-14C]- and [phenyl-U-14C] olaquindox

    International Nuclear Information System (INIS)

    Maul, W.; Scherling, D.; Seng, F.

    1981-01-01

    Olaquindox is a new feed additive. [ 14 C]Olaquindox, labelled in different positions, was needed for tracer-studies of pharmacokinetics, biotransformation and residues in several species of animals. 2-[N-(2-hydroxethyl)-carbamoyl]-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide([3- 14 C]Olaquindox) was synthesized from barium[ 14 C]carbonate (22 mmoles; 1.15 Ci) via [1- 14 C]acetic acid, sodium[1- 14 C]acetate, [1- 14 C]acetylchloride, ethyl[3- 14 C]acetoacetate and 2-carbethoxy-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide with an overall yield of 10%, based on barium[ 14 C]carbonate. The radiochemical purity was better than 98% (tlc). The specific activities of three preparations were 10.5, 8.4 and 5.45 μCi/mg respectively. [phenyl-U- 14 C]Olaquindox was synthesized starting from [U- 14 C]aniline (19.8 mmoles; 284.4 mCi). Intermediate products were N-acetyl[U- 14 C]aniline, 2-nitro-N-acetyl[U- 14 C]aniline, 2-nitro[U- 14 C]aniline and [U- 14 C]benzofurazanoxide. The total yield was 50% as calculated for [U- 14 C]aniline. At calibration samples of two preparations showed specific activities of 49.5 and 11.1 μCi/mg respectively. The radiochemical purity was checked by tlc and exceeded 98%. (author)

  16. U{sub 3}O{sub 8} and UO{sub 2} obtained from ADU (ammonium diuranate) ultrasonically treated; Obtencion de U{sub 3}O{sub 8} y UO{sub 2} a partir de ADU (diuranato amonico) precipitado con aplicacion de ultrasonido

    Energy Technology Data Exchange (ETDEWEB)

    Boero, N; Sassone, A; Mendez de Leo, L; Novara, O; Ramella, J [Comision Nacional de Energia Atomica, San Martin (Argentina). Unidad de Actividad Combustibles Nucleares

    1997-12-31

    At present, obtention of U{sub 3}O{sub 8} used in the manufacturing of MTR plates nuclear fuels, is performed by hydrolysis of UF6 to obtain uranyl fluoride. Uranyl fluoride is precipitated with ammonium hydroxide to get ammonium polyuranate (ADU). Afterwards ADU is calcinated to U{sub 3}O{sub 8} and mechanical and thermally treated in order to obtain a powder in a determined specification. In the present work, ultrasound has been applied in the stage of precipitation of ADU and for different times in the stage of digestion in order to fasten the stages of ADU filtering and eliminate the U{sub 3}O{sub 8} milling and sieving. Experiences on UO{sub 2} have also been performed. The aspect of ADU changes considerably when they have been ultrasonically treated, its filtering rate is faster and it is easier to dry as it contains less humidity. U{sub 3}O{sub 8} obtained after 800degreeC calcination of treated ADU results in an easy to desagregate powder. Only a soft mechanical treatment is needed to be performed on it before starting thermal treatment at 1400degreeC. After thermal treatment at 1400degreeC treated U{sub 3}O{sub 8} has shown adequate characteristics of size, shape and density (8.2 g/cm{sup 3}). Regarding UO{sub 2}, the shape of the agglomerates is almost spherical, leading to a free-flowing powder, whose apparent and TAP density showed to be adequate. The characteristics of the different compounds were followed by electron scanning micrographies, X-Rays, specific area measurements and differential thermal analysis. The great advantage of ultrasound appliance is that hard mechanical treatment is avoided in the obtention of U{sub 3}O{sub 8}, saving time and effort. Furthermore, UO{sub 2} proves to be adequate to make pellets, the same precursor could be used in the obtention of both uranium oxides. (author). 5 refs., 6 figs.

  17. Chemical thermodynamic representation of (U, Pu, Am)O2-x

    International Nuclear Information System (INIS)

    Osaka, Masahiko; Namekawa, Takashi; Kurosaki, Ken; Yamanaka, Shinsuke

    2005-01-01

    The oxygen potential isotherms of (U, Pu, Am)O 2-x were represented by a chemical thermodynamic model proposed by Lindemer et al. It was assumed in the present model that (U, Pu, Am)O 2-x consisted of the chemical species [UO 2 ], [PuO 2 ], [Pu 4/3 O 2 ], [AmO 2 ] and [Am 5/4 O 2 ] in a pseudo-quaternary system by treating the reduction rates of Pu and Am as identical; furthermore an interaction between [Am 5/4 O 2 ] and [UO 2 ] was introduced. The agreement between analytical and experimental isotherms was good, but the analytical values slightly overestimated the experimental values especially in the case of lower Am content. Adding an interaction between [Am 5/4 O 2 ] and [PuO 2 ] to the model resulted in a better representation

  18. The Experiment Production And Examination Of The U3Si2-AI Mini plates For Irradiation Test

    International Nuclear Information System (INIS)

    Supardjo; Boybul; Yowono; Susworo; Permana, S.

    1998-01-01

    The fuel plates containing U 3 Si 2 -AI dispersion fuel having respective loading of 3.55; 4.20; and 4.80 g/cm 3 were prepared by dispersing certain amount of U 3 Si 2 powder in the AI powder as matrix. The weight ratio of U 3 Si 2 and AI at different loading was chosen based on the 19.23 cm 3 volume basis fuel core calculation. Each fuel mixture was pressed into a fuel core having dimension of 100.20 x 60.35 x 3.15 +- (0.05) mm, which was then cut into mini fuel core having dimension of 16 x 8 x 3.15 +- (0.05) mm. The mini plates were prepared by picture and frame technique using AIMg2 as cladding material. The mini plates have been tested for blister, homogeneity, white spots, surface defects and their cladding thickness, revealing that out of 74 mini plates, they are ten (10) mini plates that have to be rejected due to blisters and white spots, thus of 64 mini plates can be further fabricated as samples for irradiation test

  19. Characterization and densification studies on ThO{sub 2}-UO{sub 2} pellets derived from ThO{sub 2} and U{sub 3}O{sub 8} powders

    Energy Technology Data Exchange (ETDEWEB)

    Kutty, T.R.G. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India)]. E-mail: tkutty@magnum.barc.ernet.in; Hegde, P.V. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Khan, K.B. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Jarvis, T. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Sengupta, A.K. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Majumdar, S. [Radiometallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India); Kamath, H.S. [Nuclear Fuels Group, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India)

    2004-12-01

    ThO{sub 2} containing around 2-3% {sup 233}UO{sub 2} is the proposed fuel for the forthcoming Indian Advanced Heavy Water Reactor (AHWR). This fuel is prepared by powder metallurgy technique using ThO{sub 2} and U{sub 3}O{sub 8} powders as the starting material. The densification behaviour of the fuel was evaluated using a high temperature dilatometer in four different atmospheres Ar, Ar-8%H{sub 2}, CO{sub 2} and air. Air was found to be the best medium for sintering among them. For Ar and Ar-8%H{sub 2} atmospheres, the former gave a slightly higher densification. Thermogravimetric studies carried out on ThO{sub 2}-2%U{sub 3}O{sub 8} granules in air showed a continuous decrease in weight up to 1500 deg. C. The effectiveness of U{sub 3}O{sub 8} in enhancing the sintering of ThO{sub 2} has been established.

  20. Short Communication on “In-situ TEM ion irradiation investigations on U{sub 3}Si{sub 2} at LWR temperatures”

    Energy Technology Data Exchange (ETDEWEB)

    Miao, Yinbin, E-mail: ymiao@anl.gov [Argonne National Laboratory, Lemont, IL 60439 (United States); Harp, Jason [Idaho National Laboratory, Idaho Fall, ID 83415 (United States); Mo, Kun [Argonne National Laboratory, Lemont, IL 60439 (United States); Bhattacharya, Sumit [Northwestern University, Evanston, IL 60208 (United States); Baldo, Peter; Yacout, Abdellatif M. [Argonne National Laboratory, Lemont, IL 60439 (United States)

    2017-02-15

    The radiation-induced amorphization of U{sub 3}Si{sub 2} was investigated by in-situ transmission electron microscopy using 1 MeV Kr ion irradiation. Both arc-melted and sintered U{sub 3}Si{sub 2} specimens were irradiated at room temperature to confirm the similarity in their responses to radiation. The sintered specimens were then irradiated at 350 °C and 550 °C up to 7.2 × 10{sup 15} ions/cm{sup 2} to examine their amorphization behavior under light water reactor (LWR) conditions. U{sub 3}Si{sub 2} remains crystalline under irradiation at LWR temperatures. Oxidation of the material was observed at high irradiation doses.

  1. Quantum algebra Uqp(u2) and application to the rotational collective dynamics of the nuclei

    International Nuclear Information System (INIS)

    Barbier, R.

    1995-01-01

    This thesis concerns some aspects of new symmetries in Nuclear Physics. It comprises three parts. The first one is devoted to the study of the quantum algebra U qp (u 2 ). More precisely, we develop its Hopf algebraic structure and we study its co-product structure. The bases of the representation theory of U qp (u 2 ) are introduced. On one hand, we construct the finite-dimensional irreducible representations of U qp (u 2 ). On the other hand, we calculate the Clebsch-Gordan coefficients with the projection operator method. To complete our study, we construct some deformed boson mappings of the quantum algebras U qp (u 2 ), U q 2 (su 2 ) and U qp (u 1,1 ). The second part deals with the construction of a new phenomenological model of the non rigid rotator. This model is based on the quantum algebra U qp (u 2 ). The rotational energy and the E2 reduced transition probabilities are obtained. They depend on the two deformation parameters q and p of the quantum algebra. We show how the use of the two-parameter deformation of the algebra U qp (u 2 ) leads to a generalization of the U q (su 2 )-rotator model. We also introduce a new model of the anharmonic oscillator on the basis of the quantum algebra U qp (u 2 ). We show that the system of the U q (su 2 )-rotator and of the anharmonic oscillator can be coupled with the use of the deformation parameters of U qp (u 2 ). A ro-vibration energy formula and expansion 'a la' Dunham are obtained. The aim of the lest part is to apply our non rigid rotator model to the rotational collective dynamics of the superdeformed nuclei of the A∼130 - 150 and A∼190 mass regions and deformed nuclei of the actinide and rare earth series. We adjust the free parameters of our model and compare our results with those arising from four other models of the non rigid rotator. A comparative analysis is given in terms of transition energies. We calculate the dynamical moments of inertia with the fitted parameters. A comparison between the

  2. Reactivity feedback coefficients of a material test research reactor fueled with high-density U{sub 3}Si{sub 2} dispersion fuels

    Energy Technology Data Exchange (ETDEWEB)

    Muhammad, Farhan [Department of Nuclear Engineering, Pakistan Institute of Engineering and Applied Sciences, Nilore, Islamabad 45650 (Pakistan)], E-mail: farhan73@hotmail.com; Majid, Asad [Department of Nuclear Engineering, Pakistan Institute of Engineering and Applied Sciences, Nilore, Islamabad 45650 (Pakistan)

    2008-10-15

    The reactivity feedback coefficients of a material test research reactor fueled with high-density U{sub 3}Si{sub 2} dispersion fuels were calculated. For this purpose, the low-density LEU fuel of an MTR was replaced with high-density U{sub 3}Si{sub 2} LEU fuels currently being developed under the RERTR program. Calculations were carried out to find the fuel temperature reactivity coefficient, moderator temperature reactivity coefficient and moderator density reactivity coefficient. Nuclear reactor analysis codes including WIMS-D4 and CITATION were employed to carry out these calculations. It is observed that the average values of fuel temperature reactivity feedback coefficient, moderator temperature reactivity coefficient and moderator density reactivity coefficient from 20 deg. C to 100 deg. C, at the beginning of life, followed the relationships (in units of {delta}k/k x 10{sup -5} K{sup -1}) -2.116 - 0.118 {rho}{sub U}, 0.713 - 37.309/{rho}{sub U} and -12.765 - 34.309/{rho}{sub U}, respectively for 4.0 {<=} {rho}{sub U} (g/cm{sup 3}) {<=} 6.0.

  3. Thermodynamic study of (alkyl esters+{alpha},{omega}-alkyl dihalides) V. H{sub m}{sup E}andV{sub m}{sup E} for 25 binary mixtures {l_brace}xC{sub u-1}H{sub 2u-1}CO{sub 2}CH{sub 3}+(1-x){alpha},{omega}-ClCH{sub 2}(CH{sub 2}){sub v-2}CH{sub 2}Cl{r_brace}, where u=1 to 5, {alpha}=1 and v={omega}=2 to 6

    Energy Technology Data Exchange (ETDEWEB)

    Ortega, J. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario de Tafira, Universidad de Las Palmas de Gran Canaria, 35071 Las Palmas de Gran Canaria, Canary Islands (Spain)]. E-mail: jortega@dip.ulpgc.es; Marrero, E. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario de Tafira, Universidad de Las Palmas de Gran Canaria, 35071 Las Palmas de Gran Canaria, Canary Islands (Spain)

    2007-05-15

    The experimental data of excess molar enthalpies H{sub m}{sup E} and excess molar volumes V{sub m}{sup E} are presented for a set of 25 binary mixtures comprised of the first five methyl esters C{sub u-1}H{sub 2u-1}COOCH{sub 3} (u=1 to 5) and five {alpha},{omega}-dichloroalkanes, ClCH{sub 2}(CH{sub 2}){sub v-2}CH{sub 2}Cl (v=2 to 6), obtained at a temperature of 298.15K and atmospheric pressure. Except for the mixtures with u=1 and v=2 to 6, which are all endothermic and with u=5 and v=2 to 6, which are all exothermic, the others present net endo/exothermic effects and these mixing effects evolve quasiregularly, from endothermic to exothermic, depending on the dichloroalkane present. However, the V{sub m}{sup E} are positive in most mixtures except for those corresponding to u=4,5 and v=5,6, which present contraction effects. These results indicate a set of specific interactions with simultaneous effects for V{sub m}{sup E} of expansion/contraction and for exothermic/endothermic H{sub m}{sup E} for this set of mixtures. The change in V{sub m}{sup E} with the chain length of the compounds is irregular. To achieve a good application of the UNIFAC model using the version of Dang and Tassios, parameters of the ester (G)/dichloride (G') interaction were calculated again, making a distinction, during its application, dependent on the acid part of the ester u. Hence, interaction parameters are presented as a function of u, and of the dichloroalkane chain length v. The most appropriate general expression was of the type:a{sub G/G{sup '}}={phi}(u,v)={sigma}sub(i=0)sup(n)a{sub i-1}u{sup i-1}+{sigma}sub(i=0= )sup(n)b{sub i-1}v{sup i-1}and with this proposal good estimations of enthalpies were obtained with the UNIFAC model.

  4. Isothermal section of diagram of U-Mo-B and U-Re-B systems

    International Nuclear Information System (INIS)

    Val'ovka, I.P.; Kuz'ma, Yu.B.

    1986-01-01

    The methods of X-ray analysis are used to study the U-Mo-B and U-Re-B systems and to plot phase equilibrium diagrams at 1000 and 800 deg C, respectively. A formation of boride UMoB 4 (structure of the ThMoB 4 type) is confirmed in the U-Mo-B system and new compounds are found: U 2 MoB 6 (rhombic structure of the Y 2 ReB 6 type, a=0.9301(9), b=1.1434(11), c=0.3678(4) nm), ∼UMo 2 B 6 and ∼ UMo 4 B 4 with unknown structures. In the U-Re-B system besides previously known boride UReB 4 (the ThMoB 4 structure type), new ones are obtained: U 2 ReB 6 (Y 2 ReB 6 type, a=0.9373(9), b=1.1529(13), c0.3653(4) nm) and UReB 3 (hexagonal structure of the proper type, a=0.5083(1), c=0.5095(1) nm)

  5. Bose-Fermi U(6/2j+1) supersymmetries and high-spin anomalies

    International Nuclear Information System (INIS)

    Morrison, I.; Jarvis, P.D.

    1985-01-01

    A supersymmetric extension of the interacting boson model (IBM) is constructed to describe high-spin anomalies in both even- and odd-mass spectra of the Hg, Pt region (190<=A<=200). Supergroup chains such as U(6/2j+1)containsOsp(6/2j+1)containsO(6)xSp(2j+1)... or U(6/2j+1)containsU(5/2j+1)xU(1)containsOsp(5/2j+1)... incorporate a single j-shell fermion in addition to the usual 's' and 'd' bosons (L=0 and L=2). The orthosympletic supergroup reflects the strong pairing force in the subspace of the fermion intruder level. The model agrees favourably with experiment and microscopic calculation. (orig.)

  6. Optical spectroscopy and crystal-field analysis of U3+: Ba2YCl7

    International Nuclear Information System (INIS)

    Karbowiak, M.; Mech, A.; Drozdzyndki, J.; Gajek, Z.; Edelstein, N.M.

    2002-01-01

    High resolution absorption spectra of a U 3+ (0.3%): Ba 2 YCl 7 single crystal were recorded in the 4000-50 000 cm -1 range at 7 K. The observed crystal-field levels were assigned and fit to the parameters of the simplified angular overlap model (AOM) as well as a semi-empirical Hamiltonian representing the combined atomic and one-electron crystal-field interactions. The starting values of the AOM parameters were obtained from ab initio calculations. The analysis of the spectra allowed the assignment of 65 crystal-field levels with a relatively small rms deviation of 25 cm -1 and has shown that the AOM approach can predict quite well the B q k crystal-field parameters. The value determined for the crystal-field strength parameter, N v , corresponds well with those determined for U 3+ in other chloride single crystals. (authors)

  7. Proportioning of U3O8 powder

    International Nuclear Information System (INIS)

    Cermak, V.; Markvart, M.; Novy, P.; Vanka, M.

    1989-01-01

    The tests are briefly described or proportioning U 3 O 8 powder of a granulometric grain size range of 0-160 μm using a vertical screw, a horizontal dual screw and a vibration dispenser with a view to proportioning very fine U 3 O 8 powder fractions produced in the oxidation of UO 2 fuel pellets. In the tests, the evenness of proportioning was assessed by the percentage value of the proportioning rate spread measured at one-minute intervals at a proportioning rate of 1-3 kg/h. In feeding the U 3 O 3 in a flame fluorator, it is advantageous to monitor the continuity of the powder column being proportioned and to assess it radiometrically by the value of the proportioning rate spread at very short intervals (0.1 s). (author). 10 figs., 1 tab., 12 refs

  8. Fabrication and microstructural analysis of UN-U_3Si_2 composites for accident tolerant fuel applications

    International Nuclear Information System (INIS)

    Johnson, Kyle D.; Raftery, Alicia M.; Lopes, Denise Adorno; Wallenius, Janne

    2016-01-01

    In this study, U_3Si_2 was synthesized via the use of arc-melting and mixed with UN powders, which together were sintered using the SPS method. The study revealed a number of interesting conclusions regarding the stability of the system – namely the formation of a probable but as yet unidentified ternary phase coupled with the reduction of the stoichiometry in the nitride phase – as well as some insights into the mechanics of the sintering process itself. By milling the silicide powders and reducing its particle size ratio compared to UN, it was possible to form a high density UN-U_3Si_2 composite, with desirable microstructural characteristics for accident tolerant fuel applications. - Highlights: • U_3Si_2 fabricated from elemental uranium and silicon through arc melting. • Homogeneity of the silicides assessed through densitometry, XRD, SEM and EDS, chemical etching and optical microscopy. • UN powder fabricated using hydriding-nitriding method. • No phase transformations detected when sintering using silicide particle sizes less than UN particle size. • High density composite (98%TD) fabricated with silicide grain coating using spark plasma sintering at 1450 °C.

  9. The U(3) principle as base of a microscopical U(3) model for the clarification of the phenomenon of nuclear molecules

    International Nuclear Information System (INIS)

    Bader, R.

    1985-01-01

    The tenor of this thesis is the regarding of the U(3) symmetry in the study of nuclear reactions. By the description of the two colliding fragments and their relative motion by means of U(3) quantum numbers U(3) channels and U(3) channel sets are defined. It is shown that in certain collisions the U(3) symmetry of U(3) channels is incompatible with the U(3) symmetry of the compound nucleus. For these U(3) channels the formation of the compound nucleus is forbidden. In this framework a microscopical U(3) model for the phenomenon of the nuclear molecule resonances is developed. U(3) barriers which play an important role in this model are responsible for the repulsion between the two fragments. By microscopical calculations it is confirmed that by the U(3) channels allowed above the U(3) barriers an attraction between the two fragments arises. This interchange of attraction and repulsion leads to the formation of nuclear molecules. Furthermore it is shown that this incompatibility and by this the phenomenon of nuclear molecule resonances can be reduced to an U(3) principle in which the Pauli principle is contained. Basing on this U(3) principle selection rules are formulated which predict candidates for nuclear molecule resonances. This explains why only some binary systems tend to the molecule formation. (orig./HSI) [de

  10. Alteration of the SETBP1 gene and splicing pathway genes SF3B1, U2AF1, and SRSF2 in childhood acute myeloid leukemia.

    Science.gov (United States)

    Choi, Hyun-Woo; Kim, Hye-Ran; Baek, Hee-Jo; Kook, Hoon; Cho, Duck; Shin, Jong-Hee; Suh, Soon-Pal; Ryang, Dong-Wook; Shin, Myung-Geun

    2015-01-01

    Recurrent somatic SET-binding protein 1 (SETBP1) and splicing pathway gene mutations have recently been found in atypical chronic myeloid leukemia and other hematologic malignancies. These mutations have been comprehensively analyzed in adult AML, but not in childhood AML. We investigated possible alteration of the SETBP1, splicing factor 3B subunit 1 (SF3B1), U2 small nuclear RNA auxiliary factor 1 (U2AF1), and serine/arginine-rich splicing factor 2 (SRSF2) genes in childhood AML. Cytogenetic and molecular analyses were performed to reveal chromosomal and genetic alterations. Sequence alterations in the SETBP1, SF3B1, U2AF1, and SRSF2 genes were examined by using direct sequencing in a cohort of 53 childhood AML patients. Childhood AML patients did not harbor any recurrent SETBP1 gene mutations, although our study did identify a synonymous mutation in one patient. None of the previously reported aberrations in the mutational hotspot of SF3B1, U2AF1, and SRSF2 were identified in any of the 53 patients. Alterations of the SETBP1 gene or SF3B1, U2AF1, and SRSF2 genes are not common genetic events in childhood AML, implying that the mutations are unlikely to exert a driver effect in myeloid leukemogenesis during childhood.

  11. 238U, 234U and 230Th in uranium miners' lungs

    International Nuclear Information System (INIS)

    Singh, M.P.; Wrenn, M.E.; Archer, V.E.; Saccomanno, G.

    1981-01-01

    Fourteen uranium miners' lungs from Colorado plateau were collected at autopsy and the concentrations of 238 U, 234 U and 230 Th were determined by radiochemical procedures utilizing solvent extraction - alpha spectrometric techniques. The uranium and thorium isotopes are in near equilibrium with average concentrations of 238 U, 234 U and 230 Th being 89.3, 95.2 and 91.1 pCi/kg respectively. The combined average radiation dose rate to lung from these three isotopes is about 24.2 mrad/year at death excluding the unmeasured contribution from the 226 Ra and daughters. The average concentration of 230 Th is about 65 times higher than the mean concentration of 230 Th in lungs of non-miners dying at comparable ages from the same region

  12. Nb2OsB2, with a new twofold superstructure of the U3Si2 type: Synthesis, crystal chemistry and chemical bonding

    International Nuclear Information System (INIS)

    Mbarki, Mohammed; Touzani, Rachid St.; Fokwa, Boniface P.T.

    2013-01-01

    The new ternary metal-rich boride, Nb 2 OsB 2 , was synthesized by arc-melting the elements in a water-cooled copper crucible under an argon atmosphere. The compound was characterized from single-crystal X-ray data and EDX measurements. It crystallizes as a new superstructure (space group P4/mnc, no. 128) of the tetragonal U 3 Si 2 -structure type with lattice parameters a=5.922(1) Å and c=6.879(2) Å. All of the B atoms are involved in B 2 dumbbells with B–B distances of 1.89(4) Å. Structure relaxation using VASP (Vienna ab intio Simulation Package) has confirmed the space group and the lattice parameters. According to electronic structure calculations (TB–LMTO–ASA), the homoatomic B–B interactions are optimized and very strong, but relatively strong heteroatomic Os–B, Nb–B and Nb–Os bonds are also found: These interactions, which together build a three-dimensional network, are mainly responsible for the structural stability of this new phase. The density of state at the Fermi level predicts metallic behavior, as expected, from this metal-rich boride. - Graphical abstract: Nb 2 OsB 2 is, to the best of our knowledge, the first fully characterized phase in the ternary Nb–Os–B system. It crystallizes (space group P4/mnc, 128) with a new twofold superstructure of the U 3 Si 2 structure type (space group P4/mbm, 127), and is therefore the first boride in this structure family crystallizing with a superstructure of the U 3 Si 2 structure type. We show that the distortions leading to this superstructure occurs mainly in the Nb-layer, which tries to accommodate the large osmium atoms. The consequence of this puckering is the building osmium dumbbells instead of chains along [001]. - Highlights: • First compound in the Nb–Os–B system. • New twofold superstructure of U 3 Si 2 structure type. • Puckering of Nb-layer responsible for superstructure occurrence. • Chemical bonding studied by density functional theory

  13. Algebraic formulas for some nontrivial U/sub n/ 6j symbols and U/sub m/n contains U/sub m/ x U/sub n/ 3jm symbols

    International Nuclear Information System (INIS)

    Haase, R.W.; Butler, P.H.

    1985-01-01

    We give tables of algebraic formulas for some nontrivial 6j symbols and 3jm symbols of the unitary groups. The tables demonstrate that the building-up method can be used successfully to obtain the rank dependence of unitary group j and jm symbols. To emphasize the rank-dependent nature of this calculation, we have employed the composite Young tableaux notation (or back-to-back notation) to label the unitary group irreps. In using this notation, the transpose conjugate symmetry of the corresponding composite Young diagram leads to a new symmetry of the unitary group 6j and 3jm symbols. The transposition of the groups U/sub m/ and U/sub n/ gives rise to a further symmetry of the 3jm symbols of U/sub m/n contains U/sub m/ x U/sub n/

  14. Opportunities for Grid Modernization Collaboration: U.K.-U.S. Grid Modernization Workshop Report, February 28 - March 2, 2017

    Energy Technology Data Exchange (ETDEWEB)

    2017-06-28

    This report captures the discussions and takeaways from the U.K.-U.S. Grid Modernization Workshop on February 28-March 2, 2017 at the National Renewable Energy Laboratory. Speakers from across the United States and Europe convened to discuss the challenges associated with grid modernization for the 21st century, while identifying transatlantic solutions and opportunities for collaboration.

  15. 11 CFR 104.20 - Reporting electioneering communications (2 U.S.C. 434(f)).

    Science.gov (United States)

    2010-01-01

    ... POLITICAL COMMITTEES AND OTHER PERSONS (2 U.S.C. 434) § 104.20 Reporting electioneering communications (2 U... 11 Federal Elections 1 2010-01-01 2010-01-01 false Reporting electioneering communications (2 U.S... electioneering communication is publicly distributed provided that the person making the electioneering...

  16. Comparison of U-Pu-Mo, U-Pu-Nb, U-Pu-Ti and U-Pu-Zr alloys; Comparaison des alliages U-Pu-Mo, U-Pu-Nb, U-Pu-Ti, U-Pu-Zr

    Energy Technology Data Exchange (ETDEWEB)

    Boucher, R; Barthelemy, P [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1964-07-01

    The data concerning the U-Pu, U-Pu-Mo and U-Pu-Nb are recalled. The results obtained with U-Pu-Ti and U-Pu-Zr alloys containing 15-20 per cent Pu and 10 wt. per cent ternary element are reported. The transformation temperatures, the expansion coefficients, the nature of phases, the thermal cycling behaviour have been determined. A list of the principal properties of these different alloys is presented and the possibilities of their use as fast reactor's fuel element are considered. The U-Pu-Ti alloys seem to be quite promising: easiness of fabrication, large thermal stability, excellent behaviour in air, small quantity of zeta phase, temperature of solidus superior to 1100 deg. C. (authors) [French] On rappelle brievement les connaissances acquises sur les alliages U-Pu, U-Pu-Mo et U-Pu-Nb. On presente les resultats obtenus avec les alliages U-Pu-Ti et U-Pu-Zr pour des teneurs de 15 a 20 pour cent de plutonium et 10 pour cent en poids d'element ternaire. On a determine les temperatures de transformation, les coefficients de dilatation, la nature des phases, la conductibilite thermique a 20 deg. C, la tenue au cyclage thermique et diverses autres proprietes. Un tableau resume les principales proprietes des divers alliages. On considere les possibilites d'emploi de ces alliages comme combustibles de reacteur rapide. Les alliages U-Pu-Ti paraissent particulierement interessants: facilite d'elaboration, stabilite thermique etendue, tenue dans l'air excellente, faible quantite de la phase U-Pu zeta, temperature de fusion commencante superieure a 1100 deg. C. (auteurs)

  17. Oxidation behaviour of U2Ti alloy in dry air

    International Nuclear Information System (INIS)

    Roy, S.P.; Gupta, N.K.; Jat, Ram Avtar; Parida, S.C.; Mukerjee, S.K.

    2016-01-01

    U 2 Ti alloy is being considered as promising storage material for storage of hydrogen isotopes. However, the absorption capacity of this reactive alloy can be affected due to presence of oxygen in the process gas. Hence, it is necessary to know the kinetic of this alloy in presence of oxygen. In this study, U 2 Ti alloy was prepared by arc melting method followed by vacuum annealing. The alloy was characterized by XRD, SEM and EDX methods. The isothermal oxidation behaviour of U 2 Ti alloy was investigated in the temperature range of 548-623 K in dry air for 24 hours by using thermo gravimetric technique. The oxidation curves are shown. The oxidation curves were analysed using the rate equation: (Δm/a) n = kt, where, (Δm/a) is the mass gain per unit area, n is the power exponent, k is the rate constant and t is time in (seconds). Analysis of the results shows that the oxidation reaction follows linear rate law (n ~ 1). Using the linear rate law, the rate constant (k) of oxidation reaction was evaluated at each temperature in the range 548-623 K. The variation of (ln k) with reciprocal temperature is shown. The activation energy of this oxidation reaction in the temperature range 548-623 K was calculated using the Arrhenius equation and found to be 76 kJ/mol. The XRD analysis of the oxidation products was found to be U 3 O 8 and TiO 2 . (author)

  18. Effect of U-238 and U-235 cross sections on nuclear characteristics of fast and thermal reactors

    Energy Technology Data Exchange (ETDEWEB)

    Akie, Hiroshi; Takano, Hideki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kaneko, Kunio

    1997-03-01

    Benchmark calculation has been made for fast and thermal reactors by using ENDF/B-VI release 2(ENDF/B-VI.2) and JENDL-3.2 nuclear data. Effective multiplication factors (k{sub eff}s) calculated for fast reactors calculated with ENDF/B-VI.2 becomes about 1% larger than the results with JENDL-3.2. The difference in k{sub eff} is caused mainly from the difference in inelastic scattering cross section of U-238. In all thermal benchmark cores, ENDF/B-VI.2 gives smaller multiplication factors than JENDL-3.2. In U-235 cores, the difference is about 0.3%dk and it becomes about 0.6% in TCA U cores. The difference in U-238 data is also important in thermal reactors, while there are found 0.1-0.3% different v values of U isotopes in thermal energy between ENDF/B-VI.2 and JENDL-3.2. (author)

  19. Unobtrusive Software and System Health Management with R2U2 on a Parallel MIMD Coprocessor

    Science.gov (United States)

    Schumann, Johann; Moosbrugger, Patrick

    2017-01-01

    Dynamic monitoring of software and system health of a complex cyber-physical system requires observers that continuously monitor variables of the embedded software in order to detect anomalies and reason about root causes. There exists a variety of techniques for code instrumentation, but instrumentation might change runtime behavior and could require costly software re-certification. In this paper, we present R2U2E, a novel realization of our real-time, Realizable, Responsive, and Unobtrusive Unit (R2U2). The R2U2E observers are executed in parallel on a dedicated 16-core EPIPHANY co-processor, thereby avoiding additional computational overhead to the system under observation. A DMA-based shared memory access architecture allows R2U2E to operate without any code instrumentation or program interference.

  20. The qualification of U3O8 as research reactor fuel

    International Nuclear Information System (INIS)

    Krull, W.

    1983-01-01

    This report summarizes the today knowledge of the qualification status of U 3 O 8 as low enriched ( 3 O 8 is so far qualified to start testing of ten (10) fuel elements with an U-density of 3.1 g U/cc in the FRG-2 research reactor. (orig.) [de

  1. Subjective experiences of watching stereoscopic Avatar and U2 3D in a cinema

    Science.gov (United States)

    Pölönen, Monika; Salmimaa, Marja; Takatalo, Jari; Häkkinen, Jukka

    2012-01-01

    A stereoscopic 3-D version of the film Avatar was shown to 85 people who subsequently answered questions related to sickness, visual strain, stereoscopic image quality, and sense of presence. Viewing Avatar for 165 min induced some symptoms of visual strain and sickness, but the symptom levels remained low. A comparison between Avatar and previously published results for the film U2 3D showed that sickness and visual strain levels were similar despite the films' runtimes. The genre of the film had a significant effect on the viewers' opinions and sense of presence. Avatar, which has been described as a combination of action, adventure, and sci-fi genres, was experienced as more immersive and engaging than the music documentary U2 3D. However, participants in both studies were immersed, focused, and absorbed in watching the stereoscopic 3-D (S3-D) film and were pleased with the film environments. The results also showed that previous stereoscopic 3-D experience significantly reduced the amount of reported eye strain and complaints about the weight of the viewing glasses.

  2. Preparation and melting of uranium from U3O8

    International Nuclear Information System (INIS)

    Hur, Jin-Mok; Choi, In-Kyu; Cho, Soo-Haeng; Jeong, Sang-Mun; Seo, Chung-Seok

    2008-01-01

    In this paper, we report on the preparation and melting of uranium in association with a spent nuclear fuel conditioning process. U 3 O 8 powder was electrochemically reduced in a mixture of molten LiCl-Li 2 O (∼3 wt.% of Li 2 O in LiCl) at 650 deg. C resulting in the formation of uranium and Li 2 O with a yield of >99%. When the powder of uranium with a residual LiCl-Li 2 O salt was heated in order to melt the metal, the uranium oxidation to UO 2 due to the reaction with Li 2 O was observed. We were able to synthesize FeU 6 by using a Fe based cathode during the U 3 O 8 reduction procedure. FeU 6 could be melted to below the temperatures where the oxidation of uranium by Li 2 O occurred. The idea of compound formation and melting is applicable to the melting and casting of a spent nuclear fuel which contains oxidative residual salts due to its conditioning in a molten salt

  3. The Effect of Early Diagenesis on the 238U/235U Ratio of Platform Carbonates.

    Science.gov (United States)

    Tissot, F.; Chen, C.; Go, B. M.; Naziemiec, M.; Healy, G.; Swart, P. K.; Dauphas, N.

    2017-12-01

    In the past 15 years, the so-called non-traditional stable isotopes systems (e.g., Mg, Fe, Mo, U) have emerged as powerful tracers of both high-T and low-T geochemical processes (e.g., [1]). Of particular interest for paleoredox studies is the ratio of "stable" isotopes of U (238U/235U), which has the potential to track the global extent of oceanic anoxia (e.g., [2, 3]). Indeed, in the modern ocean, U exists in two main oxidation states, soluble U6+ and insoluble U4+, and has a mean residence time of 400 kyr ([4]), much longer than the global ocean mixing time (1-2 kyr). As such the salinity-normalized ocean is homogeneous with regards to both U concentrations and isotopes (δ238USW = -0.392±0.005 ‰, [2]). The value of δ238USW at any given time is therefore the balance between U input to the ocean, mainly from rivers, and U removal, mostly into biogenic carbonates, anoxic/euxinic sediments and suboxic/hypoxic sediments (e.g., [2, 5]). Because the 238U/235U ratio of the past ocean cannot be measured directly, it has to be estimated from the measurement of the 238U/235U ratio of a sedimentary rock and assuming a constant fractionation factor. Carbonates appear as a promising record since they span most of Earth's history, and the δ238U values of modern primary carbonate precipitates and well-preserved fossil aragonitic coral up to 600 ka are indistinguishable from that of seawater (e.g., [2, 6, 7]). Yet, the effect of secondary processes on the δ238U values of non-coral carbonates, which represent the bulk of the rock record, has only been studied in a handful of shallow samples (down to 40cm, [6]) and remains poorly understood. To investigate the effect of early diagenesis on the 238U/235U ratio of carbonates on the 30kyr to 1Myr timescale, we measured δ13C, δ18O, and δ238U in samples from a 220m long drill core from the Bahamas carbonate platform. In order to separate lattice bound U from secondary U we developed a leaching protocol applicable to carbonate

  4. Structural instability and ground state of the U{sub 2}Mo compound

    Energy Technology Data Exchange (ETDEWEB)

    Losada, E.L., E-mail: losada@cab.cnea.gov.ar [SIM" 3, Centro Atómico Bariloche, Comisión Nacional de Energía Atómica (Argentina); Garcés, J.E. [Gerencia de Investigación y Aplicaciones Nucleares, Comisión Nacional de Energía Atómica (Argentina)

    2015-11-15

    This work reports on the structural instability at T = 0 °K of the U{sub 2}Mo compound in the C11{sub b} structure under the distortion related to the C{sub 66} elastic constant. The electronic properties of U{sub 2}Mo such as density of states (DOS), bands and Fermi surface (FS) are studied to understand the source of the instability. The C11{sub b} structure can be interpreted as formed by parallel linear chains along the z-directions each one composed of successive U–Mo–U blocks. Hybridization due to electronic interactions inside the U–Mo–U blocks is slightly modified under the D{sub 6} distortion. The change in distance between chains modifies the U–U interaction and produces a split of f-states. The distorted structure is stabilized by a decrease in energy of the hybridized states, mainly between d-Mo and f-U states, together with the f-band split. Consequently, an induced Peierls distortion is produced in U{sub 2}Mo due to the D{sub 6} distortion. It is important to note that the results of this work indicate that the structure of the ground state of the U{sub 2}Mo compound is not the assumed C11{sub b} structure. It is suggested for the ground state a structure with hexagonal symmetry (P6 #168), ∼0.1 mRy below the energy of the recently proposed Pmmn structure. - Highlights: • Structural instability of the C11b compound due to the D6 deformation. • Induced Peierls distortion due to the D6 deformation. • Distorted structure is stabilized by hybridization and split of f-Uranium state. • P6 (#168) suggested ground state for the U{sub 2}Mo compound.

  5. Point group invariants in the Uqp(u(2)) quantum algebra picture

    International Nuclear Information System (INIS)

    Kibler, M.

    1993-07-01

    Some consequences of a qp-quantization of a point group invariant developed in the enveloping algebra of SU(2) are examined. A set of open problems concerning such invariants in the U qp (u(2)) quantum algebra picture is briefly discussed. (author) 18 refs

  6. The use of U3Si2 dispersed in aluminum in plate-type fuel elements for research and test reactors

    International Nuclear Information System (INIS)

    Snelgrove, J.L.; Domagala, R.F.; Hofman, G.L.; Wiencek, T.C.; Copeland, G.L.; Hobbs, R.W.; Senn, R.L.

    1987-10-01

    A high-density fuel based on U 3 Si 2 dispersed in aluminum has been developed and tested for use in converting plate-type research and test reactors from the use of highly enriched uranium to the use of low-enriched uranium. Results of preirradiation testing and the irradiation and postirradiation examination of miniature fuel plates and full-sized fuel elements are summarized. Swelling of the U 3 Si 2 fuel particles is a linear function of the fission density in the particle to well beyond the fission density achievable in low-enriched fuels. U 3 Si 2 particle swelling rate is approximately the same as that of the commonly used UAl/sub x/ fuel particle. The presence of minor amounts of U 3 Si or uranium solid solution in the fuel result in greater, but still acceptable, fuel swelling. Blister threshold temperatures are at least as high as those of currently used fuels. An exothermic reaction occurs near the aluminum melting temperature, but the measured energy releases were low enough not to substantially worsen the consequences of an accident. U 3 Si 2 -aluminum dispersion fuel with uranium densities up to at least 4.8 Mg/m 3 is a suitable LEU fuel for typical plate-type research and test reactors. 42 refs., 28 figs., 7 tabs

  7. Estimation of covariances of {sup 16}O, {sup 23}Na, Fe, {sup 235}U, {sup 238}U and {sup 239}Pu neutron nuclear data in JENDL-3.2

    Energy Technology Data Exchange (ETDEWEB)

    Shibata, Keiichi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Nakajima, Yutaka; Kawano, Toshihiko; Oh, Soo-Youl; Matsunobu, Hiroyuki; Murata, Toru

    1997-10-01

    Covariances of nuclear data have been estimated for 6 nuclides contained in JENDL-3.2. The nuclides considered are {sup 16}O, {sup 23}Na, Fe, {sup 235}U, {sup 238}U, and {sup 239}Pu, which are regarded as important for the nuclear design study of fast reactors. The physical quantities for which covariances are deduced are cross sections, resolved and unresolved resonance parameters, and the first order Legendre-polynomial coefficient for the angular distribution of elastically scattered neutrons. As for {sup 235}U, covariances were obtained also for the average number of neutrons emitted in fission. The covariances were estimated by using the same methodology that had been used in the JENDL-3.2 evaluation in order to keep a consistency between mean values and their covariances. The least-squares fitting code GMA was used in estimating covariances for reactions of which JENDL-3.2 cross sections had been evaluated by taking account of measurements. In nuclear model calculations, the covariances were calculated by the KALMAN system. The covariance data obtained were compiled in the ENDF-6 format, and will be put into the JENDL-3.2 Covariance File which is one of JENDL special purpose files. (author). 193 refs.

  8. Irradiation mixing of Al into U3Si

    International Nuclear Information System (INIS)

    Birtcher, R.C.; Ding, F.R.; Kestel, B.J.; Baldo, P.M.; Zaluzec, N.J.

    1995-11-01

    Thermal and irradiation induced intermixing of uranium silicide reactor fuels with the aluminum cladding is an important consideration in understanding their fission gas and fuel swelling behavior. The authors have used Rutherford backscattering to follow the behavior of an Al thin film on U 3 Si and U 3 Si 2 during 1.5 MeV Kr ion irradiation at temperatures of 30 and 350 C. After an initial dose during which no intermixing occurs, the Al mixes quickly into U 3 Si. The threshold dose is believed to be associated with an oxide layer between the Al and the uranium silicide. At 300 C and doses greater than threshold, rates of mixing and aluminide phase growth are extracted

  9. Development and evaluation of a collection apparatus for recoil products for study of the deexcitation process of "2"3"5"mU

    International Nuclear Information System (INIS)

    Shigekawa, Y.; Kasamatsu, Y.; Shinohara, A.

    2016-01-01

    The nucleus "2"3"5"mU is an isomer with extremely low excitation energy (76.8 eV) and decays dominantly through the internal conversion (IC) process. Because outer-shell electrons are involved in the IC process, the decay constant of "2"3"5"mU depends on its chemical environment. We plan to study the deexcitation process of "2"3"5"mU by measuring the energy spectra of IC electrons in addition to the decay constants for various chemical forms. In this paper, the preparation method of "2"3"5"mU samples from "2"3"9Pu by using alpha-recoil energy is reported. A Collection Apparatus for Recoil Products was fabricated, and then collection efficiencies under various conditions were determined by collecting "2"2"4Ra recoiling out of "2"2"8Th electrodeposited and precipitated sources. The pressure in the apparatus (vacuum or 1 atm of N_2 gas) affected the variations of the collection efficiencies depending on the negative voltage applied to the collector. The maximum values of the collection efficiencies were mainly affected by the thickness of the "2"2"8Th sources. From these results, the suitable conditions of the "2"3"9Pu sources for preparation of "2"3"5"mU were determined. In addition, dissolution efficiencies were determined by washing collected "2"2"4Ra with solutions. When "2"2"4Ra was collected in 1 atm of N_2 gas and dissolved with polar solutions such as water, the dissolution efficiencies were nearly 100%. The method of rapid dissolution of recoil products would be applicable to rapid preparation of short-lived "2"3"5"mU samples for various chemical forms.

  10. Low silicon U(Al,Si)3 stabilization by Zr addition

    International Nuclear Information System (INIS)

    Pizarro, L.M.; Alonso, P.R.; Rubiolo, G.H.

    2009-01-01

    Previous knowledge states that (U,Zr)Al 3 and U(Al,Si) 3 phases with Zr and Si content higher than 6 at.% (7.7 wt%) and 4 at.% (1.4 wt%), respectively, does not partially transform to UAl 4 at 600 o C. In this work, four alloys within the quaternary system U-Al-Si-Zr were made with a fixed nominal 0.18 at.% (0.1 wt%) Si content in order to assess the synergetic effect of both Zr and Si alloying elements to the thermodynamic stability of the (U,Zr)(Al,Si) 3 phase. Heat treatments at 600 deg. C were undertaken and samples were analyzed by means of XRD, EPMA and EDS techniques. A remarkable conclusion is that addition of 0.3 at.% Si in the (U,Zr)(Al,Si) 3 phase reduces in 2.7 at.% the necessary Zr content to inhibit its transformation to U(Al,Si) 4 .

