WorldWideScience

Sample records for u2 oprah winfrey

  1. Oprah Winfrey : a arte de comunicar

    OpenAIRE

    Azevedo, Marta Margarida Santos Dionísio de

    2015-01-01

    Tese de doutoramento, Estudos de Literatura e de Cultura (Estudos Americanos), Universidade de Lisboa, Faculdade de Letras, 2015 O presente estudo tem como objetivo inquirir sobre a importância de Oprah Winfrey nas suas variadas áreas de intervenção a nível da cultura dos E.U.A.. Por um lado, apresenta uma particularização de Oprah Winfrey como mulher e como afroamericana, incidindo aqui no campo do feminismo e da raça/etnicidade; por outro lado, discute-se Oprah como marca, criada por ela...

  2. Setting the Agenda for Reading: Oprah Winfrey's Book Club.

    Science.gov (United States)

    Herb, Rhonda

    Oprah Winfrey is one of the wealthiest and most powerful entertainers operating in the media today. More than mere celebrity, however, she represents the notion of the heroic for her fans. In a sense, she operates as a television evangelist offering advice on secular issues of the day. This paper explores Oprah's role in influencing audiences to…

  3. It was a "mascara runnin’ kinda day": Oprah Winfrey, confession, celebrity and the formation of trust

    OpenAIRE

    Wilson, S.

    2007-01-01

    Oprah Winfrey is a very popular figure in contemporary American culture. Often described as 'authentic', the chapter explores the ways in which Winfrey deploys confessional practices on her TV talk show as a means to engender trust.

  4. The dispute between Jonathan Franzen and Oprah Winfrey

    Directory of Open Access Journals (Sweden)

    Nina Bostič

    2008-12-01

    Full Text Available Following the publication of Jonathan Franzen's The Corrections in September 2001, the novel was selected by Oprah's Book Club. Afterwards,  Franzen commented  negatively on the club's  previ­ ous selections, upon which the invitation was withdrawn. The objective of this paper is to investigate the reasons behind Franzen's negative response, the proceeding  media fall-out and the effects of the Winfrey - Franzen dispute.

  5. Hegemony or Concordance? The Rhetoric of Tokenism in "Oprah" Winfrey's Rags-to-Riches Biography.

    Science.gov (United States)

    Cloud, Dana L.

    1996-01-01

    Examines biographies of talk show host and producer Oprah Winfrey in which conventional narratives construct a token "Oprah" persona whose story reinforces the ideology of the American Dream, implying its accessibility to black Americans despite barriers inherent in a racist society. Develops theories of tokenism, biography,…

  6. Pengaruh Oprah Winfrey Dalam Acara The Oprah Winfrey Show Terhadap Minat Mahasiswa Menjadi Pembawa Acara(Studi Deskriptif Pengaruh Oprah Winfrey Dalam Acara The Oprah Winfrey Show Di Metro TV Terhadap Minat Mahasiswa Universitas Muhammadiyah Sumatera Utara (UMSU) Menjadi Pembawa Acara)

    OpenAIRE

    Nadia Chairinal D.

    2011-01-01

    Acara The Oprah Winfrey Show tercatat menempati rating teratas sebagai acara talkshow paling fenomenal dan terkenal di Amerika. Acara ini pertama kali ditayangkan secara nasional di televisi Amerika Serikat pada September 1986 di 108 televisi. Topik pertama yang dihadirkannya adalah ‘How to Marry the Man/Woman of Your Choice’. Meskipun ada yang meragukan bahwa acara ini akan mampu meraih perhatian public, namun ternyata keraguan itu tidak beralasan. Oprah mencatat sukses, dalam waktu singkat ...

  7. The Oprahfication of 9/11: September 11, the war in Iraq, and The Oprah Winfrey show

    NARCIS (Netherlands)

    Kooijman, J.; Cotten, T.T.; Springer, K.

    2010-01-01

    This chapter discusses how The Oprah Winfrey Show presented the aftermath of 9/11 and the pending war in Iraq in its episodes. It shows that in "The Oprahfication of 9/11," the show’s discourse on terrorism and war "transform[ed] possible feelings of fear, anger, anxiety, and grief into acts of

  8. O CONCEITO DE REPRESENTAÇÃO, OS MEDIA E OPRAH WINFREY: QUE RELAÇÃO?

    Directory of Open Access Journals (Sweden)

    Marta Margarida Santos Dionísio de Azevedo

    2011-06-01

    Full Text Available O objetivo com este ensaio é analisar a evolução diacrónica do conceito de representação e suas diversas áreas de influência, mais concretamente nos media. Nessa abordagem foram contempladas as questões sociais e culturais a ela inerentes, assim como os produtos televisivos em análise. Com essa contextualização delineia-se um conceito de representação específico, aliado a uma personagem televisiva que faz parte do quotidiano da sociedade americana e, também, mundial. Trata-se de Oprah Winfrey e, consequentemente, do seu talk show, The Oprah Winfrey Show. Pretendese demonstrar as várias facetas do conceito de representação, assim como sua aplicação prática a produtos televisivos como marcos de uma cultura sempre em mutação – Oprah Winfrey como um ícone cultural, comunicativo e sociológico.

  9. AN ANALYSIS OF OFF RECORD STRATEGIES REFLECTING POLITENESS IMPLICATURE IN “OPRAH WINFREY SHOW”

    Directory of Open Access Journals (Sweden)

    Rahma Yanti

    2017-08-01

    Full Text Available This thesis discusses strategies off the record that describes implicatures modesty in a conversation. Off record strategy is one of the five strategies. This strategy is discussed for the use of the language used in the forms of direct. The object of research are strategies off the record that describes implicatures politeness in a famous talk show in America, namely, "Oprah Winfrey Show". The data were taken using methods refer to refer techniques involved free conversation, where the author was not involved in the dialogue that occurs because the data is taken from the TV show, recording technique with the aid of a recorded tape. Furthermore, the authors use the technique CAAT by way of transcribing talk show back in the form transcription ortrografis. This analysis uses methods equivalent pragmatic look at the role of external factors of language, especially the factor of interlocutors on selection strategies used off record. The results showed that the context of the situation and the violations of the maxim of conversation will influence the choice of strategies used off record. However there are some cases when this option do not follow the rules. This is because of other factors that come into play in a conbersation such as an intonation. mplicatures appear generally in the form of affirmation that is used in polite. In one sentence found two or more strategy off record selected speakers.

  10. O CONCEITO DE REPRESENTAÇÃO, OS MEDIA E OPRAH WINFREY: QUE RELAÇÃO?

    OpenAIRE

    de Azevedo, Marta Margarida Santos Dionísio

    2011-01-01

    O objetivo com este ensaio é analisar a evolução diacrónica do conceito de representação e suas diversas áreas de influência, mais concretamente nos media. Nessa abordagem foram contempladas as questões sociais e culturais a ela inerentes, assim como os produtos televisivos em análise. Com essa contextualização delineia-se um conceito de representação específico, aliado a uma personagem televisiva que faz parte do quotidiano da sociedade americana e, também, mundial. Trata-se de Oprah Winfrey...

  11. Oprah, celebrity and formations of self

    OpenAIRE

    Wilson, S.

    2003-01-01

    Examining the phenomenon of the Oprah Winfrey Show within the context of contemporary American culture, the book considers the reasons for the popularity of this television programme. It explores Winfrey's celebrity persona, the ways in which individuals construct selfhood, and the role of confession. Drawing on cultural criticism and a black feminist perspective, the book demonstrates the range of conflicting discourses that are manifest on the show and combine to produce something that is c...

  12. The Oprah Revolution: Book Clubs in Library Media Centers

    Science.gov (United States)

    Littlejohn, Carol

    2006-01-01

    When Oprah Winfrey began her successful book club in 1996, she continued a tradition that public libraries have provided for decades. Oprah placed a spotlight on reading that encouraged many women who had never read a book "to read." Book clubs sprang up in neighborhoods, bookstores, and on Web sites. Library media centers began offering book…

  13. The "Oprahfication" of Literacy: Reading "Oprah's Book Club."

    Science.gov (United States)

    Hall, R. Mark

    2003-01-01

    Considers how although the influence of "Oprah's Book Club" has been well documented in the popular media, it has received little attention from the academic community. Examines the club as a literacy delivery system, asking how literacy takes its shape from the interests of both Winfrey and her readers. (SG)

  14. USA's litterære superstjerne

    DEFF Research Database (Denmark)

    Bjerre, Thomas Ærvold

    2010-01-01

    Jonathan Franzen er den mest omtalte forfatter i USA lige nu og ombejlet af alle fra Time Magazine til Oprah Winfrey. Hvad er det, han kan, manden bag ”Freedom”?......Jonathan Franzen er den mest omtalte forfatter i USA lige nu og ombejlet af alle fra Time Magazine til Oprah Winfrey. Hvad er det, han kan, manden bag ”Freedom”?...

  15. 100 History-Making Ethnic Women

    Science.gov (United States)

    York, Sherry

    2004-01-01

    A list of hundred history-making ethnic women who have created history in their respective fields and become successful writers is presented. The list includes Alma Flor Ada, Julia Alvarez and Oprah Winfrey.

  16. U2 laulusõnade tundmine lennutab Hawaile

    Index Scriptorium Estoniae

    2006-01-01

    Iiri bänd U2 algatas oma uue albumi "U2 18 Singles väljatuleku puhul internetis võistluse "Hunt The Lyric", kus fännidel on võimalus võita reis Hawaile (reisi paketis ka U2 "Vertigo" tuuri kontsert 9. dets.)

  17. Path integral for coherent states of the dynamical U2 group and U2/1 supergroup

    International Nuclear Information System (INIS)

    Kochetov, E.A.

    1992-01-01

    A part-integral formulation in the representation of coherent states for the unitary U 2 group and U 2/1 supergroup is introduced. U 2 and U 2/1 path integrals are shown to be defined on the coset spaces U 2 /U 1 xU 1 and U 2/1 /U 1/1 xU 1 , respectively. These coset appears as curved classical phase spaces. Partition functions are expressed as path integrals over these spaces. In the case when U 2 and U 2/1 are the dynamical groups, the corresponding path integrals are evaluated with the help of linear fractional transformations that appear as the group (supergroup) action in the coset space (superspace). Possible applications for quantum models are discussed. 9 refs

  18. Richard Wright, Toni Morrison, and United States book clubs

    Directory of Open Access Journals (Sweden)

    Mark Madigan

    2004-12-01

    Full Text Available This essay focuses on the influence of commercial book clubs in the United States. It will examine the country's oldest commercial book club, the Book-of-the-Month Club (BOMC, Oprah's Book Club (OBC, which bears the name of its founder, television personality Oprah Winfrey, and their roles in the careers of two African-American authors, Richard Wright and Toni Morrison.

  19. Local U(2,2) Symmetry in Relativistic Quantum Mechanics

    OpenAIRE

    Finster, Felix

    1997-01-01

    Local gauge freedom in relativistic quantum mechanics is derived from a measurement principle for space and time. For the Dirac equation, one obtains local U(2,2) gauge transformations acting on the spinor index of the wave functions. This local U(2,2) symmetry allows a unified description of electrodynamics and general relativity as a classical gauge theory.

  20. Local U(2,2) symmetry in relativistic quantum mechanics

    Science.gov (United States)

    Finster, Felix

    1998-12-01

    Local gauge freedom in relativistic quantum mechanics is derived from a measurement principle for space and time. For the Dirac equation, one obtains local U(2,2) gauge transformations acting on the spinor index of the wave functions. This local U(2,2) symmetry allows a unified description of electrodynamics and general relativity as a classical gauge theory.

  1. U-2 Bono sünnipäevapidu

    Index Scriptorium Estoniae

    2002-01-01

    10. mail toimub Guitar Safari pubis Estonian U Fan Clubi eestvedamisel ansambli U-2 laulja-kitarristi Bono sünnipäevakontert. Üritust soojendab DJ Zwillig ning peaesinejateks on ansamblid The Bluesyard ja Sequence

  2. A Realistic $U(2)$ Model of Flavor arXiv

    CERN Document Server

    Linster, Matthias

    We propose a simple $U(2)$ model of flavor compatible with an $SU(5)$ GUT structure. All hierarchies in fermion masses and mixings arise from powers of two small parameters that control the $U(2)$ breaking. In contrast to previous $U(2)$ models this setup can be realized without supersymmetry and provides an excellent fit to all SM flavor observables including neutrinos. We also consider a variant of this model based on a $D_6 \\times U(1)_F$ flavor symmetry, which closely resembles the $U(2)$ structure, but allows for Majorana neutrino masses from the Weinberg operator. Remarkably, in this case one naturally obtains large mixing in the lepton sector from small mixing in the quark sector. The model also offers a natural option for addressing the Strong CP Problem and Dark Matter by identifying the Goldstone boson of the $U(1)_F$ factor as the QCD axion.