  11. Determination of Uranium In UO2 And U3O8 Powder Using UV-VIS Spectrophotometry

    International Nuclear Information System (INIS)

    Natalia Adventini; Diah Dwiana Lestiani; Muhayatun; Endah Damastuti

    2009-01-01

    Lab. TAR PTNBR BATAN - Bandung has been accredited by National Accreditation Committee on May 2 nd , 2006 as a test laboratory with number LP-311-ID, has to maintain its laboratory performance by participating in a proficiency test. In this activity, the determination of uranium in 2 samples of UO 2 with A1 and A2 codes and other 2 samples of U 3 O 8 with B1 and B2 codes using UV-Vis spectrophotometry was carried out. Colouring method was used by reacting thiocyanate ion with the uranyl ion in acidic solution to develop a stable yellow colour of uranyl thiocyanate complex solution and measured at wavelength of 380 nm. The result gave that concentration of uranium in A1, A2, B1 and B2 samples were 77.95; 75.29; 64.58 and 63.69% respectively. The Z-score value for A samples was - 1.99, meanwhile for B samples the Z score value of between laboratory was −1.29 with intra laboratory was -1,09. It meant that Z-score values for both samples were in good category. From this result, it showed that UV-Vis spectrophotometry is one of the several methods that can be used to determine uranium in UO 2 and U 3 O 8 powder. The Lab. TAR’s proficiency test for determination of uranium in UO 2 and U 3 O 8 gave a good result and it was hoped to support BATAN's program in the nuclear fuel field. (author)

  12. High-pressure study of the non-Fermi liquid material U2Pt2In

    International Nuclear Information System (INIS)

    Estrela, P.; Visser, A. de; Boer, F.R. de; Pereira, L.C.J.

    2001-01-01

    The effect of hydrostatic pressure (p≤1.8 GPa) on the non-Fermi liquid state of U 2 Pt 2 In is investigated by electrical resistivity measurements in the temperature interval 0.3-300 K. The experiments were carried out on single-crystals with the current along (I parallel c) and perpendicular (I parallel a) to the tetragonal axis. The pressure effect is strongly current-direction dependent. For I parallel a we observe a rapid recovery of the Fermi-liquid T 2 -term with pressure. A comparison of the data with the magnetotransport theory of Rosch provides evidence for the location of U 2 Pt 2 In at an antiferromagnetic quantum critical point. For I parallel c the resistivity increases under pressure, indicating the enhancement of an additional scattering mechanism. (orig.)

  13. Thermodynamic stabilities of MO2+x(s) (M = U, Np, Pu and Am), pourbaix diagrams

    International Nuclear Information System (INIS)

    Vitorge, Pierre; Faure, Marie-Helene; Vercouter, Thomas; Capdevila, Helene; Maillard, Serge

    2002-01-01

    The experimental solubilities of the hydrated amorphous freshly precipitated M(OH) z (am) and MO 2 (OH) z (am) compounds are often used as an upper limit for the safety assessments of deep waste repositories, since these compounds slowly transform to less soluble ones, as typically M(OH) 4 (am) to MO 2 (cr). Solubility (vs. redox potential) at pH=8, and E-pH predominance diagrams are plotted in aqueous solutions at 25degC by using thermodynamic data recently selected by the NEA-TDB review, or estimated by using classical chemical analogies for the non-redox reactions. The solubilities and relative stabilities are also calculated for the MO 2+x (s) crystalline compounds of known stabilities: U 4 O 9 (s), U 3 O 7 (s), U 3 O 8 (s) and Np 2 O 5 (s) where 2+x = 2.25, 2.33, 2.67 and 2.5 respectively. The stabilities of the other MO 2+x (s) compounds are estimated by analogy: M 4 O 9 (s) (M=U, Np, Pu), M 3 O 7 (s) and M 3 O 8 (s) (M=U, Pu), and M 2 O 5 (s) (M=Np, Am) are predicted to be more stable (i.e. less soluble), than the amorphous hydroxides. However their precipitation have never been observed at room temperature possibly for kinetic reasons or difficulties in interpreting solubility experiments. (author)

  14. Uranium ("2"3"8U)-induced ROS and cell cycle perturbations, antioxidant responses and erythrocyte nuclear abnormalities in the freshwater iridescent shark fish Pangasius sutchi

    International Nuclear Information System (INIS)

    Annamalai, Sathesh Kumar; Arunachalam, Kantha Deivi

    2017-01-01

    Highlights: • Exposure to "2"3"8U deteriorated the antioxidant defenses like SOD, CAT and LPO. • Flow cytometric analysis revealed the increase in G2/M phase and S phase. • Micronucleus frequencies increased with Increased "2"3"8U exposure and time. • Exposure to waterborne "2"3"8U induces both chemical and radiotoxicity in P. sutchi. • ROS-mediated "2"3"8U toxic mechanism and the antioxidant responses has been proposed. - Abstract: The strategic plan of this study is to analyze any possible radiological impact on aquatic organisms from forthcoming uranium mining facilities around the Nagarjuna Sagar Dam in the future. The predominantly consumed and dominant fish species Pangasius sutchi, which is available year-round at Nagarjuna Sagar Dam, was selected for the study. To comprehend the outcome and to understand the mode of action of "2"3"8U, the fish species Pangasius sutchi was exposed to ¼ and ½ of the LC_5_0 doses of waterborne "2"3"8U in a static system in duplicate for 21 days. Blood and organs, including the gills, liver, brain and muscles, were collected at different time periods—0 h, 24 h, 48 h, 72 h, 96 h, 7, days 14 days and 21 days—using ICP-MS to determine the toxic effects of uranium and the accumulation of "2"3"8U concentrations. The bioaccumulation of "2"3"8U in P. sutchi tissues was dependent on exposure time and concentration. The accumulation of uranium was, in order of magnitude, measured as gills > liver > brain > tissue, with the highest accumulation in the gills. It was observed that exposure to "2"3"8U significantly reduced antioxidant enzymes such as superoxide dismutase, catalase, and lipid peroxidase. The analysis of DNA fragmentation by comet assay and cell viability by flow cytometry was performed at different time intervals. DNA histograms by flow cytometry analysis revealed an increase in the G2/M phase and the S phase. The long-term "2"3"8U exposure studies in fish showed increasing micronucleus frequencies in

  15. Summary of TMX-U results: 1984. Volume 2

    International Nuclear Information System (INIS)

    Simonen, T.C.

    1984-01-01

    The following areas are covered in this volume: (1) TREQ code, (2) Fokker-Planck and Monte Carlo calculations, (3) vacuum and gas modeling, (4) TMX-U data analysis and formulary, (5) thermal barrier operation, (6) plasma stability, (7) MHD and beta limits, (8) lf fluctuations, (9) central-cell ion-cyclotron microinstability, (10) end-cell ion-cyclotron microinstability, and (11) hot electron microinstability. In addition, discussions on the following technological developments are given: (1) vacuum, (2) magnet, (3) fueling, (4) heating, (5) potential control technology, (6) diagnostic systems, and (7) computer systems

  16. Postirradiation examination of a low enriched U3Si2-Al fuel element manufactured and irradiated at Batan, Indonesia

    International Nuclear Information System (INIS)

    Suripto, A.; Sugondo, S.; Nasution, H.

    1994-01-01

    The first low-enriched U 3 Si 2 -Al dispersion plate-type fuel element produced at the Nuclear Fuel Element Center, BATAN, Indonesia, was irradiated to a peak 235 U burnup of 62%. Postirradiation examinations performed to data shows the irradiation behavior of this element to be similar to that of U 3 Si 2 -Al plate-type fuel produced and tested at other institutions. The main effect of irradiation on the fuel plates is a thickness increase of 30--40 μm (2.5-3.0%). This thickness increase is almost entirely due to the formation of a corrosion layer (Boehmite). The contribution of fuel swelling to the thickness increase is rather small (less than 10 μm) commensurate with the burnup of the fuel and the relatively moderate as-fabricated fuel volume fraction of 27% in the fuel meat

  17. Cation interdiffusion in the UO2 - (U, Pu)O2 and UO2 - PuO2 systems

    International Nuclear Information System (INIS)

    Leme, D.G.

    1985-01-01

    The interdiffusion of U and Pu ions in UO sub(2 +- x) - (U sub(0,83) Pu sub(0,17))O sub(2 + - x) and UO sub(2 + - x) -PuO sub(2 - x) sintered pellets and UO sub(2 +- x) -(U sub(0,82) Pu sub(0,18))O sub(2 + - x) single crystals has been studied as a function of the oxygen potential ΔG sup(-) (O 2 ) or the stoichiometric ratio O/M. The diffusion profiles of UO 2 /(U,Pu)O 2 and UO 2 /PuO 2 couples of different O/M ratios have been measured using high resolution α-spectrometer and microprobe. Thermal annealing of the specimens was performed in controlled atmospheres using either CO-CO 2 gas mixtures for constant O/M ratios or purified argon. The interdiffusion profiles have been analysed by means of the Boltzmann-Matano and Hall methods. The interdiffusion coefficient D sus(approx.) increases with increasing Pu content in sintered pellets (up to 17 wt. %PuO 2 ) showing a strong dependence of D sup(approx.) on the O/M ratio. The micropobe results show that the interdiffusion along grain boundaries is the main diffusion mechanism in the pellets. Experiments have also been carried out in single cristals to measure just the bulk-interdiffusion and avoiding effects due to grain boundaries. A marked dependence of D sup(approx.) on O/M ratio or on oxygen potential ΔG sup(-) (O 2 ), similar to the dependence already reported for self diffusion by means of radioactive tracers, has also been observed. (Author) [pt

  18. U3O8 microspheres sintering kinetics

    International Nuclear Information System (INIS)

    Godoy, A.L.E.

    1986-01-01

    U 3 O 8 microspheres sintering kinetics was determined using a hot-stage optical microscopy apparatus, able to reach temperature up to 1350 0 C in controlled atmospheres. The sintered material had its microstructure analysed by optical and electron microscopy. The microspheres were characterized initialy utilizing X-ray diffractometry and thermogravimetry. The equation which describes the microspheres shrinkage in function of the time was obtained using finite difference analysis X-ray diffractometry indicated hexagonal structure for the microspheres main starting material, ammonium diuranate thermogravimetric analysis showed reduction of this material to U 3 O 8 at 600 0 C. Ceramography results showed 5 hours sintered microspheres grain sizes G vary with the temperature. Sintered U 3 O 8 micrographs compared with published results for UO 2 , indicate similar homogeneity microstructural characteristics and suggest the processed micorspheres to be potentially useful as nuclear fuels. (Author) [pt

  19. The inflow of 234U and 238U from the River Odra drainage basin to the Baltic Sea

    Directory of Open Access Journals (Sweden)

    Bogdan Skwarzec

    2010-12-01

    Full Text Available In this study the activity of uranium isotopes 234U and 238U in Odra river water samples, collected from October 2003 to July2004, was measured using alpha spectrometry. The uranium concentrations were different in each of the seasons analysed; the lowest values were recorded in summer. In all seasons, uranium concentrations were the highest in Bystrzyca river waters (from 27.81 ± 0.29Bq m-3 of 234U and 17.82 ± 0.23 Bq m-3 of 238U in spring to 194.76 ± 3.43 Bq m-3 of 234U and 134.88 ± 2.85 Bq m-3 of 238U in summer. The lowest concentrations were noted in the Mała Panew (from 1.33 ± 0.02 Bq m-3 of 234U and 1.06 ± 0.02 Bq m-3 of 238U in spring to 3.52 ± 0.05 Bq m-3 of 234U and 2.59± 0.04 Bq m-3 of 238U in autumn. The uranium radionuclides 234U and 238U in the water samples were not in radioactive equilibrium. The 234U / 238U activity ratios were the highest in Odra water samples collected at Głogów (1.84 in autumn, and the lowest in water from the Noteć (1.03 in winter and spring. The 234U / 238U activity ratio decreases along the main stream of the Odra, owing to changes in the salinity of the river's waters. Annually, 8.19 tons of uranium (126.29 G Bq of 234U and 100.80 G Bq of 238U flow into the Szczecin Lagoon with Odra river waters.

  20. Simple calculation of hybridization effects in UTX and U2T2X compounds

    International Nuclear Information System (INIS)

    Prokes, K.; Brueck, E.; Nakotte, H.; De Chatel, P.F.; De Boer, F.R.

    1995-01-01

    The band widths of several UTX and U 2 T 2 X compounds (T: transition metal, X: p-metal) are evaluated by means of a tight-binding method. The magnetism in both groups of compounds is governed by the hybridization between U f-states and transition-metal d-states. Comparing the sum of all hybridization effects, we find approximately the same hybridization effects in both groups of compounds. We also observe a decrease of the band width with increasing atomic number Z within a transition-metal series. By comparing the band width with the theoretical critical energies for the f 3 and f 2 configurations, it is in some cases possible to predict whether the ground state is magnetically ordered or not. ((orig.))

  1. Surface characterization of U(AlxSi1-x)3 alloy and its interaction with O2 and H2O, at room temperature

    Science.gov (United States)

    Matmor, M.; Cohen, S.; Rafailov, G.; Vaknin, M.; Shamir, N.; Gouder, T.; Zalkind, S.

    2018-02-01

    Surface characterization and the interactions of U(AlxSi1-x)3 alloy (x = 0.57) with oxygen and water vapor were studied, utilizing X-Ray Photoelectron Spectroscopy and Direct Recoil Spectrometry, at room temperature. The U 4f spectrum of U(AlxSi1-x)3 alloy exhibits weak correlation satellites, suggesting an itinerant description of the U 5f states for this compound. The Al and Si 2p lines are chemically shifted to lower binding energies. Exposing the alloy to oxygen and water vapor results in oxidation of mainly the uranium and aluminum components, while silicon is only slightly oxidized. Oxygen was found to be a stronger oxidizer than water vapor and the trend is consistent with the more negative enthalpies of formation of metal oxides produced by the O2 reaction, as compared to H2O. During oxygen exposure, fast oxidation occurs by oxide islands nucleation and lateral growth, followed by oxidation of the sub-surface, up to ∼4 nm, at 1000 L exposure. Water initially reacts with the surface by full dissociation and oxide islands formation, which is then covered by hydroxides. Only a minor increase in the oxide thickness of up to ∼2.5 nm, was observed after coalescence.

  2. Uranium metalla-allenes with carbene imido R_2C=U"I"V=NR' units (R=Ph_2PNSiMe_3; R'=CPh_3): alkali-metal-mediated push-pull effects with an amido auxiliary

    International Nuclear Information System (INIS)

    Lu, Erli; Tuna, Floriana; Kaltsoyannis, Nikolas; Liddle, Stephen T.; Lewis, William

    2016-01-01

    We report uranium(IV)-carbene-imido-amide metalla-allene complexes [U(BIPM"T"M"S)(NCPh_3)(NHCPh_3)(M)] (BIPM"T"M"S=C(PPh_2NSiMe_3)_2; M=Li or K) that can be described as R_2C=U=NR' push-pull metalla-allene units, as organometallic counterparts of the well-known push-pull organic allenes. The solid-state structures reveal that the R_2C=U=NR' units adopt highly unusual cis-arrangements, which are also reproduced by gas-phase theoretical studies conducted without the alkali metals to remove their potential structure-directing roles. Computational studies confirm the double-bond nature of the U=NR' and U=CR_2 interactions, the latter increasingly attenuated by potassium then lithium when compared to the hypothetical alkali-metal-free anion. Combined experimental and theoretical data show that the push-pull effect induced by the alkali metal cations and amide auxiliary gives a fundamental and tunable structural influence over the C=U"I"V=N units. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. Behavior of Compact Toroid Injected into C-2U Confinement Vessel

    Science.gov (United States)

    Matsumoto, Tadafumi; Roche, T.; Allrey, I.; Sekiguchi, J.; Asai, T.; Conroy, M.; Gota, H.; Granstedt, E.; Hooper, C.; Kinley, J.; Valentine, T.; Waggoner, W.; Binderbauer, M.; Tajima, T.; the TAE Team

    2016-10-01

    The compact toroid (CT) injector system has been developed for particle refueling on the C-2U device. A CT is formed by a magnetized coaxial plasma gun (MCPG) and the typical ejected CT/plasmoid parameters are as follows: average velocity 100 km/s, average electron density 1.9 ×1015 cm-3, electron temperature 30-40 eV, mass 12 μg . To refuel particles into FC plasma the CT must penetrate the transverse magnetic field that surrounds the FRC. The kinetic energy density of the CT should be higher than magnetic energy density of the axial magnetic field, i.e., ρv2 / 2 >=B2 / 2μ0 , where ρ, v, and B are mass density, velocity, and surrounded magnetic field, respectively. Also, the penetrated CT's trajectory is deflected by the transverse magnetic field (Bz 1 kG). Thus, we have to estimate CT's energy and track the CT trajectory inside the magnetic field, for which we adopted a fast-framing camera on C-2U: framing rate is up to 1.25 MHz for 120 frames. By employing the camera we clearly captured the CT/plasmoid trajectory. Comparisons between the fast-framing camera and some other diagnostics as well as CT injection results on C-2U will be presented.

  4. The Influence of Oxidation on the Quality of U3O8 Kernels

    International Nuclear Information System (INIS)

    Damunir; Sukarsono; Indra Suryawan

    2002-01-01

    The influence of oxidation on quality of U 3 O 8 kernels have been studied. The investigated the influence was changed of time and temperature oxidation of Uranyl-4(ammonia)-2(polyvinyl alcohol) gel on surface area, pore radius, pore volume, porosity and diameter size of U 3 O 8 kernel. The spherical of uranyl-4(ammonia)-2(polyvinyl alcohol) containing 150g U/l were oxidized at 200-800 o C temperature for 2-24 hours, formed U 3 O 8 kernel. After that, the quality of U 3 O 8 kernel were measured by their physical properties i.e. the surface area and pore radius using Surface areameter with N 2 gas as absorbent. The pore volume and porosity using pycnometer with aquabidest of water as a solvent, diameter size using a optical microscope. The experiment results, showed that the time and temperature oxidation of uranyl-4(ammonia)-2(polyvinyl alcohol) grain the influence to quality of U 3 O 8 in formed the surface area of specific, pore radius, pore volume of specific, porosity, and diameter size of U 3 O 8 kernel. The best accurred at 600-800 o C oxidation temperature and oxidation time was 2-5 hours. The resulted quality of U 3 O 8 kernel i.e surface area of specific was 10.84 - 5.99 m 2 /g, pore volume of specific was 10.35x10 -2 - 3.23x10 -2 cc/g, pore radius was 21.05 - 24.62 Angstrom, diameter size was 1264 - 1456 μm and porosity was 49.49 - 21.36 % Vol with Cumulative analysis error was 8.55 % Vol. (author)

  5. Synthesis and X-ray Crystallography of [Mg(H2O)6][AnO2(C2H5COO)3]2 (An = U, Np, or Pu).

    Science.gov (United States)

    Serezhkin, Viktor N; Grigoriev, Mikhail S; Abdulmyanov, Aleksey R; Fedoseev, Aleksandr M; Savchenkov, Anton V; Serezhkina, Larisa B

    2016-08-01

    Synthesis and X-ray crystallography of single crystals of [Mg(H2O)6][AnO2(C2H5COO)3]2, where An = U (I), Np (II), or Pu (III), are reported. Compounds I-III are isostructural and crystallize in the trigonal crystal system. The structures of I-III are built of hydrated magnesium cations [Mg(H2O)6](2+) and mononuclear [AnO2(C2H5COO)3](-) complexes, which belong to the AB(01)3 crystallochemical group of uranyl complexes (A = AnO2(2+), B(01) = C2H5COO(-)). Peculiarities of intermolecular interactions in the structures of [Mg(H2O)6][UO2(L)3]2 complexes depending on the carboxylate ion L (acetate, propionate, or n-butyrate) are investigated using the method of molecular Voronoi-Dirichlet polyhedra. Actinide contraction in the series of U(VI)-Np(VI)-Pu(VI) in compounds I-III is reflected in a decrease in the mean An═O bond lengths and in the volume and sphericity degree of Voronoi-Dirichlet polyhedra of An atoms.

  6. Stabilization of He2(A(sup 3)Sigma(sub u)(+)) molecules in liquid helium by optical pumping for vacuum UV laser

    Science.gov (United States)

    Zmuidzinas, J. S. (Inventor)

    1978-01-01

    A technique is disclosed for achieving large populations of metastable spin-aligned He2(a 3 Sigma u +) molecules in superfluid helium to obtain lasing in the vacuum ultraviolet wavelength regime around 0.0800 micron m by electronically exciting liquid (superfluid) helium with a comparatively low-current electron beam and spin aligning the metastable molecules by means of optical pumping with a modestly-powered (100mW) circularly-polarized continuous wave laser operating at, for example, 0.9096 or 0.4650 micron m. Once a high concentration of spin-aligned He2 (a 3 Sigma u +) is achieved with lifetimes of a few milliseconds, a strong microwave signal destroys the spin alignment and induces a quick collisional transition of He2 (a 3 Sigma u +) molecules to the a 1 Sigma u + state and thereby a lasing transition to the X 1 Sigma g + state.

  7. Tank 241-U-103, grab samples 3U-99-1, 3u-99-2 and 3U-99-3 analytical results for the final report

    International Nuclear Information System (INIS)

    STEEN, F.H.

    1999-01-01

    This document is the final report for tank 241-U-103 grab samples. Three grab samples were collected from riser 13 on March 12, 1999 and received by the 222-S laboratory on March 15, 1999. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal Year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP

  8. 7 CFR 51.1002 - U.S. No. 2.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946.... No. 2 grade requirements only because of blanching shall be designated as “U.S. No. 2, Mixed Color...

  9. Transcription on lampbrush chromosome loops in the absence of U2 snRNA.

    OpenAIRE

    Tsvetkov, A; Jantsch, M; Wu, Z; Murphy, C; Gall, J G

    1992-01-01

    The five small nuclear RNAs (snRNAs) involved in splicing occur on the loops of amphibian lampbrush chromosomes and in hundreds to thousands of extrachromosomal granules called B snurposomes. To assess the role of these snRNAs during transcription and to explore possible relationships between the loops and B snurposomes, we injected single-stranded antisense oligodeoxynucleotides (oligos) against U1 and U2 snRNA into toad and newt oocytes. As shown before, antisense U1 and U2 oligos caused tr...

  10. Evaluation of fission cross sections and covariances for 233U, 235U, 238U, 239Pu, 240Pu, and 241Pu

    International Nuclear Information System (INIS)

    Kawano, Toshihiko; Matsunobu, Hiroyuki; Murata, Toru

    2000-02-01

    A simultaneous evaluation code SOK (Simultaneous evaluation on KALMAN) has been developed, which is a least-squares fitting program to absolute and relative measurements. The SOK code was employed to evaluate the fission cross sections of 233 U, 235 U, 238 U, 239 Pu, 240 Pu, and 241 Pu for the evaluated nuclear data library JENDL-3.3. Procedures of the simultaneous evaluation and the experimental database of the fission cross sections are described. The fission cross sections obtained were compared with evaluated values given in JENDL-3.2 and ENDF/B-VI. (author)

  11. Isotope shift of 234U, 236U, 238U in U I

    International Nuclear Information System (INIS)

    Gagne, J.M.; Nguyen Van, S.; Saint-Dizier, J.P.; Pianarosa, P.

    1976-01-01

    New and very accurate data of isotope shifts and relative isotope shifts in 234 U, 236 U, 238 U are presented. The invariance of the relative isotope shift, for the transitions we have investigated, supports the hypothesis that the so called specific mass effect is negligible in uranium

  12. Interdiffusion between U(Mo,Pt) or U(Mo,Zr) and Al or Al A356 alloy

    International Nuclear Information System (INIS)

    Komar Varela, C.; Mirandou, M.; Arico, S.; Balart, S.; Gribaudo, L.

    2009-01-01

    Solid state reactions in chemical diffusion couples U-7 wt.%Mo-0.9 wt.%Pt/Al at 580 deg. C and U-7 wt.%Mo-0.9 wt.%Pt/Al A356 alloy, U-7 wt.%Mo-1 wt.%Zr/Al and U-7 wt.%Mo-1 wt.%Zr/Al A356 alloy at 550 deg. C were characterized. Results were obtained from optical and scanning electron microscopy, electron probe microanalysis and X-ray diffraction. The UAl 3, UAl 4 and Al 20 Mo 2 U phases were identified in the interaction layers of γU(Mo,Pt)/Al and γU(Mo,Zr)/Al diffusion couples. Al 43 Mo 4 U 6 ternary compound was also identified in γU(Mo,Zr)/Al due to the decomposition of γU(Mo,Zr) phase. The U(Al,Si) 3 and U 3 Si 5 phases were identified in the interaction layers of γU(Mo,Pt)/Al A356 and γU(Mo,Zr)/Al A356 diffusion couples. These phases are formed due to the migration of Si to the interaction layer. In the diffusion couple U(Mo,Zr)/Al A356, Zr 5 Al 3 phase was also identified in the interaction layer. The use of synchrotron radiation at Brazilian Synchrotron Light Laboratory (LNLS, CNPq, Campinas, Brazil) was necessary to achieve a complete crystallographic characterization.

  13. Effect of the fabrication process on fatigue performance of U3Si2 fuel plate with sandwich structure

    International Nuclear Information System (INIS)

    Wang Xishu; Li Shuangshou; Wang Qingyuan; Xu Yong

    2005-01-01

    U 3 Si 2 -Al fuel plate is one of the dispersion fuel structure materials recently developed and widely used in research reactors. The mechanical properties of this structural material, especially the fatigue performance, are strongly dependent on its fabrication process. To investigate the effects of these processing technologies, the fatigue tests for the different specimens were carried out. The S-N curves indicate that the fabrication processing technologies of U 3 Si 2 fuel plate, such as the addition of U 3 Si 2 particles into aluminum powder to form the fuel meat, holding and rolling the processes of meat and cladding of 6061-Al alloy, plays an important role in improving the mechanical properties and fatigue performance of this fuel plate. In addition, some factors that influence the crack initiation and propagation are summarized based on the fatigue images that are in situ observations with SEM. The critical criterion for fatigue damage is proposed based on the fatigue data of the structural material, which were obtained at the different conditions

  14. Oxidation of uraninite: does tetragonal U3O7 occur in nature?

    International Nuclear Information System (INIS)

    Janeczek, J.; Ewing, R.C.; Thomas, L.E.

    1993-01-01

    Samples of uraninite and pitchblende annealed at 1200 C in H 2 , and untreated pitchblende were sequentially oxidized in air at 180-190 C, 230 C, and 300 C. Uraninite and untreated pitchblende oxidized to the U 4 O 9 -type oxide, and their X-ray symmetry remained isometric up to 300 C. Reduced pitchblende after oxidation to UO 2+x and U 4 O 9 -type oxides transformed into α-U 3 O 8 at 300 C. Two major mechanisms control uraninite and untreated pitchblende stability during oxidation: (1) Th and/or REE maintain charge balance and block oxygen interstitials near impurity cations; (2) the uraninite structure saturates with respect to excess oxygen and radiation-induced oxygen interstitials. Untreated pitchblende during oxidation behaved similarly to irradiated UO 2 in spent nuclear fuel; whereas, reduced pitchblende resembled nonirradiated UO 2 . An analysis of the data in the literature, as well as our own efforts to identify U 3 O 7 in samples from Cigar Lake, Canada, failed to provide conclusive evidence of the natural occurrence of tetragonal α-U 3 O 7 . Most probably, reported occurrences of U 3 O 7 are mixtures of isometric uraninites of slightly different compositions. (orig.)

  15. Ugonin U stimulates NLRP3 inflammasome activation and enhances inflammasome-mediated pathogen clearance

    Directory of Open Access Journals (Sweden)

    Chun-Yu Chen

    2017-04-01

    Full Text Available The NOD-like receptor pyrin domain 3 (NLRP3 inflammasome contains Nod-like receptors, a subclass of pattern recognition receptors, suggesting that this complex has a prominent role in host defenses. Various structurally diverse stimulators activate the NLRP3 inflammasome through different signaling pathways. We previously reported that ugonin U (UgU, a natural flavonoid isolated from Helminthostachys zeylanica (L Hook, directly stimulates phospholipase C (PLC and triggers superoxide release in human neutrophils. In the present study, we showed that UgU induced NLRP3 inflammasome assembly and subsequent caspase-1 and interleukin (IL-1β processing in lipopolysaccharide-primed human monocytes. Moreover, UgU elicited mitochondrial superoxide generation in a dose-dependent manner, and a specific scavenger of mitochondrial reactive oxygen species (ROS diminished UgU-induced IL-1β and caspase-1 activation. UgU induced Ca2+ mobilization, which was inhibited by treatment with inhibitors of PLC or inositol triphosphate receptor (IP3R. Blocking Ca2+ mobilization, PLC, or IP3R diminished UgU-induced IL-1β release, caspase-1 activation, and mitochondrial ROS generation. These data demonstrated that UgU activated the NLPR3 inflammasome activation through Ca2+ mobilization and the production of mitochondrial ROS. We also demonstrated that UgU-dependent NLRP3 inflammasome activation enhanced the bactericidal function of human monocytes. The ability of UgU to stimulate human neutrophils and monocytes, both of which are professional phagocytes, and its capacity to activate the NLRP3 inflammasome, which is a promising molecular target for developing anti-infective medicine, indicate that UgU treatment should be considered as a possible novel therapy for treating infectious diseases.

  16. U and Th background contents in the Crimea rocks, Th/U ratio interpretation

    International Nuclear Information System (INIS)

    Gerasimov, Yu.G.; Voronova, M.A.; AN Ukrainskoj SSR, Kiev. Inst. Geologicheskikh Nauk)

    1981-01-01

    Radiogeochemical sampling of rocks in the Crimea is carried out. Analyses for U are made by luminescence method, while for Th by X-ray one. About 1000 samples, characterizing the whole stratigraphical cross section except Pz of crystalline rocks, have been analyzed. Low background values for U and Th are established; U content of 1.3-2.3 g/kg and Th content of 7.0-9.0 g/kg are predominant, that is lower than the clark of the earth crust. The distribution of radioelements in stepper and submontane Crimea is gradual, while in mountain part - the mosaic one. Results of Th/U ratios interpretation are presented [ru

  17. Thermal Stabilization of 233UO2, 233UO3, and 233U3O8

    International Nuclear Information System (INIS)

    Thein, S.M.; Bereolos, P.J.

    2000-01-01

    This report identifies an appropriate thermal stabilization temperature for 233 U oxides. The temperature is chosen principally on the basis of eliminating moisture and other residual volatiles. This report supports the U. S. Department of Energy (DOE) Standard for safe storage of 233 U (DOE 2000), written as part of the response to Recommendation 97-1 of the Defense Nuclear Facilities Safety Board (DNFSB), addressing safe storage of 233 U

  18. The determination of molar volumes of uranous nitrate and nitric acid in systems of U(NO3)4-HNO3-H2O and U(NO3)4-HNO3-30% TBP kerosene

    International Nuclear Information System (INIS)

    Tao Chengying

    1986-01-01

    The data of molar volumes of uranous nitrate and nitric acid are necessary for the calculation of the changes in phase volume during the extraction in U(NO 3 ) 4 -HNO 3 /30%TBP-kerosene system. However, the data of the partial molar volume of U(NO 3 ) 4 are not available in literature. In the present work, the molar volumes of U(NO 3 ) 4 and HNO 3 are calculated by linear fitting of the experimental data. The result of the molar volume of HNO 3 is consistent with those in literature

  19. 78 FR 46256 - Scope and Definitions (2 U.S.C. 431)

    Science.gov (United States)

    2013-07-31

    ... FEDERAL ELECTION COMMISSION 11 CFR Part 100 Scope and Definitions (2 U.S.C. 431) CFR Correction In Title 11 of the Code of Federal Regulations, revised as of January 1, 2012, on page 42, in Sec. 100.19, a heading is added to paragraph (a) to read as follows: Sec. 100.19 File, filed or filing (2 U.S.C...

  20. Intake of 210Po, 234U and 238U radionuclides with beer in Poland

    International Nuclear Information System (INIS)

    Skwarzec, B.; Struminska, D.I.; Borylo, A.; Falandysz, J.

    2004-01-01

    238 U, 234 U and 210 Po activity concentrations were determined in beer in Poland by alpha-spectrometry with low-level activity silicon detectors. The results revealed that the mean concentrations of 238 U, 234 U and 210 Po in the analyzed beer samples were 4.63, 4.11 and 4.94 mBq x dm -3 , respectively, the highest in Tyskie (5.71 for 210 Po, 5.06 for 234 U and 6.11 for 238 U) and the lowest in Lech (2.49 for 210 Po). The effective radiation dose due to uranium and polonium ingestions by beer was calculated and were compared to the effective radiation dose from drinking water. (author)

  1. Single-site properties of U impurities doped in La2Zn17 (abstract)

    Science.gov (United States)

    Suzuki, H.; Anzai, K.; Takagi, S.

    1997-04-01

    Thermodynamic and transport properties of heavy Fermion (HF) U compounds show similar behavior to HF Ce compounds. Although most of the magnetic properties of HF Ce compounds can be qualitatively understood on the basis of the impurity Kondo model, no such consensus for HF U compounds has been reached. In addition to this, the single-site properties of U impurities are not understood so well, in contrast to the case of Ce impurities. Recent works for dilute U systems reported new features as are not seen in dilute Ce systems. We have investigated a dilute-U2Zn17 system of (La1-zUz)2Zn17 in order to reveal the single U ion site properties of this system by preparing single crystals. The impurity contributions to various physical quantities such as ρimp(T), χimp(T), and Cimp(T) can be scaled by the U concentration between z=0.025 and 0.05, and the system is considered as in the dilute limit still for z=0.05. The electrical resistivity shows the typical impurity-Kondo upturn at low temperatures. The electronic specific-heat coefficient is strongly enhanced (γimp≈1.5 J/K2 mole U) and about 4 times as large as that for dense U2Zn17. Suppressions of the Kondo effect by the magnetic field are seen in γimp(H) and magnetoresistance. The relatively large anisotropy in χimp(T) indicates an existence of the crystal field. These features of this system will be explained in terms of the Kondo effect in the presence of the crystal field.

  2. Investigations of mechanical properties and Debye temperature of U2Ti

    International Nuclear Information System (INIS)

    Chattaraj, D.; Dash, Smruti; Kulkarni, S.G.

    2012-01-01

    U 2 Ti is a potential solid state material for safe storage, supply and recovery of hydrogen isotopes. It is not pyrophoric and its hydride is resistance to powdering upon hydrogenation. These two properties made this alloy advantageous over the conventionally used uranium as tritium getter material. Hence, thorough study of material properties like thermodynamic and elastic properties of U 2 Ti is important. Recently, present authors have reported thermodynamic functions for U 2 Ti. However, elastic moduli of this alloy have not been reported. The second derivatives of the internal energy with respect to strain, gives adiabatic elastic constants. Thus adiabatic elastic constants are related to interatomic potentials of material. They are also related to the thermal properties of a solid through the Debye theory. For metal hydride material, the elastic constants are useful for an evaluation of the elastic contribution to the hydrogen-hydrogen interaction energy and the elastic energy associated with the precipitation of hydride phases. The present paper reports the ultrasonic measurement of the elastic moduli and Debye temperature of U 2 Ti at room temperature using 38 DL plus ultrasonic velocitymeter

  3. Quantification and isotope ratio measurement of boron in U3Si2 by inductively coupled plasma mass spectrometry

    International Nuclear Information System (INIS)

    Saha, Abhijit; Deb, S.B.; Nagar, B.K.; Saxena, M.K.; Samanta, Papu

    2014-01-01

    An analytical methodology was developed for precise quantification and isotope ratio measurement of boron in U 3 Si 2 matrix by using ICP-MS after matrix separation. The analytical technique was validated by recovery studies employing standard addition method and the accuracy in isotope ratio measurement was improved by correcting the bias factor after analyzing NIST SRM951. The quantification of B in the three U 3 Si 2 samples was found in the range of 2.32-3.90 μg g -1 with a maximum standard deviation of 3%. The 10 B/ 11 B value in the three samples was found to be 0.2455±0.0042, 0.2451±0.0036 and 0.2452±0.0041. (author)

  4. Hydrogen absorption properties of U6Mn and U6Ni

    International Nuclear Information System (INIS)

    Ito, H.; Yamawaki, M.; Yamamoto, T.

    1998-01-01

    The hydrogen absorption properties of U, U 6 Mn and U 6 Ni were investigated at hydrogen pressures below 10 5 Pa. The pressure-composition (P-C) isotherms of U, U 6 Mn and U 6 Ni were obtained and the amounts of absorbed hydrogen for U, U 6 Mn and U 6 Ni were determined to be 3, 16.6 and 16.0 for x in MH x , where M is U, U 6 Mn and U 6 Ni, respectively. The desorption plateau pressures at 573 K decreased in the order: U 6 Mn-H>U 6 Ni-H>U-H. In addition, the results for the amounts of absorbed hydrogen suggests the formation of ternary hydrides U 6 MnH 18 and U 6 NiH 14 . (orig.)

  5. Hydrolysis of U(VI) and sodium uranates

    International Nuclear Information System (INIS)

    Pongi, N.-K.; Double, Gerard; Hurwic, Jozef

    1980-01-01

    The potentiometric titration curves of UO 2 (NO 3 ) 2 aqueous solutions by NaOH have been interpreted. The results we have got verify and complete those published before. From isohydric species (UO 2 ) 3 (OH) 7 - , with pH = 7,8 and the experimental molar value of the relation xsub(i) = Na/U = 2.33, the following ionic and molecular species in acid medium have been deduced: (UO 2 ) 2 (OH) 2 2+ , (UO 2 ) 3 (OH) 2 2+ , (UO 2 ) 3 (OH) 5 + and (UO 2 ) 3 (OH) 6 . The composition of the precipitates corresponding to the particular points of the potentiometric titration curves, by chemical, thermal decomposition analysis and by X-rays diffraction, have been carried out: (UO 2 ) 6 (OH) 12 .6H 2 O, Na 2 U 8 O 25 , Na 2 U 6 O 19 , Na 2 U 4 O 13 and Na 2 U 2 O 7 for xsub(i) = 1,67 and 2.00, 2.23, 2.33, 2.52, 3.00 and over, respectively. The uranyl hydroxide was obtained for first time from an aqueous solution [fr

  6. Evolution of metastable state molecules N2(A3Σu+) in a nanosecond pulsed discharge: A particle-in-cell/Monte Carlo collisions simulation

    International Nuclear Information System (INIS)

    Gao Liang; Sun Jizhong; Feng Chunlei; Bai Jing; Ding Hongbin

    2012-01-01

    A particle-in-cell plus Monte Carlo collisions method has been employed to investigate the nitrogen discharge driven by a nanosecond pulse power source. To assess whether the production of the metastable state N 2 (A 3 Σ u + ) can be efficiently enhanced in a nanosecond pulsed discharge, the evolutions of metastable state N 2 (A 3 Σ u + ) density and electron energy distribution function have been examined in detail. The simulation results indicate that the ultra short pulse can modulate the electron energy effectively: during the early pulse-on time, high energy electrons give rise to quick electron avalanche and rapid growth of the metastable state N 2 (A 3 Σ u + ) density. It is estimated that for a single pulse with amplitude of -9 kV and pulse width 30 ns, the metastable state N 2 (A 3 Σ u + ) density can achieve a value in the order of 10 9 cm -3 . The N 2 (A 3 Σ u + ) density at such a value could be easily detected by laser-based experimental methods.

  7. Evolution of metastable state molecules N2(A3 Σu+) in a nanosecond pulsed discharge: A particle-in-cell/Monte Carlo collisions simulation

    Science.gov (United States)

    Gao, Liang; Sun, Jizhong; Feng, Chunlei; Bai, Jing; Ding, Hongbin

    2012-01-01

    A particle-in-cell plus Monte Carlo collisions method has been employed to investigate the nitrogen discharge driven by a nanosecond pulse power source. To assess whether the production of the metastable state N2(A3 Σu+) can be efficiently enhanced in a nanosecond pulsed discharge, the evolutions of metastable state N2(A3 Σu+) density and electron energy distribution function have been examined in detail. The simulation results indicate that the ultra short pulse can modulate the electron energy effectively: during the early pulse-on time, high energy electrons give rise to quick electron avalanche and rapid growth of the metastable state N2(A3 Σu+) density. It is estimated that for a single pulse with amplitude of -9 kV and pulse width 30 ns, the metastable state N2(A3 Σu+) density can achieve a value in the order of 109 cm-3. The N2(A3 Σu+) density at such a value could be easily detected by laser-based experimental methods.

  8. On the fusion in SL(2)-WZNW models and 6j symbols of U{sub q}sl(2) x U{sub q'}osp(1 vertical stroke 2)

    Energy Technology Data Exchange (ETDEWEB)

    Koesling, Jens

    2010-06-15

    We introduce a novel method to determine 6j-symbols of quantum groups. This method is inspired by the methods used in the determination of fusing matrices of WZNW models. With this method we determine the 6j-symbols of the quantum group U{sub q}sl(2) and the super quantum group U{sub q}osp(1 vertical stroke 2). We present the 6j-symbols as a recurrence relation and its initial values. The 6j-symbols transform between the s-channel and the u-channel decomposition of the invariants of the four-fold tensor product of modules of a quantum group. These invariants fulfil certain difference equations. We set one of the representations in the invariant to the fundamental representation, and deduce a system of linear equations for the initial values of the recurrence relation determining the 6j-symbols. (orig.)

  9. Ising versus S U (2) 2 string-net ladder

    Science.gov (United States)

    Vidal, Julien

    2018-03-01

    We consider the string-net model obtained from S U (2) 2 fusion rules. These fusion rules are shared by two different sets of anyon theories. In this paper, we study the competition between the two corresponding non-Abelian quantum phases in the ladder geometry. A detailed symmetry analysis shows that the nontrivial low-energy sector corresponds to the transverse-field cluster model that displays a critical point described by the s o (2) 1 conformal field theory. Other sectors are obtained by freezing spins in this model.

  10. Redox reactions of U(IV) and Pu(IV) with H2O2 generated in nitric acid media by power ultrasound

    International Nuclear Information System (INIS)

    Moisy, P.; Venault, L.; Madic, C.; Nikitenko, S.

    1998-01-01

    Power ultrasound causes water molecule dissociation on H o and OH o radicals due to high local temperatures and pressures generated in the cavitation threshold. In nitric acid media scavenging of OH o radicals with NO 3 - followed by NO 3 o radicals hydrolysis leads to H 2 O 2 formation. It was shown that H 2 O 2 generated under the effect of ultrasound with the frequency 20 kHz and intensity 1-3 Wcm -2 (Ar atmosphere) oxidizes U(IV) to U(VI) or reduces Pu(IV) to Pu(III) in 1-4 M HNO 3 in the presence of antinitrous reagents ( N 2 H 5 NO 3 or NH 2 SO 3 H). The effect of HNO 3 concentration and ultrasonic intensity on the kinetics of U(IV) oxidation and Pu(IV) reduction was studied. (author)

  11. Spectroscopy and electrochemistry of U(IV/III) in basic AlCl3-EMIC

    International Nuclear Information System (INIS)

    Anderson, C.J.; Deakin, M.R.; Choppin, G.R.; Heerman, L.; D'Olieslager, W.; Pruett, D.J.

    1990-01-01

    The electrochemistry of U(IV) has been investigated in the solvent AlCl 3 -1-ethyl-3-methyl imidazolium chloride (EMIC), a room temperature ionic liquid. In basic solutions ( 3 ) the reduction of U(IV) to U(III) on glassy carbon electrodes is reversible. Spectroscopic data as well as measurements of the formal potential for U(IV)/U(III) as a function of the basic melt composition indicate that U(IV) and U(III) are both hexachloro anions. Diffusion coefficients for these species have been measured by two methods. The values are comparable to those of transition metal hexachloro complexes in the same solvent, supporting the assignment of UCl 6 2- and UCl 6 3-

  12. Mechanism of disintegration of sup 2 sup 3 sup 8 U nuclei by relativistic projectiles

    CERN Document Server

    Andronenko, L N; Kravtsov, A V; Solyakin, G E

    2002-01-01

    The sup 2 sup 3 sup 8 U nuclei disintegration through the 16 GeV energy protons and sup 3 He 2 GeV energy nuclei are considered. The pulse mechanism compensation is proposed to explain the formation of collinear mass fragments accompanied by a large amount of charged secondaries and neutrons flying on the m sub 1 relativistic particle heavy nuclei on the account of the particle emission with the mass m sub 2 > m sub 1

  13. State diagram of U-Al-Si as a basis for analysis of the processes in nuclear fuel compositions based on U(Al, Si)3 and U3Si compounds

    International Nuclear Information System (INIS)

    Chebotarev, N.T.; Konovalov, L.N.; Zhmak, V.A.; Chebotarev, Ya.N.

    1996-01-01

    Results of studies into the Al-UAl 3 -USi 3 -Si of the U-Al-Si ternary system are presented. It is established that phase equilibrium between the intermetallic compound U(Al, Si) 3 and the aluminium-silicon alloys may be presented in form of conodes on the isothermal cross-section of the state diagram. It is shown that the U(Al, Si) 3 intermetallic compound, containing up to 6.5 at.% silicon, interacts both with liquid and solid aluminium with the U(Al, Si) 4 phase formation [ru

  14. U.S. phosphate industry as a source of U3O8 to the year 2000

    International Nuclear Information System (INIS)

    Borg, I.Y.

    1976-01-01

    U 3 O 8 recovered as a by-product of the phosphate fertilizer industry may equal 3600-5200 tons by 1985 and represent 7-10 percent of the anticipated annual U.S. demand. If the enormous U.S. phosphate reserves and resources are mined primarily for their uranium content they appear sufficient to fill more than twice the projected cumulative U.S. demand to the year 2000

  15. Nitric acid titration in the presence of UO2(NO3)2, Th(NO3)4, U(NO3)4 or Zr(NO3)4

    International Nuclear Information System (INIS)

    Nakashima, T.; Lieser, K.H.

    1986-01-01

    Procedures are described for titration of HNO 3 in presence of UO 2 2+ , Th 4+ , U 4+ and Zr 4+ without formation of interfering precipitates. In the first step the hydrolysable ions are masked by addition of complexing agents and in the second step the acid is titrated by NaOH as usual. (orig.)

  16. 238U, 234U and 230Th in uranium miners' lungs

    International Nuclear Information System (INIS)

    Singh, N.P.; Wrenn, M.E.; Bennett, D.B.; Archer, V.; Saccomanno, G.

    1982-01-01

    Fourteen uranium miners' lungs from the Colorado Plateau were collected at autopsy and the concentrations of 238 U, 234 U and 230 Th were determined by radiochemical procedures utilizing solvent extraction and alpha spectrometric techniques. The uranium and thorium isotopes are in near equilibrium with average concentrations of 238 U, 234 U and 230 Th being 89.3, 95.2, and 91.1 pCi/kg respectively. The combined average radiation dose rate to lung from these three isotopes is about 24.1 mrad/year at death excluding the unmeasured contribution from the 226 Ra and daughters. The average concentration of 230 Th is about 65 times higher than the mean concentration of 230 Th in lungs of non-miners from the same region dying at comparable ages

  17. Preparation methods of U3O8 powder for MTR fuel elements

    International Nuclear Information System (INIS)

    Leal Neto, R.M.; Riella, H.G.

    1990-01-01

    Three preparation methods of U 3 O 8 powder have been studied with the aim of finding a simple and economic processing route: grinding of sintered U 3 O 8 pellets (Method-1); sintering of U 3 O 8 calcined granules (Method-2); and sintering of ammonium diuranate (ADU) granules (Method-3). Granulometric yield, powder characteristics and processing steps and difficulties have been taken into account for comparison purposes. Method-2 have been found to give the best results. Method-3 gives also good results, but there were some difficulties with ADU handling. (author) [pt

  18. Fabrication and microstructural analysis of UN-U{sub 3}Si{sub 2} composites for accident tolerant fuel applications

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Kyle D., E-mail: kylej@kth.se; Raftery, Alicia M.; Lopes, Denise Adorno; Wallenius, Janne

    2016-08-15

    In this study, U{sub 3}Si{sub 2} was synthesized via the use of arc-melting and mixed with UN powders, which together were sintered using the SPS method. The study revealed a number of interesting conclusions regarding the stability of the system – namely the formation of a probable but as yet unidentified ternary phase coupled with the reduction of the stoichiometry in the nitride phase – as well as some insights into the mechanics of the sintering process itself. By milling the silicide powders and reducing its particle size ratio compared to UN, it was possible to form a high density UN-U{sub 3}Si{sub 2} composite, with desirable microstructural characteristics for accident tolerant fuel applications. - Highlights: • U{sub 3}Si{sub 2} fabricated from elemental uranium and silicon through arc melting. • Homogeneity of the silicides assessed through densitometry, XRD, SEM and EDS, chemical etching and optical microscopy. • UN powder fabricated using hydriding-nitriding method. • No phase transformations detected when sintering using silicide particle sizes less than UN particle size. • High density composite (98%TD) fabricated with silicide grain coating using spark plasma sintering at 1450 °C.

  19. A survey of the mechanical properties of uranium alloys U-5Mo-3Nb wt.% and U-3Mo-3Nb wt.%

    Energy Technology Data Exchange (ETDEWEB)

    Dupont, G.

    1969-04-15

    In a continuing program on the development of soft and ductile uranium alloys for armament applications, two compositions were studied. These gamma extruded uranium alloys were U-5Mo-3Nb wt.% and U-3Mo-3Nb wt.%. This study was carried out to determine the influence of tempering heat treatments associated with extrusion on the ductility of these uranium alloys. The mechanical properties of both alloys were measured in the extruded condition, in the extruded and annealed condition and in the quenched and tempered condition. A maximum elongation of 13.7% in tension with a low amount of work hardening was obtained for the U-3Mo-3Nb wt.% alloy after 1 1/2 hours anneal at 1200 deg F (650 deg C) followed by a rapid cooling in water at 70 deg F (21 deg C). A maximum elongation of 17.3% with a large amount of work hardening was obtained for alloy U-5Mo-3Nb wt.% after vacuum annealing, normalizing, gamma phase solubilizing at 1500 deg F (815 deg C) and quenching in water at 700 deg F (210 deg C). The maximum ductility achieved in these two alloys by our approaches is low compared with the ductility of Armco Iron employed for the same applications in the field of ballistics.

  20. Obtaining of U-2.5Zr7.5Nb and U-3Zr-9Nb alloys by sintering process

    International Nuclear Information System (INIS)

    Mazzeu, Thiago de Oliveira; Paula, Joao Bosco de; Ferraz, Wilmar Barbosa; Santos, Ana Maria Matildes dos; Brina, Jose Giovanni Mascarenhas

    2011-01-01

    The development of metallic fuels with low enrichment to be used in research and test reactors, as well in the future pressurized water reactors, focuses on the search for uranium alloys of high density. Alloying elements such as Zr, Nb and Mo are added to uranium to improve fuel performance in reactors. In this context, the Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) in Belo Horizonte is developing the U-2.5Zr-7.5Nb and U- 3Zr-9Nb (weight %) alloys by the innovative process of sintering that utilizes raw materials in the form of powders. The powders were pressed at 400MPa and then sintered under a vacuum of about 5 x 10-6 Torr at temperatures ranging from 1050 deg to 1300 deg C. The densities of the alloys were measured geometrically and by hydrostatic method using water. The microstructures of the pellets were observed by scanning electron microscopy (SEM) and the elements of alloying were identified by energy dispersive X-ray spectroscopy (SEM/EDS) analysis. The obtained results showed a small increasing density with rising sintering temperature. The highest density achieved was approximately 80% of theoretical density. It was also qualitatively observed that the superficial oxidation of the pellets increased with increasing sintering temperature thus avoiding the fusion of the alloys at higher temperatures. (author)

  1. 49 CFR 526.2 - U.S. production by foreign manufacturer.

    Science.gov (United States)

    2010-10-01

    ... TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION PETITIONS AND PLANS FOR RELIEF UNDER THE... product plan and the assumption that the petition will be granted: (1) A description of the model type...; (2) U.S. sales projected for the model type; (3) The average percentage of the cost to the...

  2. Facile CO cleavage by a multimetallic CsU2 nitride complex

    International Nuclear Information System (INIS)

    Falcone, Marta; Scopelliti, Rosario; Mazzanti, Marinella; Kefalidis, Christos E.; Maron, Laurent

    2016-01-01

    Uranium nitrides are important materials with potential for application as fuels for nuclear power generation, and as highly active catalysts. Molecular nitride compounds could provide important insight into the nature of the uranium-nitride bond, but currently little is known about their reactivity. In this study, we found that a complex containing a nitride bridging two uranium centers and a cesium cation readily cleaved the C≡O bond (one of the strongest bonds in nature) under ambient conditions. The product formed has a [CsU 2 (μ-CN)(μ-O)] core, thus indicating that the three cations cooperate to cleave CO. Moreover, the addition of MeOTf to the nitride complex led to an exceptional valence disproportionation of the CsU IV -N-U IV core to yield CsU III (OTf) and [MeN=U V ] fragments. The important role of multimetallic cooperativity in both reactions is illustrated by the computed reaction mechanisms.

  3. Facile CO Cleavage by a Multimetallic CsU2 Nitride Complex.

    Science.gov (United States)

    Falcone, Marta; Kefalidis, Christos E; Scopelliti, Rosario; Maron, Laurent; Mazzanti, Marinella

    2016-09-26

    Uranium nitrides are important materials with potential for application as fuels for nuclear power generation, and as highly active catalysts. Molecular nitride compounds could provide important insight into the nature of the uranium-nitride bond, but currently little is known about their reactivity. In this study, we found that a complex containing a nitride bridging two uranium centers and a cesium cation readily cleaved the C≡O bond (one of the strongest bonds in nature) under ambient conditions. The product formed has a [CsU2 (μ-CN)(μ-O)] core, thus indicating that the three cations cooperate to cleave CO. Moreover, the addition of MeOTf to the nitride complex led to an exceptional valence disproportionation of the CsU(IV) -N-U(IV) core to yield CsU(III) (OTf) and [MeN=U(V) ] fragments. The important role of multimetallic cooperativity in both reactions is illustrated by the computed reaction mechanisms. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Ce2Co3Ge5: a new U2Co3Si5 - type valance fluctuating compound

    International Nuclear Information System (INIS)

    Layek, Samar; Hossain, Zakir

    2010-01-01

    Poly crystalline sample of Ce 2 Co 3 Ge 5 have been prepared by arc melting and consequently annealing at 1100 deg C. Rietveld refinement of XRD shows that it crystallize in the orthorhombic U 2 Co 3 Si 5 structure (space group Ibam) with crystal parameters a= 9.802A, b= 11.777A and c= 5.941A and unit cell volume V= 684.8 A 3 The unit cell volume of Ce 2 Co 3 Ge 5 is seen clearly to deviate from that expected on the basis of lanthanide contraction. From susceptibility measurement, effective magnetic moment of this compound μ eff = 0.95 μ B which is lower than magnetic moment free for Ce 3+ ions (2.54 μB) but higher than that of non-magnetic Ce 4+ state (0 μ B ). All these results clearly indicated Ce 2 Co 3 Ge 5 to be a mixed valance compound. (author)

  5. Effect of temperature on the expansion and microstructure Of U3 Si2-AI mini plate fuel of 3.6 g/cm3 uranium loading

    International Nuclear Information System (INIS)

    Ginting, A. Br.; Samosir, N.; Suparjo; Nasution, H.

    2000-01-01

    Expansion analysis has been conducted to 50 x 20-mm U 3 Si 2 -AI mini plate of 3.6 g/cm 3 uranium loading using dilatometer. The analysis was carried out at various temperatures of 170 o C, 350 o C and 550 o C in Argon medium with delay time 4 days. The result showed that the fuel plate was relatively stable with increasing of heating time but underwent significant expansion. Heating at 170 o C, 350 o C and 550 o C resulted in the expansion of the U 3 Si 2 -AI fuel plate of to 83-212 mum, 333-475 mum, and 433-724 mum with coefficient expansion of 24.2x10 -6 / o C - 24.3x10 -6 / o C, 25.5x10 -6 / o C - 26.2x10 -6 /'oC and 26.6 x 10 -6 / o C - 28.2 x 10 -6 / o C respectively. Microanalysis of the U 3 Si 2 -AI mini plate fuel with SEM-EDS upon heating at those temperature variation showed that microstructure change didn't occur at 170 o C, mean while interaction between AIMg2 cladding and the fuel meat appeared to take place at 350 o C and 550 o C. Data on the expansion and microstructure change of U 3 Si 2 -AI fuel plate upon heating are of great important for the manufacture/fabrication of research fuel plate to produce silicide fuel element for higher uranium loading. (author)

  6. Azimuthal Anisotropy in U +U and Au +Au Collisions at RHIC

    Science.gov (United States)

    Adamczyk, L.; Adkins, J. K.; Agakishiev, G.; Aggarwal, M. M.; Ahammed, Z.; Alekseev, I.; Alford, J.; Aparin, A.; Arkhipkin, D.; Aschenauer, E. C.; Averichev, G. S.; Banerjee, A.; Bellwied, R.; Bhasin, A.; Bhati, A. K.; Bhattarai, P.; Bielcik, J.; Bielcikova, J.; Bland, L. C.; Bordyuzhin, I. G.; Bouchet, J.; Brandin, A. V.; Bunzarov, I.; Burton, T. P.; Butterworth, J.; Caines, H.; Calderón de la Barca Sánchez, M.; Campbell, J. M.; Cebra, D.; Cervantes, M. C.; Chakaberia, I.; Chaloupka, P.; Chang, Z.; Chattopadhyay, S.; Chen, J. H.; Chen, X.; Cheng, J.; Cherney, M.; Christie, W.; Contin, G.; Crawford, H. J.; Das, S.; De Silva, L. C.; Debbe, R. R.; Dedovich, T. G.; Deng, J.; Derevschikov, A. A.; di Ruzza, B.; Didenko, L.; Dilks, C.; Dong, X.; Drachenberg, J. L.; Draper, J. E.; Du, C. M.; Dunkelberger, L. E.; Dunlop, J. C.; Efimov, L. G.; Engelage, J.; Eppley, G.; Esha, R.; Evdokimov, O.; Eyser, O.; Fatemi, R.; Fazio, S.; Federic, P.; Fedorisin, J.; Feng, Z.; Filip, P.; Fisyak, Y.; Flores, C. E.; Fulek, L.; Gagliardi, C. A.; Garand, D.; Geurts, F.; Gibson, A.; Girard, M.; Greiner, L.; Grosnick, D.; Gunarathne, D. S.; Guo, Y.; Gupta, S.; Gupta, A.; Guryn, W.; Hamad, A.; Hamed, A.; Haque, R.; Harris, J. W.; He, L.; Heppelmann, S.; Heppelmann, S.; Hirsch, A.; Hoffmann, G. W.; Hofman, D. J.; Horvat, S.; Huang, H. Z.; Huang, B.; Huang, X.; Huck, P.; Humanic, T. J.; Igo, G.; Jacobs, W. W.; Jang, H.; Jiang, K.; Judd, E. G.; Kabana, S.; Kalinkin, D.; Kang, K.; Kauder, K.; Ke, H. W.; Keane, D.; Kechechyan, A.; Khan, Z. H.; Kikola, D. P.; Kisel, I.; Kisiel, A.; Koetke, D. D.; Kollegger, T.; Kosarzewski, L. K.; Kotchenda, L.; Kraishan, A. F.; Kravtsov, P.; Krueger, K.; Kulakov, I.; Kumar, L.; Kycia, R. A.; Lamont, M. A. C.; Landgraf, J. M.; Landry, K. D.; Lauret, J.; Lebedev, A.; Lednicky, R.; Lee, J. H.; Li, W.; Li, Y.; Li, C.; Li, Z. M.; Li, X.; Li, X.; Lisa, M. A.; Liu, F.; Ljubicic, T.; Llope, W. J.; Lomnitz, M.; Longacre, R. S.; Luo, X.; Ma, L.; Ma, R.; Ma, Y. G.; Ma, G. L.; Magdy, N.; Majka, R.; Manion, A.; Margetis, S.; Markert, C.; Masui, H.; Matis, H. S.; McDonald, D.; Meehan, K.; Minaev, N. G.; Mioduszewski, S.; Mohanty, B.; Mondal, M. M.; Morozov, D. A.; Mustafa, M. K.; Nandi, B. K.; Nasim, Md.; Nayak, T. K.; Nigmatkulov, G.; Nogach, L. V.; Noh, S. Y.; Novak, J.; Nurushev, S. B.; Odyniec, G.; Ogawa, A.; Oh, K.; Okorokov, V.; Olvitt, D. L.; Page, B. S.; Pak, R.; Pan, Y. X.; Pandit, Y.; Panebratsev, Y.; Pawlik, B.; Pei, H.; Perkins, C.; Peterson, A.; Pile, P.; Planinic, M.; Pluta, J.; Poljak, N.; Poniatowska, K.; Porter, J.; Posik, M.; Poskanzer, A. M.; Pruthi, N. K.; Putschke, J.; Qiu, H.; Quintero, A.; Ramachandran, S.; Raniwala, S.; Raniwala, R.; Ray, R. L.; Ritter, H. G.; Roberts, J. B.; Rogachevskiy, O. V.; Romero, J. L.; Roy, A.; Ruan, L.; Rusnak, J.; Rusnakova, O.; Sahoo, N. R.; Sahu, P. K.; Sakrejda, I.; Salur, S.; Sandweiss, J.; Sarkar, A.; Schambach, J.; Scharenberg, R. P.; Schmah, A. M.; Schmidke, W. B.; Schmitz, N.; Seger, J.; Seyboth, P.; Shah, N.; Shahaliev, E.; Shanmuganathan, P. V.; Shao, M.; Sharma, B.; Sharma, M. K.; Shen, W. Q.; Shi, S. S.; Shou, Q. Y.; Sichtermann, E. P.; Sikora, R.; Simko, M.; Skoby, M. J.; Smirnov, D.; Smirnov, N.; Song, L.; Sorensen, P.; Spinka, H. M.; Srivastava, B.; Stanislaus, T. D. S.; Stepanov, M.; Stock, R.; Strikhanov, M.; Stringfellow, B.; Sumbera, M.; Summa, B. J.; Sun, X.; Sun, X. M.; Sun, Z.; Sun, Y.; Surrow, B.; Svirida, D. N.; Szelezniak, M. A.; Tang, Z.; Tang, A. H.; Tarnowsky, T.; Tawfik, A. N.; Thomas, J. H.; Timmins, A. R.; Tlusty, D.; Tokarev, M.; Trentalange, S.; Tribble, R. E.; Tribedy, P.; Tripathy, S. K.; Trzeciak, B. A.; Tsai, O. D.; Ullrich, T.; Underwood, D. G.; Upsal, I.; Van Buren, G.; van Nieuwenhuizen, G.; Vandenbroucke, M.; Varma, R.; Vasiliev, A. N.; Vertesi, R.; Videbaek, F.; Viyogi, Y. P.; Vokal, S.; Voloshin, S. A.; Vossen, A.; Wang, F.; Wang, Y.; Wang, H.; Wang, J. S.; Wang, Y.; Wang, G.; Webb, G.; Webb, J. C.; Wen, L.; Westfall, G. D.; Wieman, H.; Wissink, S. W.; Witt, R.; Wu, Y. F.; Xiao, Z.; Xie, W.; Xin, K.; Xu, Y. F.; Xu, N.; Xu, Z.; Xu, Q. H.; Xu, H.; Yang, Y.; Yang, Y.; Yang, C.; Yang, S.; Yang, Q.; Ye, Z.; Yepes, P.; Yi, L.; Yip, K.; Yoo, I.-K.; Yu, N.; Zbroszczyk, H.; Zha, W.; Zhang, X. P.; Zhang, J. B.; Zhang, J.; Zhang, Z.; Zhang, S.; Zhang, Y.; Zhang, J. L.; Zhao, F.; Zhao, J.; Zhong, C.; Zhou, L.; Zhu, X.; Zoulkarneeva, Y.; Zyzak, M.; STAR Collaboration

    2015-11-01

    Collisions between prolate uranium nuclei are used to study how particle production and azimuthal anisotropies depend on initial geometry in heavy-ion collisions. We report the two- and four-particle cumulants, v2{2 } and v2{4 }, for charged hadrons from U +U collisions at √{sNN }=193 GeV and Au +Au collisions at √{sNN}=200 GeV . Nearly fully overlapping collisions are selected based on the energy deposited by spectators in zero degree calorimeters (ZDCs). Within this sample, the observed dependence of v2{2 } on multiplicity demonstrates that ZDC information combined with multiplicity can preferentially select different overlap configurations in U +U collisions. We also show that v2 vs multiplicity can be better described by models, such as gluon saturation or quark participant models, that eliminate the dependence of the multiplicity on the number of binary nucleon-nucleon collisions.

  7. Azimuthal Anisotropy in U+U and Au+Au Collisions at RHIC.

    Science.gov (United States)

    Adamczyk, L; Adkins, J K; Agakishiev, G; Aggarwal, M M; Ahammed, Z; Alekseev, I; Alford, J; Aparin, A; Arkhipkin, D; Aschenauer, E C; Averichev, G S; Banerjee, A; Bellwied, R; Bhasin, A; Bhati, A K; Bhattarai, P; Bielcik, J; Bielcikova, J; Bland, L C; Bordyuzhin, I G; Bouchet, J; Brandin, A V; Bunzarov, I; Burton, T P; Butterworth, J; Caines, H; Calderón de la Barca Sánchez, M; Campbell, J M; Cebra, D; Cervantes, M C; Chakaberia, I; Chaloupka, P; Chang, Z; Chattopadhyay, S; Chen, J H; Chen, X; Cheng, J; Cherney, M; Christie, W; Contin, G; Crawford, H J; Das, S; De Silva, L C; Debbe, R R; Dedovich, T G; Deng, J; Derevschikov, A A; di Ruzza, B; Didenko, L; Dilks, C; Dong, X; Drachenberg, J L; Draper, J E; Du, C M; Dunkelberger, L E; Dunlop, J C; Efimov, L G; Engelage, J; Eppley, G; Esha, R; Evdokimov, O; Eyser, O; Fatemi, R; Fazio, S; Federic, P; Fedorisin, J; Feng, Z; Filip, P; Fisyak, Y; Flores, C E; Fulek, L; Gagliardi, C A; Garand, D; Geurts, F; Gibson, A; Girard, M; Greiner, L; Grosnick, D; Gunarathne, D S; Guo, Y; Gupta, S; Gupta, A; Guryn, W; Hamad, A; Hamed, A; Haque, R; Harris, J W; He, L; Heppelmann, S; Heppelmann, S; Hirsch, A; Hoffmann, G W; Hofman, D J; Horvat, S; Huang, H Z; Huang, B; Huang, X; Huck, P; Humanic, T J; Igo, G; Jacobs, W W; Jang, H; Jiang, K; Judd, E G; Kabana, S; Kalinkin, D; Kang, K; Kauder, K; Ke, H W; Keane, D; Kechechyan, A; Khan, Z H; Kikola, D P; Kisel, I; Kisiel, A; Koetke, D D; Kollegger, T; Kosarzewski, L K; Kotchenda, L; Kraishan, A F; Kravtsov, P; Krueger, K; Kulakov, I; Kumar, L; Kycia, R A; Lamont, M A C; Landgraf, J M; Landry, K D; Lauret, J; Lebedev, A; Lednicky, R; Lee, J H; Li, W; Li, Y; Li, C; Li, Z M; Li, X; Li, X; Lisa, M A; Liu, F; Ljubicic, T; Llope, W J; Lomnitz, M; Longacre, R S; Luo, X; Ma, L; Ma, R; Ma, Y G; Ma, G L; Magdy, N; Majka, R; Manion, A; Margetis, S; Markert, C; Masui, H; Matis, H S; McDonald, D; Meehan, K; Minaev, N G; Mioduszewski, S; Mohanty, B; Mondal, M M; Morozov, D A; Mustafa, M K; Nandi, B K; Nasim, Md; Nayak, T K; Nigmatkulov, G; Nogach, L V; Noh, S Y; Novak, J; Nurushev, S B; Odyniec, G; Ogawa, A; Oh, K; Okorokov, V; Olvitt, D L; Page, B S; Pak, R; Pan, Y X; Pandit, Y; Panebratsev, Y; Pawlik, B; Pei, H; Perkins, C; Peterson, A; Pile, P; Planinic, M; Pluta, J; Poljak, N; Poniatowska, K; Porter, J; Posik, M; Poskanzer, A M; Pruthi, N K; Putschke, J; Qiu, H; Quintero, A; Ramachandran, S; Raniwala, S; Raniwala, R; Ray, R L; Ritter, H G; Roberts, J B; Rogachevskiy, O V; Romero, J L; Roy, A; Ruan, L; Rusnak, J; Rusnakova, O; Sahoo, N R; Sahu, P K; Sakrejda, I; Salur, S; Sandweiss, J; Sarkar, A; Schambach, J; Scharenberg, R P; Schmah, A M; Schmidke, W B; Schmitz, N; Seger, J; Seyboth, P; Shah, N; Shahaliev, E; Shanmuganathan, P V; Shao, M; Sharma, B; Sharma, M K; Shen, W Q; Shi, S S; Shou, Q Y; Sichtermann, E P; Sikora, R; Simko, M; Skoby, M J; Smirnov, D; Smirnov, N; Song, L; Sorensen, P; Spinka, H M; Srivastava, B; Stanislaus, T D S; Stepanov, M; Stock, R; Strikhanov, M; Stringfellow, B; Sumbera, M; Summa, B J; Sun, X; Sun, X M; Sun, Z; Sun, Y; Surrow, B; Svirida, D N; Szelezniak, M A; Tang, Z; Tang, A H; Tarnowsky, T; Tawfik, A N; Thomas, J H; Timmins, A R; Tlusty, D; Tokarev, M; Trentalange, S; Tribble, R E; Tribedy, P; Tripathy, S K; Trzeciak, B A; Tsai, O D; Ullrich, T; Underwood, D G; Upsal, I; Van Buren, G; van Nieuwenhuizen, G; Vandenbroucke, M; Varma, R; Vasiliev, A N; Vertesi, R; Videbaek, F; Viyogi, Y P; Vokal, S; Voloshin, S A; Vossen, A; Wang, F; Wang, Y; Wang, H; Wang, J S; Wang, Y; Wang, G; Webb, G; Webb, J C; Wen, L; Westfall, G D; Wieman, H; Wissink, S W; Witt, R; Wu, Y F; Xiao, Z; Xie, W; Xin, K; Xu, Y F; Xu, N; Xu, Z; Xu, Q H; Xu, H; Yang, Y; Yang, Y; Yang, C; Yang, S; Yang, Q; Ye, Z; Yepes, P; Yi, L; Yip, K; Yoo, I-K; Yu, N; Zbroszczyk, H; Zha, W; Zhang, X P; Zhang, J B; Zhang, J; Zhang, Z; Zhang, S; Zhang, Y; Zhang, J L; Zhao, F; Zhao, J; Zhong, C; Zhou, L; Zhu, X; Zoulkarneeva, Y; Zyzak, M

    2015-11-27

    Collisions between prolate uranium nuclei are used to study how particle production and azimuthal anisotropies depend on initial geometry in heavy-ion collisions. We report the two- and four-particle cumulants, v_{2}{2} and v_{2}{4}, for charged hadrons from U+U collisions at sqrt[s_{NN}]=193  GeV and Au+Au collisions at sqrt[s_{NN}]=200  GeV. Nearly fully overlapping collisions are selected based on the energy deposited by spectators in zero degree calorimeters (ZDCs). Within this sample, the observed dependence of v_{2}{2} on multiplicity demonstrates that ZDC information combined with multiplicity can preferentially select different overlap configurations in U+U collisions. We also show that v_{2} vs multiplicity can be better described by models, such as gluon saturation or quark participant models, that eliminate the dependence of the multiplicity on the number of binary nucleon-nucleon collisions.

  8. Semidirect product gauge group [SU(3)cxSU(2)L]xU(1)Y and quantization of hypercharge

    International Nuclear Information System (INIS)

    Hattori, Chuichiro; Matsunaga, Mamoru; Matsuoka, Takeo

    2011-01-01

    In the standard model the hypercharges of quarks and leptons are not determined by the gauge group SU(3) c xSU(2) L xU(1) Y alone. We show that, if we choose the semidirect product group [SU(3) c xSU(2) L ]xU(1) Y as its gauge group, the hyperchages are settled to be n/6 mod Z(n=0,1,3,4). In addition, the conditions for gauge-anomaly cancellation give strong constraints. As a result, the ratios of the hypercharges are uniquely determined and the gravitational anomaly is automatically canceled. The standard charge assignment to quarks and leptons can be properly reproduced. For exotic matter fields their hypercharges are also discussed.

  9. The upgrade of the Thomson scattering system for measurement on the C-2/C-2U devices

    Energy Technology Data Exchange (ETDEWEB)

    Zhai, K.; Schindler, T.; Kinley, J.; Deng, B.; Thompson, M. C. [Tri Alpha Energy, Inc., P.O. Box 7010, Rancho Santa Margarita, California 92688 (United States)

    2016-11-15

    The C-2/C-2U Thomson scattering system has been substantially upgraded during the latter phase of C-2/C-2U program. A Rayleigh channel has been added to each of the three polychromators of the C-2/C-2U Thomson scattering system. Onsite spectral calibration has been applied to avoid the issue of different channel responses at different spots on the photomultiplier tube surface. With the added Rayleigh channel, the absolute intensity response of the system is calibrated with Rayleigh scattering in argon gas from 0.1 to 4 Torr, where the Rayleigh scattering signal is comparable to the Thomson scattering signal at electron densities from 1 × 10{sup 13} to 4 × 10{sup 14} cm{sup −3}. A new signal processing algorithm, using a maximum likelihood method and including detailed analysis of different noise contributions within the system, has been developed to obtain electron temperature and density profiles. The system setup, spectral and intensity calibration procedure and its outcome, data analysis, and the results of electron temperature/density profile measurements will be presented.

  10. Preparation of neptunium and plutonium tracers in nuclear reactions of sup 2 sup 3 sup 6 U with (21-60)MeV sup 3 He ions

    CERN Document Server

    Aaltonen, J; Trzaska, V; Gromova, E A; Yakovlev, V A

    2001-01-01

    Preparation of sup 2 sup 3 sup 6 Pu, sup 2 sup 3 sup 7 Pu and sup 2 sup 3 sup 5 Np by reactions sup 2 sup 3 sup 6 U( sup 3 He, t beta sup -) sup 2 sup 3 sup 6 Pu, sup 2 sup 3 sup 6 U( sup 3 He, 2n) sup 2 sup 3 sup 7 Pu and sup 2 sup 3 sup 6 U( sup 3 He, p3n) sup 2 sup 3 sup 5 Np in sup 3 He ion beams, their energy 43 and 60 MeV, in the K-130 cyclotron at Yuvyaskyul University (Finland) was studied. Cross sections of the reactions were determined. Yield curves for thick targets were calculated. The results are discussed and compared with previously obtained data on other reactions giving rise to formation of the same products. Methods of radiochemical separation of the products and sample preparation for alpha- and gamma-spectrometry are described

  11. Structure of tris(trimethylsilylcyclopentadienyl)uranium(III), [(CH3)3SiC5H43U

    International Nuclear Information System (INIS)

    Brennan, J.; Andersen, R.A.; Zalkin, A.

    1986-02-01

    Crystals of [(CH 3 ) 3 SiC 5 H 4 ] 3 U are orthorhombic, Pbca, with a = 22.630(8), b = 29.177(10) and c = 8.428(3) A at 23 0 C. For Z = 8 the calculated density is 1.551 g/cm 3 . The structure was refined by full-matrix least-squares to a conventional R factor of 0.041 [2251 data, F 2 > 2 sigma(F 2 )]. The uranium atom is bonded to the three cyclopentadienyl rings in a pentahapto fashion and is in the plane of the ring centroids. The U to ring distances are 2.54, 2.47 and 2.51 A, and the average U-C distance is 2.78 +- 0.04 A. 7 refs., 1 fig., 3 tabs

  12. Enzymatic U(VI) reduction by Desulfosporosinus species

    International Nuclear Information System (INIS)

    Suzuki, Y.; Kelly, S.D.; Kemner, K.M.; Banfield, J.F.

    2004-01-01

    Here we tested U(VI) reduction by a Desulfosporosinus species (sp.) isolate and type strain (DSM 765) in cell suspensions (pH 7) containing 1 mM U(VI) and lactate, under an atmosphere containing N 2 -CO 2 -H 2 (90: 5: 5). Although neither Desulfosporosinus species (spp.) reduced U(VI) in cell suspensions with 0.25% Na-bicarbonate or 0.85% NaCl, U(VI) was reduced in these solutions by a control strain, desulfovibrio desulfuricans (ATCC 642). However, both Desulfosporosinus strains reduced U(VI) in cell suspensions depleted in bicarbonate and NaCl. No U(VI) reduction was observed without lactate and H 2 electron donors or with heat-killed cells, indicating enzymatic U(VI) reduction. Uranium(VI) reduction by both strains was inhibited when 1 mM CuCl 2 was added to the cell suspensions. Because the Desulfosporosinus DSM 765 does not contain cytochrome c 3 used by Desulfovibrio spp. to reduce U(VI), Desulfosporosinus species reduce uranium via a different enzymatic pathway. (orig.)

  13. Energy distribution of neutrons from the (n,2n) reaction in 238U

    International Nuclear Information System (INIS)

    Misulovin, A.

    1978-12-01

    Energy distribution of the first and second neutrons from (n,2n) scattering event in 238 U was evaluated according to the consistent compound nucleus model recently proposed by Segev. The law for deriving the energy distribution of secondary neutrons from a (n,2n) scattering event, depends on whether the reaction is considered as a simultaneous emission of two neutrons from one compound nucleus, or a successive emission of neutrons from different compound nuclei. Segev has presented a means of calculating the energy distribution assuming the latter model. The laws presented in the ENDF/B data files suggest the former model. The evaluation was based on inelastic level excitation and evaporation data for 238 U and 237 U. Data was retrieved from ENDF/B files. The evaporation data for 237 U was based on (γ,n) reaction 238 U. The inelastic level excitation data for 237 U was evaluated at the Soreq Nuclear Research Centre. It is concluded from the application of Segev's model to 238 U, that the energetic spectrum of secondary neutrons, is harder in the high range of energy than the one predicted by the use of the distribution law presented in ENDF/B data files. The spectrum of secondary (n,2n) neutrons, resulting from the interaction of 14 MeV neutrons in 238 U calculated with Segev's model, is compared with the corresponding spectrum of the LLL library, ENDF/B library and the recent evaluation of BNWL. It is found that the spectrum evaluated by LLL and BNWL is harder than that evaluated with Segev's model

  14. First results of U3Si2 production and its relevance in the power scale-up of IPEN research reactor IEA-R1m

    International Nuclear Information System (INIS)

    Saliba-Silva, A.M.; Souza, J.A.B.; Frajndlich, E.U.C.; Durazzo, M.; Perrotta, J.A.

    1997-01-01

    The own supply of LEU U 3 Si 2 is crucial for IPEN, since the whole scale-up of IPEN MTR IEA-Rlm reactor will rely on it. The Brazilian request for radioisotopes production is fully linked with the already made power scale-up from 2 to 5 MW for this reactor. IPEN now depends on fuel element material upgrading from U 3 O 8 towards LEU U 3 Si 2 . The fuel plate productive technology from the powdered material is already well established, only needing simple making of minor adjustments, but to reach the stage of producing U 3 Si 2 we need a fully settled chemical pilot plant in order to reach a LEU UF 4 productive routine. Complementing this process, it was also needed to scale down the previous practice of uranium magnesiothermic reduction to around a sub-critical safe uranium mass of approximately 3000g. To complete the metallurgical processing, it is being developed the production of U 3 Si 2 in a vacuum induction furnace. Some experiments to get this intermetallic, using natural uranium, have already been carried out in order to build up a general idea of the future process of LEU U 3 Si 2 . These experiments are described in this paper and also some of the initial characterization results, such as the qualification pattern of the ingot. It is also discussed some new features of inhomogeneity of solidified phases that may be deleterious to future production routine. (author)

  15. Comparison of U-Pu-Mo, U-Pu-Nb, U-Pu-Ti and U-Pu-Zr alloys

    International Nuclear Information System (INIS)

    Boucher, R.; Barthelemy, P.

    1964-01-01

    The data concerning the U-Pu, U-Pu-Mo and U-Pu-Nb are recalled. The results obtained with U-Pu-Ti and U-Pu-Zr alloys containing 15-20 per cent Pu and 10 wt. per cent ternary element are reported. The transformation temperatures, the expansion coefficients, the nature of phases, the thermal cycling behaviour have been determined. A list of the principal properties of these different alloys is presented and the possibilities of their use as fast reactor's fuel element are considered. The U-Pu-Ti alloys seem to be quite promising: easiness of fabrication, large thermal stability, excellent behaviour in air, small quantity of zeta phase, temperature of solidus superior to 1100 deg. C. (authors) [fr

  16. Mild hydrothermal crystal growth of new uranium(IV) fluorides, Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30}: Structures, optical and magnetic properties

    Energy Technology Data Exchange (ETDEWEB)

    Yeon, Jeongho; Smith, Mark D. [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Tapp, Joshua; Möller, Angela [Department of Chemistry and Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Loye, Hans-Conrad zur, E-mail: zurloye@mailbox.sc.edu [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States)

    2016-04-15

    Two new uranium(IV) fluorides, Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} (1) and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30} (2), were synthesized through an in situ mild hydrothermal route, and were structurally characterized by single crystal X-ray diffraction. The compounds exhibit complex crystal structures composed of corner- or edge-shared UF{sub 9} and MF{sub 6} (M=Mg, Mn) polyhedra, forming hexagonal channels in the three-dimensional framework, in which ordered or disordered divalent metal and sodium atoms reside. The large hexagonal voids contain the nearly regular M(II)F{sub 6} octahedra and sodium ions, whereas the small hexagonal cavities include M(II) and sodium ions on a mixed-occupied site. Magnetic susceptibility measurements yielded effective magnetic moments of 8.36 and 11.6 µ{sub B} for 1 and 2, respectively, confirming the presence and oxidation states of U(IV) and Mn(II). The large negative Weiss constants indicate the spin gap between a triplet and a singlet state in the U(IV). Magnetization data as a function of applied fields revealed that 2 exhibits paramagnetic behavior due to the nonmagnetic singlet ground state of U(IV) at low temperature. UV–vis diffuse reflectance and X-ray photoelectron spectroscopy data were also analyzed. - Graphical abstract: Two new quaternary U(IV) fluorides, Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30}, were crystallized via an in situ reduction step of U(VI) to U(IV) under mild hydrothermal conditions. The compounds show complex crystal structures based on the 3-D building block of U{sub 6}F{sub 30}. Magnetic property measurements revealed that the U(IV) exhibits a nonmagnetic singlet ground state at low temperature with a spin gap. - Highlights: • Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30} have been synthesized and characterized. • The U(IV) fluorides exhibit complex three-dimensional crystal structures. • The

  17. Energetic particle physics in JT-60U and JFT-2M

    Energy Technology Data Exchange (ETDEWEB)

    Shinohara, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Takechi, M [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Ishikawa, M [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Kusama, Y [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Tsuzuki, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Urata, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Kawashima, H [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Tobita, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Fukuyama, A [Department of Nuclear Engineering, Kyoto University, 606-8501, (Japan); Cheng, C Z [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Darrow, D S [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Kramer, G J [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Gorelenkov, N N [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Nazikian, R [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Todo, Y [National Institute for Fusion Science, Oroshi-cho, Toki, Gifu, 509-5292, (Japan); Miura, Y [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Ozeki, T [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan)

    2004-07-01

    Recent energetic particle physics research in JT-60U and JFT-2M is reported. Alfven eigenmodes (AEs) are investigated in reversed-shear (RS) plasmas in JT-60U where frequency sweeping (FS) modes are observed to follow the q-profile evolution. The RS-induced AE model can explain the FS of the modes within the context of an evolving q-profile. Enhanced energetic ion transport is also investigated with the appearance of modes in the toroidicity-induced AE range of frequency in JT-60U using a multi-channel neutron profile monitor and in JFT-2M using a lost ion probe. Additionally, the ripple loss in the complex toroidal field ripple due to ferritic steel inserts in JFT-2M is shown and compared with model analysis. The simulation code developed to predict ripple loss in JFT-2M will be of use in estimating the heat flux in the complex ripple field of a future device such as ITER.

  18. Spontaneous compactification of D=10 Maxwell-Einstein theory leads to SU(3) X SU(2) X U(1) gauge symmetry

    International Nuclear Information System (INIS)

    Watamura, S.

    1983-01-01

    Solutions of ten-dimensional Maxwell-Einstein theory and a bosonic part of N = 2, D = 10 supergravity theory are examined. It is shown that there is a solution for which six-dimensional internal space is compactified into CP 2 x S 2 . The gauge symmetry of the effective four-dimensional theory is SU(3) x SU(2) x U(1). The introduction of fermions is also considered. The requirement of consistency in introducing a spinsup(C) structure on CP 2 results in a U(1) charge quantization condition. (orig.)

  19. Electronic structure of crystalline uranium nitrides UN, U{sub 2}N{sub 3} and UN{sub 2}: LCAO calculations with the basis set optimization

    Energy Technology Data Exchange (ETDEWEB)

    Evarestov, R A; Panin, A I; Bandura, A V; Losev, M V [Department of Quantum Chemistry, St. Petersburg State University, University Prospect 26, Stary Peterghof, St. Petersburg, 198504 (Russian Federation)], E-mail: re1973@re1973.spb.edu

    2008-06-01

    The results of LCAO DFT calculations of lattice parameters, cohesive energy and bulk modulus of the crystalline uranium nitrides UN, U{sub 2}N{sub 3} and UN{sub 2} are presented and discussed. The LCAO computer codes Gaussian03 and Crystal06 are applied. The calculations are made with the uranium atom relativistic effective small core potential by Stuttgart-Cologne group (60 electrons in the core). The calculations include the U atom basis set optimization. Powell, Hooke-Jeeves, conjugated gradient and Box methods are implemented in the author's optimization package, being external to the codes for molecular and periodic calculations. The basis set optimization in LCAO calculations improves the agreement of the lattice parameter and bulk modulus of UN crystal with the experimental data, the change of the cohesive energy due to the optimization is small. The mixed metallic-covalent chemical bonding is found both in LCAO calculations of UN and U{sub 2}N{sub 3} crystals; UN{sub 2} crystal has the semiconducting nature.

  20. Overview of C-2U FRC Experimental Program and Plans for C-2W

    Science.gov (United States)

    Gota, H.; Binderbauer, M. W.; Tajima, T.; Putvinski, S.; Tuszewski, M.; Dettrick, S.; Korepanov, S.; Smirnov, A.; Thompson, M. C.; Yang, X.; Cappello, M.; Ivanov, A. A.; TAE Team

    2016-10-01

    Tri Alpha Energy's experimental program has been focused on a demonstration of reliable field-reversed configuration (FRC) formation and sustainment, driven by fast ions via high-power neutral-beam (NB) injection. The world's largest compact-toroid experimental devices, C-2 and C-2U, have successfully produced a well-stabilized, sustainable FRC plasma state with NB injection (input power, PNB 10 + MW; 15 keV hydrogen) and end-on coaxial plasma guns. Remarkable improvements in confinement and stability of FRC plasmas have led to further improved fast-ion build up; thereby, an advanced beam-driven FRC state has been produced and sustained for up to 5 + ms (longer than all characteristic system time scales), only limited by hardware and electric supply constraints such as NB and plasma-gun power supplies. To further improve the FRC performance the C-2U device is being replaced by C-2W featuring higher injected NB power, longer pulse duration as well as enhanced edge-biasing systems and substantially upgraded divertors. Main C-2U experimental results and key features of C-2W will be presented. Tri Alpha Energy, Inc.

  1. Thermal characterization of (U, Dy)O2 pellets

    International Nuclear Information System (INIS)

    Pelloni, M; Bianchi, L; Pablovich, M.E; Kaufmann, F; Kempf, R

    2012-01-01

    The thermal diffusivity of (U,Dy)O 2 pellets were determined in the temperature range 250 K to 1600 K measured by the laser flash method. The dependence of thermal with temperature and dysprosium content was studied and found in good agreement with physical models available (author)

  2. Irradiation tests of U3Si2-Al fuels up to very high fission densities

    International Nuclear Information System (INIS)

    Nuding, M.; Boening, K.

    2001-01-01

    The new research reactor of the Munich Technical University (TUM), the FRM-II, will have U 3 Si 2 -Al as the fuel. This fuel is considered qualified and optimally usable in the light of findings obtained in the RERTR program (Reduced Enrichment for Research and Test Reactors). The RERTR program was conducted to develop new fuel for the use of low enriched uranium (LEU) in research reactors. As the unique properties of the FRM-II in research and application are based also on achieving a very compact reactor core with highly enriched uranium (HEU), additional irradiation tests were performed on the basis of the RERTR program. They were run in close cooperation with the French Commissariat a l'Energie Atomique (CEA) in its SILOE and OSIRIS facilities, among others. After extensive evaluation, also of other studies, these tests confirm the RERTR findings about fuel swelling behavior and, consequently, the suitability of U 3 Si 2 -Al (HEU) for use in the compact core of the FRM-II. (orig.) [de

  3. 12 CFR 211.3 - Foreign branches of U.S. banking organizations.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Foreign branches of U.S. banking organizations. 211.3 Section 211.3 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Operations of U.S. Banking...

  4. Measurements at the RA Reactor related to the VISA-2 project - Part 3, calculation of VISA-2 samples influence on the reactor reactivity, on the depression of thermal neutron flux in VK-5 channel and VISA-2 samples; Fizicka merenja na reaktoru RA u vezi projekta VISA-2 - III deo, Proracun uticaja uzoraka VISA-2 na reaktivnost reaktora, na depresiju fluksa termalnih neuntrona u kanalu VK-5 i u uzorcima VISA-2

    Energy Technology Data Exchange (ETDEWEB)

    Markovic, H; Martinc, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1962-07-01

    The objective of this task was to determine the thermal neutron flux in the RA reactor cell with VISA-2 samples, the influence of VISA-2 samples on the thermal neutron flux distribution in the vicinity of VK-5 channel and the antireactivity of VISA-2 samples placed in the RA reactor core. This distribution is needed for calculating the mean value of absorption and thermal efficiency factor in the reactor cell with the sample. Thermal neutron flux distribution without the sample was calculated by diffusion theory. Fast neutron flux space distribution was assumed to be constant, i.e. that it is dependent only on the nuclear properties of the materials. Macroscopic thermal neutron flux distribution was determined by two-group diffusion theory using the four factor formula applied for two regions: active RA region, and reactor region with calls containing VISA-2 samples. This calculation enables estimation of the VISA-2 samples influence on the thermal neutron flux distribution in the VK-5 channel. Antireactivity of VISA-2 samples was calculated by neutron diffusion theory applying the perturbation method. [Serbo-Croat] Cilj ovog zadatka je da se odredi raspodela fluksa termalnih neutrona u celiji reaktora RA sa uzorcima VISA-2, uticaj uzoraka VISA-2 na makroskopsku raspodelu termalnih neutrona u blizini uzoraka, tj. u kanalu VK-5, kao i antiraktivnost uzoraka VISA-2 ubacenih u jezgro RA. Poznavanje ove raspodele potrebno je za izracunavanje srednje apsorpcije i faktora termalnog iskoriscenja u celiji reaktora sa uzorkom. Raspodela fluksa termalnih neutrona u celiji RA bez uzorka izracunata je na bazi difuzione teorije. Fluks brzih neutrona uzet je kao konstanta s obzirom na prostorne koordinate, tj. da zavisi samo od nuklearnih karakteristika materijala. Makroskopska raspodela fluksa termalnih neutrona u okolini VISA-2 odredjena je na bazi dvogrupne difuzione teorije preko formule cetiri faktora, primenjene na dve zone: prva aktivna zona RA, i druga reaktorka sredina

  5. Structural Basis for Polypyrimidine Tract Recognition by the Essential Pre-mRNA Splicing Factor U2AF65

    International Nuclear Information System (INIS)

    Sickmier, E.; Frato, K.; Shen, H.; Paranawithana, S.; Green, M.; Kielkopf, C.

    2006-01-01

    The essential pre-mRNA splicing factor, U2AF 65 , guides the early stages of splice site choice by recognizing a polypyrimidine (Py)-tract consensus sequence near the 3'-splice site. Since Py-tracts are relatively poorly conserved in higher eukaryotes, U2AF 65 is faced with the problem of specifying uridine-rich sequences, yet tolerating a variety of nucleotide substitutions found in natural Py-tracts. To better understand these apparently contradictory RNA binding characteristics, the X-ray structure of the U2AF 65 RNA binding domain bound to a Py-tract composed of seven uridines has been determined at 2.5Angstroms resolution. Specific hydrogen bonds between U2AF 65 and the uracil bases provide an explanation for polyuridine recognition. Flexible sidechains and bound water molecules form the majority of the base contacts, and potentially could rearrange when the U2AF 65 structure adapts to different Py-tract sequences. The energetic importance of conserved residues for Py-tract binding is established by analysis of site-directed mutant U2AF 65 proteins using surface plasmon resonance

  6. Crystal chemistry and thermal behavior of La doped (U, Th)O2

    Science.gov (United States)

    Keskar, Meera; Shelke, Geeta P.; Shafeeq, Muhammed; Krishnan, K.; Sali, S. K.; Kannan, S.