  3. Naised, kes teevad suurt raha / Katrin Kapara

    Index Scriptorium Estoniae

    Kapara, Katrin

    2008-01-01

    Maailma rikkaimate inimeste edetabelit koostava ajakirja Forbes nimestikus oli tänavu 99 naist. Liliane Bettencourt - kosmeetikaimpeeriumi LþOreal pärija, Zhang Xin - firma SOHO China omanik, Cristina Green - jaekaubanduskettide omanik, Jelena Baturina - Vene ärinaine, Meg Whitman - eBay käivitaja, Oprah Winfrey - Ameerika telesaatejuht

  4. Communication, Hip Hop Style

    Science.gov (United States)

    Apel, Laura

    2009-01-01

    When Candi Carter, a producer at "The Oprah Winfrey Show", learned that her son, Emerson, was born with chromosome 8p, which causes heart defects, mental retardation, severe speech delay, and other issues, she was immediately thrust into the world of special needs parenting. Like many in her position, she learned quickly that her child's…

  5. Begin with Love[R]. The First Three Months: Connecting with Your Child. [Videotape].

    Science.gov (United States)

    CIVITAS Initiative, Chicago, IL.

    Hosted by Oprah Winfrey and featuring Dr. Kyle Pruett, this videotape focuses on new parents' relationship with their infant in the first 3 months of life. The 30-minute videotape begins with footage of infants during the newborn period and depicts parents talking about their emotional response to their infant's birth. The video focuses on…

  6. Getost võrsunud täht kingib lootuse / Triin Oppi

    Index Scriptorium Estoniae

    Oppi, Triin

    2007-01-01

    Vt. ka Postimees : na russkom jazõke 9. jaan., lk. 9. USA miljardärist meediatäht Oprah Winfrey avas alanud aasta teisel päeval sadadele viletsates tingimustes elanud 11-13-aastastele tüdrukutele omanimelise kooli Lõuna-Aafrikas

  7. Protecting Children in Day Care: Building a National Background Check System. Hearing before the Committee on the Judiciary, United States Senate, One Hundred Second Congress, First Session on the National Child Protection Act of 1991.

    Science.gov (United States)

    Congress of the U.S., Washington, DC. Senate Committee on the Judiciary.

    In his opening statement at this hearing, committee chairman Senator Joseph Biden mentioned the National Child Protection Act of 1991; praised Oprah Winfrey's efforts to support programs and legislation to prevent sexual abuse of children; presented data on the incidence of sexual abuse of children in the home and in day care centers; and…

  8. Power Language: Getting the Most out of Your Words.

    Science.gov (United States)

    McQuain, Jeffrey

    Aimed at writers, speakers, students, and all who wish to communicate with clarity and strength, this book illuminates the principles of effective word use. It features dozens of helpful guidelines and memorable examples--from Tennessee Williams to Oprah Winfrey, from Demosthenes to Dr. Seuss--that illustrate the basics of choosing words and using…

  9. Twenty Superstars of Education

    Science.gov (United States)

    Adams, Caralee

    2006-01-01

    In 2005, the staff at "Instruction" magazine conducted a survey to know the individuals who are most admired for their contributions to the field of education. This article presents the brief profiles of these individuals. These celebrities, authors, and teachers include Mel Levine, Oprah Winfrey, Hillary Clinton, Jonathan Kozol, Marilyn Burns,…

  10. Popular modernism: representations of modernist literature in popular culture

    NARCIS (Netherlands)

    Loontjens, J.

    2012-01-01

    Modernistische auteurs als Virginia Woolf en Marcel Proust werden tijdens hun leven met name geroemd door een select groepje critici. Tegenwoordig worden ze echter besproken in de boekenclub van Oprah Winfrey, in Hollywoodfilms en in zelfhulpliteratuur. Jannah Loontjens gebruikt de representatie van

  11. Neutrino mass with large S U (2 )L multiplet fields

    Science.gov (United States)

    Nomura, Takaaki; Okada, Hiroshi

    2017-11-01

    We propose an extension of the standard model introducing large S U (2 )L multiplet fields which are quartet and septet scalars and quintet Majorana fermions. These multiplets can induce the neutrino masses via interactions with the S U (2 ) doublet leptons. We then find the neutrino masses are suppressed by a small vacuum expectation value of the quartet/septet and an inverse of the quintet fermion mass, relaxing the Yukawa hierarchies among the standard model fermions. We also discuss collider physics at the Large Hadron Collider, considering the production of charged particles in these multiplets, and due to the effects of violating the custodial symmetry, some specific signatures can be found. Then, we discuss the detectability of these signals.

  12. Oxidation behaviour of U2Ti alloy in dry air

    International Nuclear Information System (INIS)

    Roy, S.P.; Gupta, N.K.; Jat, Ram Avtar; Parida, S.C.; Mukerjee, S.K.

    2016-01-01

    U 2 Ti alloy is being considered as promising storage material for storage of hydrogen isotopes. However, the absorption capacity of this reactive alloy can be affected due to presence of oxygen in the process gas. Hence, it is necessary to know the kinetic of this alloy in presence of oxygen. In this study, U 2 Ti alloy was prepared by arc melting method followed by vacuum annealing. The alloy was characterized by XRD, SEM and EDX methods. The isothermal oxidation behaviour of U 2 Ti alloy was investigated in the temperature range of 548-623 K in dry air for 24 hours by using thermo gravimetric technique. The oxidation curves are shown. The oxidation curves were analysed using the rate equation: (Δm/a) n = kt, where, (Δm/a) is the mass gain per unit area, n is the power exponent, k is the rate constant and t is time in (seconds). Analysis of the results shows that the oxidation reaction follows linear rate law (n ~ 1). Using the linear rate law, the rate constant (k) of oxidation reaction was evaluated at each temperature in the range 548-623 K. The variation of (ln k) with reciprocal temperature is shown. The activation energy of this oxidation reaction in the temperature range 548-623 K was calculated using the Arrhenius equation and found to be 76 kJ/mol. The XRD analysis of the oxidation products was found to be U 3 O 8 and TiO 2 . (author)

  13. Ising versus S U (2) 2 string-net ladder

    Science.gov (United States)

    Vidal, Julien

    2018-03-01

    We consider the string-net model obtained from S U (2) 2 fusion rules. These fusion rules are shared by two different sets of anyon theories. In this paper, we study the competition between the two corresponding non-Abelian quantum phases in the ladder geometry. A detailed symmetry analysis shows that the nontrivial low-energy sector corresponds to the transverse-field cluster model that displays a critical point described by the s o (2) 1 conformal field theory. Other sectors are obtained by freezing spins in this model.

  14. The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms

    KAUST Repository

    Park, Hyo-Young

    2017-04-21

    The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms. These proteins also move rapidly and continuously in the nuclei, and their movements are affected by ATP depletion. The U2AF65 proteins are splicing factors that interact with SF1 and U2AF35 proteins to promote U2snRNP for the recognition of the pre-mRNA 3\\' splice site during early spliceosome assembly. We have determined the subcellular localization and movement of these proteins\\' Arabidopsis homologs. It was found that Arabidopsis U2AF65 homologs, AtU2AF65a, and AtU2AF65b proteins interact with AtU2AF35a and AtU2AF35b, which are Arabidopsis U2AF35 homologs. We have examined the mobility of these proteins including AtSF1 using fluorescence recovery after photobleaching and fluorescence loss in photobleaching analyses. These proteins displayed dynamic movements in nuclei and their movements were affected by ATP depletion. We have also demonstrated that these proteins shuttle between nuclei and cytoplasms, suggesting that they may also function in cytoplasm. These results indicate that such splicing factors show very similar characteristics to their human counterparts, suggesting evolutionary conservation.

  15. The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms

    KAUST Repository

    Park, Hyo-Young; Lee, Keh Chien; Jang, Yun Hee; Kim, SoonKap; Thu, May Phyo; Lee, Jeong Hwan; Kim, Jeong-Kook

    2017-01-01

    The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms. These proteins also move rapidly and continuously in the nuclei, and their movements are affected by ATP depletion. The U2AF65 proteins are splicing factors that interact with SF1 and U2AF35 proteins to promote U2snRNP for the recognition of the pre-mRNA 3' splice site during early spliceosome assembly. We have determined the subcellular localization and movement of these proteins' Arabidopsis homologs. It was found that Arabidopsis U2AF65 homologs, AtU2AF65a, and AtU2AF65b proteins interact with AtU2AF35a and AtU2AF35b, which are Arabidopsis U2AF35 homologs. We have examined the mobility of these proteins including AtSF1 using fluorescence recovery after photobleaching and fluorescence loss in photobleaching analyses. These proteins displayed dynamic movements in nuclei and their movements were affected by ATP depletion. We have also demonstrated that these proteins shuttle between nuclei and cytoplasms, suggesting that they may also function in cytoplasm. These results indicate that such splicing factors show very similar characteristics to their human counterparts, suggesting evolutionary conservation.

  16. The Fourier U(2 Group and Separation of Discrete Variables

    Directory of Open Access Journals (Sweden)

    Kurt Bernardo Wolf

    2011-06-01

    Full Text Available The linear canonical transformations of geometric optics on two-dimensional screens form the group Sp(4,R, whose maximal compact subgroup is the Fourier group U(2_F; this includes isotropic and anisotropic Fourier transforms, screen rotations and gyrations in the phase space of ray positions and optical momenta. Deforming classical optics into a Hamiltonian system whose positions and momenta range over a finite set of values, leads us to the finite oscillator model, which is ruled by the Lie algebra so(4. Two distinct subalgebra chains are used to model arrays of N^2 points placed along Cartesian or polar (radius and angle coordinates, thus realizing one case of separation in two discrete coordinates. The N^2-vectors in this space are digital (pixellated images on either of these two grids, related by a unitary transformation. Here we examine the unitary action of the analogue Fourier group on such images, whose rotations are particularly visible.

  17. Hydrogen absorption-desorption properties of U2Ti

    International Nuclear Information System (INIS)

    Yamamoto, Takuya; Tanaka, Satoru; Yamawaki, Michio

    1990-01-01

    Hydrogen absorption-desorption properties of U 2 Ti intermetallic compound was examined over the temperature range of 298 to 973 K and at hydrogen pressures below 10 5 Pa. It absorbs hydrogen up to 7.6 atoms per F.U. (formula unit) by two step reactions and hence each desorption isotherm is separated into two plateau regions. In the first plateau, a newly-found ternary hydride is formed, where the hydrogen concentration, c H , reaches 2.4 H atoms/F.U. In the second plateau, UH 3 is formed and c H reaches 7.6 H atoms/F.U. The specimen is disintegrated into fine powder in the second plateau, while in the first plateau the ternary hydride which was identified to be UTi 2 H x (x=4.8 to 6.2) showed high durability against powdering. It is predicted that UTi 2 can be suitable material for tritium storage. (orig.)

  18. Destination Memory Impairment in Older People

    OpenAIRE

    Gopie, Nigel; Craik, Fergus I. M.; Hasher, Lynn

    2010-01-01

    Older adults are assumed to have poor destination memory— knowing to whom they tell particular information—and anecdotes about them repeating stories to the same people are cited as informal evidence for this claim. Experiment 1 assessed young and older adults’ destination memory by having participants tell facts (e.g., “A dime has 118 ridges around its edge”) to pictures of famous people (e.g., Oprah Winfrey). Surprise recognition memory tests, which also assessed confidence, revealed that o...

  19. Innovations in e-Business: Can Government Contracting be Adapted to Use Crowdsourcing and Open Innovation?

    Science.gov (United States)

    2010-09-01

    product standards and modular architecture benefit from wide market acceptance in commercial products.  Create a transparent and egalitarian ecosystem ... entrepreneurial spirit, such as Sylvester Stallone’s movie production Rocky, Microsoft’s founder Bill Gates and Oprah Winfrey, TV personality-commentator...innovative and entrepreneurial organizations that have a successful track record of taking technology out of the laboratory into a competitive market

  20. Notes on a National Strategy for Global Education

    Science.gov (United States)

    2011-12-01

    Hewson (“Bono”) and Oprah Winfrey, or entrepreneurs-turned- philanthropists such as Bill Gates and Warren Buffet , will no doubt come readily to mind as...Service Institute GAO Government Accountability Office (formerly the General Accounting Office) HHS Department of Health and Human Services IACP...6 U.S. Government Accountability Office, Foreign Languages: Human Capital Approach Needed to Correct Staffing and Proficiency Shortfalls, No

  1. Nova era & ciberespaço: ensaio prospectivo sobre suas afinidades eletivas a partir de um estudo de caso = New age and cyberspace: a prospective essay concerning their elective affinities – a case study

    Directory of Open Access Journals (Sweden)

    Jungblut, Airton Luiz

    2009-01-01

    Full Text Available Busca-se neste artigo, de forma ensaística, indagar analiticamente sobre algumas afinidades eletivas que podem ser notadas entre ciberespaço e a religiosidade "new age". Como base para essa reflexão, foi analisado um evento religioso na internet promovido pela celebre apresentadora de televisão e atriz norte-americana Oprah Winfrey, entre março e maio de 2008.