    2017-12-01

    X-ray diffraction, chemical and thermal studies of [(U0.2Th0.8)1-yLay]O2+x (LUTL) and [(U0.3Th0.7)1-yLay]O2+x (UTL); compounds (where y ≤ 0.4) were carried out. These compounds were synthesized by gel combustion method followed by heating in reduced atmospheres at 1673 K. To co-relate lattice parameters with metal and oxygen concentrations, reduced oxides were heated in Ar, CO2 and air atmospheres. Retention of FCC phase was confirmed in all mixed oxides with y ≤ 0.4. The cubic lattice parameters could be expressed in a linear equation of x and y as: a (Ǻ) = 5.5709 - 0.187 x + 0.032 y; [x Oxidation studies and simple ionic model calculations suggested that uranium is predominantly present as a mixture of +5 and + 6 states when La/U ratio ∼2. Oxidation kinetics of mixed oxides was studied by non-isothermal method using thermogravimetry and was found to be a diffusion controlled reaction. High temperature X-ray diffraction studies of LUTL and UTL mixed oxides showed positive thermal expansion in the temperature range of 298-1273 K and % expansion increases with La concentration.

  7. uPA/uPAR system activation drives a glycolytic phenotype in melanoma cells.

    Science.gov (United States)

    Laurenzana, Anna; Chillà, Anastasia; Luciani, Cristina; Peppicelli, Silvia; Biagioni, Alessio; Bianchini, Francesca; Tenedini, Elena; Torre, Eugenio; Mocali, Alessandra; Calorini, Lido; Margheri, Francesca; Fibbi, Gabriella; Del Rosso, Mario

    2017-09-15

    In this manuscript, we show the involvement of the uPA/uPAR system in the regulation of aerobic glycolysis of melanoma cells. uPAR over-expression in human melanoma cells controls an invasive and glycolytic phenotype in normoxic conditions. uPAR down-regulation by siRNA or its uncoupling from integrins, and hence from integrin-linked tyrosine kinase receptors (IL-TKRs), by an antagonist peptide induced a striking inhibition of the PI3K/AKT/mTOR/HIF1α pathway, resulting into impairment of glucose uptake, decrease of several glycolytic enzymes and of PKM2, a checkpoint that controls metabolism of cancer cells. Further, binding of uPA to uPAR regulates expression of molecules that govern cell invasion, including extracellular matrix metallo-proteinases inducer (EMPPRIN) and enolase, a glycolytyc enzyme that also serves as a plasminogen receptor, thus providing a common denominator between tumor metabolism and phenotypic invasive features. Such effects depend on the α5β1-integrin-mediated uPAR connection with EGFR in melanoma cells with engagement of the PI3K-mTOR-HIFα pathway. HIF-1α trans-activates genes whose products mediate tumor invasion and glycolysis, thus providing the common denominator between melanoma metabolism and its invasive features. These findings unveil a unrecognized interaction between the invasion-related uPAR and IL-TKRs in the control of glycolysis and disclose a new pharmacological target (i.e., uPAR/IL-TKRs axis) for the therapy of melanoma. © 2017 UICC.

  8. 7 CFR 51.2078 - U.S. No. 2 Mixed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 2 Mixed. 51.2078 Section 51.2078 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946...

  9. Transmission electron microscopy characterization of irradiated U-7Mo/Al-2Si dispersion fuel

    International Nuclear Information System (INIS)

    Gan, J.; Keiser, D.D.; Wachs, D.M.; Robinson, A.B.; Miller, B.D.; Allen, T.R.

    2010-01-01

    The plate-type dispersion fuels, with the atomized U(Mo) fuel particles dispersed in the Al or Al alloy matrix, are being developed for use in research and test reactors worldwide. It is found that the irradiation performance of a plate-type dispersion fuel depends on the radiation stability of the various phases in a fuel plate. Transmission electron microscopy was performed on a sample (peak fuel mid-plane temperature ∼109 deg. C and fission density ∼4.5 x 10 27 f m -3 ) taken from an irradiated U-7Mo dispersion fuel plate with Al-2Si alloy matrix to investigate the role of Si addition in the matrix on the radiation stability of the phase(s) in the U-7Mo fuel/matrix interaction layer. A similar interaction layer that forms in irradiated U-7Mo dispersion fuels with pure Al matrix has been found to exhibit poor irradiation stability, likely as a result of poor fission gas retention. The interaction layer for both U-7Mo/Al-2Si and U-7Mo/Al fuels is observed to be amorphous. However, unlike the latter, the amorphous layer for the former was found to effectively retain fission gases in areas with high Si concentration. When the Si concentration becomes relatively low, the fission gas bubbles agglomerate into fewer large pores. Within the U-7Mo fuel particles, a bubble superlattice ordered as fcc structure and oriented parallel to the bcc metal lattice was observed where the average bubble size and the superlattice constant are 3.5 nm and 11.5 nm, respectively. The estimated fission gas inventory in the bubble superlattice correlates well with the fission density in the fuel.

  10. DENSITY-FUNCTIONAL STUDY OF U-Mo AND U-Zr ALLOYS

    Energy Technology Data Exchange (ETDEWEB)

    Landa, A; Soderlind, P; Turchi, P A

    2010-11-01

    Density-functional theory previously used to describe phase equilibria in U-Zr alloys [A. Landa, P. Soederlind, P.E.A. Turchi, J. Alloys Comp. 478 (2009) 103-110] is extended to investigate the ground-state properties of U-Mo solid solutions. We discuss how the heat of formation in both alloys correlates with the charge transfer between the alloy components, and how the specific behavior of the density of states in the vicinity of the Fermi level promotes the stabilization of the U{sub 2}Mo compound. Our calculations prove that, due to the existence of a single {gamma}-phase over the typical fuel operation temperatures, {gamma}-U-Mo alloys should indeed have much lower constituent redistribution than {gamma}-U-Zr alloys for which binodal decomposition causes a high degree of constituent redistribution.

  11. A pan-cancer analysis of transcriptome changes associated with somatic mutations in U2AF1 reveals commonly altered splicing events.

    Directory of Open Access Journals (Sweden)

    Angela N Brooks

    Full Text Available Although recurrent somatic mutations in the splicing factor U2AF1 (also known as U2AF35 have been identified in multiple cancer types, the effects of these mutations on the cancer transcriptome have yet to be fully elucidated. Here, we identified splicing alterations associated with U2AF1 mutations across distinct cancers using DNA and RNA sequencing data from The Cancer Genome Atlas (TCGA. Using RNA-Seq data from 182 lung adenocarcinomas and 167 acute myeloid leukemias (AML, in which U2AF1 is somatically mutated in 3-4% of cases, we identified 131 and 369 splicing alterations, respectively, that were significantly associated with U2AF1 mutation. Of these, 30 splicing alterations were statistically significant in both lung adenocarcinoma and AML, including three genes in the Cancer Gene Census, CTNNB1, CHCHD7, and PICALM. Cell line experiments expressing U2AF1 S34F in HeLa cells and in 293T cells provide further support that these altered splicing events are caused by U2AF1 mutation. Consistent with the function of U2AF1 in 3' splice site recognition, we found that S34F/Y mutations cause preferences for CAG over UAG 3' splice site sequences. This report demonstrates consistent effects of U2AF1 mutation on splicing in distinct cancer cell types.

  12. 11 CFR 110.11 - Communications; advertising; disclaimers (2 U.S.C 441d).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Communications; advertising; disclaimers (2 U.S... AND EXPENDITURE LIMITATIONS AND PROHIBITIONS § 110.11 Communications; advertising; disclaimers (2 U.S... through radio or television, or through any broadcast, cable, or satellite transmission, must comply with...

  13. Adaptable coordination of U(IV) in the 2D-(4,4) uranium oxalate network: From 8 to 10 coordinations in the uranium (IV) oxalate hydrates

    International Nuclear Information System (INIS)

    Duvieubourg-Garela, L.; Vigier, N.; Abraham, F.; Grandjean, S.

    2008-01-01

    Crystals of uranium (IV) oxalate hydrates, U(C 2 O 4 ) 2 .6H 2 O (1) and U(C 2 O 4 ) 2 .2H 2 O (2), were obtained by hydrothermal methods using two different U(IV) precursors, U 3 O 8 oxide and nitric U(IV) solution in presence of hydrazine to avoid oxidation of U(IV) into uranyl ion. Growth of crystals of solvated monohydrated uranium (IV) oxalate, U(C 2 O 4 ) 2 .H 2 O.(dma) (3), dma=dimethylamine, was achieved by slow diffusion of U(IV) into a gel containing oxalate ions. The three structures are built on a bi-dimensional complex polymer of U(IV) atoms connected through bis-bidentate oxalate ions forming [U(C 2 O 4 )] 4 pseudo-squares. The flexibility of this supramolecular arrangement allows modifications of the coordination number of the U(IV) atom which, starting from 8 in 1 increases to 9 in 3 and, finally increases, to 10 in 2. The coordination polyhedron changes from a distorted cube, formed by eight oxygen atoms of four oxalate ions, in 1, to a mono-capped square anti-prism in 3 and, finally, to a di-capped square anti-prism in 2, resulting from rotation of the oxalate ions and addition of one and two water oxygen atoms in the coordination of U(IV). In 1, the space between the ∞ 2 [U(C 2 O 4 ) 2 ] planar layers is occupied by non-coordinated water molecules; in 2, the space between the staggered ∞ 2 [U(C 2 O 4 ) 2 .2H 2 O] layers is empty, finally in 3, the solvate molecules occupy the interlayer space between corrugated ∞ 2 [U(C 2 O 4 ) 2 .H 2 O] sheets. The thermal decomposition of U(C 2 O 4 ) 2 .6H 2 O under air and argon atmospheres gives U 3 O 8 and UO 2 , respectively. - Graphical abstract: The adaptable environment of U(IV) in U(IV) oxalates: from eight cubic coordination in U(C 2 O 4 ) 2 .6H 2 O (a) completed by water oxygens to nine in [U(C 2 O 4 ) 2 .H 2 O](C 2 NH 5 ) (b) and ten coordination in U(C 2 O 4 ) 2 .2H 2 O (c)

  14. Thermodynamic study contribution of U-Fe and U-Ga alloys by high temperature mass spectroscopy, and of the wetting of yttrium oxide by uranium

    International Nuclear Information System (INIS)

    Gardie, P.

    1992-01-01

    High temperature thermodynamic properties study of U-Fe and U-Ga alloys, and wetting study of yttrium oxide by uranium are presented. High temperature mass spectrometry coupled to a Knudsen effusion multi-cell allows to measure iron activity in U-Fe alloys and of gallium in U-Ga alloys, the U activity is deduced from Gibbs-Duhem equation. Wetting of the system U/Y_2O_3_-_x is studied between 1413 K and 1973 K by the put drop method visualized by X-rays. This technique also furnishes density, surface tension of U and of U-Fe alloys put on Y_2O_3_-_x. A new model of the interfacial oxygen action on wetting is done for the system U/Y_2O_3_-_x. (A.B.)

  15. Hydrophysical Evaluation of Wells TW-B, TW-7, UE-6d, U-2gg PSE 3A, U-10L 1, and UE-6e in Yucca Flat

    Energy Technology Data Exchange (ETDEWEB)

    Pohlmann, Karl [Desert Research Inst. (DRI), Las Vegas, NV (United States); Healey, John [Desert Research Inst. (DRI), Las Vegas, NV (United States); Lyles, Bred [Desert Research Inst. (DRI), Reno, NV (United States); Cooper, Clay [Desert Research Inst. (DRI), Reno, NV (United States); Hershey, Ronald L. [Desert Research Inst. (DRI), Reno, NV (United States)

    2017-05-01

    This study evaluated six wells in Yucca Flat in support of the Underground Test Area (UGTA) Activity conducted by the U.S. Department of Energy (DOE) at the Nevada National Security Site (NNSS). Accessibility and groundwater sampling conditions were assessed and if conditions permitted, samples were collected for tritium analysis. Four of the wells, TW-B, UE-6d, UE-6e, and TW-7 were sampled in support of UGTA responses to recommendations made by the Yucca Flat/Climax Mine External Peer Review Committee (Navarro, 2016). In addition to its role in support of these responses, TW-7 was included because it is listed in the NNSS Integrated Groundwater Sampling Plan (DOE, 2014) as a required sampling location, although it had not been sampled since 1994. U-2gg PSE 3A and U-10L 1 were evaluated to determine whether deteriorating well conditions can be addressed so that these wells can be used as additional sampling points in Yucca Flat.

  16. Mild hydrothermal crystal growth of new uranium(IV) fluorides, Na3.13Mg1.43U6F30 and Na2.50Mn1.75U6F30: Structures, optical and magnetic properties

    Science.gov (United States)

    Yeon, Jeongho; Smith, Mark D.; Tapp, Joshua; Möller, Angela; zur Loye, Hans-Conrad

    2016-04-01

    Two new uranium(IV) fluorides, Na3.13Mg1.43U6F30 (1) and Na2.50Mn1.75U6F30 (2), were synthesized through an in situ mild hydrothermal route, and were structurally characterized by single crystal X-ray diffraction. The compounds exhibit complex crystal structures composed of corner- or edge-shared UF9 and MF6 (M=Mg, Mn) polyhedra, forming hexagonal channels in the three-dimensional framework, in which ordered or disordered divalent metal and sodium atoms reside. The large hexagonal voids contain the nearly regular M(II)F6 octahedra and sodium ions, whereas the small hexagonal cavities include M(II) and sodium ions on a mixed-occupied site. Magnetic susceptibility measurements yielded effective magnetic moments of 8.36 and 11.6 μB for 1 and 2, respectively, confirming the presence and oxidation states of U(IV) and Mn(II). The large negative Weiss constants indicate the spin gap between a triplet and a singlet state in the U(IV). Magnetization data as a function of applied fields revealed that 2 exhibits paramagnetic behavior due to the nonmagnetic singlet ground state of U(IV) at low temperature. UV-vis diffuse reflectance and X-ray photoelectron spectroscopy data were also analyzed.

  17. All Small Nuclear RNAs (snRNAs) of the [U4/U6.U5] Tri-snRNP Localize to Nucleoli; Identification of the Nucleolar Localization Element of U6 snRNA

    Science.gov (United States)

    Gerbi, Susan A.; Lange, Thilo Sascha

    2002-01-01

    Previously, we showed that spliceosomal U6 small nuclear RNA (snRNA) transiently passes through the nucleolus. Herein, we report that all individual snRNAs of the [U4/U6.U5] tri-snRNP localize to nucleoli, demonstrated by fluorescence microscopy of nucleolar preparations after injection of fluorescein-labeled snRNA into Xenopus oocyte nuclei. Nucleolar localization of U6 is independent from [U4/U6] snRNP formation since sites of direct interaction of U6 snRNA with U4 snRNA are not nucleolar localization elements. Among all regions in U6, the only one required for nucleolar localization is its 3′ end, which associates with the La protein and subsequently during maturation of U6 is bound by Lsm proteins. This 3′-nucleolar localization element of U6 is both essential and sufficient for nucleolar localization and also required for localization to Cajal bodies. Conversion of the 3′ hydroxyl of U6 snRNA to a 3′ phosphate prevents association with the La protein but does not affect U6 localization to nucleoli or Cajal bodies. PMID:12221120

  18. Inhibition of bacterial U(VI) reduction by calcium

    International Nuclear Information System (INIS)

    Brooks, Scott C.; Fredrickson, Jim K.; Carroll, S. L.; Kennedy, David W.; Zachara, John M.; Plymale, Andrew E.; Kelly, S. D.; Kemner, K. M.; Fendorf, S.

    2003-01-01

    The rapid kinetics of bacterial U(VI) reduction and low solubility of uraninite (UO2,cr) make this process an attractive option for removing uranium from groundwater. Nevertheless, conditions that may promote or inhibit U(VI) reduction are not well-defined. Recent descriptions of Ca-UO2-CO3 complexes indicate that these species may dominate the aqueous speciation of U(VI) in many environments. We monitored the bacterial reduction of U(VI) in bicarbonate-buffered solution in the presence and absence of Ca. XAFS measurements confirmed the presence of a Ca-U(VI)-CO3 complex in the initial solutions containing calcium. Calcium, at millimolar concentrations (0.45-5 mM), caused a significant decrease in the rate and extent of bacterial U(VI) reduction. Both facultative (Shewanella putrefaciens strain CN32) and obligate (Desulfovibrio desulfuricans, Geobacter sulfurreducens) anaerobic bacteria were affected by the presence of calcium. Reduction of U(VI) ceased when the calculated system Eh re ached -0.046+/- 0.001 V, based on the Ca2UO2(CO3)(3) -- > UO2,cr couple. The results are consistent with the hypothesis that U is a less energetically favorable electron acceptor when the Ca-UO2-CO3 complexes are present. The results do not support Ca inhibition caused by direct interactions with the cells or with the electron donor as the reduction of fumarate or Tc(VII)O-4(-) under identical conditions was unaffected by the presence of Ca

  19. Biochemical function of typical and variant Arabidopsis thaliana U-box E3 ubiquitin-protein ligases

    DEFF Research Database (Denmark)

    Wiborg, Jakob; O'Shea, Charlotte; Skriver, Karen

    2008-01-01

    of the distant U-box protein, AtPUB49, representing a large family of eukaryotic proteins containing a U-box linked to a cyclophilin-like peptidyl-prolyl cis-trans isomerase domain, was characterized biochemically. AtPUB49 functioned both as a prolyl isomerase and a chaperone by catalysing cis......The variance of the U-box domain in 64 Arabidopsis thaliana (thale cress) E3s (ubiquitin-protein ligases) was used to examine the interactions between E3s and E2s (ubiquitin-conjugating enzymes). E2s and E3s are components of the ubiquitin protein degradation pathway. Seven U-box proteins were...... analysed for their ability to ubiquitinate proteins in vitro in co-operation with different E2s. All U-box domains exhibited ubiquitination activity and interacted productively with UBC4/5-type E2s. Three and four of the U-box domains mediated ubiquitin addition in the presence of UBC13 and UBC7 E2s...

  20. Removal of U(VI) from aqueous solution using TiO{sub 2} modified β-zeolite

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Peng; Yuan, Ni; Xiong, Wei; Wu, Hanyu; Pan, Duoqiang; Wu, Wangsuo [Lanzhou Univ. (China). Radiochemistry and Nuclear Environment Laboratory; Ministry of Education, Lanzhou (China). Key Laboratory of Special Function Materials and Structure Design

    2017-07-01

    β-Zeolite was synthesized and modified with TiO{sub 2}. The synthesized materials were characterized and used for removal of U(VI) from aqueous solutions. The influences of pH, contact time and temperature on U(VI) adsorption onto modified β-zeolite by TiO{sub 2} were studied by batch technique, and XPS was employed to analysed the experimental data. The dynamic process showed that the adsorption of U(VI) onto TiO{sub 2}/β-zeolite matched the pseudo-second-order kinetics model, and the adsorption of U(VI) were significantly dependent on pH values. Through simulating the adsorption isotherms by Langmuir, Freundlich and Dubini-Radushkevich (D-R) models, it could be seen, respectively that the adsorption patterns of U(VI) onto TiO{sub 2}/β-zeolite were mainly controlled by surface complexation, and the adsorption processes were endothermic and spontaneous. The modification of β-zeolite by TiO{sub 2} it shows a novel material for the removing of U(VI) from water environment for industrialized application.

  1. Studi On Oxidation State Of U In Ba2NdUO6

    International Nuclear Information System (INIS)

    Firman Windarto, Hendri

    1996-01-01

    Ba 2 NdUO 6 is not of the important compounds that is formed from a solidification process for high level liquid waste using super high temperature method Ba 2 NdUO 6 has ordered perovskite structure. The objective of this study is to investigate oxidation state of U in Ba 2 NdUO 6 . The properties of Ba 2 NdUO 6 were observed by using Faraday-type torsion magnetometer and X-ray Photoelectron Spectrometer (XPS). The magnetic susceptibility measured in the temperature range of 4K to room temperature showed that the Ba 2 NdUO 6 is paramagnetism that obeys the Curie-Weiss law. The effective moment of Ba 2 NdUO 6 is 3.04 μB. The results of xPs spectrum showed that the peaks of U4f for Ba 2 NdUO 6 appeared exactly between binding energy of UO 2 and UO 3 . It can be concluded that Ba 2 NdUO 6 has binding energy peaks corresponding to pentavalent uranium

  2. The Effect of fO2 on Partition Coefficients of U and Th between Garnet and Silicate Melt

    Science.gov (United States)

    Huang, F.; He, Z.; Schmidt, M. W.; Li, Q.

    2014-12-01

    Garnet is one of the most important minerals controlling partitioning of U and Th in the upper mantle. U is redox sensitive, while Th is tetra-valent at redox conditions of the silicate Earth. U-series disequilibria have provided a unique tool to constrain the time-scales and processes of magmatism at convergent margins. Variation of garnet/meltDU/Th with fO2 is critical to understand U-series disequilibria in arc lavas. However, there is still no systematic experimental study about the effect of fO2 on partitioning of U and Th between garnet and melt. Here we present experiments on partitioning of U, Th, Zr, Hf, Nb, Ta, and REE between garnet and silicate melts at various fO2. The starting material was hydrous haplo-basalt. The piston cylinder experiments were performed with Pt double capsules with C-CO, MnO-Mn3O4 (MM), and hematite-magnetite (HM) buffers at 3 GPa and 1185-1230 oC. The experiments produced garnets with diameters > 50μm and quenched melt. Major elements were measured by EMPA at ETH Zurich. Trace elements were determined using LA-ICP-MS at Northwestern University (Xi'an, China) and SIMS (Cameca1280 at the Institute of Geology and Geophysics, Beijing, China), producing consistent partition coefficient data for U and Th. With fO2 increasing from CCO to MM and HM, garnet/meltDU decreases from 0.041 to 0.005, while garnet/meltDTh ranges from 0.003 to 0.007 without correlation with fO2. Notably, garnet/meltDTh/U increases from 0.136 at CCO to 0.41 at HM. Our results indicate that U is still more compatible than Th in garnet even at the highest fO2 considered for the subarc mantle wedge (~NNO). Therefore, we predict that if garnet is the dominant phase controlling U-Th partitioning during melting of the mantle wedge, melts would still have 230Th excess over 238U. This explains why most young continental arc lavas have 230Th excess. If clinopyroxene is the dominant residual phase during mantle melting, U could be more incompatible than Th at high fO2

  3. Neutron inelastic-scattering cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu

    International Nuclear Information System (INIS)

    Smith, A.B.; Guenther, P.T.

    1982-01-01

    Differential-neutron-emission cross sections of 232 Th, 233 U, 235 U, 238 U, 239 Pu and 240 Pu are measured between approx. = 1.0 and 3.5 MeV with the angle and magnitude detail needed to provide angle-integrated emission cross sections to approx. 232 Th, 233 U, 235 U and 238 U inelastic-scattering values, poor agreement is observed for 240 Pu, and a serious discrepancy exists in the case of 239 Pu

  4. Interaction between U/UO2 bilayers and hydrogen studied by in-situ X-ray diffraction

    Science.gov (United States)

    Darnbrough, J. E.; Harker, R. M.; Griffiths, I.; Wermeille, D.; Lander, G. H.; Springell, R.

    2018-04-01

    This paper reports experiments investigating the reaction of H2 with uranium metal-oxide bilayers. The bilayers consist of ≤ 100 nm of epitaxial α-U (grown on a Nb buffer deposited on sapphire) with a UO2 overlayer of thicknesses of between 20 and 80 nm. The oxides were made either by depositing via reactive magnetron sputtering, or allowing the uranium metal to oxidise in air at room temperature. The bilayers were exposed to hydrogen, with sample temperatures between 80 and 200 C, and monitored via in-situ x-ray diffraction and complimentary experiments conducted using Scanning Transmission Electron Microscopy - Electron Energy Loss Spectroscopy (STEM-EELS). Small partial pressures of H2 caused rapid consumption of the U metal and lead to changes in the intensity and position of the diffraction peaks from both the UO2 overlayers and the U metal. There is an orientational dependence in the rate of U consumption. From changes in the lattice parameter we deduce that hydrogen enters both the oxide and metal layers, contracting the oxide and expanding the metal. The air-grown oxide overlayers appear to hinder the H2-reaction up to a threshold dose, but then on heating from 80 to 140 C the consumption is more rapid than for the as-deposited overlayers. STEM-EELS establishes that the U-hydride layer lies at the oxide-metal interface, and that the initial formation is at defects or grain boundaries, and involves the formation of amorphous and/or nanocrystalline UH3. This explains why no diffraction peaks from UH3 are observed.

  5. U.S. Korean Youth's Ideas and Experience of U.S. Education, U.S. Society, and U.S. History

    Science.gov (United States)

    An, Sohyun

    2009-01-01

    Drawing on and conversing with the large body of research and literature on young people's historical understanding, Asian American education, transnational migration, and Korean American studies, this dissertation research explored contemporary U.S. Korean youth's ideas and experiences of U.S. education, U.S. society and U.S. history.…

  6. The calculation of the contributions to low energy e+H2 scattering from sigma u+ and pion u symmetries using the Kohn variational method

    International Nuclear Information System (INIS)

    Armour, E.A.G.; Baker, D.J.; Plummer, M.

    1990-01-01

    Above incident energies of about 2 eV, the contribution to the total cross section in positron+H2 scattering from the sigma g+ symmetry is insufficient to account for the experimental value. Calculations carried out of the lowest partial waves of sigma u+ symmetry and Pion u symmetry using the Kohn variational method are described. The contributions to the total cross section from the two equivalent partial waves of Pion u symmetry significantly reduce the discrepancy with experiment up to incident energies of 4 to 5 eV. Comparisons are made with recent R-matrix calculations performed by Danby and Tennyson

  7. The calculation of the contributions to low energy e+H2 scattering from sigma u+ and Pion u symmetries using the Kohn variational method

    Science.gov (United States)

    Armour, E. A. G.; Baker, D. J.; Plummer, M.

    1990-01-01

    Above incident energies of about 2 eV, the contribution to the total cross section in positron+H2 scattering from the sigma g+ symmetry is insufficient to account for the experimental value. Calculations carried out of the lowest partial waves of sigma u+ symmetry and Pion u symmetry using the Kohn variational method are described. The contributions to the total cross section from the two equivalent partial waves of Pion u symmetry significantly reduce the discrepancy with experiment up to incident energies of 4 to 5 eV. Comparisons are made with recent R-matrix calculations performed by Danby and Tennyson.

  8. U3O8 powder from uranyl-loaded cation exchange resin

    International Nuclear Information System (INIS)

    Mosley, W.C.

    1985-01-01

    Large batches of U 3 O 8 , suitable for powder metallurgy fabrication of Al-U 3 O 8 cores for reactor fuel tubes, have been produced by deep-bed calcination of granular uranyl-loaded macroporous sulfonate cation exchange resin at 900 to 950 0 C in air. Deep-bed calcination is the backup process for the reference process of rotary calcination and sintering. These processes are to be used for recycling uranium, and to produce U 3 O 8 in the Fuel Production Facility to be built at the Savannah River Plant. 2 refs., 6 figs

  9. Kinetic study of the thermal decomposition of uranium metaphosphate, U(PO{sub 3}){sub 4}, into uranium pyrophosphate, UP{sub 2}O{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hee-Chul, E-mail: nhcyang@kaeri.re.kr; Kim, Hyung-Ju; Lee, Si-Young; Yang, In-Hwan; Chung, Dong-Yong

    2017-06-15

    The thermochemical properties of uranium compounds have attracted much interest in relation to thermochemical treatments and the safe disposal of radioactive waste bearing uranium compounds. The characteristics of the thermal decomposition of uranium metaphosphate, U(PO{sub 3}){sub 4}, into uranium pyrophosphate, UP{sub 2}O{sub 7}, have been studied from the view point of reaction kinetics and acting mechanisms. A mixture of U(PO{sub 3}){sub 4} and UP{sub 2}O{sub 7} was prepared from the pyrolysis residue of uranium-bearing spent TBP. A kinetic analysis of the reaction of U(PO{sub 3}){sub 4} into UP{sub 2}O{sub 7} was conducted using an isoconversional method and a master plot method on the basis of data from a non-isothermal thermogravimetric analysis. The thermal decomposition of U(PO{sub 3}){sub 4} into UP{sub 2}O{sub 7} followed a single-step reaction with an activation energy of 175.29 ± 1.58 kJ mol{sup −1}. The most probable kinetic model was determined as a type of nucleation and nuclei-growth models, the Avrami-Erofeev model (A3), which describes that there are certain restrictions on nuclei growth of UP{sub 2}O{sub 7} during the solid-state decomposition of U(PO{sub 3}){sub 4}. - Highlights: •Thermal decomposition kinetics of U(PO{sub 3}){sub 4} into UP{sub 2}O{sub 7} was investigated. •The thermal decomposition followed a single-step reaction with an activation energy of 175.3 ± 1.6 kJ mol{sup −1}. •The most probable kinetic model was determined as a type of nucleation and nuclei-growth models, the Avrami-Erofeev (A3).

  10. Facile CO cleavage by a multimetallic CsU{sub 2} nitride complex

    Energy Technology Data Exchange (ETDEWEB)

    Falcone, Marta; Scopelliti, Rosario; Mazzanti, Marinella [Ecole Polytechnique de Federale de Lausanne (EPFL) (Switzerland). Inst. des Sciences et Ingenierie Chimiques; Kefalidis, Christos E.; Maron, Laurent [Toulouse Univ. (France). LPCNO, CNRS et INSA, UPS

    2016-09-26

    Uranium nitrides are important materials with potential for application as fuels for nuclear power generation, and as highly active catalysts. Molecular nitride compounds could provide important insight into the nature of the uranium-nitride bond, but currently little is known about their reactivity. In this study, we found that a complex containing a nitride bridging two uranium centers and a cesium cation readily cleaved the C≡O bond (one of the strongest bonds in nature) under ambient conditions. The product formed has a [CsU{sub 2}(μ-CN)(μ-O)] core, thus indicating that the three cations cooperate to cleave CO. Moreover, the addition of MeOTf to the nitride complex led to an exceptional valence disproportionation of the CsU{sup IV}-N-U{sup IV} core to yield CsU{sup III}(OTf) and [MeN=U{sup V}] fragments. The important role of multimetallic cooperativity in both reactions is illustrated by the computed reaction mechanisms.

  11. LEU fuel development at CERCA. Status as of October 1996: U5Si4: A new phase in the U/Si diagram

    International Nuclear Information System (INIS)

    Durand, J.P.; Olagnon, G.; Colomb, P.; Lavastre, Y.; Grasse, M.; Noel, H.; Queneau, V.

    1996-01-01

    A fundamental study has been carried out by CERCA and the French CNRS (National Scientific Research Center) as a partner in order to get a better understanding of the U 3 Si 2 casting process. On the occasion of this study, a new binary phase, U 5 Si 4 , has been discovered in the USi phase equilibrium diagram. Synthesis conditions of U 5 Si 4 have been determined and the impact of such a discovery is evaluated regarding the production process of U 3 Si 2 ingots. It can be concluded that keeping the CERCA's casting tools and within the allowed limits of production parameters, the U 3 Si 2 ingots are homogenous without any detectable trace of U 5 Si 4 even if a long term heat treatment at the hot rolling temperature is carried out. On the production point of view, perfect knowledge of both metallurgical phase synthesis and the casting process guarantee the quality of U 3 Si 2 ingots and powder produced by CERCA. (author)

  12. Criticality Analysis of the U-H2O Subcritical Assembly Modified for Rand D of the High Temperature Reactor

    International Nuclear Information System (INIS)

    Syarip; Tri-Wulan-Tjiptono; Tegas-Sutondo

    2000-01-01

    A criticality analysis of the natural uranium - light water sub-criticalassembly available at the P3TM-BATAN Yogyakarta, converted into a naturaluranium - graphite system has been performed. The purpose of this study is toprovide the research facility on the basic static and kinetics studies forthe high temperature reactor (HTR) in which the HTR fuel system is underdevelopment at the P3TM. For the purpose of this study, a neutroniccalculation was performed using WIMSD/4 code, to determine the neutronmultiplication factor for various fuel configurations of the sub-criticalassemblies. The results show that the effective neutron multiplication factor(k ef ) for U-Be-H 2 O and U-Be-He systems are 1.0474 and 1.4666 respectively,while for the graphite moderated systems with coolants of H 2 O or He(U-C-H 2 O and U-C-He) systems, the corresponding k ef are 0.787 and 0.4211respectively. The results conclude that the modification of U-H 2 O toU-C-H 2 O system, in accordance with neutronic is quite feasible, safe, cheapand practical, and in addition, the treatment of H 2 O is relatively easy.(author)

  13. Thermal expansion anomaly and thermal conductivity of U3O8

    International Nuclear Information System (INIS)

    Schulz, B.

    1975-01-01

    The anomaly in the thermal expansion of U 3 O 8 and results of the thermal conductivity of this compound are described. U 3 O 8 powder heat treated at 1,223 K was consolidated by pressing and sintering in air at 1,223 and 1,373 K to a density of 66% and 80.8% TD. The O/U ratio was 2.67 and 2.63 respectively, the crystal structure being orthorhombic in both cases. For UOsub(2.63) the thermal linear expansion was measured in the temperature range 293 K-1,063 K in pressing direction and normal to it, while for UOsub(2.67) measurements were done parallel to the pressing direction. The curves of the linear thermal expansion from 373 K up to 623 K show negative values and above positive for the three curves. The results are related to known data of phase-transition-temperatures of the orthorhombic U 3 O 8 . Measurements of the thermal conductivity were done on UOsub(2.67). Because of the high porosity of the samples, known relationships for the porosity correction of the thermal conductivity were proved on alumina with 34 % porosity. The values of the thermal conductivity of UOsub(2.67) (corrected to zero porosity) show a very slight temperature dependence, they are about three times lower than those of the stoichiometric uranium dioxide in the same temperature range

  14. Synthesis, crystal structure and optical properties of the catena-metaphosphates Ce(PO3)4 and U(PO3)4

    International Nuclear Information System (INIS)

    Hoeppe, Henning A.; Daub, Michi

    2012-01-01

    The catena-metaphosphates of tetravalent cerium and tetravalent uranium were obtained as phase pure crystalline powders by reaction of the respective dioxides with phosphoric acid at 500 C. Ce(PO 3 ) 4 and U(PO 3 ) 4 crystallise in space group C2/c (Z = 16, a Ce = 13.7696(3) Aa, b Ce = 29.7120(7) Aa, c Ce = 8.9269(2) Aa, β Ce = 90.00(1) Aa 3 and a U = 13.786(3) Aa, b U = 29.843(6) Aa, c U = 8.9720(18) Aa, β U = 90.01(3) Aa 3 ). The vibrational and optical spectra of pale yellow Ce(PO 3 ) 4 and emerald-greenish U(PO 3 ) 4 are also reported. (orig.)

  15. Preparation of UO{sub 2}, ThO{sub 2} and (Th,U)O{sub 2} pellets from photochemically-prepared nano-powders

    Energy Technology Data Exchange (ETDEWEB)

    Pavelková, Tereza [Czech Technical University in Prague, Faculty of Nuclear Sciences and Physical Engineering, Břehová 7, 115 19 Praha 1 (Czech Republic); Čuba, Václav, E-mail: vaclav.cuba@fjfi.cvut.cz [Czech Technical University in Prague, Faculty of Nuclear Sciences and Physical Engineering, Břehová 7, 115 19 Praha 1 (Czech Republic); Visser-Týnová, Eva de [Nuclear Research and Consultancy Group (NRG), Research & Innovation, Westerduinweg 3, 1755 LE Petten (Netherlands); Ekberg, Christian [Nuclear Chemistry/Industrial Materials Recycling, Chalmers University of Technology, SE-412 96 Göteborg (Sweden); Persson, Ingmar [Department of Chemistry and Biotechnology, Swedish University of Agricultural Sciences, P.O. Box 7015, SE-750 07 Uppsala (Sweden)

    2016-02-15

    Photochemically-induced preparation of nano-powders of crystalline uranium and/or thorium oxides and their subsequent pelletizing has been investigated. The preparative method was based on the photochemically induced formation of amorphous solid precursors in aqueous solution containing uranyl and/or thorium nitrate and ammonium formate. The EXAFS analyses of the precursors shown that photon irradiation of thorium containing solutions yields a compound with little long-range order but likely “ThO{sub 2} like” and the irradiation of uranium containing solutions yields the mixture of U(IV) and U(VI) compounds. The U-containing precursors were carbon free, thus allowing direct heat treatment in reducing atmosphere without pre-treatment in the air. Subsequent heat treatment of amorphous solid precursors at 300–550 °C yielded nano-crystalline UO{sub 2}, ThO{sub 2} or solid (Th,U)O{sub 2} solutions with high purity, well-developed crystals with linear crystallite size <15 nm. The prepared nano-powders of crystalline oxides were pelletized without any binder (pressure 500 MPa), the green pellets were subsequently sintered at 1300 °C under an Ar:H{sub 2} (20:1) mixture (UO{sub 2} and (Th,U)O{sub 2} pellets) or at 1600 °C in ambient air (ThO{sub 2} pellets). The theoretical density of the sintered pellets varied from 91 to 97%. - Highlights: • Photochemically prepared UO{sub 2}/ThO{sub 2} nano-powders were pelletized. • The nano-powders of crystalline oxides were pelletized without any binder. • Pellets were sintered at 1300 °C (UO{sub 2} and (Th,U)O{sub 2}) or 1600 °C (ThO{sub 2} pellets). • The theoretical density of the sintered pellets varies from 91 to 97%.

  16. Estimation of build up of dose rate on U3O8 product drum

    International Nuclear Information System (INIS)

    Pandey, J.P.N.; Shinde, A.M.; Deshpande, M.D.

    2008-01-01

    In fuel reprocessing plant, plutonium oxide and uranium oxide (U 3 O 8 ) are products. Approximately 180 kg U 3 O 8 is filled in SS drum and sealed firmly before storage. In PHWR natural uranium (UO 2 ) is used as fuel. In natural uranium, thorium-232 is present as an impurity at few tens of ppm level. During irradiation in power reactors, due to nuclear reaction formation of 232 U from 232 Th takes place. Natural decay of 232 U leads to the formation of 208 Tl. As time passes, there is buildup of 208 Tl and hence increase in dose rate on the drum containing U 3 O 8 . It is essential to estimate the buildup of dose rate considering the external radiological hazards involved during U 3 O 8 drum handling, transportation and fuel fabrication. This paper describes the calculation of dose rate on drum in future years using MCNP code. For dose rate calculation decay of fission product activity which remains as contamination in product and build up of '2 08 Tl from 232 U is considered. Some measured values of dose rate on U 3 O 8 drum are given for the comparisons with estimated dose rate based on MCNP code. (author)

  17. The valence state of uranium in K{sub 6}Cu{sub 12}U{sub 2}S{sub 15}

    Energy Technology Data Exchange (ETDEWEB)

    Schilder, H; Speldrich, M; Lueken, H; Sutorik, A C; Kanatzidis, M G

    2004-07-14

    The paramagnetic behaviour of K{sub 6}Cu{sub 12}U{sub 2}S{sub 15} has been analysed, regarding copper as diamagnetic (Cu{sup +}), sulfur as mixed-valent S{sup 2-}/S{sup -} with magnetically silent delocalized S{sup -} holes in the valence band, and the actinide as either U{sup 5+}[5f{sup 1}] or U{sup 4+}[5f{sup 2}] in trigonally distorted octahedral surrounding (pseudosymmetry 3-bar) of sulfur. Fitting procedures have been carried out, accounting for spin-orbit coupling, ligand-field potential (parameters B{sup k}{sub q}), interelectronic repulsion (for U{sup 4+}[5f{sup 2}]), cooperative magnetic effects (molecular field parameter {lambda}), and applied magnetic field. Keeping the ratios B{sup 4}{sub 3}/B{sup 4}{sub 0}, B{sup 6}{sub 3}/B{sup 6}{sub 0}, B{sup 6}{sub 6}/B{sup 6}{sub 0} on their point charge electrostatic values with respect to the sulfur ligands, the three axial parameters B{sup k}{sub 0} (k=2,4,6) and {lambda} were refined. Agreement between measured and calculated susceptibility data was obtained for U{sup 5+} with B{sup k}{sub 0} values expected for octahedral surrounding and {lambda}<0 speaking for antiferromagnetic interactions. The U{sup 4+} model does yield a fit of comparable quality, but gives B{sup k}{sub 0} values that are unreasonable with respect to sign and magnitude. To conclude, on the basis of the magnetic properties the title compound is a 5f{sup 1} system corresponding to the elements formal charges (K{sup +}){sub 6}(Cu{sup +}){sub 12}(U{sup 5+}){sub 2}(S{sup 2-}){sub 13}(S{sup -}){sub 2}.

  18. Analysis of 235U enrichment by chemical exchange in U(IV) - U(VI) system on anionite

    International Nuclear Information System (INIS)

    Raica, Paula; Axente, Damian

    2007-01-01

    Full text: A theoretical study about the 235 U enrichment by chemical exchange method in U(IV)-U(VI) system on anion-exchange resins is presented. The 235 U isotope concentration profiles along the band were numerically calculated using an accurate mathematical model and simulations were carried out for the situation of product and waste withdrawal and feed supply. By means of numerical simulation, an estimation of the migration time, necessary for a desired enrichment degree, was obtained. The required migration distance, the production of uranium 3 at.% 235 U per year and the plant configuration are calculated for different operating conditions. An analysis of the process scale for various experimental conditions is also presented. (authors)

  19. Biochemical function of typical and variant Arabidopsis thaliana U-box E3 ubiquitin-protein ligases.

    Science.gov (United States)

    Wiborg, Jakob; O'Shea, Charlotte; Skriver, Karen

    2008-08-01

    The variance of the U-box domain in 64 Arabidopsis thaliana (thale cress) E3s (ubiquitin-protein ligases) was used to examine the interactions between E3s and E2s (ubiquitin-conjugating enzymes). E2s and E3s are components of the ubiquitin protein degradation pathway. Seven U-box proteins were analysed for their ability to ubiquitinate proteins in vitro in co-operation with different E2s. All U-box domains exhibited ubiquitination activity and interacted productively with UBC4/5-type E2s. Three and four of the U-box domains mediated ubiquitin addition in the presence of UBC13 and UBC7 E2s respectively, but no productive interaction was observed with the UBC15 E2 tested. The activity of AtPUB54 [Arabidopsis thaliana (thale cress) plant U-box 54 protein] was dependent on Trp(266) in the E2-binding cleft, and the E2 selectivity was changed by substitution of this position. The function of the distant U-box protein, AtPUB49, representing a large family of eukaryotic proteins containing a U-box linked to a cyclophilin-like peptidyl-prolyl cis-trans isomerase domain, was characterized biochemically. AtPUB49 functioned both as a prolyl isomerase and a chaperone by catalysing cis-trans isomerization of peptidyl-prolyl bonds and dissolving protein aggregates. In conclusion, both typical and atypical Arabidopsis U-box proteins were active E3s. The overlap in the E3/E2 selectivity suggests that in vivo specificity is not determined only by the E3-E2 interactions, but also by other parameters, e.g. co-existence or interactions with additional domains. The biochemical functions of AtPUB49 suggest that the protein can be involved in folding or degradation of protein substrates. Similar functions can also be retained within a protein complex with separate chaperone and U-box proteins.

  20. Dicty_cDB: Contig-U11195-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN

  1. Crystal-field analysis of U3+ ions in K2LaX5 (X=Cl, Br or I) single crystals

    Science.gov (United States)

    Karbowiak, M.; Edelstein, N.; Gajek, Z.; Drożdżyński, J.

    1998-11-01

    An analysis of low temperature absorption spectra of U3+ ions doped in K2LaX5 (X=Cl, Br or I) single crystals is reported. The energy levels of the U3+ ion in the single crystals were assigned and fitted to a semiempirical Hamiltonian representing the combined atomic and crystal-field interactions at the Cs symmetry site. An analysis of the nephelauxetic effect and crystal-field splittings in the series of compounds is also reported.

  2. Effect of thermo-mechanical processing on microstructure and mechanical properties of U - Nb - Zr alloys: Part 2 - U - 3 wt % Nb - 9 wt % Zr and U - 9 wt% Nb - 3 wt% Zr

    Science.gov (United States)

    Morais, Nathanael Wagner Sales; Lopes, Denise Adorno; Schön, Cláudio Geraldo

    2018-04-01

    The present work is the second and final part of an extended investigation on Usbnd Nb - Zr alloys. It investigates the effect of mechanical processing routes on microstructure of alloys U - 3 wt % Nb - 9 wt % Zr and U - 9 wt% Nb - 3 wt% Zr, through X-ray diffraction and scanning electron microscopy, completing the investigation, which started with alloy U - 6 wt% Nb - 6 wt% Zr in part 1. Mechanical properties are determined using microhardness and bending tests and correlated with the developed microstructures. The results show that processing sequence, in particular the inclusion of a 1000 °C heat treatment step, affects significantly the microstructure and mechanical properties of these alloys alloy in different ways. Microstructural characterization shows that both alloys present significant volume fraction of precipitates of a body-centered cubic (BCC) γ-Nb-Zr rich phase in addition the uranium-rich matrix. Bending tests show that sample ductility does not correlate necessarily with hardness and that the key factor appears to be the amount of the γ-Nb-Zr precipitates, which controls the matrix microstructure. Samples with a monoclinic α″ cellular microstructure and/or with the tetragonally-distorted BCC phase (γ0), although not strictly ductile, showed the largest allowed strains-before-break and complete elastic recovery of the broken pieces, pointing out to the macroscopic observation of superelasticity.