  2. Nova era & ciberespaço: ensaio prospectivo sobre suas afinidades eletivas a partir de um estudo de caso = New age and cyberspace: a prospective essay concerning their elective affinities: a case study

    Directory of Open Access Journals (Sweden)

    Jungblut, Airton Luiz

    2009-01-01

    Full Text Available Busca-se neste artigo, de forma ensaística, indagar analiticamente sobre algumas afinidades eletivas que podem ser notadas entre ciberespaço e a religiosidade "new age". Como base para essa reflexão, foi analisado um evento religioso na internet promovido pela celebre apresentadora de televisão e atriz norte-americana Oprah Winfrey, entre março e maio de 2008

  3. Campaign Seeks Buy-In for High School Reforms: "Stand Up" Aims to Rouse Public Support

    Science.gov (United States)

    Robelen, Erik W.

    2006-01-01

    Kicked off the week of April 10, 2006 with a big plug on "The Oprah Winfrey Show," a new campaign spearheaded by the Bill & Melinda Gates Foundation is aiming to drum up public action to address what its organizers see as a crisis in America's public high schools. The Stand Up campaign comes as high schools have emerged as a focus of public-policy…

  4. You Get a Book! Demand Spillovers, Combative Advertising, and Celebrity Endorsements

    OpenAIRE

    Craig L. Garthwaite

    2012-01-01

    This paper studies the economic effects of endorsements. In the publishing sector, endorsements from the Oprah Winfrey Book Club are found to be a business stealing form of advertising that raises title level sales without increasing the market size. The endorsements decrease aggregate adult fiction sales; likely as a result of the endorsed books being more difficult than those that otherwise would have been purchased. Economically meaningful sales increases are also found for non-endorsed ti...

  5. R2U2: Monitoring and Diagnosis of Security Threats for Unmanned Aerial Systems

    Science.gov (United States)

    Schumann, Johann; Moosbruger, Patrick; Rozier, Kristin Y.

    2015-01-01

    We present R2U2, a novel framework for runtime monitoring of security properties and diagnosing of security threats on-board Unmanned Aerial Systems (UAS). R2U2, implemented in FPGA hardware, is a real-time, REALIZABLE, RESPONSIVE, UNOBTRUSIVE Unit for security threat detection. R2U2 is designed to continuously monitor inputs from the GPS and the ground control station, sensor readings, actuator outputs, and flight software status. By simultaneously monitoring and performing statistical reasoning, attack patterns and post-attack discrepancies in the UAS behavior can be detected. R2U2 uses runtime observer pairs for linear and metric temporal logics for property monitoring and Bayesian networks for diagnosis of security threats. We discuss the design and implementation that now enables R2U2 to handle security threats and present simulation results of several attack scenarios on the NASA DragonEye UAS.

  6. RLIM interacts with Smurf2 and promotes TGF-β induced U2OS cell migration

    International Nuclear Information System (INIS)

    Huang, Yongsheng; Yang, Yang; Gao, Rui; Yang, Xianmei; Yan, Xiaohua; Wang, Chenji; Jiang, Sirui; Yu, Long

    2011-01-01

    Highlights: → RLIM directly binds to Smurf2. → RLIM enhances TGF-β responsiveness in U2OS cells. → RLIM promotes TGF-β driven migration of osteosarcoma U2OS cells. -- Abstract: TGF-β (transforming growth factor-β), a pleiotropic cytokine that regulates diverse cellular processes, has been suggested to play critical roles in cell proliferation, migration, and carcinogenesis. Here we found a novel E3 ubiquitin ligase RLIM which can directly bind to Smurf2, enhancing TGF-β responsiveness in osteosarcoma U2OS cells. We constructed a U2OS cell line stably over-expressing RLIM and demonstrated that RLIM promoted TGF-β-driven migration of U2OS cells as tested by wound healing assay. Our results indicated that RLIM is an important positive regulator in TGF-β signaling pathway and cell migration.

  7. U2AF1 mutations alter splice site recognition in hematological malignancies.

    Science.gov (United States)

    Ilagan, Janine O; Ramakrishnan, Aravind; Hayes, Brian; Murphy, Michele E; Zebari, Ahmad S; Bradley, Philip; Bradley, Robert K

    2015-01-01

    Whole-exome sequencing studies have identified common mutations affecting genes encoding components of the RNA splicing machinery in hematological malignancies. Here, we sought to determine how mutations affecting the 3' splice site recognition factor U2AF1 alter its normal role in RNA splicing. We find that U2AF1 mutations influence the similarity of splicing programs in leukemias, but do not give rise to widespread splicing failure. U2AF1 mutations cause differential splicing of hundreds of genes, affecting biological pathways such as DNA methylation (DNMT3B), X chromosome inactivation (H2AFY), the DNA damage response (ATR, FANCA), and apoptosis (CASP8). We show that U2AF1 mutations alter the preferred 3' splice site motif in patients, in cell culture, and in vitro. Mutations affecting the first and second zinc fingers give rise to different alterations in splice site preference and largely distinct downstream splicing programs. These allele-specific effects are consistent with a computationally predicted model of U2AF1 in complex with RNA. Our findings suggest that U2AF1 mutations contribute to pathogenesis by causing quantitative changes in splicing that affect diverse cellular pathways, and give insight into the normal function of U2AF1's zinc finger domains. © 2015 Ilagan et al.; Published by Cold Spring Harbor Laboratory Press.

  8. Unlimited Horizons: Design and Development of the U-2. [NASA Aeronautics Book Series

    Science.gov (United States)

    Merlin, Peter W.

    2015-01-01

    This book describes the creation, history, design, and research value of the U-2 program. It also describes the involvement of NACA, as a cover story, and the later use by NASA of these aircraft as environmental research platforms.

  9. Unobtrusive Software and System Health Management with R2U2 on a Parallel MIMD Coprocessor

    Science.gov (United States)

    Schumann, Johann; Moosbrugger, Patrick

    2017-01-01

    Dynamic monitoring of software and system health of a complex cyber-physical system requires observers that continuously monitor variables of the embedded software in order to detect anomalies and reason about root causes. There exists a variety of techniques for code instrumentation, but instrumentation might change runtime behavior and could require costly software re-certification. In this paper, we present R2U2E, a novel realization of our real-time, Realizable, Responsive, and Unobtrusive Unit (R2U2). The R2U2E observers are executed in parallel on a dedicated 16-core EPIPHANY co-processor, thereby avoiding additional computational overhead to the system under observation. A DMA-based shared memory access architecture allows R2U2E to operate without any code instrumentation or program interference.

  10. Quantum algebra Uqp(u2) and application to the rotational collective dynamics of the nuclei

    International Nuclear Information System (INIS)

    Barbier, R.

    1995-01-01

    This thesis concerns some aspects of new symmetries in Nuclear Physics. It comprises three parts. The first one is devoted to the study of the quantum algebra U qp (u 2 ). More precisely, we develop its Hopf algebraic structure and we study its co-product structure. The bases of the representation theory of U qp (u 2 ) are introduced. On one hand, we construct the finite-dimensional irreducible representations of U qp (u 2 ). On the other hand, we calculate the Clebsch-Gordan coefficients with the projection operator method. To complete our study, we construct some deformed boson mappings of the quantum algebras U qp (u 2 ), U q 2 (su 2 ) and U qp (u 1,1 ). The second part deals with the construction of a new phenomenological model of the non rigid rotator. This model is based on the quantum algebra U qp (u 2 ). The rotational energy and the E2 reduced transition probabilities are obtained. They depend on the two deformation parameters q and p of the quantum algebra. We show how the use of the two-parameter deformation of the algebra U qp (u 2 ) leads to a generalization of the U q (su 2 )-rotator model. We also introduce a new model of the anharmonic oscillator on the basis of the quantum algebra U qp (u 2 ). We show that the system of the U q (su 2 )-rotator and of the anharmonic oscillator can be coupled with the use of the deformation parameters of U qp (u 2 ). A ro-vibration energy formula and expansion 'a la' Dunham are obtained. The aim of the lest part is to apply our non rigid rotator model to the rotational collective dynamics of the superdeformed nuclei of the A∼130 - 150 and A∼190 mass regions and deformed nuclei of the actinide and rare earth series. We adjust the free parameters of our model and compare our results with those arising from four other models of the non rigid rotator. A comparative analysis is given in terms of transition energies. We calculate the dynamical moments of inertia with the fitted parameters. A comparison between the

  11. Non-circadian expression masking clock-driven weak transcription rhythms in U2OS cells.

    Directory of Open Access Journals (Sweden)

    Julia Hoffmann

    Full Text Available U2OS cells harbor a circadian clock but express only a few rhythmic genes in constant conditions. We identified 3040 binding sites of the circadian regulators BMAL1, CLOCK and CRY1 in the U2OS genome. Most binding sites even in promoters do not correlate with detectable rhythmic transcript levels. Luciferase fusions reveal that the circadian clock supports robust but low amplitude transcription rhythms of representative promoters. However, rhythmic transcription of these potentially clock-controlled genes is masked by non-circadian transcription that overwrites the weaker contribution of the clock in constant conditions. Our data suggest that U2OS cells harbor an intrinsically rather weak circadian oscillator. The oscillator has the potential to regulate a large number of genes. The contribution of circadian versus non-circadian transcription is dependent on the metabolic state of the cell and may determine the apparent complexity of the circadian transcriptome.

  12. Split-Family SUSY, U(2)^5 Flavour Symmetry and Neutrino Physics

    CERN Document Server

    Jones-Pérez, Joel

    2014-01-01

    In split-family SUSY, one can use a U(2)^3 symmetry to protect flavour observables in the quark sector from SUSY contributions. However, attempts to extend this procedure to the lepton sector by using an analogous U(2)^5 symmetry fail to reproduce the neutrino data without introducing some form of fine-tuning. In this work, we solve this problem by shifting the U(2)^2 symmetry acting on leptons towards the second and third generations. This allows neutrino data to be reproduced without much difficulties, as well as protecting the leptonic flavour observables from SUSY. Key signatures are a $\\mu\\to e\\gamma$ branching ratio possibly observable in the near future, as well as having selectrons as the lightest sleptons.

  13. Transcription on lampbrush chromosome loops in the absence of U2 snRNA.

    OpenAIRE

    Tsvetkov, A; Jantsch, M; Wu, Z; Murphy, C; Gall, J G

    1992-01-01

    The five small nuclear RNAs (snRNAs) involved in splicing occur on the loops of amphibian lampbrush chromosomes and in hundreds to thousands of extrachromosomal granules called B snurposomes. To assess the role of these snRNAs during transcription and to explore possible relationships between the loops and B snurposomes, we injected single-stranded antisense oligodeoxynucleotides (oligos) against U1 and U2 snRNA into toad and newt oocytes. As shown before, antisense U1 and U2 oligos caused tr...

  14. Determination of interstitial oxygen atom position in U2N3+xOy by near edge structure study

    Science.gov (United States)

    Jiang, A. K.; Zhao, Y. W.; Long, Z.; Hu, Y.; Wang, X. F.; Yang, R. L.; Bao, H. L.; Zeng, R. G.; Liu, K. Z.

    2018-06-01

    The determination of interstitial oxygen atom site in U2N3+xOy film could facilitate the understanding of the oxidation mechanism of α-U2N3 and the effect of U2N3+xOy on anti-oxidation. By comparing the similarities and variances between N K edge and O K edge electron energy loss spectra (EELS) for oxidized α-U2N3 and UO2, the present work looks at the local structure of nitrogen and oxygen atoms in U2N3+xOy film, identifying the most possible position of interstitial O atom.

  15. Point group invariants in the Uqp(u(2)) quantum algebra picture

    International Nuclear Information System (INIS)

    Kibler, M.