  3. Interdiffusion and reaction between U and Zr

    Science.gov (United States)

    Park, Y.; Newell, R.; Mehta, A.; Keiser, D. D.; Sohn, Y. H.

    2018-04-01

    The microstructural development and diffusion kinetics were examined for the binary U vs. Zr system using solid-to-solid diffusion couples, U vs. Zr, annealed at 580 °C for 960 h, 650 °C for 480 h, 680 °C for 240 h, and 710 °C for 96 h. Scanning and transmission electron microscopies with X-ray energy dispersive spectroscopy were employed for detailed microstructural and compositional analyses. Interdiffusion and reaction in U vs. Zr diffusion couples primarily produced: δ-UZr2 solid solution (hP3) and α‧-U at 580 °C; and (γU,βZr) solid solution (cI2) and α‧-U at 650°, 680° and 710 °C. The α‧-phase was confirmed as a reduced variant of the α-U orthorhombic structure with lattice parameters, a × b × c = 2.65 × 5.40 × 4.75 (Å) with a negligible solubility for Zr at room temperature. Concentration profiles were examined to determine interdiffusion coefficients, integrated interdiffusion coefficients, and intrinsic diffusion coefficients using Boltzmann-Matano, Wagner, and Heumann analyses, respectively. Composition-dependence of interdiffusion coefficients were documented for α-U, δ-UZr2 (at 580 °C) and (γU,βZr) solid solution (at 650°, 680° and 710 °C). U was determined to intrinsically diffuse faster than Zr, approximately by an order of magnitude, in the δ-UZr2 at 580 °C, and (γU,βZr) phases at 650°, 680° and 710 °C. Based on Darken's approach, thermodynamic data available in literature were coupled to estimate the tracer diffusion coefficients and atomic mobilities of U and Zr.

  4. Effect of boron and gadolinium concentration on the calculated neutron multiplication factor of U(3)O2 fuel pins in optimum geometries

    International Nuclear Information System (INIS)

    Thomas, J.T.

    1984-10-01

    The KENO-Va improved Monte Carlo criticality program is used to calculate the neutron multiplication factor for TMI-U2 fuel compositions in a variety of configurations and to display parametric regions giving rise to maximum reactivity contributions. The lattice pitch of UO 2 fuel pins producing a maximum k/sub eff/ is determined as a function of boron concentrations in the coolant for infinite and finite systems. The characteristics of U 3 O 8 -coolant mixtures of interest to modeling the rubble region of the core are presented. Several disrupted core configurations are calculated and comparisons made. The results should be useful to proposed defueling of the TMI-U2 reactor

  5. Thermal reactions of uranium metal, UO 2, U 3O 8, UF 4, and UO 2F 2 with NF 3 to produce UF 6

    Science.gov (United States)

    McNamara, Bruce; Scheele, Randall; Kozelisky, Anne; Edwards, Matthew

    2009-11-01

    This paper demonstrates that NF 3 fluorinates uranium metal, UO 2, UF 4, UO 3, U 3O 8, and UO 2F 2·2H 2O to produce the volatile UF 6 at temperatures between 100 and 550 °C. Thermogravimetric and differential thermal analysis reaction profiles are described that reflect changes in the uranium fluorination/oxidation state, physiochemical effects, and instances of discrete chemical speciation. Large differences in the onset temperatures for each system investigated implicate changes in mode of the NF 3 gas-solid surface interaction. These studies also demonstrate that NF 3 is a potential replacement fluorinating agent in the existing nuclear fuel cycle and in actinide volatility reprocessing.

  6. Dicty_cDB: Contig-U01204-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN

  7. Reply to Comment on "Zircon U-Th-Pb dating using LA-ICP-MS: Simultaneous U-Pb and U-Th dating on the 0.1 Ma Toya Tephra, Japan"

    Science.gov (United States)

    Ito, Hisatoshi

    2015-04-01

    Guillong et al. (2015) mentioned that corrections for abundance sensitivity for 232Th and molecular zirconium sesquioxide ions (Zr2O3+) are critical for reliable determination of 230Th abundances in zircon for LA-ICP-MS analyses. There is no denying that more rigorous treatments are necessary to obtain more reliable ages than those in Ito (2014). However, as shown in Fig. 2 in Guillong et al. (2015), the uncorrected (230Th)/(238U) for reference zircons except for Mud Tank are only 5-20% higher than unity. Since U abundance of Toya Tephra zircons that have U-Pb ages Ito (2014) obtained U-Th ages of the Toya Tephra by comparison with Fish Canyon Tuff (FCT) data. Because both the FCT and the Toya Tephra have similar trends of overestimation of 230Th, the effect of overestimation of 230Th to cause overestimation of U-Th age should be cancelled out or negligible. Therefore the pivotal conclusion in Ito (2014) that simultaneous U-Pb and U-Th dating using LA-ICP-MS is possible and useful for Quaternary zircons holds true.

  8. Biološka razgradnja i mehaničko ponašanje sinteriranih kompakata od Co-Cr legure u prahu dopiranih sa ZrO2 rabljenih u stomatologiji

    OpenAIRE

    Băilă, Diana-Irinel; Mocioiu, Oana-Cătălina; Truşcă, Roxana; Surdu, Adrian; Zaharia, Cătălin; Bunea, Mihaela

    2016-01-01

    Direct Metal Laser Sintering je postupak moderne tehnologije s primjenom u različitim industrijama, uključujući medicinsku industriju. Namjena ovog istraživanja bila je dobiti sinterirane kompakte Co-Cr praha dopiranog sa ZrO2 u cilju poboljšanja biološke aktivnosti implantata te ponašanja in vitro nakon uranjanja u simuliranu biološku tekućinu (SBF) tijekom 21 dana. Co-Cr prašak (ST2724G) rabljen je za izradu jednog referentnog uzorka Co-Cr i 4 kompakta Co-Cr dopirana sa ZrO2 u sljedećim pos...

  9. Dicty_cDB: Contig-U10837-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI

  10. DFT+U study of defects in bulk rutile TiO2

    DEFF Research Database (Denmark)

    Stausholm-Møller, Jess; Kristoffersen, Henrik Høgh; Hinnemann, Berit

    2010-01-01

    phase of bulk titanium dioxide. We find that by applying a sufficiently large value for the Hubbard-U parameter of the Ti 3d states, the excess electrons localize spatially at the Ti sites and appear as states in the band gap. At U = 2.5 eV, the position in energy of these gap states are in fair...... is that regardless of which structural defect is the origin of the gap states, at U = 2.5 eV, these states are found to have their mean energies within a few hundredths of an eV from 0.94 eV below the conduction band minimum.......We present a systematic study of electronic gap states in defected titania using our implementation of the Hubbard-U approximation in the grid-based projector-augmented wave density functional theory code, GPAW. The defects considered are Ti interstitials, O vacancies, and H dopants in the rutile...

  11. Determination of 234U and 238U activity concentrations in groundwaters from three deep wells drilled in Itu Intrusive Suite (SP)

    International Nuclear Information System (INIS)

    Souza, Francisca de

    2006-01-01

    Activity concentrations of ( 234 U) and ( 238 U) were determined in groundwaters drawn from three deep wells drilled in rocks from Itu Intrusive Suite (SP), two located in Salto town (S and SY wells) and the other one in Itu (I well). Sampling was done from September, 2004 to December, 2005, and twelve samples of each well were collected monthly. For those determinations alpha spectrometry technique was used, providing high precision results, as shown by the very good agreement of the data obtained in the analyses of 23 duplicates. The waters from the three wells presented a considerable enrichment of 234 U in relation to 238 U, indicating an important radioactive disequilibrium of these isotopes. In well I, the activity concentrations of ( 238 U) varied from (1,06 +- 0,03) to (2,1+- 0,2) mBq/L and those of ( 234 U) spanned from (3,1 +- 0,2) to (6,0 +- 0,4) mBq/L, whereas ( 234 U/ 238 U) activity ratios did not present significant variation, during the sampling time interval, presenting an average of 2,8 +- 0,1. The S waters showed the lowest uranium concentrations and the largest diversity of ( 238 U) and ( 234 U) activity concentrations, which varied from (0,26 +- 0,02) to (1,07+- 0,08) mBq/L and from (1,8 +- 0,1) to (7,0 +- 0,5) mBq/L, respectively, and also presented variable ( 234 U/ 238 U) activity ratios, spanning from (2,79 +- 0,07) to (8,1+- 0,3). In SY well, ( 238 U) activities varied between (0,8 +- 0,1) and (4,2 +- 0,3) mBq/L and those ones of ( 234 U) from (14 +- 1) to (53 +- 4) mBq/L, whereas ( 234 U/ 238 U) ratios fell in the interval from 12,6 +- 0,3 to 18,3 +- 0,4, with the highest activities of both radioisotopes registered during the dry season and the lowest ones in the rainy time period. The ( 234 U/ 238 U) activity ratios, which were invariable during sampling period of well I, indicated the contribution of rainfall to recharge the aquifer. The observed correlation between those ratios and uranium concentrations, for S and SY wells, showed

  12. Repair of U/G and U/A in DNA by UNG2-associated repair complexes takes place predominantly by short-patch repair both in proliferating and growth-arrested cells

    DEFF Research Database (Denmark)

    Akbari, Mansour; Otterlei, Marit; Pena Diaz, Javier

    2004-01-01

    Nuclear uracil-DNA glycosylase UNG2 has an established role in repair of U/A pairs resulting from misincorporation of dUMP during replication. In antigen-stimulated B-lymphocytes UNG2 removes uracil from U/G mispairs as part of somatic hypermutation and class switch recombination processes. Using......, PCNA and DNA ligase, the latter detected as activity. Short-patch repair was the predominant mechanism both in extracts and UNG2-ARC from proliferating and less BER-proficient growth-arrested cells. Repair of U/G mispairs and U/A pairs was completely inhibited by neutralizing UNG...

  13. U(IV) chalcogenolates synthesized via oxidation of uranium metal by dichalcogenides.

    Science.gov (United States)

    Gaunt, Andrew J; Scott, Brian L; Neu, Mary P

    2006-09-04

    Treatment of uranium metal with dichalcogenides in the presence of a catalytic amount of iodine in pyridine affords molecular U(IV) chalcogenolates that do not require stabilizing ancillary ligands. Oxidation of U(0) by PhEEPh yields monomeric seven-coordinate U(EPh)4(py)3 (E = S(1), Se(2)). The dimeric eight-coordinate complexes [U(EPh)2(mu2-EPh)2(CH3CN)2]2 (E = S(3), Se(4)) are obtained by crystallization from solutions of 1 and 2 dissolved in acetonitrile. Oxidation of U(0) by pySSpy and crystallization from thf yields nine-coordinate U(Spy)4(thf) (5). Incorporation of elemental selenium into the oxidation of U(0) by PhSeSePh results in the isolation of [U(py)2(SePh)(mu3-Se)(mu2-SePh)]4.4py (6), a tetrameric cluster in which each U(IV) ion is eight-coordinate and the U4Se4 core forms a distorted cube. The compounds were analyzed spectroscopically and the single-crystal X-ray structures of 1 and 3-6 were determined. The isolation of 1-6 represents six new examples of actinide chalcogenolates and allows insight into the nature of "hard" actinide ion-"soft" chalcogen donor interactions.

  14. Hydrogeologic Characterization of the U-3bl Collapse Zone

    International Nuclear Information System (INIS)

    NSTec Geotechnical Services

    2006-01-01

    The U-3bl collapse crater was formed by an underground nuclear test in August 1962. This crater and the adjoining U-3ax crater were subsequently developed and used as a bulk low-level radioactive waste disposal cell (U-3ax/bl), which is part of the Area 3 Radioactive Waste Management Site at the Nevada Test Site (NTS). Various investigations have been conducted to assess the hydrogeologic characteristics and properties in the vicinity of the U-3ax/bl waste disposal cell. This report presents data from one of these investigations, conducted in 1996. Also included in this report is a review of pertinent nuclear testing records, which shows that the testing operations and hydrogeologic setting of the U-3ax/bl site were typical for the period and location of testing. Borehole U-3bl-D2 is a 45-degree-angle hole drilled from the edge of the crater under the waste cell to intercept the U-3bl collapse zone, the disturbed alluvium between the crater (surface collapse sink) and the nuclear test cavity. A casing-advance system with an air percussion hammer was used to drill the borehole, and air was used as the drilling fluid. Properties of the U-3bl crater collapse zone were determined from cores collected within the interval, 42.1 to 96.6 meters (138 to 317 feet) below the ground surface. Selected core samples were analyzed for particle density, particle size, bulk density, water retention, hydraulic conductivity, water content, water potential, chloride, carbonate, stable isotopes, and tritium. Physical and hydraulic properties were typical of alluvial valley sediments at the NTS. No visual evidence of preferential pathways for water transport was observed in the core samples. Soil parameters showed no trends with depth. Volumetric water content values ranged from 0.08 to 0.20 cubic meters per cubic meter, and tended to increase with depth. Water-retention relations were typical for soils of similar texture. Water potentials ranged from -1.9 MegaPascals at a depth of 42

  15. Peculiarities of U-based Laves phases

    Energy Technology Data Exchange (ETDEWEB)

    Goncalves, A P; Henriques, M S; Waerenborgh, J C; Pereira, L C J; Lopes, E B; Almeida, M [Department of Chemistry, Instituto Tecnologico e Nuclear/CFMCUL, Estrada Nacional 10, 2686-953 Sacavem (Portugal); Maskova, S; Havela, L [Department of Condensed Matter Physics, Faculty of Mathematics and Physics, Charles University, Ke Karlovu 5, 12116, Prague (Czech Republic); Shick, A; Arnold, Z [Institute of Physics, Academy of Sciences of the Czech Republic, Prague 8 (Czech Republic); Berthebaud, D; Tougait, O; Noel, H, E-mail: apg@itn.pt [Sciences Chimiques de Rennes- Equipe Chimie du Solide et Materiaux. UMR CNRS 6226, Universite de Rennes 1, Avenue de General Leclerc, 35042 Rennes (France)

    2010-03-15

    This contribution focuses on the structural and physical properties of U-based Laves phases. It starts with the structural description of the different type of Laves phases, followed by a brief description of the factors that affect their stability. The majority of the uranium Laves phases show a weakly paramagnetic behaviour. The reason is the compact structure of the phases that leads to small a U-U spacing as well as very high coordination numbers, regarding both the uranium and the ligands sublattices, which brings a strong hybridization with non-f states. However, there are some exceptions of uranium Laves phases that do order magnetically (UFe{sub 2}, UNi{sub 2} and the recently discovered U{sub 2}Fe{sub 3}Ge compound). These exceptions are discussed in more detail in the present manuscript.

  16. Voltametric determination of O:U relation in uranium oxide

    International Nuclear Information System (INIS)

    Carvalho, F.M.S. de; Abrao, A.

    1988-07-01

    Uranium oxide samples are dissolved in hot concentrated H 3 PO 4 - H 2 SO 4 mixture and the solution diluted with 1M H 2 SO 4 . One aliquot of such solution (A) is used to record the first voltamogram which gives the U(VI) content. To a second aliquot HNO 3 and H 2 O 2 is added to oxidise uranium to the hexavalent state (B) and the second voltamogram is recorded from 0.0 to 0.4 V X SCE. The O:U ratio in the original sample is calculated by the expression: O/U = 2.000 + [U (VI) soln.A/% U(VI) soln. B]. The method provides an accurate means for determining O to U ratios in high-purity uranium dioxide, fuel pellets and a variety of oxides prepared for developmental work on ceramic fuel materials. (author) [pt

  17. Impact of uranium (U) on the cellular glutathione pool and resultant consequences for the redox status of U.

    Science.gov (United States)

    Viehweger, Katrin; Geipel, Gerhard; Bernhard, Gert

    2011-12-01

    Uranium (U) as a redox-active heavy metal can cause various redox imbalances in plant cells. Measurements of the cellular glutathione/glutathione disulfide (GSH/GSSG) by HPLC after cellular U contact revealed an interference with this essential redox couple. The GSH content remained unaffected by 10 μM U whereas the GSSG level immediately increased. In contrast, higher U concentrations (50 μM) drastically raised both forms. Using the Nernst equation, it was possible to calculate the half-cell reduction potential of 2GSH/GSSG. In case of lower U contents the cellular redox environment shifted towards more oxidizing conditions whereas the opposite effect was obtained by higher U contents. This indicates that U contact causes a consumption of reduced redox equivalents. Artificial depletion of GSH by chlorodinitrobenzene and measuring the cellular reducing capacity by tetrazolium salt reduction underlined the strong requirement of reduced redox equivalents. An additional element of cellular U detoxification mechanisms is the complex formation between the heavy metal and carboxylic functionalities of GSH. Because two GSH molecules catalyze electron transfers each with one electron forming a dimer (GSSG) two UO(2) (2+) are reduced to each UO(2) (+) by unbound redox sensitive sulfhydryl moieties. UO(2) (+) subsequently disproportionates to UO(2) (2+) and U(4+). This explains that in vitro experiments revealed a reduction to U(IV) of only around 33% of initial U(VI). Cellular U(IV) was transiently detected with the highest level after 2 h of U contact. Hence, it can be proposed that these reducing processes are an important element of defense reactions induced by this heavy metal.

  18. Nb{sub 2}OsB{sub 2}, with a new twofold superstructure of the U{sub 3}Si{sub 2} type: Synthesis, crystal chemistry and chemical bonding

    Energy Technology Data Exchange (ETDEWEB)

    Mbarki, Mohammed; Touzani, Rachid St.; Fokwa, Boniface P.T., E-mail: boniface.fokwa@ac.rwth-aachen.de

    2013-07-15

    The new ternary metal-rich boride, Nb{sub 2}OsB{sub 2}, was synthesized by arc-melting the elements in a water-cooled copper crucible under an argon atmosphere. The compound was characterized from single-crystal X-ray data and EDX measurements. It crystallizes as a new superstructure (space group P4/mnc, no. 128) of the tetragonal U{sub 3}Si{sub 2}-structure type with lattice parameters a=5.922(1) Å and c=6.879(2) Å. All of the B atoms are involved in B{sub 2} dumbbells with B–B distances of 1.89(4) Å. Structure relaxation using VASP (Vienna ab intio Simulation Package) has confirmed the space group and the lattice parameters. According to electronic structure calculations (TB–LMTO–ASA), the homoatomic B–B interactions are optimized and very strong, but relatively strong heteroatomic Os–B, Nb–B and Nb–Os bonds are also found: These interactions, which together build a three-dimensional network, are mainly responsible for the structural stability of this new phase. The density of state at the Fermi level predicts metallic behavior, as expected, from this metal-rich boride. - Graphical abstract: Nb{sub 2}OsB{sub 2} is, to the best of our knowledge, the first fully characterized phase in the ternary Nb–Os–B system. It crystallizes (space group P4/mnc, 128) with a new twofold superstructure of the U{sub 3}Si{sub 2} structure type (space group P4/mbm, 127), and is therefore the first boride in this structure family crystallizing with a superstructure of the U{sub 3}Si{sub 2} structure type. We show that the distortions leading to this superstructure occurs mainly in the Nb-layer, which tries to accommodate the large osmium atoms. The consequence of this puckering is the building osmium dumbbells instead of chains along [001]. - Highlights: • First compound in the Nb–Os–B system. • New twofold superstructure of U{sub 3}Si{sub 2} structure type. • Puckering of Nb-layer responsible for superstructure occurrence. • Chemical bonding studied

  19. 3. Laser Thomson scattering by plasmas. 3.2. Applications of incoherent Thomson scattering. 3.2.2. Incoherent Thomson scattering systems for JT-60U and JFT-2M

    International Nuclear Information System (INIS)

    Hatae, Takaki; Yoshida, Hidetoshi; Naito, Osamu; Yamauchi, Toshihiko

    2000-01-01

    Development of Thomson scattering diagnostics for the JT-60U and JFT-2M Tokamaks are described. Two Thomson scattering systems have been installed on JT-60U. The first system uses two ruby lasers (10 J, 0.25 Hz) and measures electron temperature (T e ) and density (n e ) profiles of 60 spatial points with high spatial resolution (8 mm). The second system uses a YAG laser (2 J, 30 Hz) and measures time evolution of T e and n e profiles with 15 spatial points. On JFT-2M, a TV Thomson Scattering system (TVTS) has been installed and measures at 81 spatial points with high spatial resolution (8.6 mm). These systems have provided not only profiles of all over the plasma, but successfully measured local structures to study various physics issues; e.g. H-mode edge pedestal, internal transport barrier, local MHD event. (author)

  20. Neutrino mass with large S U (2 )L multiplet fields

    Science.gov (United States)

    Nomura, Takaaki; Okada, Hiroshi

    2017-11-01

    We propose an extension of the standard model introducing large S U (2 )L multiplet fields which are quartet and septet scalars and quintet Majorana fermions. These multiplets can induce the neutrino masses via interactions with the S U (2 ) doublet leptons. We then find the neutrino masses are suppressed by a small vacuum expectation value of the quartet/septet and an inverse of the quintet fermion mass, relaxing the Yukawa hierarchies among the standard model fermions. We also discuss collider physics at the Large Hadron Collider, considering the production of charged particles in these multiplets, and due to the effects of violating the custodial symmetry, some specific signatures can be found. Then, we discuss the detectability of these signals.

  1. The Influence of Uranium Content and PVA/U Ratio on Physical Propertiesof PVA-U Gel and Its Oxide

    International Nuclear Information System (INIS)

    Damunir; W, Bangun; Indra-Suryawan; Endang-Nawangsih

    2000-01-01

    The influence of uranium content and PVA/U ratio on physical propertiesof PVA-U gel and its oxide has been investigated. Fifty milliliters of uranylnitrate solution containing 100 g U/l was neutralized using 1M NH 4 0H. Thesolution was converted into PVA-U sol by adding 9.18 % PVA while mixed andheated at 80 o C for 20 minutes. In order to find spherical gel, the solsolution was dropped into a 5 M NH 4 0H solution at room temperature. Theshape formed of the gels small spherical, shape of the formed gels werefiltered, washed and heated at 120 o C. After that the gels were calcined at800 o C for 4 hours. The formed U 3 O 8 particles. Under a similar method, theinfluence of uranium content from 150-400 g/l and the influence of PVA/Uratio of 6.5-12.5 % in 100 g U/l were studied. Characterization of the resultwas obtained from physical properties of the gel and its oxide in the form ofdensity using pycnometer, surface area using surface areameter with N 2 asabsorbent and particle size/ shape using a loop and optical microscope. Theexperimental results showed that both uranium content and PVA/U ratioaffected the physical properties of the kernel properties. The best resultoccurred at uranium content of 100 g/l and PVA/U 9.18 %. The resulted gelwith solid content of 89.17 %, density of 3.36 g/l and size of 124 μm. Theresulted oxide U 3 0 8 had density of 7.98 g U/l, surface area of specific of0.449 m 2 /g and grain size of 810 μm. (author)

  2. Mass spectrometric 230Th-234U-238U dating of the Devils Hole calcite vein

    International Nuclear Information System (INIS)

    Ludwig, K.R.; Simmons, K.R.; Szabo, B.J.; Riggs, A.C.; Winograd, I.J.; Landwehr, J.M.; Hoffman, R.J.

    1992-01-01

    The Devils Hole calcite vein contains a long-term climatic record, but requires accurate chronologic control for its interpretation. Mass-spectrometric U-series ages for samples from core DH-11 yielding 230 Th ages with precisions ranging from less than 1,000 years (2σ) for samples younger than ∼140 ka (thousands of years ago) to less than 50,000 years for the oldest samples (∼566 ka). The 234 U/ 238 U ages could be determined to a precision of ∼20,000 years for all ages. Calcite accumulated continuously from 566 ka until ∼60 ka at an average rate of 0.7 millimeter per 10 3 years. The precise agreement between replicate analyses and the concordance of the 230 Th/ 238 U and 234 U/ 238 U ages for the oldest samples indicate that the DH-11 samples were closed systems and validate the dating technique in general

  3. HYDROGEOLOGIC CHARACTERIZATION OF THE U-3bl COLLAPSE ZONE

    International Nuclear Information System (INIS)

    Bechtel Nevada and National Security Technologies, LLC

    2006-01-01

    The U-3bl collapse crater was formed by an underground nuclear test in August 1962. This crater and the adjoining U-3ax crater were subsequently developed and used as a bulk low-level radioactive waste disposal cell (U-3ax/bl), which is part of the Area 3 Radioactive Waste Management Site at the Nevada Test Site (NTS). Various investigations have been conducted to assess the hydrogeologic characteristics and properties in the vicinity of the U-3ax/bl waste disposal cell. This report presents data from one of these investigations, conducted in 1996. Also included in this report is a review of pertinent nuclear testing records, which shows that the testing operations and hydrogeologic setting of the U-3ax/bl site were typical for the period and location of testing

  4. Rice MEL2, the RNA recognition motif (RRM) protein, binds in vitro to meiosis-expressed genes containing U-rich RNA consensus sequences in the 3'-UTR.

    Science.gov (United States)

    Miyazaki, Saori; Sato, Yutaka; Asano, Tomoya; Nagamura, Yoshiaki; Nonomura, Ken-Ichi

    2015-10-01

    Post-transcriptional gene regulation by RNA recognition motif (RRM) proteins through binding to cis-elements in the 3'-untranslated region (3'-UTR) is widely used in eukaryotes to complete various biological processes. Rice MEIOSIS ARRESTED AT LEPTOTENE2 (MEL2) is the RRM protein that functions in the transition to meiosis in proper timing. The MEL2 RRM preferentially associated with the U-rich RNA consensus, UUAGUU[U/A][U/G][A/U/G]U, dependently on sequences and proportionally to MEL2 protein amounts in vitro. The consensus sequences were located in the putative looped structures of the RNA ligand. A genome-wide survey revealed a tendency of MEL2-binding consensus appearing in 3'-UTR of rice genes. Of 249 genes that conserved the consensus in their 3'-UTR, 13 genes spatiotemporally co-expressed with MEL2 in meiotic flowers, and included several genes whose function was supposed in meiosis; such as Replication protein A and OsMADS3. The proteome analysis revealed that the amounts of small ubiquitin-related modifier-like protein and eukaryotic translation initiation factor3-like protein were dramatically altered in mel2 mutant anthers. Taken together with transcriptome and gene ontology results, we propose that the rice MEL2 is involved in the translational regulation of key meiotic genes on 3'-UTRs to achieve the faithful transition of germ cells to meiosis.

  5. U-Th Burial Dates on Ostrich Eggshell

    Science.gov (United States)

    Sharp, W. D.; Fylstra, N. D.; Tryon, C. A.; Faith, J. T.; Peppe, D. J.

    2015-12-01

    Obtaining precise and accurate dates at archaeological sites beyond the range of radiocarbon dating is challenging but essential for understanding human origins. Eggshells of ratites (large flightless birds including ostrich, emu and others) are common in many archaeological sequences in Africa, Australia and elsewhere. Ancient eggshells are geochemically suitable for the U-Th technique (1), which has about ten times the range of radiocarbon dating (>500 rather than 50 ka), making eggshells attractive dating targets. Moreover, C and N isotopic studies of eggshell provide insights into paleovegetation and paleoprecipitation central to assessing past human-environment interactions (2,3). But until now, U-Th dates on ratite eggshell have not accounted for the secondary origin of essentially all of their U. We report a novel approach to U-Th dating of eggshell that explicitly accounts for secondary U uptake that begins with burial. Using ostrich eggshell (OES) from Pleistocene-Holocene east African sites, we have measured U and 232Th concentration profiles across OES by laser ablation ICP-MS. U commonly peaks at 10s to 100s of ppb and varies 10-fold or more across the ~2 mm thickness of OES, with gradients modulated by the layered structure of the eggshell. Common Th is high near the shell surfaces, but low in the middle "pallisade" layer of OES, making it optimal for U-Th dating. We determine U-Th ages along the U concentration gradient by solution ICP-MS analyses of two or more fractions of the pallisade layer. We then estimate OES burial dates using a simple model for diffusive uptake of uranium. Comparing such "U-Th burial dates" with radiocarbon dates for OES calcite from the same shells, we find good agreement in 7 out of 9 cases, consistent with rapid burial and confirming the accuracy of the approach. The remaining 2 eggshells have anomalous patterns of apparent ages that reveal they are unsuitable for U-Th dating, thereby providing reliability criteria innate

  6. Limitations on the precision of 238U/235U measurements and implications for environmental monitoring

    International Nuclear Information System (INIS)

    Russ III, G.P.

    1997-01-01

    The ability to determine the isotopic composition of uranium in environmental samples is an important component of the International Atomic Energy Agency's (IAEA) safeguards program, and variations in the isotopic ratio 238 U/ 235 U provide the most direct evidence of isotopic enrichment activities. The interpretation of observed variations in 238 U/ 235 U depends on the ability to distinguish enrichment from instrumental biases and any variations occurring in the environment but not related to enrichment activities. Instrumental biases that have historically limited the accuracy of 238 U/ 235 U determinations can be eliminated by the use of the 233 U/ 236 U double-spike technique. With this technique, it is possible to determine the 238 U/ 235 U in samples to an accuracy equal to the precision of the measurement, ca. 0.1% for a few 10's of nanograms of uranium. Given an accurate determination of 238 U/ 235 U, positive identification of enrichment activities depends on the observed value being outside the range of 238 U/ 235 U's expected as a result of natural or environmental variations. Analyses of a suite of soil samples showed no variation beyond 0.2% in 238 U/ 235 U

  7. Optical spectroscopy and crystal-field analysis of U{sup 3+}: Ba{sub 2}YCl{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Karbowiak, M.; Mech, A.; Drozdzyndki, J. [Wroclaw Univ., Faculty of Chemistry (Poland); Gajek, Z. [Polish Academy of Sciences, W. Trzebiatowski Institute of Low Temperature and Structure Research, Wroclaw (Poland); Edelstein, N.M. [Lawrence Berkeley National Lab., Chemical Sciences Div., CA (United States)

    2002-11-01

    High resolution absorption spectra of a U{sup 3+}(0.3%): Ba{sub 2}YCl{sub 7} single crystal were recorded in the 4000-50 000 cm{sup -1} range at 7 K. The observed crystal-field levels were assigned and fit to the parameters of the simplified angular overlap model (AOM) as well as a semi-empirical Hamiltonian representing the combined atomic and one-electron crystal-field interactions. The starting values of the AOM parameters were obtained from ab initio calculations. The analysis of the spectra allowed the assignment of 65 crystal-field levels with a relatively small rms deviation of 25 cm{sup -1} and has shown that the AOM approach can predict quite well the B{sub q}{sup k} crystal-field parameters. The value determined for the crystal-field strength parameter, N{sub v}, corresponds well with those determined for U{sup 3+} in other chloride single crystals. (authors)

  8. Examination of U3Si2-Al fuel elements from the Oak Ridge Research Reactor

    International Nuclear Information System (INIS)

    Copeland, G.L.; Snelgrove, J.L.; Hofman, G.L.

    1986-01-01

    The results of postirradiation examination of low-enriched U 3 Si 2 fuel elements from the Oak Ridge Research Reactor are presented. The elements replaced standard high-enriched elements and were handled routinely except that the burnup of half the elements was extended beyond normal limits up to about 98% peak. The elements were manufactured by commercial fuel suppliers. The performance was completely satisfactory for all the elements

  9. U-234/U-238 ratio: Qualitative estimate of groundwater flow in Rocky Flats monitoring wells

    International Nuclear Information System (INIS)

    Laul, J.C.

    1994-01-01

    Groundwater movement through various pathways is the primary mechanism for the transport of radionuclides and trace elements in a water/rock interaction. About three dozen wells, installed in the Rocky Flats Plant (RFP) Solar Evaporation Ponds (SEP) area, are monitored quarterly to evaluate the extent of any lateral and downgradient migration of contaminants from the Solar Evaporation Ponds: 207-A; 207-B North, 207-B Center, and 207-B South; and 207-C. The Solar Ponds are the main source for the various contaminants: radionuclides (U-238, U-234, Pu-239, 240 and Am-241); anions; and trace metals to groundwaters. The U-238 concentrations in Rocky Flats groundwaters vary from 2 (CO 3 ) 2 2- , because of the predominant bicarbonate medium

  10. Spectroscopic constants and potential energy curve of the iodine weakly bound 1u state correlating with the I(2P1/2) + I(2P1/2) dissociation limit

    International Nuclear Information System (INIS)

    Akopyan, M E; Baturo, V V; Lukashov, S S; Poretsky, S A; Pravilov, A M

    2015-01-01

    The stepwise three-step three-color laser population of the I 2 (β1 g , ν β , J β ) rovibronic states via the B0 u + , ν B , J B rovibronic states and rovibronic levels of the 1 u (bb) and 0 g + (bb) states mixed by hyperfine interaction is used for determination of rovibronic level energies of the weakly bound I 2 (1 u (bb)) state. Dunham coefficients of the state, Y i0 (i = 0–3), Y i1 (i = 0–2), Y 02 and Y 12 for the v 1 u  = 1–5, 8, 10, 15 and J 1 u  ≈ 9–87 ranges, the dissociation energy of the state, D e , and equilibrium I–I distance, R e , as well as the potential energy curve are determined. There are aperiodicities in the excitation spectrum corresponding to the β, ν β  = 23, J β  ← 1 u (bb), ν 1u  = 4, 5, J 1u progressions in the I 2  + Rg = He, Ar mixture, namely, a great number of lines which do not coincide with the R or P line progressions. Their positions conflict with the ΔJ-even selection rule. Furthermore, they do not correspond to the ΔJ-odd progression. (paper)

  11. Methyl isobutyl ketone (MIBK) induction of α2u-globulin nephropathy in male, but not female rats

    International Nuclear Information System (INIS)

    Borghoff, S.J.; Hard, G.C.; Berdasco, N.M.; Gingell, R.; Green, S.M.; Gulledge, W.

    2009-01-01

    Male F-344 rats were administered corn oil (vehicle control), d-limonene (positive control, 300 mg/kg), or MIBK (1000 mg/kg) and female F-344 rats corn oil (vehicle control) or MIBK for 10 consecutive days by oral gavage. Approximately 24 h after the final dose the kidneys were excised and the left kidney prepared and evaluated for histological changes including protein (hyaline) droplet accumulation, immunohistochemical staining for α2u-globulin (α2u), and proliferating cell nuclear antigen (PCNA) to quantitate renal cell proliferation. The right kidney was prepared for quantitation of total protein and α2u using an ELISA. MIBK elicited an increase in protein droplets, accumulation of α2u, and renal cell proliferation in male, but not female rats, responses characteristic of α2u-mediated nephropathy. MIBK produced identical histopathological changes in the male rat kidney when compared to d-limonene, an acknowledged inducer of α2u-nephropathy except that the grade of severity tended to be slightly lower with MIBK. MIBK did not induce any effects in female rats. Therefore, renal histopathology, along with the other measures of α2u accumulation, provides additional weight of evidence to support the inclusion of MIBK in the category of chemicals exerting renal effects through a α2u-nephropathy-mediated mode-of-action

  12. Monte Carlo analyses of simple U233 O2-ThO2 and U235 O2-ThO2 lattices with ENDF/B-IV data (AWBA development program)

    International Nuclear Information System (INIS)

    Hardy, J. Jr.; Ullo, J.J.

    1980-09-01

    A number of water-moderated Th-U235 and Th-U233 lattice integral experiments were analyzed in a consistent manner, with ENDF/B-IV data and detailed Monte Carlo methods. These experiments provide a consistent test of the nuclear data. The ENDF/B-IV data are found to perform reasonably well. Adequate agreement is found with integral measurements of thorium capture. Calculated K/sub eff/ values show a generally coherent pattern which is consistent with K/sub eff/ results obtained for homogeneous aqueous critical assemblies. Harder prompt fission spectra for U233 and U235 can correct the principal discrepancy observed with ENDF/B-IV, a bias trend in K/sub eff/ attributed to an underprediction of leakage

  13. Irradiation damage in U{sub 3}Si

    Energy Technology Data Exchange (ETDEWEB)

    MacEwan, J R; Bethune, B

    1969-04-15

    The ordered body-centered tetragonal structure of U{sub 3}S1 transforms allotropically or by irradiation damage to ordered and disordered face -centered cubic structures respectively. An exposure of about 6 x 10{sup 16} fissions/cm{sup 3} at 100{sup o}C produced X-ray diffraction patterns of the cubic form with a 0.6% decrease in X-ray density. However, immersion density measurements showed a volume increase of 2.3% at a similar exposure. Further irradiation removed all but two peaks from the diffraction pattern indicating a trend to an amorphous structure. Electrical resistivity measurements showed that U{sub 3}Si is an electronic conductor with a large positive temperature coefficient. Measurements made below the irradiation temperature of 100{sup o}C showed that the temperature coefficient decreased with irradiation and approached zero at high exposure, Amorphous materials have a negligible temperature coefficient, so the result confirms the trend observed by X-ray analyses. (author)

  14. Ranking U-Sapiens 2010-2

    Directory of Open Access Journals (Sweden)

    Carlos-Roberto Peña-Barrera

    2011-08-01

    Full Text Available Los principales objetivos de esta investigación son los siguientes: (1 que la comunidad científica nacional e internacional y la sociedad en general co-nozcan los resultados del Ranking U-Sapiens Colombia 2010_2, el cual clasifica a cada institución de educación superior colombiana según puntaje, posición y cuartil; (2 destacar los movimientos más importantes al comparar los resultados del ranking 2010_1 con los del 2010_2; (3 publicar las respuestas de algunos actores de la academia nacional con respecto a la dinámica de la investigación en el país; (4 reconocer algunas instituciones, medios de comunicación e investigadores que se han interesado a modo de reflexión, referenciación o citación por esta investigación; y (5 dar a conocer el «Sello Ranking U-Sapiens Colombia» para las IES clasificadas. El alcance de este estudio en cuanto a actores abordó todas y cada una de las IES nacionales (aunque solo algunas lograran entrar al ranking y en cuanto a tiempo, un periodo referido al primer semestre de 2010 con respecto a: (1 los resultados 2010-1 de revistas indexadas en Publindex, (2 los programas de maestrías y doctorados activos durante 2010-1 según el Ministerio de Educación Nacional, y (3 los resultados de grupos de investigación clasificados para 2010 según Colciencias. El método empleado para esta investigación es el mismo que para el ranking 2010_1, salvo por una especificación aún más detallada en uno de los pasos del modelo (las variables α, β, γ; es completamente cuantitativo y los datos de las variables que fundamentan sus resultados provienen de Colciencias y el Ministerio de Educación Nacional; y en esta ocasión se darán a conocer los resultados por variable para 2010_1 y 2010_2. Los resultados más relevantes son estos: (1 entraron 8 IES al ranking y salieron 3; (2 las 3 primeras IES son públicas; (3 en total hay 6 instituciones universitarias en el ranking; (4 7 de las 10 primeras IES son

  15. Production and release of the fission gas in (Th U)O2 fuel rods

    International Nuclear Information System (INIS)

    Dias, Marcio S.

    1982-06-01

    The volume, composition and release of the fission gas products were caculated for (Th, U)O 2 fuel rods. The theorectical calculations were compared with experimental results available on the literature. In ThO 2 + 5% UO 2 fuel rods it will be produced approximated 5% more fission gas as compared to UO 2 fuel rods. The fission gas composition or Xe to Kr ratio has showed a decreasing fuel brunup dependence, in opposition to that of UO 2 . Under the same fuel rod operational conditions, the (Th, U)O 2 fission gas release will be smaller as compared to UO 2 . This behaviour of (Th, U)O 2 fuel comes from smallest gas atom difusivity and higher activation energies of the processes that increase the fission gas release. (Author) [pt

  16. Effect of anthropogenic organic complexants on the solubility of Ni, Th, U(IV) and U(VI)

    Energy Technology Data Exchange (ETDEWEB)

    Felipe-Sotelo, M., E-mail: m.felipe-sotelo@lboro.ac.uk [Department of Chemistry, Loughborough University, LE11 3TU Loughborough, Leicestershire (United Kingdom); Edgar, M. [Department of Chemistry, Loughborough University, LE11 3TU Loughborough, Leicestershire (United Kingdom); Beattie, T. [MCM Consulting. Täfernstrasse 11, CH 5405 Baden-Dättwil (Switzerland); Warwick, P. [Enviras Ltd., LE11 3TU Loughborough, Leicestershire (United Kingdom); Evans, N.D.M.; Read, D. [Department of Chemistry, Loughborough University, LE11 3TU Loughborough, Leicestershire (United Kingdom)

    2015-12-30

    Highlights: • Citrate increases the solubility of Ni, Th and U between 3 and 4 orders of magnitude. • Theophrastite is the solubility controlling phase of Ni in 95%-saturated Ca(OH){sub 2}. • U(VI) and Ni may form Metal-citrate-OH complexes stabilised by the presence of Ca{sup 2+}. - Abstract: The influence of anthropogenic organic complexants (citrate, EDTA and DTPA from 0.005 to 0.1 M) on the solubility of nickel(II), thorium(IV) and uranium (U(IV) and U(VI)) has been studied. Experiments were carried out in 95%-saturated Ca(OH){sub 2} solutions, representing the high pH conditions anticipated in the near field of a cementitious intermediate level radioactive waste repository. Results showed that Ni(II) solubility increased by 2–4 orders of magnitude in the presence of EDTA and DTPA and from 3 to 4 orders of magnitude in the case of citrate. Citrate had the greatest effect on the solubility of Th(IV) and U(IV)/(VI). XRD and SEM analyses indicate that the precipitates are largely amorphous; only in the case of Ni(II), is there some evidence of incipient crystallinity, in the form of Ni(OH){sub 2} (theophrastite). A study of the effect of calcium suggests that U(VI) and Ni(II) may form metal-citrate-OH complexes stabilised by Ca{sup 2+}. Thermodynamic modelling underestimates the concentrations in solution in the presence of the ligands for all the elements considered here. Further investigation of the behaviour of organic ligands under hyperalkaline conditions is important because of the use of the thermodynamic constants in preparing the safety case for the geological disposal of radioactive wastes.

  17. Behavior of uranium along Jucar River (Eastern Spain). Determination of 234U/238U and 235U/238U ratios

    International Nuclear Information System (INIS)

    Rodriguez-Alvarez, M.J.; Sanchez, F.

    1995-01-01

    The uranium concentration and the 234 U/ 238 U, 235 U/ 238 U activity ratios were studied in water samples from Jucar River, using low-level α-spectrometry. The effects of pH, temperature and salinity were considered and more detailed sampling was done in the neighbourhood of Cofrentes Nuclear Plant (Valencia, Spain). Changes were observed in the uranium concentration with the salinity and the 234 U/ 238 U activity ratio was found to vary with pH. Leaching and dilution, which depend on pH and salinity, are the probable mechanisms for these changes in the concentration of uranium and the activity ratios. (author) 25 refs.; 4 figs.; 1 tab

  18. Membrane-bound human orphan cytochrome P450 2U1: Sequence singularities, construction of a full 3D model, and substrate docking.

    Science.gov (United States)

    Ducassou, Lionel; Dhers, Laura; Jonasson, Gabriella; Pietrancosta, Nicolas; Boucher, Jean-Luc; Mansuy, Daniel; André, François

    2017-09-01

    Human cytochrome P450 2U1 (CYP2U1) is an orphan CYP that exhibits several distinctive characteristics among the 57 human CYPs with a highly conserved sequence in almost all living organisms. We compared its protein sequence with those of the 57 human CYPs and constructed a 3D structure of a full-length CYP2U1 model bound to a POPC membrane. We also performed docking experiments of arachidonic acid (AA) and N-arachidonoylserotonin (AS) in this model. The protein sequence of CYP2U1 displayed two unique characteristics when compared to those of the human CYPs, the presence of a longer N-terminal region upstream of the putative trans-membrane helix (TMH) containing 8 proline residues, and of an insert of about 20 amino acids containing 5 arginine residues between helices A' and A. Its N-terminal part upstream of TMH involved an additional short terminal helix, in a manner similar to what was reported in the crystal structure of Saccharomyces cerevisiae CYP51. Our model also showed a specific interaction between the charged residues of insert AA' and phosphate groups of lipid polar heads, suggesting a possible role of this insert in substrate recruitment. Docking of AA and AS in this model showed these substrates in channel 2ac, with the terminal alkyl chain of AA or the indole ring of AS close to the heme, in agreement with the reported CYP2U1-catalyzed AA and AS hydroxylation regioselectivities. This model should be useful to find new endogenous or exogenous CYP2U1 substrates and to interpret the regioselectivity of their hydroxylation. Copyright © 2017 Elsevier B.V. and Société Française de Biochimie et Biologie Moléculaire (SFBBM). All rights reserved.

  19. General U(1)xU(1) F-theory Compactifications and Beyond: Geometry of unHiggsings and novel Matter Structure

    CERN Document Server

    Cvetic, Mirjam; Piragua, Hernan; Taylor, Washington

    2015-01-01

    We construct the general form of an F-theory compactification with two U(1) factors based on a general elliptically fibered Calabi-Yau manifold with Mordell-Weil group of rank two. This construction produces broad classes of models with diverse matter spectra, including many that are not realized in earlier F-theory constructions with U(1)xU(1) gauge symmetry. Generic U(1)xU(1) models can be related to a Higgsed non-Abelian model with gauge group SU(2)xSU(2)xSU(3), SU(2)^3xSU(3), or a subgroup thereof. The nonlocal horizontal divisors of the Mordell-Weil group are replaced with local vertical divisors associated with the Cartan generators of non-Abelian gauge groups from Kodaira singularities. We give a global resolution of codimension two singularities of the Abelian model; we identify the full anomaly free matter content, and match it to the unHiggsed non-Abelian model. The non-Abelian Weierstrass model exhibits a new algebraic description of the singularities in the fibration that results in the first expl...

  20. Solvability in D1,2(Ω) of the equation -Δu+c=Keu

    International Nuclear Information System (INIS)

    Duong Minh Duc.