    1993-07-01

    Some consequences of a qp-quantization of a point group invariant developed in the enveloping algebra of SU(2) are examined. A set of open problems concerning such invariants in the U qp (u(2)) quantum algebra picture is briefly discussed. (author) 18 refs

  16. The Role of U2AF1 Mutations in the Pathogenesis of Myelodysplastic Syndromes

    Science.gov (United States)

    2016-12-01

    splicing contribute to disease patho mutation in the spliceosome gene U2AF1 and observed hemat also occur in patients with MDS or acute myeloid...Method for Combining Non-Independent, One-Sided Tests of Significance. Biometrics 31, 987–992. Buschbeck, M., Uribesalgo, I., Wibowo, I., Rué, P

  17. Investigations of mechanical properties and Debye temperature of U2Ti

    International Nuclear Information System (INIS)

    Chattaraj, D.; Dash, Smruti; Kulkarni, S.G.

    2012-01-01

    U 2 Ti is a potential solid state material for safe storage, supply and recovery of hydrogen isotopes. It is not pyrophoric and its hydride is resistance to powdering upon hydrogenation. These two properties made this alloy advantageous over the conventionally used uranium as tritium getter material. Hence, thorough study of material properties like thermodynamic and elastic properties of U 2 Ti is important. Recently, present authors have reported thermodynamic functions for U 2 Ti. However, elastic moduli of this alloy have not been reported. The second derivatives of the internal energy with respect to strain, gives adiabatic elastic constants. Thus adiabatic elastic constants are related to interatomic potentials of material. They are also related to the thermal properties of a solid through the Debye theory. For metal hydride material, the elastic constants are useful for an evaluation of the elastic contribution to the hydrogen-hydrogen interaction energy and the elastic energy associated with the precipitation of hydride phases. The present paper reports the ultrasonic measurement of the elastic moduli and Debye temperature of U 2 Ti at room temperature using 38 DL plus ultrasonic velocitymeter

  18. Structural instability and ground state of the U_2Mo compound

    International Nuclear Information System (INIS)

    Losada, E.L.; Garcés, J.E.

    2015-01-01

    This work reports on the structural instability at T = 0 °K of the U_2Mo compound in the C11_b structure under the distortion related to the C_6_6 elastic constant. The electronic properties of U_2Mo such as density of states (DOS), bands and Fermi surface (FS) are studied to understand the source of the instability. The C11_b structure can be interpreted as formed by parallel linear chains along the z-directions each one composed of successive U–Mo–U blocks. Hybridization due to electronic interactions inside the U–Mo–U blocks is slightly modified under the D_6 distortion. The change in distance between chains modifies the U–U interaction and produces a split of f-states. The distorted structure is stabilized by a decrease in energy of the hybridized states, mainly between d-Mo and f-U states, together with the f-band split. Consequently, an induced Peierls distortion is produced in U_2Mo due to the D_6 distortion. It is important to note that the results of this work indicate that the structure of the ground state of the U_2Mo compound is not the assumed C11_b structure. It is suggested for the ground state a structure with hexagonal symmetry (P6 #168), ∼0.1 mRy below the energy of the recently proposed Pmmn structure. - Highlights: • Structural instability of the C11b compound due to the D6 deformation. • Induced Peierls distortion due to the D6 deformation. • Distorted structure is stabilized by hybridization and split of f-Uranium state. • P6 (#168) suggested ground state for the U_2Mo compound.

  19. The possibility of the mixed valence state in the uranium intermetallic compounds: UCoGa5, U2Ru2Sn and U2RuGa8

    International Nuclear Information System (INIS)

    Troc, Robert

    2007-01-01

    The mixed valence (MV) phenomenon has been observed so far in a large number of various compounds but containing only lanthanides. These properties are usually associated with the mixing of the localised f-state and the band states. The usual valence state for magnetic uranium intermetallics is the trivalent state 5f 3 or hybridised 5f 2 6d 1 , both are nearly degenerate in energy and can compete for a stability of the compound. In some cases a gain in an energy minimum may be achieved by very fast fluctuating between these two states with a time of 10 -14 s, which does not allow to yield the ordered state even if the exchange interactions (favourite the U-U distances) would be able for that. The latter cases seem to concern the described here intermetallics: one ternary compound based on Co, UCoGa 5 , and the two uranium ternary compounds based on Ru, namely U 2 Ru 2 Sn and U 2 RuGa 8 which all crystallize in a tetragonal unit cell. All these compounds show a maximum in their temperature dependences of the magnetic susceptibility measured along and perpendicular to the c-axis. Such a behaviour, which is reminiscent of a number of Ce (Sm, Eu) and Yb compounds for which χ(T) has in the past been considered by Sales and Wohlleben (SW) by applying their ICF model or by Lawrance et al. following their scaling procedure. It turned out that these phenomenological models can also be applied to the considered here two Ru-based uranium ternaries from which some reliable energy parameters could be found. In order to further support the mixing valence scenario for the first such cases in uranium compounds presented here, the transport and thermodynamic properties are also discussed. However, some of the most important results confirming the MV state, e.g., in U 2 RuGa 8 , has recently been achieved from the inelastic neutron scattering performed in the Rutherford Appleton Laboratory on the ISIS facility. From these measurements a characteristic gap of 60 meV has been

  20. High-pressure study of the non-Fermi liquid material U2Pt2In

    International Nuclear Information System (INIS)

    Estrela, P.; Visser, A. de; Boer, F.R. de; Pereira, L.C.J.

    2001-01-01

    The effect of hydrostatic pressure (p≤1.8 GPa) on the non-Fermi liquid state of U 2 Pt 2 In is investigated by electrical resistivity measurements in the temperature interval 0.3-300 K. The experiments were carried out on single-crystals with the current along (I parallel c) and perpendicular (I parallel a) to the tetragonal axis. The pressure effect is strongly current-direction dependent. For I parallel a we observe a rapid recovery of the Fermi-liquid T 2 -term with pressure. A comparison of the data with the magnetotransport theory of Rosch provides evidence for the location of U 2 Pt 2 In at an antiferromagnetic quantum critical point. For I parallel c the resistivity increases under pressure, indicating the enhancement of an additional scattering mechanism. (orig.)

  1. Magnetic structure of the heavy-fermion compound U2Zn17

    DEFF Research Database (Denmark)

    Cox, D. E; Shirane, G.; Shapiro, S. M.

    1986-01-01

    The phase transition of U2Zn17 at 9.7K has been investigated by neutron powder diffraction. The transition corresponds to the onset of antiferromagnetic order where the U moments are oriented antiparallel to their neighbors within the basal planes and the near neighbor along the c^ axis of this r...... of this rhombohedral compound. At 5K, the ordered moments lie within the basal planes and are of magnitude (0.8±0.1) μB, which is substantially below the paramagnetic moment of 2.25 μB/U atom given by high-temperature susceptibility data......The phase transition of U2Zn17 at 9.7K has been investigated by neutron powder diffraction. The transition corresponds to the onset of antiferromagnetic order where the U moments are oriented antiparallel to their neighbors within the basal planes and the near neighbor along the c^ axis...

  2. Synthesis, crystal structure and magnetic properties of U2RuGa8

    International Nuclear Information System (INIS)

    Grin', Yu.N.; Rogl', P.; Aksel'rud, L.G.; Pecharskij, V.K.; Yarmolyuk, Ya.P.

    1988-01-01

    Synthesis of a new uranium intermetallic compound of U 2 RuGa 8 composition was conducted. The compound crystallizes in Ho 2 CoGa 8 structural type, met earlier only in compounds of rare earths. Magnetic susceptibility of the compound is rather high and is practically independent of temperature in 80-300 K range. This feature is typical for paramagnetism of electron gas and testifies to the absence of localized magnetic moments on ruthenium and uranium atoms

  3. Lower Neurocognitive Function in U-2 Pilots: Relationship to White Matter Hyperintensities

    Science.gov (United States)

    2014-07-09

    computer-based instrument, more com- prehensive neuropsychological testing is required to draw conclu- sions about the general cognitive profile of...consistency with other neuropsychological instrument batteries.24 MRI assessment. Structural MRI data for U2Ps were collected at the Research Imaging...report no disclo- sures. L. Rowland serves as an editorial board member of Schizophrenia Bulletin and is funded by NIH grants R01MH094520 and

  4. Closure plan for Corrective Action Unit 109: U-2bu subsidence crater, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    1999-03-01

    The U-2bu subsidence crater, Corrective Action Unit 109, will be closed in accordance with the Resource Conservation and Recovery Act, the Nevada Division of Environmental Protection operational permit, and the Federal Facility Agreement and Consent Order. The U-2bu subsidence crater is located in Area 2 of the Nevada Test Site. It was created in 1971 by an underground nuclear test with the name Miniata. The crater has a diameter of 288 meters (944 feet) and an approximate depth of 35 meters (115 feet). Based on the results of the analyses reported in the site characterization report, the only constituents of concern in the U-2bu subsidence crater include leachable lead and total petroleum hydrocarbons. Closure activities will include the excavation and disposal of impacted soil from the top of the crater. Upon completion of excavation, verification samples will be collected to show that the leachable lead has been removed to concentrations below the regulatory action level. After sample results show that the lead has been removed, the excavated area will be backfilled and a soil flood diversion berm will be constructed as a best management practice. An independent registered professional engineer will certify the site was closed following the approved Closure Plan. Post-closure care is not warranted for this site because closure activities will involve removal of the Resource Conservation and Recovery Act constituents of concern

  5. RCRA Part A permit characterization plan for the U-2bu subsidence crater. Revision 1

    International Nuclear Information System (INIS)

    1998-04-01

    This plan presents the characterization strategy for Corrective Action Unit (CAU) 109, U-2bu Subsidence Crater (referred to as U-2bu) in Area 2 at the Nevada Test Site (NTS). The objective of the planned activities is to obtain sufficient characterization data for the crater soils and observed wastes under the conditions of the current Resource Conservation and Recovery Act (RCRA) Part A permit. The scope of the characterization plan includes collecting surface and subsurface soil samples with hand augers and for the purpose of site characterization. The sampling strategy is to characterize the study area soils and look for RCRA constituents. Observable waste soils and surrounding crater soils will be analyzed and evaluated according to RCRA closure criteria. Because of the status of the crater a RCRA Part A permit site, acquired radionuclide analyses will only be evaluated in regards to the health and safety of site workers and the disposition of wastes generated during site characterization. The U-2bu Subsidence Crater was created in 1971 by a Lawrence Livermore National Laboratory underground nuclear test, event name Miniata, and was used as a land-disposal unit for radioactive and hazardous waste from 1973 to 1988

  6. Closure plan for Corrective Action Unit 109: U-2bu subsidence crater, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    The U-2bu subsidence crater, Corrective Action Unit 109, will be closed in accordance with the Resource Conservation and Recovery Act, the Nevada Division of Environmental Protection operational permit, and the Federal Facility Agreement and Consent Order. The U-2bu subsidence crater is located in Area 2 of the Nevada Test Site. It was created in 1971 by an underground nuclear test with the name Miniata. The crater has a diameter of 288 meters (944 feet) and an approximate depth of 35 meters (115 feet). Based on the results of the analyses reported in the site characterization report, the only constituents of concern in the U-2bu subsidence crater include leachable lead and total petroleum hydrocarbons. Closure activities will include the excavation and disposal of impacted soil from the top of the crater. Upon completion of excavation, verification samples will be collected to show that the leachable lead has been removed to concentrations below the regulatory action level. After sample results show that the lead has been removed, the excavated area will be backfilled and a soil flood diversion berm will be constructed as a best management practice. An independent registered professional engineer will certify the site was closed following the approved Closure Plan. Post-closure care is not warranted for this site because closure activities will involve removal of the Resource Conservation and Recovery Act constituents of concern.

  7. Contribution to the U$_2$C$_3$ formation by the synthetic reaction and by the decomposition of UC$_2$; Beitrag zur U$_2$C$_3$-bildung nach der synthetischen reaktion und durch zerfall von UC$_2$

    Energy Technology Data Exchange (ETDEWEB)

    Buschinelli, A. J.A.

    1974-06-01

    This work is a contribution to the study of the mechanism and of the kinetics of the U$_2$C$_3$ formation by the synthetic reaction. The influences of a mechanical and a thermical pre-treatment of the samples on the reaction kinetics were investigated and discussed taking into account other information from the literature. The relative increasing of the U$_2$C$_3$ nucleation rate due to the pulverization corresponds approximately to the surface enlargement of the pulverized material. The activation energy for the synthetic reaction in powder was found to be 94 +- 7 kcal/mol. The negative influence of nitrogen, oxygen and tungsten on the U$_2$C$_3$ formation was reported. In the decomposition of UC$_2$ to U$_2$C$_3$ and graphite, the influences of the morphology of the graphite precipitate and the fast neutron irradiation on the beginning of the U$_2$C$_3$ formation were also investigated.

  8. Diffraction study on the nonstoichiometric α-U2N3+x phase

    International Nuclear Information System (INIS)

    Serizawa, H.; Fukuda, K.; Ishii, Y.; Funahashi, S.; Katsura, M.

    1993-01-01

    X-ray and neutron diffraction studies were performed on nonstoichiometric α-U 2 N 3+ x having a composition range 1.68 2 N 3+x in this composition range was distorted Mn 2 O 3 -type. Structure parameters of U and N atoms were determined. The results showed that positions of U atoms varied continuously with nitrogen content. No evidence of the modification from bcc to fcc could be obtained. Interatomic distances of U-U and U-N were determined. The position parameter of N atoms showed that N atoms were slightly deviated from the tetrahedral site. (author)

  9. Ground state structure of U2Mo: static and lattice dynamics study

    International Nuclear Information System (INIS)

    Mukherjee, D.; Sahoo, B.D.; Joshi, K.D.; Kaushik, T.C.

    2016-01-01

    According to experimental reports, the ground state stable structure of U 2 Mo is tetragonal. However, various theoretical studies performed in past do not get tetragonal phase as the stable structure at ambient conditions. Therefore, the ground state structure of U 2 Mo is still unresolved. In an attempt to understand the ground state properties of this system, we have carried out first principle electronic band structure calculations. The structural stability analysis carried out using evolutionary structure search algorithm in conjunction with ab-inito method shows that a hexagonal structure (space group P6/mmm) is the lowest enthalpy structure at ambient condition and remains stable upto 200 GPa. The elastic and lattice dynamical stability further supports the stability of this phase at ambient condition. Further, using the 0 K calculations in conjunction with finite temperature corrections, we have derived the isotherm and shock adiabat (Hugoniot) of this material. Various equilibrium properties such as ambient pressure volume, bulk modulus, pressure derivative of bulk modulus etc. are derived from equation of state. (author)

  10. Cyberinfrastructure for the collaborative development of U2U decision support tools

    Directory of Open Access Journals (Sweden)

    Larry L. Biehl

    2017-01-01

    Full Text Available This paper describes the use of cyberinfrastructure to create interactive applications as part of the Useful to Usable (U2U project. These applications transform historical climate data, knowledge, and models into decision support tools for end users such as crop farmers, university Extension educators, and other agricultural advisors. In creating a cyberinfrastructure to support the U2U project, four major challenges have been addressed: designing and developing highly usable web applications with frequent feedback, establishing a software engineering environment to support iterative development, integrating and synthesizing historical and current datasets from a variety of sources (local vs. remote, different access methods, and formats, and supporting project collaboration needs of data and document sharing, project management, and public outreach. The overall goals of the cyberinfrastructure and its architecture design are described. Methods for data retrieval and synthesis, as well as the various software components utilized are discussed. The development and integration of tools into the collaborative HUBzero framework are highlighted, including the use of HUBzero’s core features to share ideas, algorithms, and results. A highly iterative development process that includes feedback from experts and end-users to feed requirement definition, design and application updates are also examined.

  11. Subjective experiences of watching stereoscopic Avatar and U2 3D in a cinema

    Science.gov (United States)

    Pölönen, Monika; Salmimaa, Marja; Takatalo, Jari; Häkkinen, Jukka

    2012-01-01

    A stereoscopic 3-D version of the film Avatar was shown to 85 people who subsequently answered questions related to sickness, visual strain, stereoscopic image quality, and sense of presence. Viewing Avatar for 165 min induced some symptoms of visual strain and sickness, but the symptom levels remained low. A comparison between Avatar and previously published results for the film U2 3D showed that sickness and visual strain levels were similar despite the films' runtimes. The genre of the film had a significant effect on the viewers' opinions and sense of presence. Avatar, which has been described as a combination of action, adventure, and sci-fi genres, was experienced as more immersive and engaging than the music documentary U2 3D. However, participants in both studies were immersed, focused, and absorbed in watching the stereoscopic 3-D (S3-D) film and were pleased with the film environments. The results also showed that previous stereoscopic 3-D experience significantly reduced the amount of reported eye strain and complaints about the weight of the viewing glasses.

  12. Closure Plan for Corrective Action Unit 109: U-2bu Subsidence Crater Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    Shannon Parsons

    1999-03-01

    The U-2bu subsidence crater, Corrective Action Unit 109, will be closed in accordance with the Resource Conservation and Recovery Act, the Nevada Division of Environmental Protection operational permit, and the Federal Facilities Agreement and Consent Order. The U-2bu subsidence crater is located in Area 2 of the Nevada Test Site. It was created in 1971 by an underground nuclear test with the name Miniata. The crater has a diameter of 288 meters (944 feet) and an approximate depth of 35 meters (115 feet). The subsidence crater was used as a land disposal unit for radioactive and hazardous waste from 1973 to 1988. Site disposal history is supported by memorandums, letters, and personnel who worked at the Nevada Test Site at the time of active disposal. Closure activities will include the excavation and disposal of impacted soil form the tip of the crater. Upon completion of excavation, verification samples will be collected to show that lead has been removed to concentrations be low regulatory action level. The area will then be backfilled and a soil flood diversion berm will be constructed, and certified by an independent professional engineer as to having followed the approved Closure Plan.

  13. High-field magnetization studies of U2T2Sn (T=Co, Ir, Pt) compounds

    International Nuclear Information System (INIS)

    Prokes, K.; Nakotte, H.; de Boer, F.R.

    1995-01-01

    High-field magnetization measurements at 4.2 K on U 2 T 2 Sn (T = Co, Ir and Pt) compounds have been performed on free and fixed powders up to 57 T. An antiferromagnetic ground state of U 2 Pt 2 Sn is corroborated by a metamagnetic transition at 22 T with very small hysteresis going up and down with field. U 2 Co 2 Sn and U 2 Ir 2 Sn show no metamagnetic transition up to 57 T which is in agreement with the non-magnetic ground state of these compounds. In all cases, the maximum applied field is not sufficient to achieve saturation. The short-pulse measurements presented here are compared with previous results obtained in quasi-static fields up to 35 T

  14. Yeast endoribonuclease stimulated by Novikoff Hepatoma small nuclear RNAS U1 and U2

    International Nuclear Information System (INIS)

    Stevens, A.

    1982-01-01

    Using [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) from yeast as a substrate, an endoribonuclease has been detected in enzyme fractions derived from a high salt wash of ribonucleoprotein particles of Saccharomyces cerevisiae. The [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) seems to be a preferred substrate since other polyribonucleotides are hydrolyzed more slowly, if at all. The enzyme is inhibited by ethidium bromide, but fully double-stranded polyribonucleotides are not hydrolyzed. The hydrolysis of [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) is stimulated about 2.5-fold by the addition of small nuclear RNAs U1 and U2 of Novikoff hepatoma cells. Results show that the stimulation involves an interaction of the labeled RNA with the small nuclear RNA

  15. Simple calculation of hybridization effects in UTX and U2T2X compounds

    International Nuclear Information System (INIS)

    Prokes, K.; Brueck, E.; Nakotte, H.; De Chatel, P.F.; De Boer, F.R.

    1995-01-01

    The band widths of several UTX and U 2 T 2 X compounds (T: transition metal, X: p-metal) are evaluated by means of a tight-binding method. The magnetism in both groups of compounds is governed by the hybridization between U f-states and transition-metal d-states. Comparing the sum of all hybridization effects, we find approximately the same hybridization effects in both groups of compounds. We also observe a decrease of the band width with increasing atomic number Z within a transition-metal series. By comparing the band width with the theoretical critical energies for the f 3 and f 2 configurations, it is in some cases possible to predict whether the ground state is magnetically ordered or not. ((orig.))

  16. Coolant radiolysis studies in the high temperature, fuelled U-2 loop in the NRU reactor

    International Nuclear Information System (INIS)

    Elliot, A.J.; Stuart, C.R.

    2008-06-01

    An understanding of the radiolysis-induced chemistry in the coolant water of nuclear reactors is an important key to the understanding of materials integrity issues in reactor coolant systems. Significant materials and chemistry issues have emerged in Pressurized Water Reactors (PWR), Boiling Water Reactors (BWR) and CANDU reactors that have required a detailed understanding of the radiation chemistry of the coolant. For each reactor type, specific computer radiolysis models have been developed to gain insight into radiolysis processes and to make chemistry control adjustments to address the particular issue. In this respect, modelling the radiolysis chemistry has been successful enough to allow progress to be made. This report contains a description of the water radiolysis tests performed in the U-2 loop, NRU reactor in 1995, which measured the CHC under different physical conditions of the loop such as temperature, reactor power and steam quality. (author)

  17. Facile CO cleavage by a multimetallic CsU2 nitride complex

    International Nuclear Information System (INIS)

    Falcone, Marta; Scopelliti, Rosario; Mazzanti, Marinella; Kefalidis, Christos E.; Maron, Laurent

    2016-01-01

    Uranium nitrides are important materials with potential for application as fuels for nuclear power generation, and as highly active catalysts. Molecular nitride compounds could provide important insight into the nature of the uranium-nitride bond, but currently little is known about their reactivity. In this study, we found that a complex containing a nitride bridging two uranium centers and a cesium cation readily cleaved the C≡O bond (one of the strongest bonds in nature) under ambient conditions. The product formed has a [CsU 2 (μ-CN)(μ-O)] core, thus indicating that the three cations cooperate to cleave CO. Moreover, the addition of MeOTf to the nitride complex led to an exceptional valence disproportionation of the CsU IV -N-U IV core to yield CsU III (OTf) and [MeN=U V ] fragments. The important role of multimetallic cooperativity in both reactions is illustrated by the computed reaction mechanisms.

  18. A yeast endoribonuclease stimulated by Novikoff hepatoma small nuclear RNAs U1 and U2

    International Nuclear Information System (INIS)

    Stevens, A.

    1982-01-01

    Using [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) from yeast as a substrate, an endoribonuclease has been detected in enzyme fractions derived from a high salt wash of ribonucleoprotein particles of Saccharomyces cerevisiae. The [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) seems to be a preferred substrate since other polyribonucleotides are hydrolyzed more slowly, if at all. The enzyme is inhibited by ethidium bromide, but fully double-stranded polyribonucleotides are not hydrolyzed. The hydrolysis of [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) is stimulated about 2.5-fold by the addition of small nuclear RNAs U1 and U2 of Novikoff hepatoma cells. Results show that the stimulation involves an interaction of the labeled RNA with the small nuclear RNA

  19. Crystal structure of U2+xCo2Ga1-x

    International Nuclear Information System (INIS)

    Zelinskii, A.V.; Fedorchuk, A.A.

    1995-01-01

    In studies of phase equilibria in the U-Co-Ga system at 600 degrees C, the authors found a ternary compound close in composition to U 2 Co 2 Ga. A sample of composition U 42 Co 40 Ga 18 was prepared by arc-melting a mixture of high-purity U (99.4%), Co (99.99%), and Ga (99.99%) in a purified argon atmosphere. The sample was homogenized at 600 degrees C for 720 h in an evacuated quartz tube and then quenched in cold water. In structure determination, the authors used a DRON-4-07 powder X-ray diffractometer (CuK α radiation, 0.02 degrees 2θ scan step) and the CSD software package. The X-ray diffraction pattern showed tetragonal symmetry, with lattice parameters obtained from least-squares refinements a = 0.707729(5) and c = 0.34707(4) nm

  20. Towards critical physics in 2+1d with U(2N)-invariant fermions

    Energy Technology Data Exchange (ETDEWEB)

    Hands, Simon [Department of Physics, College of Science, Swansea University,Singleton Park, Swansea SA2 8PP (United Kingdom)

    2016-11-04

    Interacting theories of N relativistic fermion flavors in reducible spinor representations in 2+1 spacetime dimensions are formulated on a lattice using domain wall fermions (DWF), for which a U(2N) global symmetry is recovered in the limit that the wall separation L{sub s} is made large. The Gross-Neveu (GN) model is studied in the large-N limit and an exponential acceleration of convergence to the large-L{sub s} limit is demonstrated if the usual parity-invariant mass mψ̄ψ is replaced by the U(2N)-equivalent im{sub 3}ψ̄γ{sub 3}ψ. The GN model and two lattice variants of the Thirring model are simulated for N=2 using a hybrid Monte Carlo algorithm, and studies made of the symmetry-breaking bilinear condensate and its associated susceptibility, the axial Ward identity, and the mass spectrum of both fermion and meson excitations. Comparisons are made with existing results obtained using staggered fermions. For the GN model a symmetry-breaking phase transition is observed, the Ward identity is recovered, and the spectrum found to be consistent with large-N expectations. There appears to be no obstruction to the study of critical UV fixed-point physics using DWF. For the Thirring model the Ward identity is not recovered, the spectroscopy measurements are inconclusive, and no symmetry breaking is observed all the way up to the effective strong coupling limit. This is consistent with a critical Thirring flavor number N{sub c}<2, contradicting earlier staggered fermion results.