    1989-06-01

    We establish the Sobolev inequality for a limiting case. Using this result, the Ekeland variational principle and our generalized critical values results we get the existence, nonexistence and nonuniqueness of solutions in D 1,2 (Ω) of the equation -Δu+c=Ke u . (author). 18 refs

  1. Phase stability, crystal structure and magnetism in (U1-xNbx)2 Ni21B6 and (UyNb1-y)3Ni20B6

    Science.gov (United States)

    Provino, Alessia; Bhattacharya, Amitava; Dhar, Sudesh K.; Pani, Marcella; Gatti, Flavio; Paudyal, Durga; Manfrinetti, Pietro

    Ternary phases with composition T2M21X6 and T3M20X6 (T = transition metal; M = 3 d metal; X = B, C, P) are reported to crystallize with the W2Cr21C6-type and Mg3Ni20B6-type, respectively (ternary ordered derivatives of the cubic Cr23C6-type, cF116). They attract interest due to their refractory, mechanical, and peculiar magnetic properties. Literature data on these compounds only concern apparently stoichiometric 2:21:6 and 3:20:6 phases. Often only nominal composition has been reported, with few structural refinements and no measurements of physical properties. Lack of detailed stoichiometry and crystallographic data does not allow sufficient understanding of the crystal chemistry and properties of these compounds. We studied stability, crystal structure and magnetism of (U1-xNbx)2 Ni21B6 and (UyNb1-y)3Ni20B6; stable phases are U2Ni21B6 and Nb3Ni20B6, as also confirmed by theoretical calculations. The two pristine compounds solubilize Nb and U, respectively, up to a given extent. The substitution of U by Nb leads to a structural change from the W2Cr21C6- to the Mg3Ni20B6-type. While U2Ni21B6 is a Pauli paramagnet (itinerant non-magnetic state of U-5 f electrons), in agreement with literature, magnetization data for (UyNb1-y)3 Ni20B6 show itinerant ferromagnetism with TC >300 K.

  2. Pulsed reactivity measurements of large 235U--Al castings in H2O

    International Nuclear Information System (INIS)

    Pellarin, D.J.; Jarriel, J.L.

    1977-01-01

    The safe storage and handling of large 235 U-Al castings at the Savannah River Plant are assured by limiting the number of fuel pieces and their spacing such that the k/sub eff/ calculated by KENO-IV with Hansen-Roach cross sections does not exceed some conservative limit with complete, accidental water immersion. For economic reasons, the conservative limit on the calculated k/sub eff/ is generally chosen as high as possible consistent with an accurate knowledge of the margin of error in the k/sub eff/ calculation. The margin of error for arrays of large, hollow cylinders of highly enriched 235 U-Al alloy fuel in H 2 O is presented. The subcritical reactivities were derived from pulsed neutron measurements. The measurements are extended to castings with 17.39 kg 235 U/m, the pulsed experiments are more accurately analyzed by the αv -1 method, and measurements for both 7-assembly hexagonal and 2 x 3 square pitch lattices are compared with KENO-IV calculations

  3. Local structure of Th1-xMO2 solid solutions (M = U, Pu)

    International Nuclear Information System (INIS)

    Hubert, S.; Heisbourg, G.; Moisy, Ph.; Dacheux, N.; Purans, J.E.

    2004-01-01

    X-ray absorption spectroscopy of Th 1-x U x O 2 and Th 1-x Pu x O 2 solid solutions was carried out on the Th, U L 3 -edges, and Pu L 3 edge to study the local structure environment of actinide mixed oxides. Various compositions of Th 1-x M x O 2 solid solutions have been prepared through the coprecipitation of the mixed oxalates from chloride or nitrate solutions: x = 0.11, 0.24, 0.37, 0.53, 0.67, 0.81, 0.91 and 1 for Th 1-x U x O 2 , and x = 0.13, 0.32, 0.66 and 1 for Th 1-x Pu x O 2 . They were characterized using X- ray diffraction. XRD analysis allowed to confirm that the variation of the lattice parameters varies linearly with the composition between the end members, suggesting that the atomic volume was conserved regardless of the details of the local distortions of the lattice, following the Vegard's law. Extending X-ray absorption fine structure (EXAFS) provides a direct characterization of the local distortions present in solid solutions. We found that opposite to the lattice parameter obtained by XRD, the interatomic distances given by EXAFS do not follow completely to neither the Vegard's law nor the virtual crystal approximation (VCA). However, the average lattice parameter obtained from EXAFS data for the first and the second shells agrees well with the one calculated from XRD data. (authors)

  4. Thermophysical and anion diffusion properties of (U x ,Th1-x )O2.

    Science.gov (United States)

    Cooper, Michael W D; Murphy, Samuel T; Fossati, Paul C M; Rushton, Michael J D; Grimes, Robin W

    2014-11-08

    Using molecular dynamics, the thermophysical properties of the (U x ,Th 1- x )O 2 system have been investigated between 300 and 3600 K. The thermal dependence of lattice parameter, linear thermal expansion coefficient, enthalpy and specific heat at constant pressure is explained in terms of defect formation and diffusivity on the oxygen sublattice. Vegard's law is approximately observed for solid solution thermal expansion below 2000 K. Different deviations from Vegard's law above this temperature occur owing to the different temperatures at which the solid solutions undergo the superionic transition (2500-3300 K). Similarly, a spike in the specific heat, associated with the superionic transition, occurs at lower temperatures in solid solutions that have a high U content. Correspondingly, oxygen diffusivity is higher in pure UO 2 than in pure ThO 2 . Furthermore, at temperatures below the superionic transition, oxygen mobility is notably higher in solid solutions than in the end members. Enhanced diffusivity is promoted by lower oxygen-defect enthalpies in (U x ,Th 1- x )O 2 solid solutions. Unlike in UO 2 and ThO 2 , there is considerable variety of oxygen vacancy and oxygen interstitial sites in solid solutions generating a wide range of property values. Trends in the defect enthalpies are discussed in terms of composition and the lattice parameter of (U x ,Th 1- x )O 2 .

  5. Dicty_cDB: Contig-U01997-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l

  6. Complexes of Cd sup 2 sup +, U(O sub 2 ) sup 2 sup + and Th sup 4 sup + at radiotracer levels with phosphoric acid

    International Nuclear Information System (INIS)

    Bouhlassa, S.; El-Yahyaoui, A.; Brillard, L.; Hussonnois, M.; Guillaumont, R.

    1994-01-01

    In this work, we have turn to account the radiochemical techniques in order to investigate the complexation of Cd sup 2 sup +, U(O sub 2) sup 2 sup + and Th sup 2 sup +, at strength Mu=0,2, in various phosphoric media characterized by C sub ( H sub 3 P O sub 4) <= 4 M and 0.7 <= pH <= 4. The method chosen for this purpose is the liquid-liquid extraction of radioisotopes at tracer scale, with di(2-ethyl hexyl) phosphoric acid dissolved in benzene. The radionuclides used are Cd-109, U-233, U-230 and Th-227. Their distribution between the two phases are established by alpha or gamma spectrometric analysis. The analysis of the distribution data allows to define, in addition of species extracted in organic phase, the nature of phosphoric complexes which take place in aqueous media. Stability constants of these complexes and associated thermodynamic data are determined. 2 tabs.; 2 refs. (author)

  7. New uranium chalcoantimonates, RbU{sub 2}SbS{sub 8} and KU{sub 2}SbSe{sub 8}, with a polar noncentrosymmetric structure

    Energy Technology Data Exchange (ETDEWEB)

    Choi, K S; Kanatzidis, M G

    1999-09-01

    The new compounds, RbU{sub 2}SbS{sub 8} and KU{sub 2}SbSe{sub 8}, were prepared as golden-black, blocklike crystals by the polychalcogenide molten flux method. RbU{sub 2}SbS{sub 8} has a two-dimensional character with layers running perpendicular to the c-axis. The coordination geometry around the U{sup 4+} atoms is best described as a bicapped trigonal prism. The trigonal prisms share triangular faces with neighboring prisms, forming one-dimensional columns along the a-axis. The columns are then joined to construct sheets by sharing capping S atoms. Sb{sup 3+} ions are sitting at the center of a slightly distorted seesaw coordination environment (CN = 4). Rb{sup +} ions are stabilized in 8-coordinate bicapped trigonal prismatic sites. KU{sub 2}SbSe{sub 8} has essentially the same structure as RbU{sub 2}SbS{sub 8}. However, Sb{sup 3+} and K{sup +} ions appear disordered in every other layer resulting in a different unit cell. RbU{sub 2}SbS{sub 8} is a semiconductor with a band gap of 1.38 eV. The band gap of KU{sub 2}SbSe{sub 8} could not be determined precisely due to the presence of overlapping intense f-f transitions in the region (0.5--1.1 eV). The Raman spectra show the disulfide stretching vibration in RbU{sub 2}SbS{sub 8} at 479 cm{sup {minus}1} and the diselenide stretching vibration in KU{sub 2}SbSe{sub 8} at 252 cm{sup {minus}1}. Magnetic susceptibility measurements indicate the presence of U{sup 4+} centers in the compounds. The compounds do not melt below 1,000 C under vacuum.

  8. Dicty_cDB: Contig-U10335-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG

  9. U^{28+}-intensity record applying a H_{2}-gas stripper cell

    Directory of Open Access Journals (Sweden)

    Winfried Barth

    2015-04-01

    Full Text Available To meet the Facility for Antiproton and Ion Research science requirements higher beam intensity has to be achieved in the present GSI-accelerator complex. For this an advanced upgrade program for the UNILAC is ongoing. Stripping is a key technology for all heavy ion accelerators. For this an extensive research and development program was carried out to optimize for high brilliance heavy ion operation. After upgrade of the supersonic N_{2}-gas jet (2007, implementation of high current foil stripping (2011 and preliminary investigation of H_{2}-gas jet operation (2012, recently (2014 a new H_{2}-gas cell using a pulsed gas regime synchronized with arrival of the beam pulse has been developed. An obviously enhanced stripper gas density as well as a simultaneously reduced gas load for the pumping system result in an increased stripping efficiency, while the beam emittance remains the same. A new record intensity (7.8 emA for ^{238}U^{28+} beams at 1.4  MeV/u has been achieved applying the pulsed high density H_{2} stripper target to a high intensity ^{238}U^{4+} beam from the VARIS ion source with a newly developed extraction system. The experimental results are presented in detail.

  10. VG2 URA TRAJECTORY DERIVED SUMM U1 COORDS 48SEC V1.0

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset contains Voyager 2 spacecraft position vectors relative to Uranus in minus U1 coordinates. The U1 or Uranus West Longitude System coordinate system is a...

  11. Study of electrical transport properties of (U 1- xY x)RuP 2Si 2

    Science.gov (United States)

    Radha, S.; Park, J.-G.; Roy, S. B.; Coles, B. R.; Nigam, A. K.; McEwen, K. A.

    1996-02-01

    Electrical resistivity and magnetoresistance ( {δϱ}/{ϱ}) measurements on a series of (U 1- xY x)Ru 2Si 2 (0 ⩽ x ⩽ 0.9) compounds in the temperature range 4.2-300 K and in magnetic fields up to 45 kOe are reported. The resistivity measurements do not show any signature of antiferromagnetism for x > 0.5. The compound URu 2Si 2 exhibits a large, positive ( {δϱ}/{ϱ}) presumably due to destruction of Kondo coherence as well as due to antiferromagnetism. The presence of even 5% Y at U-site weakens the Kondo coherence and reduces the magnetoresistance considerably.

  12. Geochemical control on the reduction of U(VI) to mononuclear U(IV) species in lacustrine sediments

    Science.gov (United States)

    Stetten, L.; Mangeret, A.; Brest, J.; Seder-Colomina, M.; Le Pape, P.; Ikogou, M.; Zeyen, N.; Thouvenot, A.; Julien, A.; Alcalde, G.; Reyss, J. L.; Bombled, B.; Rabouille, C.; Olivi, L.; Proux, O.; Cazala, C.; Morin, G.

    2018-02-01

    Contaminated systems in which uranium (U) concentrations slightly exceed the geochemical background are of particular interest to identify natural processes governing U trapping and accumulation in Earth's surface environments. For this purpose, we examined the role of early diagenesis on the evolution of U speciation and mobility in sediments from an artificial lake located downstream from a former mining site. Sediment and pore water chemistry together with U and Fe solid state speciation were analyzed in sediment cores sampled down to 50 cm depth at four locations in the lake. These organic-rich sediments (∼12% organic C) exhibited U concentrations in the 40-80 mg kg-1 range. The sediment columns were anoxic 2-3 mm below the sediment-water interface and pore waters pH was circumneutral. Pore water chemistry profiles showed that organic carbon mineralization was associated with Fe and Mn reduction and was correlated with a decrease in dissolved U concentration with depth. Immobilization of U in the sediment was correlated with the reduction of U(VI) to U(IV) at depth, as shown by U LIII-edge XANES spectroscopic analysis. XANES and EXAFS spectroscopy at the Fe K-edge showed the reduction of structural Fe(III) to Fe(II) in phyllosilicate minerals with depth, coincident with U(VI) to U(IV) reduction. Thermodynamic modeling suggests that Fe(II) could act as a major reducing agent for U(VI) during early diagenesis of these sediments, leading to complete U reduction below ∼30 cm depth. Shell-by-shell and Cauchy-Wavelet analysis of U LIII-EXAFS spectra indicates that U(VI) and U(IV) are mainly present as mononuclear species bound to C, P or Si ligands. Chemical extractions confirmed that ∼60-80% of U was present as non-crystalline species, which emphasizes that such species should be considered when evaluating the fate of U in lacustrine environments and the efficiency of sediment remediation strategies.

  13. Towards critical physics in 2+1d with U(2N)-invariant fermions

    Energy Technology Data Exchange (ETDEWEB)

    Hands, Simon [Department of Physics, College of Science, Swansea University,Singleton Park, Swansea SA2 8PP (United Kingdom)

    2016-11-04

    Interacting theories of N relativistic fermion flavors in reducible spinor representations in 2+1 spacetime dimensions are formulated on a lattice using domain wall fermions (DWF), for which a U(2N) global symmetry is recovered in the limit that the wall separation L{sub s} is made large. The Gross-Neveu (GN) model is studied in the large-N limit and an exponential acceleration of convergence to the large-L{sub s} limit is demonstrated if the usual parity-invariant mass mψ̄ψ is replaced by the U(2N)-equivalent im{sub 3}ψ̄γ{sub 3}ψ. The GN model and two lattice variants of the Thirring model are simulated for N=2 using a hybrid Monte Carlo algorithm, and studies made of the symmetry-breaking bilinear condensate and its associated susceptibility, the axial Ward identity, and the mass spectrum of both fermion and meson excitations. Comparisons are made with existing results obtained using staggered fermions. For the GN model a symmetry-breaking phase transition is observed, the Ward identity is recovered, and the spectrum found to be consistent with large-N expectations. There appears to be no obstruction to the study of critical UV fixed-point physics using DWF. For the Thirring model the Ward identity is not recovered, the spectroscopy measurements are inconclusive, and no symmetry breaking is observed all the way up to the effective strong coupling limit. This is consistent with a critical Thirring flavor number N{sub c}<2, contradicting earlier staggered fermion results.

  14. 235U and 238U (n,xn gamma) cross-sections

    International Nuclear Information System (INIS)

    Bacquias, A.; Dessagne, Ph.; Kerveno, M.; Rudolf, G.; Thiry, J.C.; Borcea, C.; Negret, A.L.; Drohe, J.C.; Nankov, N.; Nyman, M.; Plompen, A.; Rouki, C.; Stanoiu, M.

    2014-01-01

    The (n,n') and (n,2n) are important processes in the energy domain of fission neutrons, but the cross-sections suffer from large uncertainties, not compatible with the objectives fixed for future and advanced nuclear reactors. This paper presents our experimental effort to improve 235 U and 238 U (n,xnγ) cross-section data. The experiments were performed at the GELINA facility (Belgium), which provides a pulsed (800 Hz) neutron beam covering a wide energy spectrum (from a few eV to about 20 MeV). The GRAPhEME set-up is designed for prompt gamma spectroscopy and time-of-flight measurement. The analysis methods are presented. Already published results on 235 U are shown, as well as results on 238 U. The interpretation and discussion rely on the comparison with TALYS and EMPIRE predictions. (authors)

  15. Non(anti)commutative N = (1,1/2) supersymmetric U(1) gauge theory

    International Nuclear Information System (INIS)

    Araki, Takeo; Ito, Katsushi; Ohtsuka, Akihisa

    2005-01-01

    We study a reduction of deformation parameters in non(anti)commutative N = 2 harmonic superspace to those in non(anti)commutative N = 1 superspace. By this reduction we obtain the exact gauge and supersymmetry transformations in the Wess-Zumino gauge of non(anti)commutative N = 2 supersymmetric U(1) gauge theory defined in the deformed harmonic superspace. We also find that the action with the first order correction in the deformation parameter reduces to the one in the N = 1 superspace by some field redefinition. We construct deformed N = (1,1/2) supersymmetry in N = 2 supersymmetric U(1) gauge theory in non(anti)commutative N = 1 superspace

  16. Neutron Energy Spectra from Neutron Induced Fission of 235U at 0.95 MeV and of 238U at 1.35 and 2.02 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Almen, E; Holmqvist, B; Wiedling, T

    1971-09-15

    The shapes of fission neutron spectra are of interest for power reactor calculations. Recently it has been suggested that the neutron induced fission spectrum of 235U may be harder than was earlier assumed. For this reason measurements of the neutron spectra of some fissile isotopes are in progress at our laboratory. This report will present results from studies of the energy spectra of the neutrons emitted in the neutron induced fission of 235U and 238U. The measurements were performed at an incident neutron energy of 0.95 MeV for 235U and at energies of 1.35 and 2.02 MeV for 238U using time-of-flight techniques. The time-of-flight spectra were only analysed at energies higher than those of the incident neutrons and up to about 10 MeV. Corrections for neutron attenuation in the uranium samples were calculated using a Monte Carlo program. The corrected fission neutron spectra were fitted to Maxwellian temperature distributions. For 235U a temperature of 1.27 +- 0.01 MeV gives the best fit to the experimental data and for 238U the corresponding values are 1.29 +- 0.03 MeV at 1.35 MeV and 1.29 +- 0.02 MeV at 2.02 MeV

  17. Involvement of reversible binding to alpha 2u-globulin in 1,4-dichlorobenzene-induced nephrotoxicity.

    Science.gov (United States)

    Charbonneau, M; Strasser, J; Lock, E A; Turner, M J; Swenberg, J A

    1989-06-01

    Similarly to unleaded gasoline, 1,4-dichlorobenzene (1,4-DCB) administered for 2 years caused a dose-related increase in the incidence of renal tumors in male but not in female rats or in either sex of mice. Unleaded gasoline and 2,2,4-trimethylpentane (TMP), a component of unleaded gasoline, increased protein droplet formation and cell proliferation in male but not in female rat kidneys. These protein droplets contained, alpha 2u-globulin, a male rat-specific low-molecular-weight protein and 2,4,4-trimethyl-2-pentanol, a metabolite of TMP that was reversibly bound to this protein. Studies were undertaken to determine if 1,4-DCB produced similar effects; 1,2-DCB was used for comparison since it did not produce renal carcinogenesis in male rats. Gel filtration chromatography of a 116,000g supernatant prepared from kidneys of 1,4-[14C]DCB-treated rats showed that radiolabel coeluted with alpha 2u-globulin as one sharp peak as opposed to a multipeak pattern observed for 1,2-[14C]DCB; the maximal quantity of radiolabel for 1,4-DCB was twice that for 1,2-DCB. Equilibrium dialysis of kidney cytosol in the presence or absence of sodium dodecyl sulfate demonstrated that the radiolabel was reversibly bound to alpha 2u-globulin; the amount for 1,4-[14C]DCB-treated rats was almost twice as much as that for 1,2-[14C]DCB-treated rats. 1,2-DCB was also shown to be covalently bound to renal alpha 2u-globulin, and covalently bound to liver and plasma high-molecular-weight proteins. 1,4-DCB and, to a minor extent, 2,5-dichlorophenol, the major metabolite of 1,4-DCB, were reversibly bound to renal alpha 2u-globulin from 1,4-DCB-treated rats. 1,4-DCB increased protein droplet formation in male but not in female rat kidneys, whereas equimolar doses of 1,2-DCB showed no effect in either sex. Renal cell proliferation, measured by [3H]thymidine incorporation into renal DNA, was increased after 1,4-DCB but not after 1,2-DCB treatment. Nephrotoxicity and biochemical alterations induced by

  18. High-pressure U3O8 with the fluorite-type structure

    International Nuclear Information System (INIS)

    Zhang, F.X.; Lang, M.; Wang, J.W.; Li, W.X.; Sun, K.; Prakapenka, V.; Ewing, R.C.

    2014-01-01

    A new high-pressure phase of U 3 O 8 , which has a fluorite-type structure, forms at pressures greater than ∼8.1 GPa that was confirmed by in situ x-ray diffraction (XRD) measurements. The fluorite-type U 3 O 8 is stable at pressures at least up to ∼40 GPa and temperatures to 1700 K, and quenchable to ambient conditions. Based on the XRD analysis, there is a huge volume collapse (>20%) for U 3 O 8 during the phase transition and the quenched high-pressure phase is 28% denser than the initial orthorhombic phase at ambient conditions. The high-pressure phase has a very low compressibility comparing with the starting orthorhombic phase. - Graphical abstract: α-U 3 O 8 is in a layered structure with orthorhombic symmetry, at high pressures, it transformed to a fluorite-type cubic structure. There are a lot of defects in the cubic structure, and it is a new kind of hyperstoichiometric uranium oxide, which is stable at ambient conditions. - Highlights: • A new fluorite-type high-pressure phase was found in hyperstoichometric UO 2 +x (x∼0.8). • The new high-pressure structure is quenchable to ambient conditions. • Pressure driven phase transition in orthorhombic U 3 O 8 was first found

  19. Dicty_cDB: Contig-U15036-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG

  20. Vibrational structures in electron-CO2 scattering below the 2Πu shape resonance

    International Nuclear Information System (INIS)

    Allan, Michael

    2002-01-01

    Structures of vibrational origin were discovered in vibrationally inelastic electron-CO 2 cross sections in the energy range 0.4-0.9 eV, well below the 2 Π u shape resonance. They appear in the excitation of higher vibrational levels, in particular the highest members of the Fermi polyads of the type (n, 2m, 0) with n+m=2-4. The lowest two structures, at 0.445 and 0.525 eV, are narrow; higher-lying structures are broader and boomerang-like. The structures are absent when the antisymmetric stretch is co-excited. The structures are interpreted in terms of a wavepacket of the nuclei reflected from a potential surface of the CO 2 - anion in a bent and stretched geometry. A state emerging from the virtual state upon bending and stretching and the state resulting from bending the 2 Π u shape resonance are discussed as possibly being responsible for the structures. (author). Letter-to-the-editor

  1. Evaluation of fission cross sections and covariances for {sup 233}U, {sup 235}U, {sup 238}U, {sup 239}Pu, {sup 240}Pu, and {sup 241}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Kawano, Toshihiko [Kyushu Univ., Fukuoka (Japan); Matsunobu, Hiroyuki [Data Engineering, Inc. (Japan); Murata, Toru [AITEL Corporation, Tokyo (JP)] [and others

    2000-02-01

    A simultaneous evaluation code SOK (Simultaneous evaluation on KALMAN) has been developed, which is a least-squares fitting program to absolute and relative measurements. The SOK code was employed to evaluate the fission cross sections of {sup 233}U, {sup 235}U, {sup 238}U, {sup 239}Pu, {sup 240}Pu, and {sup 241}Pu for the evaluated nuclear data library JENDL-3.3. Procedures of the simultaneous evaluation and the experimental database of the fission cross sections are described. The fission cross sections obtained were compared with evaluated values given in JENDL-3.2 and ENDF/B-VI. (author)

  2. U.S. Coastal Relief Model - Southern California Version 2

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NGDC's U.S. Coastal Relief Model (CRM) provides a comprehensive view of the U.S. coastal zone integrating offshore bathymetry with land topography into a seamless...

  3. 195Pt and 119Sn Knight shifts of U3Pt3Sn4

    International Nuclear Information System (INIS)

    Kojima, K.; Takabatake, T.; Harada, A.; Hihara, T.

    1995-01-01

    The 195 Pt and 119 Sn Knight shifts in U 3 Pt 3 Sn 4 have been measured in the temperature range 4.2-298K. They exhibit Curie-Weiss like behaviors above about 50K and remain constant below about 10K. This suggests that the deviation of χ(T) from the modified Curie-Weiss law is an intrinsic property of U 3 Pt 3 Sn 4 . ((orig.))

  4. A novel method for stoichiometric reduction of (U{sub 3}O{sub 8},PuO{sub 2}) and its controlled oxidation using microwave

    Energy Technology Data Exchange (ETDEWEB)

    Singh, G., E-mail: gitendars@barctara.gov.in [Advanced Fuel Fabrication Facility (AFFF), Bhabha Atomic Research Centre, Tarapur, 401 502 (India); Kumar, Pradeep [Integrated Fuel Fabrication Facility, Bhabha Atomic Research Centre, Mumbai, 400 085 (India); Aher, S.; Purohit, P.; Khot, P.M. [Advanced Fuel Fabrication Facility (AFFF), Bhabha Atomic Research Centre, Tarapur, 401 502 (India); Prakash, Amrit [Radio-Metallurgy Division, Bhabha Atomic Research Centre, Mumbai, 400 085 (India); Das, D.K.; Behere, P.G.; Afzal, Mohd [Advanced Fuel Fabrication Facility (AFFF), Bhabha Atomic Research Centre, Tarapur, 401 502 (India)

    2016-10-15

    We report a process for stoichiometric reduction of U{sub 3}O{sub 8} and (U{sub 3}O{sub 8},PuO{sub 2}) mixed oxide powders using an indigenously developed 2.4 GHz microwave processing system. The process parameters were optimized by interpreting reduction kinetic curves at a temperature which is 150 °C lower than the conventional reduction. The process improved the sinterability of the powder which was evaluated in terms of average particle size, BET specific surface area and bulk density. A quick method for controlled oxidation of the reduced powder to incorporate a controlled amount of hyper-stoichiometry was demonstrated by modifying the same reduction process. The percent reduction was measured experimentally using O:(U + Pu) ratio. The X-ray diffraction analysis confirmed the various phases present. The process is novel considering shorter processing cycle, lower temperature processing, improved powder properties, energy efficiency and cost effectiveness. - Highlights: • A process for stoichiometric reduction of (U{sub 3}O{sub 8},PuO{sub 2}) was demonstrated using 2.4 GHz microwave. • A simple and quick method for obtaining controlled hyper-stoichiometry in the reduced powder was successfully demonstrated. • The process is novel relative to conventional methods in terms of time and energy economy and sinter-activity.

  5. Uniqueness of Positive Solutions of Δu+f(u)=0 in N, N<=3

    Science.gov (United States)

    Cortázar, Carmen; Elgueta, Manuel; Felmer, Patricio

    We study the uniqueness of radial ground states for the semilinear elliptic partial differential equation $Δ u+f(u)=0 {(*)}$ in N. We assume that the function f has two zeros, the origin and u0>0. Above u0 the function f is positive, is locally Lipschitz continuous and satisfies convexity and growth conditions of a superlinear nature. Below u0, f is assumed to be non-positive, non-identically zero and merely continuous. Our results are obtained through a careful analysis of the solutions of an associated initial-value problem, and the use of a monotone separation theorem. It is known that, for a large class of functions f, the ground states of (*) are radially symmetric. In these cases our result implies that (*) possesses at most one ground state.

  6. Uranium metalla-allenes with carbene imido R{sub 2}C=U{sup IV}=NR' units (R=Ph{sub 2}PNSiMe{sub 3}; R'=CPh{sub 3}): alkali-metal-mediated push-pull effects with an amido auxiliary

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Erli; Tuna, Floriana; Kaltsoyannis, Nikolas; Liddle, Stephen T. [School of Chemistry, The University of Manchester (United Kingdom); Lewis, William [School of Chemistry, The University of Nottingham (United Kingdom)

    2016-08-08

    We report uranium(IV)-carbene-imido-amide metalla-allene complexes [U(BIPM{sup TMS})(NCPh{sub 3})(NHCPh{sub 3})(M)] (BIPM{sup TMS}=C(PPh{sub 2}NSiMe{sub 3}){sub 2}; M=Li or K) that can be described as R{sub 2}C=U=NR' push-pull metalla-allene units, as organometallic counterparts of the well-known push-pull organic allenes. The solid-state structures reveal that the R{sub 2}C=U=NR' units adopt highly unusual cis-arrangements, which are also reproduced by gas-phase theoretical studies conducted without the alkali metals to remove their potential structure-directing roles. Computational studies confirm the double-bond nature of the U=NR' and U=CR{sub 2} interactions, the latter increasingly attenuated by potassium then lithium when compared to the hypothetical alkali-metal-free anion. Combined experimental and theoretical data show that the push-pull effect induced by the alkali metal cations and amide auxiliary gives a fundamental and tunable structural influence over the C=U{sup IV}=N units. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. PPADS: an antagonist at endothelial P2Y-purinoceptors but not P2U-purinoceptors.

    Science.gov (United States)

    Brown, C; Tanna, B; Boarder, M R

    1995-11-01

    1. Bovine aortic endothelial (BAE) cells contain two co-existing receptors for extracellular ATP, the P2Y and P2U-purinoceptors. Here we have determined whether the proposed P2X-purinoceptor antagonist, pyridoxalphosphate-6-azophenyl-2', 4'-disulphonic acid (PPADS) could distinguish between these two receptor subtypes. 2. Cells labelled with myo-[2-3H]-inositol were stimulated with increasing concentrations of either the P2Y-agonist, 2MeSATP, or the P2U-agonist, UTP in the absence or presence of 30 microM PPADS. The accumulation of total [3H]-inositol (poly)phosphates mediated by 2MeSATP was markedly attenuated by PPADS, whereas the response to UTP was not significantly affected. 3. Stimulation of BAE cells with increasing concentrations of ATP showed a reduced response in the presence of 10 microM PPADS, but this effect of the antagonist was not significant. By contrast, inhibition of the response to ADP was profound and highly significant. 4. These observations show that PPADS is not a selective P2X-purinoceptor antagonist, but is able to distinguish between P2Y- and P2YU-purinoceptors in BAE cells, and indicate that this compound may provide a useful tool in the study of multiple subtypes of P2-purinoceptors. Furthermore the results are consistent with the hypothesis that ATP interacts with both receptor subtypes, but that the action of ADP is primarily at the P2Y-purinoceptor in these endothelial cells.

  8. Measurement of the 235U/238U fission cross section ratio in the 235U fission neutron spectrum

    International Nuclear Information System (INIS)

    Azimi-Garakani, D.; Bagheri-Darbandi, M.

    1983-06-01

    Fission cross section ratio of 235 U to 238 U has been measured in the fast neutron field generated by the 235 U fission plate installed on the thermal column of the Tehran Research Reactor (TRR) with a Makrofol solid state nuclear track detector. The experiments were carried out with a set of total six enriched 235 U and depleted 238 U deposits with different masses and Makrofol films of 0.025mm and 0.060mm thicknesses. The chemically etched tracks were counted by an optical microscope. No significant differences were observed with the thin and the thick films. The results showed that the average fission cross section ratio is 3.83+-0.25. (author)

  9. Atomistic simulations of nanocrystalline U0.5Th0.5O2 solid solution under uniaxial tension

    Directory of Open Access Journals (Sweden)

    Hongxing Xiao

    2017-12-01

    Full Text Available Molecular dynamics simulations were performed to investigate the uniaxial tensile properties of nanocrystalline U0.5Th0.5O2 solid solution with the Born–Mayer–Huggins potential. The results indicated that the elastic modulus increased linearly with the density relative to a single crystal, but decreased with increasing temperature. The simulated nanocrystalline U0.5Th0.5O2 exhibited a breakdown in the Hall–Petch relation with mean grain size varying from 3.0 nm to 18.0 nm. Moreover, the elastic modulus of U1-yThyO2 solid solutions with different content of thorium at 300 K was also studied and the results accorded well with the experimental data available in the literature. In addition, the fracture mode of nanocrystalline U0.5Th0.5O2 was inclined to be ductile because the fracture behavior was preceded by some moderate amount of plastic deformation, which is different from what has been seen earlier in simulations of pure UO2.

  10. 11 CFR 102.11 - Petty cash fund (2 U.S.C. 432(h)(2)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Petty cash fund (2 U.S.C. 432(h)(2)). 102.11 Section 102.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL REGISTRATION, ORGANIZATION, AND... and Congressional district) sought by such candidate. ...

  11. Mianningite, (□,Pb,Ce,Na) (U"4"+,Mn,U"6"+) Fe"3"+_2(Ti,Fe"3"+)_1_8O_3_8, a new member of the crichtonite group from Maoniuping REE deposit, Mianning county, southwest Sichuan, China

    International Nuclear Information System (INIS)

    Ge, Xiangkun; Fan, Guang; Chen, Zhangru; Ai, Yujie; Li, Guowu

    2017-01-01

    Mianningite (IMA 2014-072), ideally (□,Pb,Ce,Na)(U"4"+,Mn,U"6"+) Fe"3"+_2(Ti,Fe"3"+)_1_8O_3_8, is a new member of the crichtonite group from the Maoniuping REE deposit, Mianning county, Sichuan province, China. It was found in fractures of lamprophyre veins and in the contact between lamprophyre and a later quartz-alkali feldspar syenite dyke with REE mineralization, and is named after its type locality. Associated minerals are microcline, albite, quartz, iron-rich phlogopite, augite, muscovite, calcite, baryte, fluorite, epidote, pyrite, magnetite, hematite, galena, hydroxylapatite, titanite, ilmenite, rutile, garnet-group minerals, zircon, allanite-(Ce), monazite-(Ce), bastnaesite-(Ce), parisite-(Ce), maoniupingite-(Ce), thorite, pyrochlore-group minerals and chlorite. Mianningite occurs as opaque subhedral to euhedral tabular crystals, up to 1-2 mm in size, black in color and streak, and with a submetallic luster. Mianningite is brittle, with a conchoidal fracture. Its average micro-indentation hardness is 83.8 kg/mm"2 (load 0.2 kg), which is equivalent to ∝6 on the Mohs hardness scale. Its measured and calculated densities are 4.62 (8) g/cm"3 and 4.77 g/cm"3, respectively. Under reflected light, mianningite is grayish white, with no internal reflections. It appears isotropic and exhibits neither bireflectance nor pleochroism. The empirical formula, calculated on the basis of 38 O atoms per formula unit (apfu), is [□_0_._3_2_2(Pb_0_._2_1_5Ba_0_._0_3_7Sr_0_._0_3_6Ca_0_._0_1_0)_Σ_0_._2_9_8(Ce_0_._1_2_8La_0_._0_7_7Nd_0_._0_1_2)_Σ_0_._2_1_7 (Na_0_._1_2_7K_0_._0_3_6)_Σ_0_._1_6_3]_Σ_0_1_._0_0_0(U"4"+_0_._4_4_7Mn_0_0_._2_9_3U"6 "+_0_._1_1_2Y_0_._0_9_1Zr_0_._0_2_3Th_0_._0_1_1)_Σ_0_._9_7_7(Fe"3"+_1_._2_2_4Fe"2"+_0_._2_4_3Mg_0_._0_2_3P_0_._0_0_8Si_0_._0_0_6 □_0_._4_9_6)_Σ_2_._0_0_0(Ti_1_2_._4_6_4Fe"3"+_5_._2_9_2V"5"+_0_._1_1_8Nb_0_._0_8_3Al_0_._0_2_6Cr"3"+_0_._0_1_7)_Σ_1_8_._0_0_0O_3_8. Mianningite is trigonal, belongs to the space group R anti 3, and has

  12. Dicty_cDB: Contig-U01750-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig

  13. Study on the irradiation swelling of U3Si2-Al dispersion fuel

    International Nuclear Information System (INIS)

    Xing Zhonghu; Ying Shihao

    2001-01-01

    The dominant modeling mechanisms on irradiation swelling of U 3 Si 2 -Al dispersion fuel are introduced. The core of dispersion fuel is looked to as micro-fuel elements of continuous matrix. The formation processes of gas bubbles in the fuel phase are described through the behavior mechanisms of fission gases. The swelling in the fuel phase causes the interaction between fuel particles and metal matrix, and the metal matrix can restrain the irradiation swelling of fuel particles. The developed code can predict irradiation-swelling values according to the parameters of fuel elements and irradiation conditions, and the predicted values are in agreement with the measured results

  14. Study on the effect of UO2 composition on dissolution of sintered (Th-U)O2 MOX by microwave heating

    International Nuclear Information System (INIS)

    Singh, G.; Malav, R.K.; Fulzele, A.K.; Prakash, A.; Afzal, Md.; Panakkal, J.P.

    2010-01-01

    Full text: Complete dissolution of sample is a prerequisite for any chemical analysis in liquid form. Dissolution of ThO 2 based mixed oxide sample like (Th-U)O 2 , (Th-Pu)O 2 is a challenging job due to single oxidation state of thorium (IV). The present paper describes a study carried out on effect of UO 2 composition on dissolution of sintered (Th-U)O 2 mixed oxide pellets, in 0.05M HF prepared in 16 M HNO 3 . The experiments were performed in PTFE pressure vessels which could stand up to ∼ 250 deg C and safely operated up to 120 psi in an indigenous 700 watts microwave digestion system. ThO 2 , ThO 2 -3.75%UO 2 and ThO 2 -5%UO 2 pellets (∼ 6 g each) were dissolved in 60 mL of 16M HNO 3 /HF mixtures (0.05M HF in 16 M HNO 3 ) in PTFE (teflon) made pressure vessels (each experiment triplicate) at a pressure of ∼ 120 psi. Samples (two at an instant) were withdrawn after each hour and Th in the solution was determined by EDTA complexometric titration where end point was detected visually. Table 1 shows the results of percent dissolution of Th (mean of three experiments) for the sintered pellet after each interval of time until 100% dissolution. The plot for percent dissolution of Th (mean Th %) against time taken for sintered pellets is shown. Application of microwave heating has been applied for the dissolution of uncrushed sintered ThO 2 and (Th-U)O 2 pellets. It is quite evident from Th% dissolved versus time curves that the dissolution is faster as percentage of UO 2 in (Th-U)O 2 MOX solid solution increases. This is attributed to UO 2 as it can easily absorb microwave energy, leading to high temperature

  15. Investigation of phase transformations of U2.5Zr7.5Nb and U3Zr9Nb alloys aging at 600 deg C

    International Nuclear Information System (INIS)

    Cantagalli, Natalia Mattar; Tanure, Leandro Paulo de Almeida Reis; Braga, Daniel Martins; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa

    2009-01-01

    Investigation has been made of the effects of high-temperature aging (600 deg C) on the phase transformations in the U2.5Zr7.5Nb and U3Zr9Nb alloys. These alloys have been produced with vacuum induction melting (VIM) furnace in cast ingots. The ingots were homogenized at 1000 deg C for 24 hours in vacuum of -4 torr, and cooled to room temperature at a rate of 3 deg C/min. Specimens from these homogeneous materials, cut in 3 mm high and 10 mm diameter, were reheated to γ phase at 850 deg C, for 1 hour, and aging at 600 deg C at different times from 0.5 to 24 hours. The phases decomposition were characterized by X-ray diffraction (XRD), metallographic, micro-probe analyze by energy dispersive spectrometry (EDS) and microhardness methods. It was verified that the decomposition of the δ phase proceeds in two steps. The first is a discontinuous precipitation of a lamellar two-phase aggregate composed of alpha solid solution and a metastable gamma phase. The metastable gamma phase has a constant composition at given temperature. After longer annealing, it decomposes eutectoidally into the equilibrium (α + δ 2 ) phases mixture. During this process a modification of the original lamellar microstructure takes place. The obtained metastable phases of these alloys of different compositions were analyzed in relation to their constitution, heat treatability and micrographic features and the results confronted with available distinct uranium alloys data from literature. (author)

  16. Stopping powers of havar for 1.6, 2.3 and 3.2 MeV/u heavy ions

    Energy Technology Data Exchange (ETDEWEB)

    Alanko, T. E-mail: tommi.alanko@phys.jyu.fi; Hyvoenen, J.; Kylloenen, V.; Raeisaenen, J.; Virtanen, A

    2000-03-01

    Stopping powers of havar for {sup 28,30}Si-, {sup 36}Ar-, {sup 54,56}Fe- and {sup 80,84}Kr-ions with energies of 1.6, 2.3 and 3.2 MeV/u have been determined by a transmission technique. Sample foils are exposed to the direct beams. No previous data for havar with these ions have been published. The obtained results are brought together with literature havar data for {sup 1}H-, {sup 4}He-, {sup 7}Li-, {sup 11}B-, {sup 12}C-, {sup 14}N-, {sup 16}O- and {sup 127}I-ions at the same ion velocity. The experimental data are compared with the values predicted by the SRIM-2000 parametrization using Bragg's rule. A systematic underestimation, by 6-23%, of the experimental stopping powers was observed. The empirical correction scheme of Thwaites has been applied to the stopping power values obtained by the parametrization. The corrected values agree well with the present results. Also, the effective charge values of the various ions were deduced from the experimental set of data.

  17. Calorimetric measurements on plutonium rich (U,Pu)O2 solid solutions

    International Nuclear Information System (INIS)

    Kandan, R.; Babu, R.; Nagarajan, K.; Vasudeva Rao, P.R.

    2008-01-01

    Enthalpy increments of U (1-y) Pu y O 2 solid solutions with y = 0.45, 0.55 and 0.65 were measured using a high-temperature differential calorimeter by employing the method of inverse drop calorimetry in the temperature range 956-1803 K. From the fit equations for the enthalpy increments, other thermodynamic functions such as heat capacity, entropy and Gibbs energy function have been computed in the temperature range 298-1800 K. The results are presented and compared with the data available in the literature. The results indicate that the enthalpies of U (1-y) Pu y O 2 solid solutions with y = 0.45, 0.55 and 0.65 obey the Neumann-Kopp's molar additivity rule

  18. Ion microprobe U-Pb dating of a dinosaur tooth

    International Nuclear Information System (INIS)

    Sano, Yuji; Terada, Kentaro; Ly, Chi V.; Park, Eun Ju

    2006-01-01

    Ion microprobe U-Pb dating of apatite is applied to a fossil tooth of a Allosaurid derived from the Hasandong Formation in the Gyeongsang basin, southeastern Korea. Twelve spots on a single fragment of the fossil dentine yield a Tera-Wasserburg concordia intercept age of 115±10 Ma (2σ, MSWD=0.59) on a 238 U/ 206 Pb- 207 Pb/ 206 Pb- 204 Pb/ 206 Pb diagram. The age provides a constraint on the depositional age of the fossil in its host Hassandong Formation as Early Aptian. The success of the ion microprobe dating depends on the heterogeneities of diagenetically incorporated U and Pb at the few hundred μm scale, the consequent variations in Pb isotopic compositions due to radioactive decay and the closed-system behavior of U and Pb. There are at least three end-members to explain the variations of minor chemical components such as FeO, SiO 2 and Al 2 O 3 , and trace elements as Th, U and rare earth elements (REE) in the sample by a simple mixing model. They are (1) very low minor and REE, very high common Pb with variable U abundances, (2) low common Pb, high minor, REE, and U abundances, and (3) low minor, common Pb, and U with intermediate REE abundances, even though groups (2) and (3) may consist of a larger group. Various contributions of the three (and/or two) end-members during diagenetic processes may cause the elemental fractionation of U and Pb in a fossil tooth. (author)

  19. Exploring the supersymmetric U(1 ) B -L×U(1 ) R model with dark matter, muon g - 2 , and Z' mass limits

    Science.gov (United States)

    Frank, Mariana; Özdal, Özer

    2018-01-01

    We study the low scale predictions of the supersymmetric standard model extended by U (1 )B -L×U (1 )R symmetry, obtained from S O (10 ) breaking via a left-right supersymmetric model, imposing universal boundary conditions. Two singlet Higgs fields are responsible for the radiative U (1 )B -L×U (1 )R symmetry breaking, and a singlet fermion S is introduced to generate neutrino masses through an inverse seesaw mechanism. The lightest neutralino or sneutrino emerge as dark matter candidates, with different low scale implications. We find that the composition of the neutralino lightest supersymmetric particle (LSP) changes considerably depending on the neutralino LSP mass, from roughly half U (1 )R bino, half minimal supersymmetric model (MSSM) bino, to a singlet higgsino, or completely dominated by the MSSM higgsino. The sneutrino LSP is statistically much less likely, and when it occurs it is a 50-50 mixture of right-handed sneutrino and the scalar S ˜. Most of the solutions consistent with the relic density constraint survive the XENON 1T exclusion curve for both LSP cases. We compare the two scenarios and investigate parameter space points and find consistency with the muon anomalous magnetic moment only at the edge of a 2 σ deviation from the measured value. However, we find that the sneutrino LSP solutions could be ruled out completely by the strict reinforcement of the recent Z' mass bounds. We finally discuss collider prospects for testing the model.

  20. U-Mo/Al-Si interaction: Influence of Si concentration

    International Nuclear Information System (INIS)

    Allenou, J.; Palancher, H.; Iltis, X.; Cornen, M.; Tougait, O.; Tucoulou, R.; Welcomme, E.; Martin, Ph.; Valot, C.; Charollais, F.; Anselmet, M.C.; Lemoine, P.

    2010-01-01

    Within the framework of the development of low enriched nuclear fuels for research reactors, U-Mo/Al is the most promising option that has however to be optimised. Indeed at the U-Mo/Al interfaces between U-Mo particles and the Al matrix, an interaction layer grows under irradiation inducing an unacceptable fuel swelling. Adding silicon in limited content into the Al matrix has clearly improved the in-pile fuel behaviour. This breakthrough is attributed to an U-Mo/Al-Si protective layer around U-Mo particles appeared during fuel manufacturing. In this work, the evolution of the microstructure and composition of this protective layer with increasing Si concentrations in the Al matrix has been investigated. Conclusions are based on the characterization at the micrometer scale (X-ray diffraction and energy dispersive spectroscopy) of U-Mo7/Al-Si diffusion couples obtained by thermal annealing at 450 deg. C. Two types of interaction layers have been evidenced depending on the Si content in the Al-Si alloy: the threshold value is found at about 5 wt.% but obviously evolves with temperature. It has been shown that for Si concentrations ranging from 2 to 10 wt.%, the U-Mo7/Al-Si interaction is bi-layered and the Si-rich part is located close to the Al-Si for low Si concentrations (below 5 wt.%) and close to the U-Mo for higher Si concentrations. For Si weight fraction in the Al alloy lower than 5 wt.%, the Si-rich sub-layer (close to Al-Si) consists of U(Al, Si) 3 + UMo 2 Al 20 , when the other sub-layer (close to U-Mo) is silicon free and made of UAl 3 and U 6 Mo 4 Al 43 . For Si weight concentrations above 5 wt.%, the Si-rich part becomes U 3 (Si, Al) 5 + U(Al, Si) 3 (close to U-Mo) and the other sub-layer (close to Al-Si) consists of U(Al, Si) 3 + UMo 2 Al 20 . On the basis of these results and of a literature survey, a scheme is proposed to explain the formation of different types of ILs between U-Mo and Al-Si alloys (i.e. different protective layers).