  1. Structural Basis for Polypyrimidine Tract Recognition by the Essential Pre-mRNA Splicing Factor U2AF65

    International Nuclear Information System (INIS)

    Sickmier, E.; Frato, K.; Shen, H.; Paranawithana, S.; Green, M.; Kielkopf, C.

    2006-01-01

    The essential pre-mRNA splicing factor, U2AF 65 , guides the early stages of splice site choice by recognizing a polypyrimidine (Py)-tract consensus sequence near the 3'-splice site. Since Py-tracts are relatively poorly conserved in higher eukaryotes, U2AF 65 is faced with the problem of specifying uridine-rich sequences, yet tolerating a variety of nucleotide substitutions found in natural Py-tracts. To better understand these apparently contradictory RNA binding characteristics, the X-ray structure of the U2AF 65 RNA binding domain bound to a Py-tract composed of seven uridines has been determined at 2.5Angstroms resolution. Specific hydrogen bonds between U2AF 65 and the uracil bases provide an explanation for polyuridine recognition. Flexible sidechains and bound water molecules form the majority of the base contacts, and potentially could rearrange when the U2AF 65 structure adapts to different Py-tract sequences. The energetic importance of conserved residues for Py-tract binding is established by analysis of site-directed mutant U2AF 65 proteins using surface plasmon resonance

  2. Lattice QCD at the physical point meets S U (2 ) chiral perturbation theory

    Science.gov (United States)

    Dürr, Stephan; Fodor, Zoltán; Hoelbling, Christian; Krieg, Stefan; Kurth, Thorsten; Lellouch, Laurent; Lippert, Thomas; Malak, Rehan; Métivet, Thibaut; Portelli, Antonin; Sastre, Alfonso; Szabó, Kálmán; Budapest-Marseille-Wuppertal Collaboration

    2014-12-01

    We perform a detailed, fully correlated study of the chiral behavior of the pion mass and decay constant, based on 2 +1 flavor lattice QCD simulations. These calculations are implemented using tree-level, O (a )-improved Wilson fermions, at four values of the lattice spacing down to 0.054 fm and all the way down to below the physical value of the pion mass. They allow a sharp comparison with the predictions of S U (2 ) chiral perturbation theory (χ PT ) and a determination of some of its low energy constants. In particular, we systematically explore the range of applicability of next-to-leading order (NLO) S U (2 ) χ PT in two different expansions: the first in quark mass (x expansion), and the second in pion mass (ξ expansion). We find that these expansions begin showing signs of failure for Mπ≳300 MeV , for the typical percent-level precision of our Nf=2 +1 lattice results. We further determine the LO low energy constants (LECs), F =88.0 ±1.3 ±0.2 and BMS ¯(2 GeV )=2.61 (6 )(1 ) GeV , and the related quark condensate, ΣMS ¯(2 GeV )=(272 ±4 ±1 MeV )3 , as well as the NLO ones, ℓ¯3=2.6 (5 )(3 ) and ℓ¯4=3.7 (4 )(2 ), with fully controlled uncertainties. We also explore the next-to-next-to-leading order (NNLO) expansions and the values of NNLO LECs. In addition, we show that the lattice results favor the presence of chiral logarithms. We further demonstrate how the absence of lattice results with pion masses below 200 MeV can lead to misleading results and conclusions. Our calculations allow a fully controlled, ab initio determination of the pion decay constant with a total 1% error, which is in excellent agreement with experiment.

  3. Magnetic, transport and electronic structure properties of U2RuGa8

    International Nuclear Information System (INIS)

    Troc, R.; Bukowski, Z.; SuIkowski, C.; Morkowski, J.A.; Szajek, A.; CheIkowska, G.

    2005-01-01

    A single crystal of uranium ternary intermetallic of U 2 RuGa 8 was grown by the Ga self-flux method. This compound crystallizes in the tetragonal unit cell of space group P4/mmm. Despite the fairly large U-U shortest distance of 4.22A, this compound shows no signs of any magnetic ordering down to 1.9K. Instead, the susceptibility measured along the a and c axes, goes through a broad maximum at T max =220K showing a distinct anisotropy. For j||a there is a weak temperature dependence of the electrical resistivity with a large value of ρ 0 =117μΩcm, while for j||c the ρ(T) curve goes through a maximum at about 130K. The magnetoresistivity measured along two crystallographic directions is small and positive. The thermopower S for the two directions studied is positive and larger along the a-axis. It goes through a broad maximum at 175K reaching a value of 45μV/K. The electronic structure has been calculated by the tight-binding linear muffin-tin orbital method (TB-LMTO) and the results were used in calculation of the valence band near the Fermi level compared next to that found in photoemission experiment. The core 4f spectra are also presented. All the above properties are discussed in view of mixed valence behaviour of uranium atom in this compound

  4. Creating subgroups of U(2w) for quantum-minus computers

    International Nuclear Information System (INIS)

    De Vos, Alexis; Boes, Michiel

    2011-01-01

    Classical reversible computers on w bits are isomorphic to the (finite) symmetric group S 2 w ; quantum computers on w qubits are isomorphic to the (Lie) unitary group U(2 w ). We investigate and classify groups X which represent computers intermediate between classical reversible computers and quantum computers. Such intermediate groups X may exist in three flavours: - finite groups of order larger than (2 w )!,; - infinite but discrete groups, and; - Lie groups of dimension smaller than (2 w ). The larger the group, the more powerful the computer may be, but the smaller the group, the easier it can be to build the computer hardware. In the present paper, we investigate the first two flavours only. For our purpose, we start from 1-qubit transformations, represented by 2 x 2 unitary matrices. We call this group the creator. Its members are called gates and act on one qubit. Controlled gates are quantum circuits acting on w qubits, such that the 1-qubit transformation (applied to a particular qubit) depends on the state of the w - 1 other qubits. The controlled gates generate the group X of 2 w x 2 w matrices, called the creation. We discuss all creators of order up to 8. Additionally a creator of order 16 and one of order 192 are discussed.

  5. Facile CO Cleavage by a Multimetallic CsU2 Nitride Complex.

    Science.gov (United States)

    Falcone, Marta; Kefalidis, Christos E; Scopelliti, Rosario; Maron, Laurent; Mazzanti, Marinella

    2016-09-26

    Uranium nitrides are important materials with potential for application as fuels for nuclear power generation, and as highly active catalysts. Molecular nitride compounds could provide important insight into the nature of the uranium-nitride bond, but currently little is known about their reactivity. In this study, we found that a complex containing a nitride bridging two uranium centers and a cesium cation readily cleaved the C≡O bond (one of the strongest bonds in nature) under ambient conditions. The product formed has a [CsU2 (μ-CN)(μ-O)] core, thus indicating that the three cations cooperate to cleave CO. Moreover, the addition of MeOTf to the nitride complex led to an exceptional valence disproportionation of the CsU(IV) -N-U(IV) core to yield CsU(III) (OTf) and [MeN=U(V) ] fragments. The important role of multimetallic cooperativity in both reactions is illustrated by the computed reaction mechanisms. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Creating subgroups of U(2{sup w}) for quantum-minus computers

    Energy Technology Data Exchange (ETDEWEB)

    De Vos, Alexis; Boes, Michiel, E-mail: alex@elis.UGent.b [Imec v.z.w. and Vakgroep elektronika en informatiesystemen Universiteit Gent Sint Pietersnieuwstraat 41 B - 9000 Gent (Belgium)

    2011-03-01

    Classical reversible computers on w bits are isomorphic to the (finite) symmetric group S{sub 2}{sup w}; quantum computers on w qubits are isomorphic to the (Lie) unitary group U(2{sup w}). We investigate and classify groups X which represent computers intermediate between classical reversible computers and quantum computers. Such intermediate groups X may exist in three flavours: - finite groups of order larger than (2{sup w}); - infinite but discrete groups, and; - Lie groups of dimension smaller than (2{sup w}). The larger the group, the more powerful the computer may be, but the smaller the group, the easier it can be to build the computer hardware. In the present paper, we investigate the first two flavours only. For our purpose, we start from 1-qubit transformations, represented by 2 x 2 unitary matrices. We call this group the creator. Its members are called gates and act on one qubit. Controlled gates are quantum circuits acting on w qubits, such that the 1-qubit transformation (applied to a particular qubit) depends on the state of the w - 1 other qubits. The controlled gates generate the group X of 2{sup w} x 2{sup w} matrices, called the creation. We discuss all creators of order up to 8. Additionally a creator of order 16 and one of order 192 are discussed.

  7. Thermal properties of KUO3(s) and K2U2O7 - by high temperature Calvet calorimeter

    International Nuclear Information System (INIS)

    Jayanthi, K.; Iyer, V.S.; Venugopal, V.

    1998-01-01

    The thermal properties of KUO 3 (s) and K 2 U 2 O 7 (s) were determined using a high temperature Calvet calorimeter by drop method. The enthalpy increments, (H T o - H 298.15 0 ), in kJ/mol for KUO 3 (s) and K 2 U 2 O 7 (s) can be represented by, H T o - H 298.15 0 KUO 3 (s) kJ/mol ± 0.7 = -39.15 + 0.129T + 0.1005x10 -4 T 2 (369-714K) and H T o -H 298.15 0 K 2 U 2 O 7 (s) kJ/mol ± 0.7 = -52.99 + 0.1361T + 0.146x10 -3 T 2 (391 - 683K). (author)

  8. Cycloalkyl-based unsymmetrical unsaturated (U2)-NHC ligands: Flexibility and dissymmetry in ruthenium-catalysed olefin metathesis

    KAUST Repository

    Rouen, Mathieu

    2014-01-01

    Air-stable Ru-indenylidene and Hoveyda-type complexes bearing new unsymmetrical unsaturated N-heterocyclic carbene (U2-NHC) ligands combining a mesityl unit and a flexible cycloalkyl moiety as N-substituents were synthesised. Structural features, chemical stabilities and catalytic profiles in olefin metathesis of this new library of cycloalkyl-based U2-NHC Ru complexes were studied and compared with their unsymmetrical saturated NHC-Ru homologues as well as a set of commercially available Ru-catalysts bearing either symmetrical SIMes or IMes NHC ligands. © 2014 the Partner Organisations.

  9. Alpha Particles and X Rays Interact in Inducing DNA Damage in U2OS Cells.

    Science.gov (United States)

    Sollazzo, Alice; Brzozowska, Beata; Cheng, Lei; Lundholm, Lovisa; Haghdoost, Siamak; Scherthan, Harry; Wojcik, Andrzej

    2017-10-01

    Survivors of the atomic bombings of Hiroshima and Nagasaki are monitored for health effects within the Life Span Study (LSS). The LSS results represent the most important source of data about cancer effects from ionizing radiation exposure, which forms the foundation for the radiation protection system. One uncertainty connected to deriving universal risk factors from these results is related to the problem of mixed radiation qualities. The A-bomb explosions generated a mixed beam of the sparsely ionizing gamma radiation and densely ionizing neutrons. However, until now the possible interaction of the two radiation types of inducing biological effects has not been taken into consideration. The existence of such interaction would suggest that the application of risk factors derived from the LSS to predict cancer effects after pure gamma-ray irradiation (such as in the Fukushima prefecture) leads to an overestimation of risk. To analyze the possible interaction of radiation types, a mixed-beam exposure facility was constructed where cells can be exposed to sparsely ionizing X rays and densely ionizing alpha particles. U2OS cells were used, which are stably transfected with a plasmid coding for the DNA repair gene 53BP1 coupled to a gene coding for the green fluorescent protein (GFP). The induction and repair of DNA damage, which are known to be related to cancer induction, were analyzed. The results suggest that alpha particles and X rays interact, leading to cellular and possibly cancer effects, which cannot be accurately predicted based on assuming simple additivity of the individual mixed-beam components.

  10. Crystallization and preliminary X-ray analysis of a U2AF65 variant in complex with a polypyrimidine-tract analogue by use of protein engineering

    International Nuclear Information System (INIS)

    Sickmier, E. Allen; Frato, Katherine E.; Kielkopf, Clara L.

    2006-01-01

    A complex of the essential splicing factor U2AF 65 and a deoxyuridine oligonucleotide has been crystallized by modification of an interdomain linker. The large subunit of the essential pre-mRNA splicing factor U2 auxiliary factor (U2AF 65 ) binds the polypyrimidine tract near the 3′ splice site of pre-mRNA introns and directs the association of the U2 small nuclear ribonucleoprotein particle (U2 snRNP) of the spliceosome with the pre-mRNA. Protein engineering, in which the flexible linker region connecting tandem RNA-recognition motifs (RRMs) within the U2AF 65 RNA-binding domain was partially deleted, allowed successful crystallization of the protein–nucleic acid complex. Cocrystals of a U2AF 65 variant with a deoxyuridine dodecamer diffract X-rays to 2.9 Å resolution and contain one complex per asymmetric unit

  11. Useful to Usable (U2U): Transforming climate information into usable tools to support Midwestern agricultural production

    Science.gov (United States)

    Prokopy, L. S.; Widhalm, M.

    2014-12-01

    There is a close connection between weather and climate patterns and successful agricultural production. Therefore, incorporating climate information into farm management is likely to reduce the risk of economic losses and increase profitability. While weather and climate information is becoming ever more abundant and accessible, the use of such information in the agricultural community remains limited. Useful to Usable (U2U): Transforming Climate Variability and Change Information for Cereal Crop Producers is a USDA-NIFA funded research and extension project focused on improving the use of climate information for agricultural production in the Midwestern United States by developing user-driven decision tools and training resources. The U2U team is a diverse and uniquely qualified group of climatologists, crop modelers, agronomists, and social scientists from 9 Midwestern universities and two NOAA Regional Climate Centers. Together, we strive to help producers make better long-term plans on what, when and where to plant and also how to manage crops for maximum yields and minimum environmental damage. To ensure relevance and usability of U2U products, our social science team is using a number of techniques including surveys and focus groups to integrate stakeholder interests, needs, and concerns into all aspects of U2U research. It is through this coupling of physical and social science disciplines that we strive to transform existing climate information into actionable knowledge.

  12. Conserved number of U2 snDNA sites in Piabina argentea, Piabarchus stramineus and two Bryconamericus species (Characidae, Stevardiinae

    Directory of Open Access Journals (Sweden)

    Diovani Piscor

    2018-03-01

    Full Text Available ABSTRACT The chromosomal location of 5S rRNA and U2 snRNA genes of Piabina argentea, Piabarchus stramineus and two Bryconamericus species from two different Brazilian river basins were investigated, in order to contribute to the understanding of evolutionary characteristics of these repetitive DNAs in the subfamily Stevardiinae. The diploid chromosome number was 2n = 52 for Bryconamericus cf. iheringii, Bryconamericus turiuba, Piabarchus stramineus and Piabina argentea. The 5S rDNA clusters were located on one chromosome pair in P. stramineus and B. cf. iheringii, and on two pairs in B. turiuba and P. argentea. The U2 snDNA clusters were located on the one pair in all species. Two-color FISH experiments showed that the co-localization between 5S rDNA and U2 snDNA in P. stramineus can represent a marker for this species. Thus, the present study demonstrated that the number of U2 snDNA clusters observed for the four species was conserved, but particular characteristics can be found in the genome of each species.

  13. Exact solutions of sl-boson system in U(2l + 1) reversible O(2l + 2) transitional region

    CERN Document Server

    Zhang Xin

    2002-01-01

    Exact eigen-energies and the corresponding wavefunctions of the interacting sl-boson system in U(2l + 1) reversible O(2l +2) transitional region are obtained by using an algebraic Bethe Ansatz with the infinite dimensional Lie algebraic technique. Numerical algorithm for solving the Bethe Ansatz equations by using mathematical package is also outlined

  14. Ribonucleoprotein organization of eukaryotic RNA. XXXII. U2 small nuclear RNA precursors and their accurate 3' processing in vitro as ribonucleoprotein particles.

    Science.gov (United States)

    Wieben, E D; Nenninger, J M; Pederson, T

    1985-05-05

    Biosynthetic precursors of U2 small nuclear RNA have been identified in cultured human cells by hybrid-selection of pulse-labeled RNA with cloned U2 DNA. These precursor molecules are one to approximately 16 nucleotides longer than mature U2 RNA and contain 2,2,7-trimethylguanosine "caps". The U2 RNA precursors are associated with proteins that react with a monoclonal antibody for antigens characteristic of small nuclear ribonucleoprotein particles. Like previously described precursors of U1 and U4 small nuclear RNAs, the pre-U2 RNAs are recovered in cytoplasmic fractions, although it is not known if this is their location in vivo. The precursors are processed to mature-size U2 RNA when cytoplasmic extracts are incubated in vitro at 37 degrees C. Mg2+ is required but ATP is not. The ribonucleoprotein structure of the pre-U2 RNA is maintained during the processing reaction in vitro, as are the 2,2,7-trimethylguanosine caps. The ribonucleoprotein organization is of major importance, as exogenous, protein-free U2 RNA precursors are degraded rapidly in the in vitro system. Two lines of evidence indicate that the conversion of U2 precursors to mature-size U2 RNA involves a 3' processing reaction. First, the reaction is unaffected by a large excess of mature U2 small nuclear RNP, whose 5' trimethylguanosine caps would be expected to compete for a 5' processing activity. Second, when pre-U2 RNA precursors are first stoichiometrically decorated with an antibody specific for 2,2,7-trimethylguanosine, the extent of subsequent processing in vitro is unaffected. These results provide the first demonstration of a eukaryotic RNA processing reaction in vitro occurring within a ribonucleoprotein particle.

  15. A pan-cancer analysis of transcriptome changes associated with somatic mutations in U2AF1 reveals commonly altered splicing events.

    Directory of Open Access Journals (Sweden)

    Angela N Brooks

    Full Text Available Although recurrent somatic mutations in the splicing factor U2AF1 (also known as U2AF35 have been identified in multiple cancer types, the effects of these mutations on the cancer transcriptome have yet to be fully elucidated. Here, we identified splicing alterations associated with U2AF1 mutations across distinct cancers using DNA and RNA sequencing data from The Cancer Genome Atlas (TCGA. Using RNA-Seq data from 182 lung adenocarcinomas and 167 acute myeloid leukemias (AML, in which U2AF1 is somatically mutated in 3-4% of cases, we identified 131 and 369 splicing alterations, respectively, that were significantly associated with U2AF1 mutation. Of these, 30 splicing alterations were statistically significant in both lung adenocarcinoma and AML, including three genes in the Cancer Gene Census, CTNNB1, CHCHD7, and PICALM. Cell line experiments expressing U2AF1 S34F in HeLa cells and in 293T cells provide further support that these altered splicing events are caused by U2AF1 mutation. Consistent with the function of U2AF1 in 3' splice site recognition, we found that S34F/Y mutations cause preferences for CAG over UAG 3' splice site sequences. This report demonstrates consistent effects of U2AF1 mutation on splicing in distinct cancer cell types.

  16. Decompression Sickness and U-2 Operations: Summary of Research, Findings, and Recommendations Regarding Use of Exercise During Prebreathe

    Science.gov (United States)

    2010-03-01

    Research Laboratory Hypobaric DCS Research Database developed at Brooks AFB, TX, which has detailed information on over 3,000 research chamber... hyperbaric oxygen therapy resulting in complete resolution of all symptoms. After instituting EDP, the same pilot flew 36 U-2 high flights without any...consultation with base SGP and USAFSAM Hyperbarics and MAJCOM/SGPA. Earlier guidance in the 1980’s was much more restrictive and, in fact, permanently

  17. The influence of U-2 fraction of a tortoise spleen extract on the formation of ectopic locus of haemopoiesis

    International Nuclear Information System (INIS)

    Turdyev, A.A.; Prus, E.K.; Basova, A.R.

    1990-01-01

    The implantation of a bone marrow fragment of intact mouse donors below the kidney capsule of irradiated (7 Gy) recipients leads to the formation of the haemopoiesis locus that somewhat exceeds, by mass and cellularity, the new-formed locus of control animals. The U-2 fraction of a tortoise spleen extract administered to recipients irradiated with the same dose increases the mass and cellularity of the haemopoiesis locus by 2.2 and 4.9 times respectively

  18. Ancient Origin of the U2 Small Nuclear RNA Gene-Targeting Non-LTR Retrotransposons Utopia.

    Science.gov (United States)

    Kojima, Kenji K; Jurka, Jerzy

    2015-01-01

    Most non-long terminal repeat (non-LTR) retrotransposons encoding a restriction-like endonuclease show target-specific integration into repetitive sequences such as ribosomal RNA genes and microsatellites. However, only a few target-specific lineages of non-LTR retrotransposons are distributed widely and no lineage is found across the eukaryotic kingdoms. Here we report the most widely distributed lineage of target sequence-specific non-LTR retrotransposons, designated Utopia. Utopia is found in three supergroups of eukaryotes: Amoebozoa, SAR, and Opisthokonta. Utopia is inserted into a specific site of U2 small nuclear RNA genes with different strength of specificity for each family. Utopia families from oomycetes and wasps show strong target specificity while only a small number of Utopia copies from reptiles are flanked with U2 snRNA genes. Oomycete Utopia families contain an "archaeal" RNase H domain upstream of reverse transcriptase (RT), which likely originated from a plant RNase H gene. Analysis of Utopia from oomycetes indicates that multiple lineages of Utopia have been maintained inside of U2 genes with few copy numbers. Phylogenetic analysis of RT suggests the monophyly of Utopia, and it likely dates back to the early evolution of eukaryotes.

  19. Development and characterization of monolithic fuel miniplate alloy U-2.5Zr-7.5Nb, coated in zircaloy

    International Nuclear Information System (INIS)

    Machado, Geraldo Correa

    2014-01-01

    The autocthonal production of nuclear fuel in Brazil for test and research reactors is restricted to MTR (Material Test Reactor) fuel type dispersion plate, using U3Si2 alloy, coated and dispersed in aluminum, developed by IPEN-SP for use in IEA-R1 reactor. Moreover, the UO 2 fuel rod type for power reactors is manufactured by Rezende (RJ) with a German technology by INB under license. Currently, Brazil is performing two programs of developing reactors. Currently, Brazil is developing two reactors. One of them is the development, by CNEN, the Brazilian Multipurpose Reactor (RMB), for testing, research and radioisotope production. The other one is the development a power reactor for naval propulsion, conducted by the Brazilian Navy. This dissertation presents the development and characterization of monolithic fuel miniplate alloy U-2.5Zr-7.5Nb, coated in zircaloy (ZRY), on a laboratory scale. Due to its innovative features and properties, this fuel can be used as fuel in both test reactors, research and producing radioisotopes for power reactors as small and medium sizes. Thus, this high potential fuel can be used in domestic reactors currently under development. The development of monolithic fuel plate type is made using the technique called 'picture-frame' where a sandwich composed of a monolith alloy U-2.5Zr- 7.5Nb coupled to a frame and coated sheets of Zry is obtained. The alloy U-2.5Zr-7.5Nb was obtained by melting in an induction furnace and then was cast into rectangular ingots of graphite, thus achieving an ingot with approximate dimensions of 170 x 50 x 60 mm. The obtained ingot was hot rolled at 850 ºC, with a 50 % reduction in thickness, in order to refine the raw structure of fusion. Samples cut from the alloy U-2.5Zr-7.5Nb, with dimensions 20 x 20 x 6 mm were placed in frames and plates Zry and joined by TIG (Tungsten Inert Gas) under an atmosphere of argon, obtaining a set of 10 mm thick, 45 mm wide and 100 mm long. The sandwiches were hot rolled to

  20. Analysis of the right-handed Majorana neutrino mass in an S U (4 )×S U (2 )L×S U (2 )R Pati-Salam model with democratic texture

    Science.gov (United States)

    Yang, Masaki J. S.

    2017-03-01

    In this paper, we attempt to build a unified model with the democratic texture, that has some unification between up-type Yukawa interactions Yν and Yu . Since the S3 L×S3 R flavor symmetry is chiral, the unified gauge group is assumed to be Pati-Salam type S U (4 )c×S U (2 )L×S U (2 )R. The breaking scheme of the flavor symmetry is considered to be S3 L×S3 R→S2 L×S2 R→0 . In this picture, the four-zero texture is desirable for realistic masses and mixings. This texture is realized by a specific representation for the second breaking of the S3 L×S3 R flavor symmetry. Assuming only renormalizable Yukawa interactions, type-I seesaw mechanism, and neglecting C P phases for simplicity, the right-handed neutrino mass matrix MR can be reconstructed from low energy input values. Numerical analysis shows that the texture of MR basically behaves like the "waterfall texture." Since MR tends to be the "cascade texture" in the democratic texture approach, a model with type-I seesaw and up-type Yukawa unification Yν≃Yu basically requires fine-tunings between parameters. Therefore, it seems to be more realistic to consider universal waterfall textures for both Yf and MR, e.g., by the radiative mass generation or the Froggatt-Nielsen mechanism. Moreover, analysis of eigenvalues shows that the lightest mass eigenvalue MR 1 is too light to achieve successful thermal leptogenesis. Although the resonant leptogenesis might be possible, it also requires fine-tunings of parameters.