  1. Charge compensation mechanisms in U{sub 1-x}Gd{sub x}O{sub 2} and Th{sub 1-x}Gd{sub x}O{sub 2-x/2} studied by X-ray Absorption Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Bès, R., E-mail: rene.bes@aalto.fi [Department of Applied Physics, Aalto University, P.O. Box 14100, FI-00076 Aalto (Finland); Pakarinen, J.; Baena, A. [Belgian Nuclear Research Centre (SCK-CEN), Institute for Nuclear Materials Science, Boeretang 200, B-2400 Mol (Belgium); Conradson, S. [Synchrotron SOLEIL, Ligne de Lumière MARS, L' Orme des Merisiers, Saint Aubin, BP 48, F-91192 Gif-sur-Yvette Cedex (France); Verwerft, M. [Belgian Nuclear Research Centre (SCK-CEN), Institute for Nuclear Materials Science, Boeretang 200, B-2400 Mol (Belgium); Tuomisto, F. [Department of Applied Physics, Aalto University, P.O. Box 14100, FI-00076 Aalto (Finland)

    2017-06-15

    The charge compensation mechanisms in U{sub 1-x}Gd{sub x}O{sub 2} and Th{sub 1-x}Gd{sub x}O{sub 2-x/2} have been systematically studied using X-ray Absorption Spectroscopy (XAS) upon gradually increasing the Gd content. Gd doped nuclear fuels are widely used for optimizing the fresh core neutronics, yet when Gd{sup 3+} is substituted into U{sup 4+} or Th{sup 4+} lattice position in UO{sub 2} or ThO{sub 2}, respectively, charge must be compensated for charge neutrality. In U{sub 1-x}Gd{sub x}O{sub 2} the general hypothesis has been that the U{sup 4+} will oxidise to U{sup 5+}/U{sup 6+} while in Th{sub 1-x}Gd{sub x}O{sub 2-x/2} the fixed Th{sup 4+} valence requires generation of O vacancies. Our XAS results for a series of technologically relevant Gd contents (x = 0.04 to 0.14) in U{sub 1-x}Gd{sub x}O{sub 2} clearly demonstrate that upon increasing the Gd content U{sup 5+} is formed inducing slight increase in the U coordination number and contraction for the U-O distances while the Gd local environment remains virtually unchanged. For the Th{sub 1-x}Gd{sub x}O{sub 2-x/2} larger Gd fractions were applied (x = 0.10 to 0.34). Nonetheless, both Gd and Th local environments show changes upon increasing the Gd content; the average Gd-O and Th-O distances decrease gradually and the Gd and Th coordination numbers follow the expected trend considering the O vacancy formation to obtain charge neutrality. Finally, comparison to Gd{sub 2}O{sub 3} allowed us to propose that one of the Gd L{sub 3}-edge XANES resonance features is directly connected to the generation of O vacancies.

  2. Development of an U and Pu recovery process by molten salt electrorefining. Behavior of U and Pu at simultaneous recoveries into liquid cadmium cathodes

    International Nuclear Information System (INIS)

    Uozumi, Koichi; Kato, Tetsuya; Iizuka, Masatoshi; Inoue, Tadashi; Iwai, Takashi; Shirai, Osamu; Arai, Yasuo

    2003-01-01

    In order to study behaviors of U and Pu at simultaneous recoveries into liquid cadmium cathodes (LCCs) in the electrorefining of pyrometallurgical reprocessing, several experiments were conducted to recover U and Pu into LCCs at different U/Pu ratios in the salt phase. The major results were as follows: (1) The weight ratios of U and Pu in 120 g LCCs reached 10 wt.% (the tentative target), with current efficiencies higher than 80 %. (2) Under the conditions of U/Pu ratios in the initial salt phase less than 1/4.3, the amounts of recovered U and Pu were proportional to the passed electric charges, with the separation factors of U to Pu (= (U/Pu ration in the recovered product)/(U/Pu ratio in the salt)) between 1.2 and 2.0. (3) On the other hand, under the condition of U/Pu ratio in the initial salt phase at 1/1.73, only U was recovered into the LCC after the saturation of LCC with U and Pu. Accordingly, there will be a threshold in the U/Pu ratio of the salt phase for the simultaneous recovery of U and Pu. (4) Am showed a similar behavior to Pu. The separation factors of Am to Pu (=(AM/Pu ratio in the recovered product)/(Am/Pu ratio in the salt)) was 0.78, which means that Am is co-recovered with Pu into LCC. (author)

  3. A Stable U Isotopic Perspective on the U Budget and Global Extent of Modern Anoxia in the Ocean.

    Science.gov (United States)

    Tissot, F.; Dauphas, N.

    2015-12-01

    Isotopic fractionation between U4+ and U6+makes U stable isotopes potential tracers of global paleoredox conditions. In this work [1], we put the U-proxy up to a test against a highly constrained system: the modern ocean. We measured a large number of seawater samples from geographically diverse locations and found that the open ocean has a homogenous isotopic composition at δ238USW= -0.392 ± 0.005 ‰ (rel. to CRM-112a). From our measurement of rock samples (n=64) and compilations of literature data (n=380), we then estimated the U isotopic compositions of the various reservoirs involved in the modern oceanic U budget, as well as the fractionation factors associated with U incorporation into those reservoirs. Using a steady-state model, we compared the isotopic composition of the seawater predicted by the four most recent U oceanic budgets [2-5] to the modern seawater value we measured. Three of these budgets [2-4] predict a seawater isotopic composition in very good agreement with the observed δ238USW, which strengthens our confidence in the isotopic fractionation factors associated with each deposition environment and the fact that U is at steady-state in the modern ocean. The U oceanic budget of Henderson and Anderson (2003) does not reproduce the observed seawater composition because the U flux to anoxic/euxinic sediments relative to the total U flux out of the ocean is high in their model, which our analysis shows cannot be correct. The U isotopic composition of seawater is used to constrain the extent of anoxia in the modern ocean (% of seafloor covered by anoxic/euxinic sediments), which is 0.21 ± 0.09 %. This work demonstrates that stable isotopes of U can indeed trace the extent of anoxia in the modern global ocean, thereby validating the application of U isotope measurements to paleoredox reconstructions. Based on the above work, we will present the best estimate of the modern oceanic U budget. [1] Tissot F.L.H., Dauphas N. (2015) Geochim Cosmochim

  4. Mechanical behaviour of U3O8-Al cermets

    International Nuclear Information System (INIS)

    Figueredo, A.M. de; Ferreira, I.

    1981-01-01

    Homogeneous, high density U 3 O 8 -Al cermets, containing between 5 W% and 55 Wt% of U 3 ω 8 were fabricated using hot swaging and powder metallurgy technics. Tensile tests were performed at room temperature on specimens obtained from the cermets fabricated. The results show that the ultimate tensile strength (UTS) and elongation to fracture decrease with increasing U 3 O 8 in the cermet. The UTS is shown to be proportional to the minimum matrix load bearing cross-sectional area. The main influence of an increase in the content of U 3 O 8 in the cermet appears to be the decrease in the minimum matrix, load bearing cross-section. (Author) [pt

  5. U(N) instantons on N=(1/2) superspace: Exact solution and geometry of moduli space

    International Nuclear Information System (INIS)

    Britto, Ruth; Feng Bo; Lunin, Oleg; Rey, Soo-Jong

    2004-01-01

    We construct the exact solution of one (anti-)instanton in N=(1/2) super Yang-Mills theory defined on non(anti-)commutative superspace. We first identify N=(1/2) superconformal invariance as maximal spacetime symmetry. For the gauge group U(2), the SU(2) part of the solution is given by the standard (anti-)instanton, but the U(1) field strength also turns out to be nonzero. The solution is SO(4) rotationally symmetric. For the gauge group U(N), in contrast with the U(2) case, we show that the entire U(N) part of the solution is deformed by non(anti-)commutativity and fermion zero modes. The solution is no longer rotationally symmetric; it is polarized into an axially symmetric configuration because of the underlying non(anti-)commutativity. We compute the 'information metric' of one (anti-)instanton. We find that the moduli space geometry is deformed from the hyperbolic space H 5 (Euclidean anti-de Sitter space) in a way anticipated from reduced spacetime symmetry. Remarkably, the volume measure of the moduli space turns out to be independent of the non(anti-)commutativity. Implications for D branes in the Ramond-Ramond flux background and the gauge-gravity correspondence are discussed

  6. Human U87 astrocytoma cell invasion induced by interaction of βig-h3 with integrin α5β1 involves calpain-2.

    Directory of Open Access Journals (Sweden)

    Jie Ma

    Full Text Available It is known that βig-h3 is involved in the invasive process of many types of tumors, but its mechanism in glioma cells has not been fully clarified. Using immunofluorescent double-staining and confocal imaging analysis, and co-immunoprecipitation assays, we found that βig-h3 co-localized with integrin α5β1 in U87 cells. We sought to elucidate the function of this interaction by performing cell invasion assays and gelatin zymography experiments. We found that siRNA knockdowns of βig-h3 and calpain-2 impaired cell invasion and MMP secretion. Moreover, βig-h3, integrins and calpain-2 are known to be regulated by Ca(2+, and they are also involved in tumor cell invasion. Therefore, we further investigated if calpain-2 was relevant to βig-h3-integrin α5β1 interaction to affect U87 cell invasion. Our data showed that βig-h3 co-localized with integrin α5β1 to enhance the invasion of U87 cells, and that calpain-2, is involved in this process, acting as a downstream molecule.

  7. U3O8 obtained from metallic uranium

    International Nuclear Information System (INIS)

    Lopez, Marisol; Gonzalez, Alfredo; Pasqualini, Enrique E.

    2003-01-01

    Enriched uranium oxide, U 3 O 8 , used as nuclear powder in MTR's, can be obtained by direct oxidation of metallic uranium at 800 C degrees. Maximum density, 8.2 gr/cm 3 , is achieved after grinding and a high temperature treatment at 1400 C degrees. All the process is highly controllable and performed in dry environments. (author)

  8. New insights in third phase formation in the U(VI)-HNO3, TBP-alkane system

    International Nuclear Information System (INIS)

    Jensen, M. P.; Chiarizia, R.; Ferraro, J. R.; Borkowski, M.; Nash, K. L.; Thiyagarajan, P.; Littrell, K. C.

    2001-01-01

    In this work, the system U(VI)-HNO 3 -tributylphosphate (TBP)-n-dodecane has been revisited with the objective of gaining coordination chemistry and structural information on the species that are formed in the organic phase before and after third phase formation. Chemical analyses, spectroscopic and EXAFS data indicate that U(VI) is extracted as the UO 2 (NO 3 ) 2 · 2TBP adduct, while the third phase species has the composition UO 2 (NO 3 ) 2 · 2TBP · HNO 3 . Small-angle neutron scattering (SANS) data reveal the presence in the organic phase, both before and after phase splitting, of ellipsoidal aggregates whose formation seems to depend more on the extraction of HNO 3 than that of U(VI)

  9. Natural and anthropogenic {sup 236}U in environmental samples

    Energy Technology Data Exchange (ETDEWEB)

    Steier, Peter [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)], E-mail: peter.steier@univie.ac.at; Bichler, Max [Atominstitut der Osterreichischen Universitaeten, Technische Universitaet Wien, Stadionallee 2, Wien A-1020 (Austria); Keith Fifield, L. [Department of Nuclear Physics, RSPhysSE, Australian National University, Canberra, ACT 0200 (Australia); Golser, Robin; Kutschera, Walter; Priller, Alfred [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Quinto, Francesca [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Richter, Stephan [Euopean Commission, Directorate-General Joint Research Centre, Institute for Reference Materials and Measurements (IRMM), Retieseweg 111, B-2440 Geel (Belgium); Srncik, Michaela [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Terrasi, Philippo [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Wacker, Lukas [Institute for Particle Physics, HPK H25, Schafmattstrasse 20, CH-8093 Zuerich (Switzerland); Wallner, Anton [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Wallner, Gabriele [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Wilcken, Klaus M. [Scottish Universities Environmental Research Centre, Scottish Enterprise Technology Park, East Kilbride G75 OQF (United Kingdom); Maria Wild, Eva [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)

    2008-05-15

    The interaction of thermal neutrons with {sup 235}U results in fission with a probability of {approx}85% and in the formation of {sup 236}U (t{sub 1/2} = 2.3 x 10{sup 7} yr) with a probability of {approx}15%. While anthropogenic {sup 236}U is, therefore, present in spent nuclear fuel at levels of {sup 236}U/U up to 10{sup -2}, the expected natural ratios in the pre-anthropogenic environment range from 10{sup -14} to 10{sup -10}. At VERA, systematic investigations suggest a detection limit below {sup 236}U/U = 5 x 10{sup -12} for samples of 0.5 mg U, while chemistry blanks of {approx}2 x 10{sup 7} atoms {sup 236}U per sample limit the sensitivity for smaller samples. We have found natural isotopic ratios in uranium reagents separated before the onset of human nuclear activities, in uranium ores from various origins and in water from a subsurface well in Bad Gastein, Austria. Anthropogenic contamination was clearly visible in soil and rivulet samples from Salzburg, Austria, whereas river sediments from Garigliano river (Southern Italy) were close to the detection limit. Finally, our natural in-house standard Vienna-KkU was calibrated against a certified reference material (IRMM REIMEP-18 A)

  10. Hydration structures of U(III) and U(IV) ions from ab initio molecular dynamics simulations

    International Nuclear Information System (INIS)

    Leung, Kevin; Nenoff, Tina M.

    2012-01-01

    We apply DFT+U-based ab initio molecular dynamics simulations to study the hydration structures of U(III) and U(IV) ions, pertinent to redox reactions associated with uranium salts in aqueous media. U(III) is predicted to be coordinated to 8 water molecules, while U(IV) has a hydration number between 7 and 8. At least one of the innershell water molecules of the hydrated U(IV) complex becomes spontaneously deprotonated. As a result, the U(IV)–O pair correlation function exhibits a satellite peak at 2.15 Å associated with the shorter U(IV)–(OH − ) bond. This feature is not accounted for in analysis of extended x-ray absorption fine structure and x-ray adsorption near edge structure measurements, which yield higher estimates of U(IV) hydration numbers. This suggests that it may be useful to include the effect of possible hydrolysis in future interpretation of experiments, especially when the experimental pH is close to the reported hydrolysis equilibrium constant value.

  11. Static electric dipole polarizabilities of An5+/6+ and AnO2+/2+ (An = U, Np, and Pu) ions

    International Nuclear Information System (INIS)

    Parmar, Payal; Peterson, Kirk A.; Clark, Aurora E.

    2014-01-01

    The parallel components of static electric dipole polarizabilities have been calculated for the lowest lying spin-orbit states of the penta- and hexavalent oxidation states of the actinides (An) U, Np, and Pu, in both their atomic and molecular diyl ion forms (An 5+/6+ and AnO 2 +/2+ ) using the numerical finite-field technique within a four-component relativistic framework. The four-component Dirac-Hartree-Fock method formed the reference for MP2 and CCSD(T) calculations, while multireference Fock space coupled-cluster (FSCC), intermediate Hamiltonian Fock space coupled-cluster (IH-FSCC) and Kramers restricted configuration interaction (KRCI) methods were used to incorporate additional electron correlation. It is observed that electron correlation has significant (∼5 a.u. 3 ) impact upon the parallel component of the polarizabilities of the diyls. To the best of our knowledge, these quantities have not been previously reported and they can serve as reference values in the determination of various electronic and response properties (for example intermolecular forces, optical properties, etc.) relevant to the nuclear fuel cycle and material science applications. The highest quality numbers for the parallel components (α zz ) of the polarizability for the lowest Ω levels corresponding to the ground electronic states are (in a.u. 3 ) 44.15 and 41.17 for UO 2 + and UO 2 2+ , respectively, 45.64 and 41.42 for NpO 2 + and NpO 2 2+ , respectively, and 47.15 for the PuO 2 + ion

  12. Static electric dipole polarizabilities of An(5+/6+) and AnO2 (+/2+) (An = U, Np, and Pu) ions.

    Science.gov (United States)

    Parmar, Payal; Peterson, Kirk A; Clark, Aurora E

    2014-12-21

    The parallel components of static electric dipole polarizabilities have been calculated for the lowest lying spin-orbit states of the penta- and hexavalent oxidation states of the actinides (An) U, Np, and Pu, in both their atomic and molecular diyl ion forms (An(5+/6+) and AnO2 (+/2+)) using the numerical finite-field technique within a four-component relativistic framework. The four-component Dirac-Hartree-Fock method formed the reference for MP2 and CCSD(T) calculations, while multireference Fock space coupled-cluster (FSCC), intermediate Hamiltonian Fock space coupled-cluster (IH-FSCC) and Kramers restricted configuration interaction (KRCI) methods were used to incorporate additional electron correlation. It is observed that electron correlation has significant (∼5 a.u.(3)) impact upon the parallel component of the polarizabilities of the diyls. To the best of our knowledge, these quantities have not been previously reported and they can serve as reference values in the determination of various electronic and response properties (for example intermolecular forces, optical properties, etc.) relevant to the nuclear fuel cycle and material science applications. The highest quality numbers for the parallel components (αzz) of the polarizability for the lowest Ω levels corresponding to the ground electronic states are (in a.u.(3)) 44.15 and 41.17 for UO2 (+) and UO2 (2+), respectively, 45.64 and 41.42 for NpO2 (+) and NpO2 (2+), respectively, and 47.15 for the PuO2 (+) ion.

  13. Evolution of metastable state molecules N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) in a nanosecond pulsed discharge: A particle-in-cell/Monte Carlo collisions simulation

    Energy Technology Data Exchange (ETDEWEB)

    Gao Liang; Sun Jizhong; Feng Chunlei; Bai Jing; Ding Hongbin [School of Physics and Optical Electronic Technology, Key Laboratory of Materials Modification by Laser, Ion, and Electron Beams, Chinese Ministry of Education, Dalian University of Technology, Dalian 116024 (China)

    2012-01-15

    A particle-in-cell plus Monte Carlo collisions method has been employed to investigate the nitrogen discharge driven by a nanosecond pulse power source. To assess whether the production of the metastable state N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) can be efficiently enhanced in a nanosecond pulsed discharge, the evolutions of metastable state N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) density and electron energy distribution function have been examined in detail. The simulation results indicate that the ultra short pulse can modulate the electron energy effectively: during the early pulse-on time, high energy electrons give rise to quick electron avalanche and rapid growth of the metastable state N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) density. It is estimated that for a single pulse with amplitude of -9 kV and pulse width 30 ns, the metastable state N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) density can achieve a value in the order of 10{sup 9} cm{sup -3}. The N{sub 2}(A{sup 3}{Sigma}{sub u}{sup +}) density at such a value could be easily detected by laser-based experimental methods.

  14. U-series dating using thermal ionisation mass spectrometry (TIMS)

    Energy Technology Data Exchange (ETDEWEB)

    McCulloch, M.T. [Australian National University, Canberra, ACT (Australia). Research School of Earth Science

    1999-11-01

    U-series dating is based on the decay of the two long-lived isotopes{sup 238}U({tau}{sub 1/2}=4.47 x 10{sup 9} years) and {sup 235}U ({tau}{sub 1/2} 0.7 x 10{sup 9} years). {sup 238}U and its intermediate daughter isotopes {sup 234}U ({tau}{sub 1/2} = 245.4 ka) and {sup 230}Th ({tau}{sub 1/2} = 75.4 ka) have been the main focus of recently developed mass spectrometric techniques (Edwards et al., 1987) while the other less frequently used decay chain is based on the decay {sup 235}U to {sup 231}Pa ({tau}{sub 1/2} = 32.8 ka). Both the {sup 238}U and {sup 235}U decay chains terminate at the stable isotopes {sup 206}Pb and {sup 207}Pb respectively. Thermal ionization mass spectrometry (TIMS) has a number of inherent advantages, mainly the ability to measure isotopic ratios at high precision on relatively small samples. In spite of these now obvious advantages, it is only since the mid-1980`s when Chen et al., (1986) made the first precise measurements of {sup 234}U and {sup 232}Th in seawater followed by Edwards et al., (1987) who made combined {sup 234}U-{sup 230}Th measurements, was the full potential of mass spectrometric methods first realised. Several examples are given to illustrate various aspects of TIMS U-series 9 refs., 3 figs.

  15. Heterogeneity in the 238U/235U Ratios of Angrites.

    Science.gov (United States)

    Tissot, F.; Dauphas, N.; Grove, T. L.

    2016-12-01

    Angrites are differentiated meteorites of basaltic composition, of either volcanic or plutonic origin, that display minimal post-crystallization alteration, metamorphism, shock or impact brecciation. Because quenched angrites cooled very rapidly, all radiochronometric systems closed simultaneously in these samples. Quenched angrites are thus often used as anchors for cross-calibrating short-lived dating methods (e.g., 26Al-26Mg) and the absolute dating techniques (e.g, Pb-Pb). Due to the constancy of the 238U/235U ratio in natural samples, Pb-Pb ages have long been calculated using a "consensus" 238U/235U ratio, but the discovery of resolvable variations in the 238U/235U ratio of natural samples, means that the U isotopic composition of the material to date also has to be determined in order to obtain high-precision Pb-Pb ages. We set out (a) to measure at high-precision the 238U/235U ratio of a large array of angrites to correct their Pb-Pb ages, and (b) to identify whether all angrites have a similar U isotopic composition, and, if not, what were the processes responsible for this variability. Recently, Brennecka & Wadhwa (2012) suggested that the angrite-parent body had a homogeneous 238U/235U ratio. They reached this conclusion partly because they propagated the uncertainties of the U isotopic composition of the various U double spikes that they used onto the final 238U/235U ratio the sample. Because this error is systematic (i.e., it affects all samples similarly), differences in the δ238U values of samples corrected by the same double spike are better known than one would be led to believe if uncertainties on the spike composition are propagated. At the conference, we will present the results of the high-precision U isotope analyses for six angrite samples: NWA 4590, NWA 4801, NWA 6291, Angra dos Reis, D'Orbigny, and Sahara 99555. We will show that there is some heterogeneity in the δ238U values of the angrites and will discuss the possible processes by

  16. Development of a numerical code for the analysis of the linear stability of the U1 and U2 reactors of the CNLV; Desarrollo de un codigo numerico para el analisis de estabilidad lineal de los reactores de las U1 y U2 de la CNLV

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa P, G.; Estrada P, C.E. [Universidad Autonoma Metropolitana-Iztapalapa, 09000 Mexico D.F. (Mexico); Nunez C, A.; Amador G, R. [Comision Nacional de Seguridad Nuclear y Salvaguardias, Mexico D.F. (Mexico)

    2001-07-01

    The computer code ANESLI-1 developed by the CNSNS and UAM-I, has the main goal of making stability analysis of nuclear reactors of the BWR type, more specifically, the reactors of the U1 and U2 of the CNLV. However it can be used for another kind of applications. Its capacity of real time simulator, allows the prediction of operational transients, and conditions of dynamic steady states. ANESLI-1 was developed under a modular scheme, which allows to extend or/and to improve its scope. The lineal stability analysis predicts the instabilities produced by the wave density phenomenon. (Author)

  17. 7 CFR 51.3053 - U.S. No. 3.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... Standards for Florida Avocados Grades § 51.3053 U.S. No. 3. “U.S. No. 3” consists of avocados of similar...

  18. Dicty_cDB: Contig-U04768-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04768-1 no gap 762 6 2607190 2606476 MINUS 3 3 U04768 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U04768-1 Contig ID Contig-U04768-1 Contig update 2001. 8.29 Contig sequence >Contig-U04768-1 (Contig...-U04768-1Q) /CSM_Contig/Contig-U04768-1Q.Seq.d AAAGTCTTATTTGTTTAAAAAAAAAAAAAAAAAATAAAAAACTTTATTCT...AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Gap no gap Contig length 762 Chromosome number (1..6, M...lknf*KMVMMHDEYISPTKLQFGFMIAVAFLG TIGVMGFCQNVFDILLGVISILSIYIGMRGVWKRKKRWLFVFMWLMMGMGFLHLVSFAVV VILHHKNPTKNTVF

  19. Dicty_cDB: Contig-U12765-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA

  20. Electronic excitation of the b 3Σ+sub(u) state of H2 by electron impact in the linear algebraic approach

    International Nuclear Information System (INIS)

    Schneider, B.I.; Collins, L.A.

    1985-01-01

    Two-state close-coupling calculations have been performed on the X 1 Σsub(g) to b 3 Σsub(u) transition for e-H 2 scattering within the linear algebraic, effective optical potential approach. The strong orthogonality constraint between bound and continuum orbitals is relaxed by including correlation-type configurations. These correlation terms prove to be very important in the 2 Σsub(g) and 2 Σsub(u) symmetries and lead to an increase in the total cross section of a factor of two over earlier approaches, which neglected these terms. Good agreement is obtained with recent R-matrix and Schwinger variational calculations. (author)

  1. $\\Upsilon$ production in U + U collisions at $\\sqrt{s_{NN}}$=193 GeV measured with the STAR experiment

    CERN Document Server

    Adamczyk, L.

    2016-12-15

    We present a measurement of the inclusive production of Upsilon mesons in U+U collisions at 193 GeV at mid-rapidity (|y| < 1). Previous studies in central Au+Au collisions at 200 GeV show a suppression of Upsilon(1S+2S+3S) production relative to expectations from the Upsilon yield in p+p collisions scaled by the number of binary nucleon-nucleon collisions (Ncoll), with an indication that the Upsilon(1S) state is also suppressed. The present measurement extends the number of participant nucleons in the collision (Npart) by 20% compared to Au+Au collisions, and allows us to study a system with higher energy density. We observe a suppression in both the Upsilon(1S+2S+3S) and Upsilon(1S) yields in central U+U data, which consolidates and extends the previously observed suppression trend in Au+Au collisions.

  2. Introduction: U.S. Homophile Internationalism.

    Science.gov (United States)

    Stein, Marc

    2017-01-01

    This article introduces "U.S. Homophile Internationalism," a special issue of the Journal of Homosexuality. The introduction provides a broad overview of the "U.S. Homophile Internationalism" archive and exhibit, which was published on the Outhistory Web site in 2015. The archive and exhibit consists of more than 800 U.S. homophile magazine articles, letters, and other items that referenced non-U.S. regions of the world from 1953 to 1964. The essays in the special issue focus on (1) Africa; (2) Asia and the Pacific; (3) Canada; (4) Latin America and the Caribbean; (5) the Middle East; and (6) Russia, the Soviet Union, and Eastern Europe. There is also an article that addresses the public history and digital humanities dimensions of the project. The introduction concludes by discussing the essays' common goals, themes, and concerns.

  3. Preparation of 235mU targets for 235U(n,n')235mU cross section measurements

    International Nuclear Information System (INIS)

    Bond, E.M.; Vieira, D.J.; Rundberg, R.S.; Glover, S.; Hynek, D.; Jansen, Y.; Becker, J.; Macri, R.

    2008-01-01

    This paper describes the preparation of samples for an experiment to measure the cross-section for 235 U(n,n') 235m U in a fast fission spectrum of neutrons provided by a fast pulsed reactor/critical assembly. Samples of 235m U have been prepared for the calibration of the internal conversion electron detector that is used for the 235m U measurement. Two methods are described for the preparation of 235 mU. The first method used a U-Pu chemical separation based on anion-exchange chromatography and the second method used an alpha recoil collection method. Thin, uniform samples of 235m U+ 235 U were prepared for the experiment using electrodeposition. (author)

  4. Dicty_cDB: Contig-U12086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

  5. The technique for determination of surface contamination by uranium on U3Si2-Al plate-type fuel elements

    International Nuclear Information System (INIS)

    Li Shulan; He Fengqi; Wang Qingheng; Han Jingquan

    1993-04-01

    The NDT method for determining the surface contamination by uranium on U 3 Si 2 -Al plate-type fuel elements, the process of standard specimen preparation and the graduation curve are described. The measurement results of U 3 Si 2 -Al plate-type fuel elements show that the alpha counting method to measure the surface contamination by uranium on fuel plate is more reliable. The UB-1 type surface contamination meter, which was recently developed, has many advantages such as high sensitivity to determine the uranium pollution, short time in measuring, convenience for operation, and the minimum detectable amount of uranium is 5 x 10 -10 g/cm 2 . The measuring device is controlled by a microcomputer. Besides data acquisition and processing, it has functions of statistics, output data on terminal or to printer and alarm. The procedures of measurement are fully automatic. All of these will meet the measuring needs in batch process

  6. Duality invariance of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory

    International Nuclear Information System (INIS)

    Dayi, Oemer F.; Kelleyane, Lara T.; Uelker, Kayhan

    2005-01-01

    A parent action is introduced to formulate (S-) dual of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory. Partition function for parent action in phase space is utilized to establish the equivalence of partition functions of the theories which this parent action produces. Thus, duality invariance of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory follows. The results which we obtained are valid at tree level or equivalently at the first order in the nonanticommutativity parameter C μν

  7. Quantitative dissolution of (U, Pu)O2 MOX (0.4% to 44% PuO2) using microwave heating technique

    International Nuclear Information System (INIS)

    Malav, R.K.; Fulzele, Ajit K.; Prakash, Amrit; Afzal, Md.; Panakkal, J.P.

    2011-01-01

    AFFF has fabricated the (U, Pu)O 2 mixed oxide fuels for PHWRs, BWRs, PFBRs and FBTRs. The quantitative dissolution of the fuel samples are required within time for accurate determination of uranium-plutonium in chemical quality control laboratory. This paper describes the use of microwave heating technique in quantitative dissolution of (U, Pu)O 2 MOX (from 0.4% to 44% PuO 2 ). (author)

  8. Dicty_cDB: Contig-U09822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

  9. Characterization of the interaction layer in diffusion couples U-Mo-Zr/Al and U-Mo-Zr/Al-A356 at 550 C degrees; Caracterizacion de la zona de interaccion en pares de difusion a 550 grados C U-Mo-Zr/Al y U-Mo-Zr/Al-A356

    Energy Technology Data Exchange (ETDEWEB)

    Komar Varela, Carolina; Arico, Sergio; Mirandou, Marcela; Balart, Silvia; Gribaudo, Luis [Comision Nacional de Energia Atomica, General San Martin (Argentina). Dept. de Materiales; com, carolinakomar@gmail

    2007-07-01

    Out-of-pile diffusion experiments were performed between U-7 wt.% Mo-1 wt.% Zr and Al or Al A356 (7,1 wt.% Si) at 550 C degrees. In this work morphological characterization and phase identification on both interaction layers are presented. They were carried out by the use of different techniques: optical and scanning electron microscopy, X-ray diffraction and WDS microanalysis. In the interaction layer U-7 wt.% Mo-1 wt.% Zr/Al, the phases UAl{sub 3}, UAl{sub 4}, Al{sub 20}Mo{sub 2}U and Al{sub 43}Mo{sub 4}U{sub 6} were identified. Similar results in the interaction layer of the U-7 % Mo/Al at 580 C degrees were previously obtained. In the interaction layer U-7 wt.% Mo-1 wt.% Zr/Al A356, the phases U(Al,Si){sub 3} with 25 at.% Si and Si{sub 5}U{sub 3} were identified. This last phase, with a higher Si concentration, was identified with X-ray diffraction synchrotron radiation performed at the National Synchrotron Light Laboratory, Campinas, Brazil. (author) [Spanish] Se realizaron experiencias fuera de reactor en pares de difusion quimica U-7 % Mo-1 % Zr/Al y U-7 % Mo-1 % Zr/Al A356. En este trabajo se presentan los resultados de la caracterizacion morfologica e identificacion de fases presentes en la zona de interaccion que se forma al ser sometidos a un tratamiento isotermico de 1,5 h a 550 grados C. Las tecnicas utilizadas fueron: microscopia optica y electronica de barrido, difraccion de rayos X y microanalisis cuantitativo por sonda electronica. En la zona de interaccion correspondiente al par U-7 % Mo-1 % Zr/Al se identificaron las fases UAl{sub 3}, UAl{sub 4}, Al{sub 20}Mo{sub 2}U y Al{sub 43}Mo{sub 4}U{sub 6}. Estas cuatro fases fueron identificadas en pares U-7 % Mo/Al a 580 grados C en trabajos anteriores. En la zona de interaccion correspondiente al par U-7 % Mo-1 % Zr/Al A356 se identificaron las fases U(Al,Si){sub 3} (con una concentracion de 25 %at.Si) y Si{sub 5}U{sub 3}. Este compuesto rico en Si solo pudo ser identificado mediante la utilizacion de

  10. Preparation of high density (Th, U)O2 pellets by sol-gel microsphere pelletization and 1300 C air sintering

    International Nuclear Information System (INIS)

    Yamagishi, Shigeru; Takahashi, Yoshihisa

    1994-01-01

    The fabrication of high density (Th, U)O 2 pellets by the sol-gel microsphere pelletization (SGMP) process was studied. To prepare source ThO 2 -UO 3 microspheres, isopropyl alcohol was substituted for the water in gel and thereafter removed by evacuating and subsequently by heating at 200 C in air. After humidifying the microspheres up to the moisture content ranging 10-21%, they were compacted into a pellet under 150-500 MPa and sintered in air at 1300 C. Even at the relatively low temperature, the maximum density reached 98% TD or higher for the U/(Th+U) ratios of 5-20 mol%. Such high density products survived as firm pellets with a similarly high density of 99% TD during the reduction into (Th, U)O 2 in Ar-4% H 2 at 1300 C. ((orig.))

  11. The synthesis of [U-14C phenyl] LS 840606, an agricultural fungicide

    International Nuclear Information System (INIS)

    Madegard, G.; Mestre, P.; Raimond, P.; Noel, J.-P.

    1995-01-01

    2,2',4'-Trichloro-[ring U- 14 C]acetophenone was the key intermediate of this synthesis patterned after the industrial route. An unexpected poor yield was observed during the preparation by the Friedel-Crafts reaction of chloroacetyl chloride with 1,3-dichloro-[U- 14 C]benzene, possibly the result of an isotope effect although this poor yield might be explained by other factors. Two routes were checked for the preparation of 1,3-dichloro-[U- 14 C]benzene. The action of CCl 4 with 1,3-dinitro-[U- 14 C]benzene at 280 o C was entailed with explosions. A safer route started from [U- 14 C]aniline via 2,4-dichloro-[ring U- 14 C]acetanilide. Friedel-Crafts reaction with acetyl chloride gave rise in 52% yield to 2',4'-dichloro-[ring U- 14 C]acetophenone which was brominated to 2-bromo-2',4'-dichloro-[ring U- 14 C]acetophenone; was condensed with 2,2-ethylenedioxy)etylmagnesium bromide to compound, was condensed with 1,2,4-triazole then successively treated with HCl:water:dioxane and 2,2,2-trifluoroethanol/HCl. Separation of the two diastereomers by medium pressure liquid chromatography. 7% overall radioactivity yield from [U- 14 C]aniline. Radiochemical purity 99%. (author)

  12. IAEA CIELO Evaluation of Neutron-induced Reactions on 235U and 238U Targets

    Science.gov (United States)

    Capote, R.; Trkov, A.; Sin, M.; Pigni, M. T.; Pronyaev, V. G.; Balibrea, J.; Bernard, D.; Cano-Ott, D.; Danon, Y.; Daskalakis, A.; Goričanec, T.; Herman, M. W.; Kiedrowski, B.; Kopecky, S.; Mendoza, E.; Neudecker, D.; Leal, L.; Noguere, G.; Schillebeeckx, P.; Sirakov, I.; Soukhovitskii, E. S.; Stetcu, I.; Talou, P.

    2018-02-01

    Evaluations of nuclear reaction data for the major uranium isotopes 238U and 235U were performed within the scope of the CIELO Project on the initiative of the OECD/NEA Data Bank under Working Party on Evaluation Co-operation (WPEC) Subgroup 40 coordinated by the IAEA Nuclear Data Section. Both the mean values and covariances are evaluated from 10-5 eV up to 30 MeV. The resonance parameters of 238U and 235U were re-evaluated with the addition of newly available data to the existing experimental database. The evaluations in the fast neutron range are based on nuclear model calculations with the code EMPIRE-3.2 Malta above the resonance range up to 30 MeV. 235U(n,f), 238U(n,f), and 238U(n,γ) cross sections and 235U(nth,f) prompt fission neutron spectrum (PFNS) were evaluated within the Neutron Standards project and are representative of the experimental state-of-the-art measurements. The Standards cross sections were matched in model calculations as closely as possible to guarantee a good predictive power for cross sections of competing neutron scattering channels. 235U(n,γ) cross section includes fluctuations observed in recent experiments. 235U(n,f) PFNS for incident neutron energies from 500 keV to 20 MeV were measured at Los Alamos Chi-Nu facility and re-evaluated using all available experimental data. While respecting the measured differential data, several compensating errors in previous evaluations were identified and removed so that the performance in integral benchmarks was restored or improved. Covariance matrices for 235U and 238U cross sections, angular distributions, spectra and neutron multiplicities were evaluated using the GANDR system that combines experimental data with model uncertainties. Unrecognized systematic uncertainties were considered in the uncertainty quantification for fission and capture cross sections above the thermal range, and for neutron multiplicities. Evaluated files were extensively benchmarked to ensure good performance in

  13. Scalar mesons and glueballs in a chiral U(3)xU(3) quark model with 't Hooft interaction

    International Nuclear Information System (INIS)

    Nagy, M.; Volkov, M.K.; Yudichev, V.L.

    2000-01-01

    In a U(3)xU(3) quark chiral model of the Nambu-Jona-Lasino (NJL) type with the 't Hooft interaction, the ground scalar isoscalar mesons and a scalar glueball are described. The glueball (dilaton) is introduced into the effective meson Lagrangian written in a chirally symmetric form on the basis of scale invariance. The singlet-octet mixing of scalar isoscalar mesons and their mixing with the glueball are taken into account. Mass spectra of the scalar mesons and glueball and their strong decays are described

  14. Intenzitet stresa kod učitelja u osnovnim školama

    OpenAIRE

    Tomašević, Suzana; Horvat, Gordana; Leutar, Zdravka; Horvat, Gordana

    2016-01-01

    Cilj ovog rada bio je istražiti intenzitet stresa kod učitelja razredne i predmetne nastave u seoskim i gradskim osnovnim školama. Ovim istraživanjem želi se utvrditi postoji li statistički značajna razlika u intenzitetu stresa između učitelja razredne nastave i učitelja predmetne nastave s obzirom na mjesto rada, selo ili grad. U istraživanju je korišten psihologijski instrument za mjerenje percepcije stresa (PerceivedStressScale) (Cohen, S., Kamarck, T, Mermelstein, R. 1983). Istraživanj...

  15. The crystal structure of ianthinite, [U24+(UO2)4O6(OH)4(H2O)4](H2O)5: a possible phase for Pu4+ incorporation during the oxidation of spent nuclear fuel

    International Nuclear Information System (INIS)

    Burns, P.C.; Hawthorne, F.C.; Miller, M.L.; Ewing, R.C.

    1997-01-01

    Ianthinite, [U 4+ 2 (UO 2 ) 4 O 6 (OH) 4 (H 2 O) 4 ](H 2O) 5 , is the only known uranyl oxide hydrate mineral that contains U 4+ , and it has been proposed that ianthinite may be an important Pu 4+ -bearing phase during the oxidative dissolution of spent nuclear fuel. The crystal structure of ianthinite, orthorhombic, a=0.7178(2), b=1.1473(2), c=3.039(1) nm, V=2.5027 nm 3 , Z=4, space group P2 1 cn, has been solved by direct methods and refined by least-squares methods to an R index of 9.7% and a wR index of 12.6% using 888 unique observed [ vertical stroke F vertical stroke ≥5σ vertical stroke F vertical stroke ] reflections. The structure contains both U 6+ and U 4+ . The U 6+ cations are present as roughly linear (U 6+ O 2 ) 2+ uranyl ions (Ur) that are in turn coordinated by five O 2- and OH - located at the equatorial positions of pentagonal bipyramids. The U 4+ cations are coordinated by O 2- , OH - and H 2 O in a distorted octahedral arrangement. The Urφ 5 and U 4+ φ 6 (φ: O 2- , OH - , H 2 O) polyhedra link by sharing edges to form two symmetrically distinct sheets at z∼0.0 and z∼0.25 that are parallel to (001). The sheets have the β-U 3 O 8 sheet anion-topology. There are five symmetrically distinct H 2 O groups located at z∼0.125 between the sheets of Uφ n polyhedra, and the sheets of Uφ n polyhedra are linked together only by hydrogen bonding to the intersheet H 2 O groups. The crystal-chemical requirements of U 4+ and Pu 4+ are very similar, suggesting that extensive Pu 4+ U 4+ substitution may occur within the sheets of Uφ n polyhedra in the structure of ianthinite. (orig.)

  16. A thermal conductivity model for U-­Si compounds

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yongfeng [Idaho National Lab. (INL), Idaho Falls, ID (United States); Andersson, Anders David Ragnar [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-02-02

    U3Si2 is a candidate for accident tolerant nuclear fuel being developed as an alternative to UO2 in commercial light water reactors (LWRs). One of its main benefits compared to UO2 is higher thermal conductivity that increases with temperature. This increase is contrary to UO2, for which the thermal conductivity decreases with temperature. The reason for the difference is the electronic origin of thermal conductivity in U3Si2, as compared to the phonon mechanism responsible for thermal transport in UO2. The phonon thermal conductivity in UO2 is unusually low for a fluorite oxide due to the strong interaction with the spins in the paramagnetic phase. The thermal conductivity of U3Si2 as well as other U-­Si compounds has been measured experimentally [1-­4]. However, for fuel performance simulations it is also critical to model the degradation of the thermal conductivity due to damage and microstructure evolution caused by the reactor environment (irradiation and high temperature). For UO2 this reduction is substantial and it has been the topic of extensive NEAMS research resulting in several publications [5, 6]. There are no data or models for the evolution of the U3Si2 thermal conductivity under irradiation. We know that the intrinsic thermal conductivities of UO2 (semi-conductor) and U3Si2 (metal) are very different, and we do not necessarily expect the dependence on damage to be the same either, which could present another advantage for the silicide fuel. In this report we summarize the first step in developing a model for the thermal conductivity of U-­Si compounds with the goal of capturing the effect of damage in U3Si2. Next year, we will focus on lattice damage. We will also attempt to assess the impact of fission gas bubbles.

  17. Biological availability of 238U, 234U and 226Ra for wild berries and meadow grasses in natural ecosystems of Belarus

    International Nuclear Information System (INIS)

    Sokolik, G.A.; Ovsiannikova, S.V.; Voinikava, K.V.; Ivanova, T.G.; Papenia, M.V.

    2014-01-01

    This work is devoted to investigation of behavior of 234 U, 238 U and 226 Ra by determining the soil to plant transfer under different natural conditions such as forest or swamped areas and meadow lands with different soil types. The paper summarizes the data on investigation of uranium and radium uptake by wild berries and natural meadow grasses in the typical conditions of Belarus. Parameters characterizing the biological availability of 234 U, 238 U and 226 Ra for bilberry (Vaccinium myrtillus), lingonberry (Vaccinium viti-idaea), blueberry (Vaccinium iliginosum) and cranberry (Vaccinium oxycoccus palustris) as well as for widely occurring mixed meadow vegetation, which belongs to the sedge-grass or grass-sedge associations and forbs, have been established. In the sites under investigation, the deposition levels of 238+239+240 Pu were less than 0.37 kBq m −2 and 137 Cs deposition ranged between less than 0.37 and 37 kBq m −2 . It was found that activity concentrations of radionuclides in berries varied in the ranges of 0.037–0.11 for 234 U, 0.036–0.10 for 238 U and 0.11–0.43 Bq kg −1 for 226 Ra, but in the mixed meadow grasses they were 0.32–4.4, 0.24–3.9 and 0.14–6.9 Bq kg −1 accordingly. The 234 U/ 238 U activity ratios were 1.02 ± 0.01 for wild berries, 1.20 ± 0.09 for underground meadow grasses and 1.02 ± 0.02 for proper soils. The concentration ratios (CRs, dry weight basis) of 234 U and 238 U for mixed meadow grasses were 0.036–0.42 and 0.041–0.46 respectively. The correspondent geometric means (GM) were 0.13 and 0.15 with geometric standard deviations (GSD) of 2.4. The CRs of 226 Ra for meadow grasses were 0.031–1.0 with GM 0.20 and GSD 2.6. The CRs of 234 U, 238 U and 226 Ra for wild berries ranged within 0.0018–0.008 (GM is 0.0034, GSD is 1.8), 0.0018–0.008 (GM is 0.0035, GSD is 1.8) and 0.005–0.033 (GM is 0.016, GSD is 2.1) accordingly. The highest CR values of uranium for mixed meadow grasses were found in the sites

  18. Role of Spm-Cer-S1P signalling pathway in MMP-2 mediated U46619-induced proliferation of pulmonary artery smooth muscle cells: protective role of epigallocatechin-3-gallate.

    Science.gov (United States)

    Chowdhury, Animesh; Sarkar, Jaganmay; Chakraborti, Tapati; Chakraborti, Sajal

    2015-10-01

    During remodelling of pulmonary artery, marked proliferation of pulmonary artery smooth muscle cells (PASMCs) occurs, which contributes to pulmonary hypertension. Thromboxane A2 (TxA2) has been shown to produce pulmonary hypertension. The present study investigates the inhibitory effect of epigallocatechin-3-gallate (EGCG) on the TxA2 mimetic, U46619-induced proliferation of PASMCs. U46619 at a concentration of 10 nM induces maximum proliferation of bovine PASMCs. Both pharmacological and genetic inhibitors of p(38)MAPK, NF-κB and MMP-2 significantly inhibit U46619-induced cell proliferation. EGCG markedly abrogate U46619-induced p(38)MAPK phosphorylation, NF-κB activation, proMMP-2 expression and activation, and also the cell proliferation. U46619 causes an increase in the activation of sphingomyelinase (SMase) and sphingosine kinase (SPHK) and also increase sphingosine 1 phosphate (S1P) level. U46619 also induces phosphorylation of ERK1/2, which phosphorylates SPHK leading to an increase in S1P level. Both pharmacological and genetic inhibitors of SMase and SPHK markedly inhibit U46619-induced cell proliferation. Additionally, pharmacological and genetic inhibitors of MMP-2 markedly abrogate U46619-induced SMase activity and S1P level. EGCG markedly inhibit U46619-induced SMase activity, ERK1/2 and SPHK phosphorylation and S1P level in the cells. Overall, Sphingomyeline-Ceramide-Sphingosine-1-phosphate (Spm-Cer-S1P) signalling axis plays an important role in MMP-2 mediated U46619-induced proliferation of PASMCs. Importantly, EGCG inhibits U46619 induced increase in MMP-2 activation by modulating p(38)MAPK-NFκB pathway and subsequently prevents the cell proliferation. Copyright © 2015 John Wiley & Sons, Ltd.

  19. Experiences in accessing the U.S. equity markets

    International Nuclear Information System (INIS)

    Gosbee, G. F. J.

    1998-01-01

    This paper was designed to deal with three issues: (1) reasons for the difficulty of attracting U.S. capital into Canada; (2) Canadian companies' need for U.S. capital, and (3) how to successfully attract U.S. capital. As far as the reasons for the difficulties of attracting U.S. capital are concerned, intense world-wide competition for U.S. capital, the relatively small capital needs in Canada, the relatively poorly developed reporting practices, passive management and shareholders, and Canada's more stringent regulatory practices were highlighted as being most responsible. As to whether Canadian companies need U.S. capital, the answer was in the affirmative, citing multiple expansion, shareholder base diversification and the large equity raising power of the U.S. market as contributing factors. With regard to attracting U.S. capital into Canada, the advice given included differentiating the company, adopting U.S. reporting practices, addressing regulatory concerns, obtaining U.S.listings, and outperforming competitors

  20. Environmental control of U concentration and 234U/238U in speleothems at subannual resolution

    Science.gov (United States)

    Hu, C.; Henderson, G. M.

    2003-12-01

    Trace element and isotope variability in speleothems encodes a range of information about the past environment, although its interpretation is often problematic. U concentration and isotopes have frequently been analysed in speleothems in order to provide chronology, but their use as environmental proxies in their own right has not been comprehensively investigated. In this study, we have investigated the environmental controls of U in a stalagmite from the Central Yangtze Valley in China. This stalagmite grew rapidly throughout the Holocone and contains visible annual layers about 300microns thick. Analysis of a portion of the stalagmite corresponding to the 1970s by electron probe, LA-ICP-MS, and by physical subsampling indicate clear annual cycles in Sr/Ca, Mg/Ca, and Ba/Ca. The reasonably open cave structure and the correlation of Sr/Ca with Mg/Ca suggest that temperature exerts considerable control over these trace element variations. U/Ca also varies seasonally by up to 42 % and shows a clear anti-correlation with Mg/Ca (correlation coefficient -0.64). Based on the inverse relationship between U/Ca and temperature exhibited in other carbonates (e.g. corals) the speleothem U/Ca is suggested to be controlled primarily by temperature and may provide a paleo cave thermometer with less rainfall influence than Mg/Ca. Ongoing monitoring of the cave temperature and humidity will assess the robustness of this conclusion and the sensitivity of speleothem U/Ca to temperature. (234U/238U) in this stalagmite range from 1.733 to 1.872 during the Holocene. The U concentration is high enough (typically 0.48 ppm) and growth rate fast enough, that (234U/238U) can also be measured at a subannual resolution. The expected alpha-recoil control of excess 234U supply suggests that these measurements may provide a measure of the transit time of recharge waters to the stalagmite during the seasonal cycle. Such a proxy would enable deconvolution of temperature and recharge-rate control

  1. Efficacy of 3,4,3-LI(1,2-HOPO) for decorporation of Pu,Am and U from rats injected intramuscularly with high-fired particles of MOX

    International Nuclear Information System (INIS)

    Paquet, F.; Chazel, V.; Houpert, P.; Guilmette, R.; Muggenburg, B.

    2003-01-01

    This study aimed to assess the efficacy of 3,4,3-LI(1,2-HOPO) for reducing uranium, plutonium and americium in rats after intramuscular injection of (U-Pu)O 2 particles (MOX). Sixteen rats were contaminated by intramuscular injection of a 1 mg MOX suspension and then treated daily for 7 d with LIHOPO (30 or 200 μmol kg -1 ) or DTPA (30 μmol kg -1 ). LIHOPO was inefficient for removing Pu, Am and U from the wound site. However, it reduced Pu retention in carcass and liver by factors of 2 and 6 respectively, and Am retention in carcass and liver by factors of 10 and 30. In contrast, the effect of LIHOPO on U was to decrease the retention in kidneys by a factor of 75. These results confirm that LIHOPO is a good candidate for use after contamination with MOX, in combination with localised wound lavage or surgical treatment aimed at removing most of the contaminant at the wound site. (author)

  2. u-Constacyclic codes over F_p+u{F}_p and their applications of constructing new non-binary quantum codes

    Science.gov (United States)

    Gao, Jian; Wang, Yongkang

    2018-01-01

    Structural properties of u-constacyclic codes over the ring F_p+u{F}_p are given, where p is an odd prime and u^2=1. Under a special Gray map from F_p+u{F}_p to F_p^2, some new non-binary quantum codes are obtained by this class of constacyclic codes.

  3. Third phase formation revisited: the U(VI), HNO3 - TBP, n-dodecane system

    International Nuclear Information System (INIS)

    Chiarizia, R.; Jensen, M.P.; Borkowski, M.; Ferraro, J.R.; Thiyagarajan, P.; Littrell, K.C.

    2003-01-01

    In this work, the system U(VI), HNO 3 -tri-n-butylphosphate (TBP), n-dodecane has been revisited with the objective of gaining information on the coordination chemistry and structural evolution of the species formed in the organic phase before and after third phase formation. Chemical analyses, spectroscopic and EXAFS data indicate that U(VI) is extracted as the UO 2 (NO 3 ) 2 ·2TBP adduct, while the third phase species have the average composition UO 2 (NO 3 ) 2 ·2TBP·HNO 3 . Small-angle neutron scattering (SANS) measurements on TBP solutions loaded with only HNO 3 or with increasing amounts of U(VI) have revealed the presence, before phase splitting, of ellipsoidal aggregates with the major and minor axes up to about 64 and 15 A, respectively. The formation of these aggregates, very likely of the reverse micelle-type, is observed in all cases, that is, when only HNO 3 , only UO 2 (NO 3 ) 2 , or both HNO 3 and UO 2 (NO 3 ) 2 are extracted by the TBP solution. Upon third phase formation, the SANS data reveal the presence of smaller aggregates in the light organic phase, while the heavy organic phase contains pockets of diluent, each with an average of about two molecules of n-dodecane.

  4. U.S. Economic Assistance to Colombia: A Model for U.S. Economic Assistance to Mexico?

    Science.gov (United States)

    2013-12-01

    chronologically and territorially speaking); with Plan Colombia (2000– 2006) as the major program for U.S.-Colombia relations and the Merida Initiative...Ecuador 24.3 19.8 21.3 Peru 96.6 83.6 73.7 Venezuela 5.0 5.0 3.0 Total 621.0 519.7 452.0 Table 2. U.S. assistance to the Andean Region, FY2011–FY2013...Office of National Drug Control (ONDC) policy, Colombia’s potential cocaine production capabilities have once again fallen below those of Peru and

  5. Determination of excitation temperature and vibrational temperature of the N2(C 3Πu, ν') state in Ne-N2 RF discharges

    International Nuclear Information System (INIS)

    Rehman, N U; Naveed, M A; Zakaullah, M; Khan, F U

    2008-01-01

    Optical emission spectroscopy is used to investigate the effect of neon mixing on the excitation and vibrational temperatures of the second positive system in nitrogen plasma generated by a 13.56 MHz RF generator. The excitation temperature is determined from Ne I line intensities, using Boltzmann's plot. The overpopulation of the levels of the N 2 (C 3 Π u , ν') states with neon mixing are monitored by measuring the emission intensities of the second positive system of nitrogen molecules. The vibrational temperature is calculated for the sequence Δν = -2, with the assumption that it follows Boltzmann's distribution. But due to overpopulation of levels, e.g. 1, 4, a linearization process was employed for such distributions allowing us to calculate the vibrational temperature of the N 2 (C 3 Π u , ν') state. It is found that the excitation temperature as well as the vibrational temperature of the second positive system can be raised significantly by mixing neon with nitrogen plasma. It is also found that the vibrational temperature increases with power and pressure up to 0.5 mbar.

  6. U.S., U.S.S.R. Marine Expedition

    Science.gov (United States)

    Wainger, Lisa A.

    An historic expedition involving U.S. and U.S.S.R. scientists may open a new era of cooperation in marine research. A University of California, San Diego/Scripps Institution of Oceanography ship carrying a team that includes two Soviet scientists is on an expedition that will take the R/V Thomas Washington into the Exclusive Economic Zone (EEZ) of the U.S.S.R. For the first time in a decade a U.S. research vessel has been given permission to operate in the Soviet Union's EEZ, according to Department of State representative Tom Cocke, who worked with Scripps on this project. The ship will also operate in the U.S. EEZ and international waters.

  7. Informacioni sistemi u upravljanju rizicima u životnoj sredini

    Directory of Open Access Journals (Sweden)

    Dejan Inđić

    2013-02-01

    Full Text Available Normal 0 MicrosoftInternetExplorer4 Sažetak: Zemljotresi, poplave, nuklearni i hemijski akcidenti, zagađivanje vazduha, zemljišta i voda, ukazuju na sve veće prisustvo nesreća nastalih intenzivnim razvojem i često nekontrolisanom primenom tehnološkog razvoja. Pred društvo se postavlja problem kako se što bolje pripremiti, kako obezbediti veću usklađenost i funkcionisanje aktivnosti i mera za sprečavanje nastanka akcidentnih situacija i kako uneti promene u društveni i tehnološki razvoj koje će ići u korist prirode, ali i za dobrobit budućih generacija. U radu je prikazano korišćenje različitih informacionih sistema (IS u upravljanju rizicima u životnoj sredini i predlog za izradu jedinstvenog IS u Republici Srbiji.

  8. Structure and physical properties of ternary uranium transition-metal antimonides U3MSb5 (M = Zr, Hf, Nb)

    International Nuclear Information System (INIS)

    Tkachuk, Andriy V.; Muirhead, Craig P.T.; Mar, Arthur

    2006-01-01

    The ternary uranium transition-metal antimonides U 3 MSb 5 (M = Zr, Hf, Nb) were prepared by arc-melting reactions followed by annealing at 800 deg. C, or by use of a Sn flux. These compounds extend the previously known series U 3 MSb 5 (M = Ti, V, Cr, Mn) and RE 3 MSb 5 (RE = La, Ce, Pr, Nd, Sm; M = Ti, Zr, Hf, Nb). The crystal structures of U 3 MSb 5 were determined by single-crystal X-ray diffraction data (Pearson symbol hP18, hexagonal, space group P6 3 /mcm, Z = 2; U 3 ZrSb 5 , a = 9.2223(3) A, c = 6.1690(2) A; U 3 HfSb 5 , a = 9.2084(4) A, c = 6.1629(3) A; U 3 NbSb 5 , a = 9.1378(4) A, c 6.0909(6) A). U 3 TaSb 5 has also been identified in microcrystalline form (a = 9.233(3) A, c = 6.142(3) A). Four-probe electrical resistivity measurements on single crystals and dc magnetic susceptibility measurements on powders indicated prominent transitions that are attributed to ferromagnetic ordering. The Curie temperatures, T C , located from ac magnetic susceptibility curves, are 135 K for U 3 ZrSb 5 , 141 K for U 3 HfSb 5 , and 107 K for U 3 NbSb 5

  9. System for uranium superficial density measurement in U3Si2 MTR fuel plates using radiography

    International Nuclear Information System (INIS)

    Hey, Martin A.; Gomez Marlasca, Fernando

    2003-01-01

    The paper describes a method for measuring uranium superficial density in high density uranium silicide (U 3 Si 2 ) MTR fuel plates, through the use of industrial radiography, a set of patterns built for this purpose, a transmission optical densitometer, and a quantitative model of analysis and measurement. Our choice for this particular method responds to its high accuracy, low cost and easy implementation according to the standing quality control systems. (author)

  10. Nitridation of U and Pu recovered in liquid Cd cathode by molten salt electrorefining of (U,Pu)N

    Energy Technology Data Exchange (ETDEWEB)

    Satoh, Takumi; Iwai, Takashi; Arai, Yasuo [Japan Atomic Energy Agency (Japan)

    2009-06-15

    Solid solutions of actinide mono-nitrides have been proposed as a candidate fuel of the accelerator-driven system (ADS) and Gen.IV-type fast reactors because the thermal conductivity and metal density are higher than those of actinide oxides and also they have high melting temperature. Pyrochemical process has several advantages over conventional wet process in treating of spent nitride fuel. One of the key technologies of the pyrochemical reprocessing of nitride fuel is the formation of the nitrides from actinides in the liquid Cd cathode. The nitridation-distillation combined method was developed and has been adopted to convert the actinides to the nitrides. In this method, the nitridation of actinides and the distillation of Cd occurred simultaneously by heating the actinide-Cd alloys in N{sub 2} gas stream. In the present study, the nitride formation behavior of U and Pu recovered in Cd cathode by molten salt electrorefining of (U,Pu)N was experimentally investigated. In addition, the nitride pellet was prepared form the powder obtained by the nitridation of U and Pu recovered in Cd cathode. (U,Pu)N (PuN = 80 mol %) was used as the starting material in the experiment. Molten salt electrorefining of (U,Pu)N pellet was carried out in the LiCl-KCl eutectic salt with 1.2 wt% PuCl{sub 3} and 0.3 wt% UCl{sub 3} of about 110 g at the constant anodic potential of -0.60 to -0.55 V vs. Ag/AgCl for about 9 hours at 773 K. After the electrorefining, about 42 % of U and Pu in the starting (U,Pu)N pellet was dissolved at the anode and recovered into the liquid Cd cathode. The recovered U-Pu-Cd alloy was heated in an alumina crucible at 973 K for 10 hours under N{sub 2} gas (99.999 %) stream (0.015 L/min). Fine black powder was recovered after heating the U-Pu-Cd alloy. The powder was identified as the single phase solid solution of (U,Pu)N by the XRD analysis. After milling in the agate mortar for 1 hour, the powder was compacted into green pellet under a pressure of about

  11. Dicty_cDB: Contig-U09412-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09412-1 gap included 873 3 3953072 3953946 PLUS 1 2 U09412 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09412-1 Contig ID Contig-U09412-1 Contig update 2002. 9.13 Contig sequence >Contig-U09412-1 (Contig...-U09412-1Q) /CSM_Contig/Contig-U09412-1Q.Seq.d ATTATCACAACTATTTTATAATAAACCAATTTTAAAGATTAAAGT...TGGTTCAATAAAAGAAATTAAATATAATTATCAATAAT AATAATAAATTAATTAATAAATTTAAATCAAAA Gap gap included Contig length 873 ...DCQCGFVSVVENNNNNNNNSDNENNENNENNENNE NNEDLEDFIPRKLLKKSSSTLQSRTYLVIYLGRRGILEIWGLKHRSREYFKTIG

  12. Dicty_cDB: Contig-U10996-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG

  13. Kinetics of U(VI) reduction control kinetics of U(IV) reoxidation

    International Nuclear Information System (INIS)

    Senko, J.M.; Minyard, M.L.; Dempsey, B.A.; Roden, E.E.; Yeh, G.-T.; Burgos, W.D.

    2006-01-01

    For the in situ reductive immobilization of U to be an acceptable strategy for the removal of that element from groundwater, the long-term stability of U(IV) must be determined. Rates of biotransformation of Fe species influence the mineralogy of the resulting products (Fredrickson et al., 2003; Senko et al., 2005), and we hypothesize that the rate of U(VI) reduction influences the mineralogy of resultant U(IV) precipitates. We hypothesize that slower rates of U(VI) reduction will yield U(IV) phases that are more resistant to reoxidation, and will therefore be more stable upon cessation of electron donor addition. U(IV) phases formed by relatively slow reduction may be more crystalline or larger in comparison to their relatively rapidly-formed counterparts (Figure 1), thus limiting the reactivity of slowly-formed U(IV) phases toward various oxidants. The physical location of U(IV) precipitates relative to bacterial cells may also limit the reactivity of biogenic U(IV) phases. In this situation, we expect that precipitation of U(IV) within the bacterial cell may protect U(IV) from reoxidation by limiting physical contact between U(IV) and oxidants (Figure 1). We assessed the effect of U(VI) reduction rate on the subsequent reoxidation of biogenic U(IV) and are currently conducting column scale studies to determine whether U(VI) reduction rate can be manipulated by varying the electron donor concentration used to stimulate U(VI) reduction

  14. MEDICIS(ASTEC-V2) sensitivity calculations for investigation of the crust formation in VB-U5 and VB-U6 VULCANO tests

    International Nuclear Information System (INIS)

    Stefanova, A.; Grudev, P.; Gencheva, R.

    2011-01-01

    This paper presents the results from sensitivity calculations made with MEDICIS(ASTECv2) for investigation of the crust formation during the Molten Corium-Concrete Interaction(MCCI) in VB-U5 and VB-U6 VULCANO tests. All calculations are made with MEDICIS computer code. The main goal of these analyses is to assess how the assumptions for crust formation or not formation influence over the concrete ablation. Three calculations have been done for each one of the experiments with different crust thickness and lock of crust formation at the bottom, side and upper surface. (authors)

  15. Thermal diffusivity and thermal conductivity of (Th,U)O2 fuels

    International Nuclear Information System (INIS)

    Sengupta, A.K.; Jarvis, T.; Nair, M.R.; Ramachandran, R.; Mujumdar, S.; Purushotham, D.S.C.

    2000-05-01

    India has vast reserves of thorium (> 460,000 tons) and sustained work on all aspects of thorium utilization has been initiated. In this context work on fabrication of sintered thoria and mixed (Th,U)O 2 pellets and evaluation of their thermophysical properties have been taken up in Radiometallurgy Division. Thermal conductivity, being the most important thermal properties, has been calculated using the experimentally measured thermal diffusivity, density and literature values of specific heats for ThO 2 and thoria containing 2,4,6,10 and 20% UO 2 . Thermal diffusivity was measured experimentally by the laser flash method from 600 to 1600 deg C in vacuum. It was observed that thermal conductivity of ThO 2 and mixed (Th,U)O 2 decrease with increase in temperature. It was also observed that the conductivity decreases with increase in UO 2 content, the decrease being more at lower temperature than that at higher temperatures. Empirical relations correlating thermal conductivity to temperatures have been generated by the least square fit method and reported. (author)

  16. U(3)-flavor nonet scalar as an origin of the flavor mass spectra

    International Nuclear Information System (INIS)

    Koide, Yoshio

    2008-01-01

    According to an idea that the quark and lepton mass spectra originate in a VEV structure of a U(3)-flavor nonet scalar Φ, the mass spectra of the down-quarks and charged leptons are investigated. The U(3) flavor symmetry is spontaneously and completely broken by non-zero and non-degenerated VEVs of Φ, without passing any subgroup of U(3). The ratios (m e +m μ +m τ )/(√(m e )+√(m μ )+√(m τ )) 2 and √(m e m μ m τ )/(√(m e )+√(m μ )+√(m τ )) 3 are investigated based on a toy model

  17. Perspektive promidžbe u XXI. stoljeću

    OpenAIRE

    Haramija, Predrag; Njavro, Đuro; Propat Darrer, Jagoda

    2012-01-01

    Otkriće i primjena novih postupaka u promidžbi ovisna je o dvjema vrstama silnica; s jedne strane, o novim tehničkim ili tehnološkim otkrićima glede sredstava komunikacije, a s druge strane o novim situacijama odnosno okolnostima u gospodarskome i društvenom okružju. U radu se prikazuje dosadašnji razvoj i istražuju moguće dominantne tendencije promidžbe u XXI. stoljeću. Početak XXI. stoljeća obilježava zasićenost potrošača mnoštvom promidžbenih poruka i sve veće nepovjerenje u njih, s...

  18. Feasibility to convert an advanced PWR from UO2 to a mixed U/ThO2 core – Part I: Parametric studies

    International Nuclear Information System (INIS)

    Maiorino, Jose R.; Stefani, Giovanni Laranjo; Moreira, João M.L.; Rossi, Pedro C.R.; Santos, Thiago A.

    2017-01-01

    Highlights: • Neutronics calculation using SERPENT code. • Conversion of an advanced PWR from a UO 2 to (U-Th)O 2 core. • AP 1000-advanced PWR. • Parametric studies to define a converted core. • Demonstration of the feasibility to convert the AP 1000 by using mixed uranium thorium oxide fuel with advantages. - Abstract: This work presents the neutronics and thermal hydraulics feasibility to convert the UO 2 core of the Westinghouse AP1000 in a (U-Th)O 2 core by performing a parametric study varying the type of geometry of the pins in fuel elements, using the heterogeneous seed blanket concept and the homogeneous concept. In the parametric study, all geometry and materials for the burnable poison were kept the same as the AP 1000, and the only variable was the fuel pin material, in which we use several mass proportion of uranium and thorium but keeping the enrichment in 235 U, as LEU (20 w/o). The neutronics calculations were made by SERPENT code, and to validate the thermal limits we used a homemade code. The optimization criteria were to maximize the 233 U, and conversion factor, and minimize the plutonium production. The results obtained showed that the homogeneous concept with three different mass proportion zones, the first containing (32% UO 2 -68%ThO 2 ); the second with (24% UO 2 -76% ThO 2 ), and the third with (20% UO 2 -80% ThO 2 ), using 235 U LEU (20 w/o), and corresponding with the 3 enrichment zones of the AP 1000 (4.45 w/o; 3.40 w/o; 2.35 w/o), satisfies the optimization criteria as well as attending all thermal constrain. The concept showed advantages compared with the original UO 2 core, such a lower power density, and keeping the same 18 months of cycle a reduction of B-10 concentration at the soluble poison as well as eliminating in the integral boron poison coated (IFBA).

  19. High temperature interdiffusion and phase equilibria in U-Mo

    International Nuclear Information System (INIS)

    Lundberg, L.B.

    1988-01-01

    Experimental data for interdiffusion and phase equilibria in the U-Mo system have been obtained over the temperature range 1400 to 1525 K as a fallout from compatibility experiments in which UO 2 was decomposed by lithium in closed molybdenum capsules. Composition-position, x-ray diffraction and microstructural data from the interdiffusion zones indicate that the intermediate phase U 2 Mo is found in this temperature range, contrary to the currently accepted equilibrium U-Mo phase diagram. The U-Mo interdiffusion data are in good agreement with published values. Inclusion of the U 2 Mo phase in a theoretical correlation of interdiffusion and phase equilibria data using Darken's equation indicate that high temperature interdiffusion of uranium and molybdenum follows the usual thermodynamic rules. Significant changes in the value of the thermodynamic based Darken factor near the U 2 Mo phase boundary on the high uranium side are indicated from both the new and published interdiffusion data. 9 refs., 10 figs., 3 tabs

  20. Extreme fractionation of 234U 238U and 230Th 234U in spring waters, sediments, and fossils at the Pomme de Terre Valley, southwestern Missouri

    Science.gov (United States)

    Szabo, B. J.

    1982-01-01

    Isotopic fractionation as great as 1600% exists between 234U and 238U in spring waters, sediments, and fossils in the Pomme de Terre Valley, southwestern Missouri. The activity ratios of 234U 238U in five springs range from 7.2 to 16 in water which has been discharged for at least the past 30,000 years. The anomalies in 234U 238U ratio in deep water have potential usefulness in hydrologic investigations in southern Missouri. Clayey units overlying the spring bog sediments of Trolinger Spring are enriched in 230Th relative to their parent 234U by as much as 720%. The results indicate that both preferential displacement via alpha recoil ejection and the preferential emplacement via recoiling and physical entrapment are significant processes that are occurring in the geologic environment. ?? 1982.

  1. Calibration of 232U solution; Calibracion de una disolucion de 232U

    Energy Technology Data Exchange (ETDEWEB)

    Galan Valera, M P; Acena Berrenechea, M L

    1988-07-01

    A method for as certain the activity by alpha spectroscopy with semiconductor detectors, of a solution of 232U is presented. It consists of the comparison with a 233U solution activity previously measured in a gridded ionization chamber of 2{pi} geometry. The total measurement uncertainty is about + - 0,02. (Author) 9 refs.

  2. Konstruktivistički pristup obrazovnom postignuću učenika

    OpenAIRE

    Gutvajn, Nikoleta

    2009-01-01

    U savremenoj pedagoškoj literaturi, razlike u obrazovnom postignuću učenika se, veomaretko, proučavaju iz perspektive učenika što je, verovatno, jedan od bitnih razloga zakontinuiranu egzistenciju kategorije „neuspešan učenik”. Cilj našeg istraživanja bio je dase problem školskog neuspeha razmotri iz perspektive učenika koji su pozicionirani kaoneuspešni. Umesto mnogobrojnih pretpostavki istraživača o tome zašto su neki učenicineusp...

  3. Uranium magnetism in UGa2 and U(Gasub(1-x)Alsub(x))2 compounds

    International Nuclear Information System (INIS)

    Ballou, R.

    1983-01-01

    Magnetism of intermetallic compounds of uranium is studied. A monocrystal of the highly anisotropic ferromagnetic material UGa 2 is studied by polarized neutron diffraction. Localisation of 5f electrons is evidenced. Magnetic structure of uranium in UGa 2 is determined. The pseudobinary compound U(Gasub(1-x)Alsub(x)) 2 is studied for crystal structure, ferromagnetism, paramagnetism, specific heat and resistivity [fr

  4. GGA+U study on phase transition, optoelectronic and magnetic properties of AmO{sub 2} with spin–orbit coupling

    Energy Technology Data Exchange (ETDEWEB)

    Bendjedid, A.; Seddik, T. [Laboratoire de Physique Quantique et de Modélisation Mathématique, Université de Mascara, 29000 (Algeria); Khenata, R., E-mail: khenata_rabah@yahoo.fr [Laboratoire de Physique Quantique et de Modélisation Mathématique, Université de Mascara, 29000 (Algeria); Baltache, H. [Laboratoire de Physique Quantique et de Modélisation Mathématique, Université de Mascara, 29000 (Algeria); Murtaza, G., E-mail: murtaza@icp.edu.pk [Materials Modeling Laboratory, Department of Physics, Islamia College University, Peshawar (Pakistan); Bouhemadou, A. [Laboratory for Developing New Materials and their Characterization, Department of Physics, Faculty of Science, University of Setif, 19000 Setif (Algeria); Bin Omran, S. [Department of Physics and Astronomy, College of Science, King Saud University, P.O. Box 2455, Riyadh 11451 (Saudi Arabia); Azam, Sikander; Khan, Saleem Ayaz [New Technologies-Research Center, University of West Bohemia, Univerzitni 8, 306 14 Pilsen (Czech Republic)

    2015-12-15

    In this work, we have investigated the structural, phase transition, optoelectronic and magnetic properties of AmO{sub 2} using the full potential linearized augmented plane wave plus local orbital (FP-LAPW+lo) method. The exchange-correlation potential was treated with the generalized gradient approximation (GGA). Moreover, the GGA+U approximation (where U denotes the Hubbard Coulomb energy U term) is employed to treat the f electrons properly. The structurally stable AmO{sub 2} compound is the Fm3m phase and at a pressure between 40 and 60 GPa underwent a phase transition to the Pnma phase. Our present calculations have considered ferromagnetic and simple antiferromagnetic ground states and the AF state is favored. However, the experimental situation suggests a complex magnetic structure, perhaps involving multipolar ordering. Our band structure calculation with GGA and GGA+U predicted the metallic behavior of AmO{sub 2}; however, with the spin–orbit coupling (SOC) added to the Coulomb energy U term, semiconducting ground states with antiferromagnetism is correctly predicted. The projected density of states from the energy-band structure indicates that the band gap opening is governed by the partially filled Am “5f” state, and the calculated gap is approximately 1.29 eV. Moreover, the optical properties reveal strong response of AmO{sub 2} in the UV region. - Highlights: • AmO{sub 2} is antiferromagnetic and stable in the Fm3m phase under ambient conditions. • It makes structural transition from the Fm3m to the Pnma phase at 55.91 GPa. • Columbic repulsion parameter U correctly predicted the electronic state of AmO{sub 2}. • This compound absorbs strongly in the UV region.

  5. The transport characteristics of "2"3"8U, "2"3"2Th, "2"2"6Ra, and "4"0K in the production cycle of phosphate rock

    International Nuclear Information System (INIS)

    Jung, Yoon Hee; Lim, Jong Myoung; Ji, Young Yong; Chung, Kun Ho; Kang, Mun Ja

    2017-01-01

    Phosphate rock and its by-product are widely used in various industries to produce phosphoric acid, gypsum, gypsum board, and fertilizer. Owing to its high level of natural radioactive nuclides (e.g., 238U and 226Ra), the radiological safety of workers who work with phosphate rock should be systematically managed. In this study, 238U, 232Th, 226Ra, and 40K levels were measured to analyze the transport characteristics of these radionuclides in the production cycle of phosphate rock. Energy dispersive X-ray fluorescence and gamma spectrometry were used to determine the activity of 238U, 232Th, 226Ra, and 40K. To evaluate the extent of secular disequilibrium, the analytical results were compared using statistical methods. Finally, the distribution of radioactivity across different stages of the phosphate rock production cycle was evaluated. The concentration ratios of 226Ra and 238U in phosphate rock were close to 1.0, while those found in gypsum and fertilizer were extremely different, reflecting disequilibrium after the chemical reaction process. The nuclide with the highest activity level in the production cycle of phosphate rock was 40K, and the median 40K activity was 8.972 Bq·g−1 and 1.496 Bq·g−1, respectively. For the 238U series, the activity of 238U and 226Ra was greatest in phosphate rock, and the distribution of activity values clearly showed the transport characteristics of the radionuclides, both for the byproducts of the decay sequences and for their final products. Although the activity of 40K in k-related fertilizer was relatively high, it made a relatively low contribution to the total radiological effect. However, the activity levels of 226Ra and 238U in phosphate rock were found to be relatively high, near the upper end of the acceptable limits. Therefore, it is necessary to systematically manage the radiological safety of workers engaged in phosphate rock processing

  6. Dicty_cDB: Contig-U12399-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL

  7. Dicty_cDB: Contig-U12545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

  8. Dicty_cDB: Contig-U11323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF134321 |pid:none) Dissostichus mawsoni clone Dm7m ch... 84 3e-14 AM747721_702( ...S101... 81 2e-13 U58944_1( U58944 |pid:none) Dissostichus mawsoni AFGP antifreeze g... 81 2e-13 AM182501_1( ...017194_2467( AE017194 |pid:none) Bacillus cereus ATCC 10987, com... 75 1e-11 U43149_1( U43149 |pid:none) Dissostichus mawson

  9. Corrosion of MTR type fuel plates containing U3O8-Al cermet cores

    International Nuclear Information System (INIS)

    Durazzo, M.

    1985-01-01

    The fuel plate samples containing U 3 O 8 -Al cermet cores with concentrations from 10 to 90% of U 3 O 8 weight were fabricated. Samples with 58% of U 3 O 8 eight were fabricated using compacts with densities from 75 to 95% of theoretical density. The influences of U 3 O 8 concentration and porosity of compacted core on porosity and uniformity of core thickness are discussed. The U 3 O 8 -Al cores were submitted to corrosion tests and exposed to deionized water at temperatures of 30, 50, 70 and 90 0 C by cladding deffect produced artificially. The results shown that core corrosion is accompanied by hydrogen release. The total volum of released hydrogen and the time interval to observe the initiation of hydrogen releasing (incubation time) are depending on core pososity and absolute temperature. A mechanism for U 3 O 8 -Al core corrosion process is proposed and discussed. The cladding of fuel plate samples was submitted to corrosion tests under similar conditons of the IAE-R1 reactor operating at 2, 5 and 10 MW. (Author) [pt

  10. Online Manufacturing Training. ToolingU Review (U)

    Energy Technology Data Exchange (ETDEWEB)

    Montano, Joshua Daniel [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-03-23

    The following report is a review of ToolingU, an online manufacturing training website. ToolingU provided the author with a trail account where a number of courses were taken and the overall program was evaluated. A review of the classes revealed that most of the offerings directly align with work at the Laboratory. Ease of use, effectiveness of the system and price all make ToolingU an attractive option for manufacturing training needs.

  11. Post-match recovery methods used by U19 and U21 provincial ...

    African Journals Online (AJOL)

    The aim of the study was to identify the most preferred post-match recovery methods utilized by U19 and U21 provincial rugby union players (n=97; Mean age: ± 20.2 years) in Gauteng Province of South Africa. Questionnaire-based data were collected from a purposive sample size of 97 rugby players. The findings ...

  12. Study of the sintering process and the formation of a (Th, U) O2 solid solution

    International Nuclear Information System (INIS)

    Tomasi, Roberto

    1979-01-01

    The effect of some variables in the (Th, U) O 2 sintering process and solid solution formation was studied. ThO 2 , U 3 O 8 and UO 2 powder were prepared. The ThO 2 powders were obtained by calcination of thorium at 500 and 750 deg C; the U 3 O 8 powders were derived from the calcination of ADU at 660 and 750 deg C; the UO 2 powder were prepared from ADU and from ATCU. The different characteristics of these materials were determined by measurements of surface area, by scanning electron microscopy, tap density tests, X-ray diffractometry and by measurements of the O/U ratios. The oxide mixtures were chosen in order to produce a final composition with 10 w/o of UO 2 . A mixture of thorium oxalate and ADU was also prepared by calcining these salts in air at 700 deg C, in order to obtain certain amount of solid solution prior to sintering. The sintering operations were developed in an argon atmosphere at temperatures between 1400 and 1700 deg C, during interval varying from 1 to 4 hours. The effect of the mixture characteristics on the sintering process and solid solution formation were studied considering the results of densification, microstructure development and X-ray diffractometry. The ThO 2 powder characteristics have a main effect on the mixtures compactability and sinterability, the higher calcining temperatures increasing the green density, but decreasing the final density of the sintered pellets. In the sintering of mixtures containing U 3 O 3 , this oxide is reduced to UO 2 and it is possible to obtain pellets with density and microstructures similar to those produced from mixtures containing UO 2 . But if oxygen in excess is present during sintering, the process is affected, occurring exaggerated grain growth. The densification results were related to the Coble's kinetics equation for second stage of sintering, valid for bulk diffusion, grain boundary acting as vacancy sinks. The sintering activation energy is independent from the powder starting

  13. Chemical, physical and isotopic characterization of U3Si2, for nuclear forensics purposes

    International Nuclear Information System (INIS)

    Rosa, Daniele Scarpim

    2011-01-01

    In the early 1990's, the first illicit trafficking of nuclear and radioactive materials was observed mainly in Europe. A decade marked by numerous cases of seizures of these materials. As a result, these events have become the subject of criminal forensic investigations and develop from there, nuclear forensics. In Brazil there are no illicit trafficking official records of nuclear material, however, is widely known the extraction and illegal transportation of radioactive geological materials, and the materials pieces attachment used as shielding for radioactive sources. One of the main tools used in nuclear forensics is the nuclear materials databases establishment. These documents must contain the most information as possible about the physical, chemical and nuclear material seized, allowing the identification of their origin, manufacturing process or age. Thus, it sets characteristic composition standards of each material, called 'chemical signatures' (chemical finger print). In this work nuclear forensic protocol was adopted as well as the three stages of assessment suggested by International Atomic Energy Agency (IAEA) in identifying the origin of uranium silicide (U 3 Si 2 ). Assays were performed in order to make physical, chemical and isotopic characterization of the studied materials and compared the data with those obtained for other uranium compounds (Uranium tetrafluoride, UF 4 ; uranium oxide, UO 2 and U 3 O 8 ; Yellow cake) by establishing a characteristic signature for each one. Through the assays the uranium compounds were classify by origin groups, as far as they are from different manufactured process and/ or origin. It was also possible to show the importance of a nuclear forensic database during an investigation of a nuclear forensic event. (author)

  14. Study of phase transformation of U-2,5Zr-7,5Nb e U-3Zr-9Nb alloys for application in advanced nuclear fuel; Estudo das transformacoes de fases nas ligas U-2,5Zr-7,5Nb e U-3Zr-9Nb para aplicacao em combustivel nuclear avancado

    Energy Technology Data Exchange (ETDEWEB)

    Pais, Rafael Witter Dias

    2015-07-01

    Metal fuels are relevant in the nuclear area due to the versatility of its use in the nuclear fuel cycle. Among the alloys of uranium investigated with high potential for use in nuclear power reactors, U-Zr-Nb alloys appear as an important alternative because of their superior physico-chemical and metallurgical properties. These alloys have also potential for use in nuclear testing, research and production radioisotopes of high performance nuclear reactors. Therefore, the development of these alloys is strategic since they are planned to be used in national reactors as RMB (Brazilian Multipurpose Reactor) and LABGENE (Electrical Generation Core Laboratory), currently under development in Brazil. In this work it was realized a extensive study in the scope of the manufacturing, heat treatment and phase transformations of U-2,5Zr-7,5Nb (m/m%) and U-3ZR-9NB (m/m%) fuel alloys. Ingots of both alloys were produced employing a specific methodology developed in this study. This methodology comprised the melting process in a vacuum induction furnace at high temperatures (1500 °C) and thermal-mechanical processing to break the as-cast structure. Samples with typical dimensions (17 x 7 x 2.5 mm) free from macrostructural defects were homogenized at 1000 °C in vacuum of 10{sup -5} torr for 17.5 hours with a 10°C/min cooling rate until to 820 °C and, subsequently, quenched in water. The samples, randomly selected, were subjected to isothermal treatment tests under different conditions of time and temperature. Isothermal treatments for transformation and retention phases were carried out in a special assembly designed for this work. After the tests, the samples were characterized by the usual phase characterization techniques with particular emphasis for the X-ray diffraction technique. In this way, the Rietveld refinement method was applied. In the case of uranium based alloys it is quite challenging due to the lack of data in the literature. In this work a strategy for the

  15. Kinetics and thermodynamics of the dissolution of Th1-xMxO2 solid solutions (M = U, Pu)

    International Nuclear Information System (INIS)

    Hubert, S.; Heisbourg, G.; Dacheux, N.; Moisy, Ph.; Purans, J.

    2004-01-01

    Kinetics of the dissolution of Th 1-x M x O 2 (M = U, Pu) solid solutions was investigated as a function of several chemical parameters such as pH, substitution ratio, temperature, ionic strength, and electrolyte. Several compositions of Th 1-x U x O 2 and Th 1-x Pu x O 2 were synthesized and characterized before and after leaching by using several methods such as XRD, EXAFS, BET, PIXE, SEM, and XPS. Leaching tests were performed in nitric, hydrochloric or sulfuric media and groundwater. The normalized dissolution rates were evaluated for Th 1-x U x O 2 , and Th 0.88 Pu 0.12 O 2 leading to the determination of the partial order related to the proton concentration, n, and to the corresponding normalized dissolution rate constant at pH = 0, k'T. While for Th enriched solids, the solid solutions Th 1-x U x O 2 have the same dissolution behaviour than ThO 2 with a partial order n ∼ 0.3, in the case of uranium enriched solids, Th 1-x U x O 2 has the same dissolution behaviour than UO 2 with a partial order of n = 1, indicating that uranium oxidation rate becomes the limiting step of the dissolution process. The stoichiometry of the release of both actinides (U or Pu, Th) was verified until the precipitation of thorium occurred in the leachate for pH > 2, while uranium was released in the solution as an uranyl form. For uranium enriched solid solutions, thermodynamic equilibrium was reached after 100 days, and solubility constant of secondary phase was determined. In the case of Th 1-x Pu x O 2 , the dissolution behaviour is similar to that of ThO 2 , but only kinetic aspect of the dissolution can be studied. From the analysis of XPS and EXAFS data on leached and un-leached Th 1-x U x O 2 samples, the dissolution mechanism of solid solutions was explained and will be discussed. The role of the electrolytes on the dissolution of the solid solutions is discussed. Kinetics parameters of dissolution are also given in groundwater and in neutral media

  16. Contribution to the study of U-Ti and U-Pu-Ti carbides; Contribution a l'etude des carbures U-C-Ti et (U, Pu) - C-Ti

    Energy Technology Data Exchange (ETDEWEB)

    Milet, C A [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1968-07-01

    After having discussed the reasons to use (U,Pu) carbides as fast reactor fuel, we examine the influence of the addition of titanium to these carbides. A preliminary study has been done on the system of U-C-Ti and some properties have been measured such as: density, thermal expansion, electrical resistivity, atmospheric corrosion and compatibility with stainless steel. The systems U-Pu-C-Ti (Pu/U + Pu equal to 15 per cent) and U-C-Ti have been found to be very similar. There exists a two phases region (U,Pu)C + TiC, an eutectic between (U,Pu)C and TiC for approximately 15 at %. The solubilities of U + Pu in TiC and of Ti in (U,Pu)C is less than 1 % at. The addition of titanium does not markedly change thermal expansion coefficients of (U,Pu)C. However the resistance to atmospheric corrosion and compatibility with stainless steel is improved. Thermal conductivity, calculated from electrical resistivity, has increased. On the other side, the density of fissile material is lowered. The combination of (U,Pu)C + TiC seems to be the most promising alloy for application as nuclear fuel. (author) [French] Apres avoir rappele les problemes poses par un combustible pour les reacteurs a neutrons rapides et l'interet des carbures U-Pu-C comme combustible, on examine l'influence de l'addition de titane dans ces carbures. Une etude preliminaire sur le systeme U-C-Ti a ete effectuee et quelques proprietes sont indiquees: densite, coefficients de dilatation, resistivite electrique, tenue a la corrosion atmospherique, compatibilite avec l'acier inoxydable. Le systeme U-Pu-C-Ti (Pu/U + Pu egal a 15 pour cent) presente de grandes analogies avec le systeme U-C-Ti. Il existe un domaine biphase (U,Pu)C + TiC, un eutectique entre (U,Pu)C et TiC pour environ 15 at % Ti; les solubilites de U + Pu clans TiC et de Ti dans (U,Pu)C sont inferieures a 1 at %. Par rapport a la phase (U,Pu)C, l'addition de titane est sans effets importants sur les coefficients de dilatation. Par contre la tenue a

  17. Behaviour of high O/U fuel

    International Nuclear Information System (INIS)

    Davies, J.H.; Hoshi, E.V.; Zimmerman, D.L.

    2000-01-01

    Full text: The effect of increased fuel oxygen potential on fuel behaviour has been studied by fabricating and irradiating urania fuel with an average O/U ratio of 2.05. The fuel was fabricated by re-sintering standard urania pellets in a controlled oxygen potential environment and irradiated in a segmented rod bundle in a U.S. BWR. Preirradiation ceramographic characterization of the pellets revealed the well-known Widmanstaetten precipitation of U-409 platelets in the UO 2 matrix. The high O/U fuel pellets were clad in Zircaloy-2 and irradiated to over 20 GWd/MT. Ramp tests were performed in a test reactor and detailed postirradiation examinations of both ramped and nonramped rods have been performed. The cladding inner surface condition, fission gas release and swelling behavior of high O/U fuel have been characterized and compared with standard UO 2 pellets. Although fuel microstructural features in ramp-tested high O/U fuel showed evidence of higher fuel temperatures and/or enhanced transport processes, fission gas release to the fuel rod free space was less than for similarly tested standard UO 2 fuel. However, fuel swelling and cladding strains were significantly greater. In spite of high cladding strains, PCI crack propagation was inhibited in the high O/U fuel I rods. Evidence is presented that the crystallographically oriented etch features often noted in peripheral regions of high burnup fuels are not an indication of higher oxides of uranium. (author)

  18. Dicty_cDB: Contig-U16457-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16457-1 no gap 1065 3 996438 997502 PLUS 6 5 U16457 0 0 1 0 1 0 2 0 0 0 0 0 1 1 Show Contig...-U16457-1 Contig ID Contig-U16457-1 Contig update 2004. 6.11 Contig sequence >Contig-U16457-1 (Contig...-U16457-1Q) /CSM_Contig/Contig-U16457-1Q.Seq.d ACAATTGGTGTTGCTGCTCTATTCGGTCTTCCAGCTATGGCACGTTCCGC A...TTTAACAAGATTGGAAGAC CAAAAAGAAAAAAAA Gap no gap Contig length 1065 Chromosome numb... Translated Amino Acid sequence TIGVAALFGLPAMARSAAMSLVFLIPFMWIVFSVHYPINSVVADICMSYNNNTGSIEQQL ANYTNPIVSEIFGTC

  19. Dicty_cDB: Contig-U10709-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT

  20. Remediation of U(VI)-contaminated water using zero-valent iron

    International Nuclear Information System (INIS)

    Abdelouas, A.; Gong, W.; Lutze, W.; Nuttall, E.

    1999-01-01

    We investigated the possibility of U(VI) reduction by zero-valent iron (Fe 0 ). We conducted batch experiments with granular iron and solutions containing 0.25 and 9.3 mg L -1 U(VI) at 24 deg C. The solution pH ranges between 2 and 9. In all experiments uranium removal was complete within several hours to several days regardless of the pH value. The reduced uranium precipitated as poorly crystallized hydrated uraninite, UO 2 .nH 2 O. The reduction of U(VI) to U(IV) by Fe 0 was found to be the principal mechanism of U removal from the solution. Other mechanisms such as U(VI) sorption on the newly formed Fe(III) hydroxides are insignificant. These results show that zero-valent iron can be used to remedy U-contaminated waters from uranium mines and mill tailings sites, the pH of which usually ranges between 2 and 9. (authors)