  1. Ce2Co3Ge5: a new U2Co3Si5 - type valance fluctuating compound

    International Nuclear Information System (INIS)

    Layek, Samar; Hossain, Zakir

    2010-01-01

    Poly crystalline sample of Ce 2 Co 3 Ge 5 have been prepared by arc melting and consequently annealing at 1100 deg C. Rietveld refinement of XRD shows that it crystallize in the orthorhombic U 2 Co 3 Si 5 structure (space group Ibam) with crystal parameters a= 9.802A, b= 11.777A and c= 5.941A and unit cell volume V= 684.8 A 3 The unit cell volume of Ce 2 Co 3 Ge 5 is seen clearly to deviate from that expected on the basis of lanthanide contraction. From susceptibility measurement, effective magnetic moment of this compound μ eff = 0.95 μ B which is lower than magnetic moment free for Ce 3+ ions (2.54 μB) but higher than that of non-magnetic Ce 4+ state (0 μ B ). All these results clearly indicated Ce 2 Co 3 Ge 5 to be a mixed valance compound. (author)

  2. The new NCPSS BL19U2 beamline at the SSRF for small-angle X-ray scattering from biological macromolecules in solution.

    Science.gov (United States)

    Li, Na; Li, Xiuhong; Wang, Yuzhu; Liu, Guangfeng; Zhou, Ping; Wu, Hongjin; Hong, Chunxia; Bian, Fenggang; Zhang, Rongguang

    2016-10-01

    The beamline BL19U2 is located in the Shanghai Synchrotron Radiation Facility (SSRF) and is its first beamline dedicated to biological material small-angle X-ray scattering (BioSAXS). The electrons come from an undulator which can provide high brilliance for the BL19U2 end stations. A double flat silicon crystal (111) monochromator is used in BL19U2, with a tunable monochromatic photon energy ranging from 7 to 15 keV. To meet the rapidly growing demands of crystallographers, biochemists and structural biologists, the BioSAXS beamline allows manual and automatic sample loading/unloading. A Pilatus 1M detector (Dectris) is employed for data collection, characterized by a high dynamic range and a short readout time. The highly automated data processing pipeline SASFLOW was integrated into BL19U2, with help from the BioSAXS group of the European Molecular Biology Laboratory (EMBL, Hamburg), which provides a user-friendly interface for data processing. The BL19U2 beamline was officially opened to users in March 2015. To date, feedback from users has been positive and the number of experimental proposals at BL19U2 is increasing. A description of the new BioSAXS beamline and the setup characteristics is given, together with examples of data obtained.

  3. Equation of state of U2Mo up-to Mbar pressure range: Ab-initio study

    Science.gov (United States)

    Mukherjee, D.; Sahoo, B. D.; Joshi, K. D.; Kaushik, T. C.

    2018-04-01

    Experimentally, U2Mo is known to exist in tetragonal structure at ambient conditions. In contrast to experimental reports, the past theoretical studies carried out in this material do not find this phase to be stable structure at zero pressure. In order to examine this discrepancy between experiment and theory, we have performed ab-initio electronic band structure calculations on this material. In our theoretical study, we have attempted to search for lowest enthalpy structure at ambient as well at high pressure up to 200 GPa, employing evolutionary structure search algorithm in conjunction with ab-inito method. Our investigations suggest that a hexagonal structure with space group symmetry P6/mmm is the lowest enthalpy structure not only at ambient pressure but also up to pressure range of ˜200 GPa. To further, substantiate the results of these static lattice calculations the elastic and lattice dynamical stability has also been analysed. The theoretical isotherm derived from these calculations has been utilized to determine the Hugoniot of this material. Various physical properties such as zero pressure equilibrium volume, bulk modulus and its pressure derivative has also been derived from theoretical isotherm.

  4. The homeobox transcription factor HOXA9 is a regulator of SHOX in U2OS cells and chicken micromass cultures.

    Directory of Open Access Journals (Sweden)

    Claudia Durand

    Full Text Available The homeobox gene SHOX encodes for a transcription factor that plays an important role during limb development. Mutations or deletions of SHOX in humans cause short stature in Turner, Langer and Leri-Weill syndrome as well as idiopathic short stature. During embryonic development, SHOX is expressed in a complex spatio-temporal pattern that requires the presence of specific regulatory mechanisms. Up to now, it was known that SHOX is regulated by two upstream promoters and several enhancers on either side of the gene, but no regulators have been identified that can activate or repress the transcription of SHOX by binding to these regulatory elements. We have now identified the homeodomain protein HOXA9 as a positive regulator of SHOX expression in U2OS cells. Using luciferase assays, chromatin immunoprecipitation and electrophoretic mobility shift assays, we could narrow down the HOXA9 binding site to two AT-rich sequences of 31 bp within the SHOX promoter 2. Virus-induced Hoxa9 overexpression in a chicken micromass model validated the regulation of Shox by Hoxa9 (negative regulation. As Hoxa9 and Shox are both expressed in overlapping regions of the developing limb buds, a regulatory relationship of Hoxa9 and Shox during the process of limb development can be assumed.

  5. Alteration of the SETBP1 gene and splicing pathway genes SF3B1, U2AF1, and SRSF2 in childhood acute myeloid leukemia.

    Science.gov (United States)

    Choi, Hyun-Woo; Kim, Hye-Ran; Baek, Hee-Jo; Kook, Hoon; Cho, Duck; Shin, Jong-Hee; Suh, Soon-Pal; Ryang, Dong-Wook; Shin, Myung-Geun

    2015-01-01

    Recurrent somatic SET-binding protein 1 (SETBP1) and splicing pathway gene mutations have recently been found in atypical chronic myeloid leukemia and other hematologic malignancies. These mutations have been comprehensively analyzed in adult AML, but not in childhood AML. We investigated possible alteration of the SETBP1, splicing factor 3B subunit 1 (SF3B1), U2 small nuclear RNA auxiliary factor 1 (U2AF1), and serine/arginine-rich splicing factor 2 (SRSF2) genes in childhood AML. Cytogenetic and molecular analyses were performed to reveal chromosomal and genetic alterations. Sequence alterations in the SETBP1, SF3B1, U2AF1, and SRSF2 genes were examined by using direct sequencing in a cohort of 53 childhood AML patients. Childhood AML patients did not harbor any recurrent SETBP1 gene mutations, although our study did identify a synonymous mutation in one patient. None of the previously reported aberrations in the mutational hotspot of SF3B1, U2AF1, and SRSF2 were identified in any of the 53 patients. Alterations of the SETBP1 gene or SF3B1, U2AF1, and SRSF2 genes are not common genetic events in childhood AML, implying that the mutations are unlikely to exert a driver effect in myeloid leukemogenesis during childhood.

  6. Evidence that C9ORF72 Dipeptide Repeat Proteins Associate with U2 snRNP to Cause Mis-splicing in ALS/FTD Patients.

    Science.gov (United States)

    Yin, Shanye; Lopez-Gonzalez, Rodrigo; Kunz, Ryan C; Gangopadhyay, Jaya; Borufka, Carl; Gygi, Steven P; Gao, Fen-Biao; Reed, Robin

    2017-06-13

    Hexanucleotide repeat expansion in the C9ORF72 gene results in production of dipeptide repeat (DPR) proteins that may disrupt pre-mRNA splicing in amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD) patients. At present, the mechanisms underlying this mis-splicing are not understood. Here, we show that addition of proline-arginine (PR) and glycine-arginine (GR) toxic DPR peptides to nuclear extracts blocks spliceosome assembly and splicing, but not other types of RNA processing. Proteomic and biochemical analyses identified the U2 small nuclear ribonucleoprotein particle (snRNP) as a major interactor of PR and GR peptides. In addition, U2 snRNP, but not other splicing factors, mislocalizes from the nucleus to the cytoplasm both in C9ORF72 patient induced pluripotent stem cell (iPSC)-derived motor neurons and in HeLa cells treated with the toxic peptides. Bioinformatic studies support a specific role for U2-snRNP-dependent mis-splicing in C9ORF72 patient brains. Together, our data indicate that DPR-mediated dysfunction of U2 snRNP could account for as much as ∼44% of the mis-spliced cassette exons in C9ORF72 patient brains. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.

  7. Evidence that C9ORF72 Dipeptide Repeat Proteins Associate with U2 snRNP to Cause Mis-splicing in ALS/FTD Patients

    Directory of Open Access Journals (Sweden)

    Shanye Yin

    2017-06-01

    Full Text Available Hexanucleotide repeat expansion in the C9ORF72 gene results in production of dipeptide repeat (DPR proteins that may disrupt pre-mRNA splicing in amyotrophic lateral sclerosis (ALS and frontotemporal dementia (FTD patients. At present, the mechanisms underlying this mis-splicing are not understood. Here, we show that addition of proline-arginine (PR and glycine-arginine (GR toxic DPR peptides to nuclear extracts blocks spliceosome assembly and splicing, but not other types of RNA processing. Proteomic and biochemical analyses identified the U2 small nuclear ribonucleoprotein particle (snRNP as a major interactor of PR and GR peptides. In addition, U2 snRNP, but not other splicing factors, mislocalizes from the nucleus to the cytoplasm both in C9ORF72 patient induced pluripotent stem cell (iPSC-derived motor neurons and in HeLa cells treated with the toxic peptides. Bioinformatic studies support a specific role for U2-snRNP-dependent mis-splicing in C9ORF72 patient brains. Together, our data indicate that DPR-mediated dysfunction of U2 snRNP could account for as much as ∼44% of the mis-spliced cassette exons in C9ORF72 patient brains.

  8. The Influence of Poly Vinil Alcohol Amount and Temperatures of the SolProcess on the Formation of (NH4)2U2O7 Gel

    International Nuclear Information System (INIS)

    Indra-Suryawan; Bangun-Wasito; Damunir; Hidayati; Setyo-Sulardi; Bambang-Siswanto; Ari-Handayani

    2000-01-01

    Research on the influence of poly vinil alcohol and temperatures on theresulted sol solutions. The sols were fed into gelation process using ammoniamedium and resulted were (NH 4 ) 2 U 2 O 7 gels spherical. The PVA variablesaddition on the sol process were 10; 15; 20; 25 and 30 g/1l uranyl nitrates.The temperature variables on the sol process were 75, 80, 85, 90 and 95 o C.The sol which successfully resulted (NH 4 ) 2 U 2 O 7 gel the gelation processwas on the PVA amount of 15 g and 90 o C. The resulted gel was then washed,dried and calcinate. The characterization of shape and surface of gel havebeen carried out using SEM photography. The density of gels were measured.For the 15 g PVA addition, the density was 8.3710 g/ml. While for process at90 o C, the density was 7.8871 g/ml. (author)

  9. Monte Carlo analysis of the SU(2)xU(1) and U(2) lattice gauge theories at different space-time dimensionalities

    International Nuclear Information System (INIS)

    Baig, M.; Colet, J.

    1986-01-01

    Using Monte Carlo simulations the SU(2)xU(1) lattice gauge theory has been analyzed, which is equivalent for the Wilson action to a U(2) theory, at space-time dimensionalities from d=3 to 5. It has been shown that there exist first-order phase transitions for both d=4 and d=5. A monopole-condensation mechanism seems to be responsible for these phase transitions. At d=3 no phase transitions have been detected. (orig.)

  10. Hyperpolarized [U-(2) H, U-(13) C]Glucose reports on glycolytic and pentose phosphate pathway activity in EL4 tumors and glycolytic activity in yeast cells.

    Science.gov (United States)

    Timm, Kerstin N; Hartl, Johannes; Keller, Markus A; Hu, De-En; Kettunen, Mikko I; Rodrigues, Tiago B; Ralser, Markus; Brindle, Kevin M

    2015-12-01

    A resonance at ∼181 ppm in the (13) C spectra of tumors injected with hyperpolarized [U-(2) H, U-(13) C]glucose was assigned to 6-phosphogluconate (6PG), as in previous studies in yeast, whereas in breast cancer cells in vitro this resonance was assigned to 3-phosphoglycerate (3PG). These peak assignments were investigated here using measurements of 6PG and 3PG (13) C-labeling using liquid chromatography tandem mass spectrometry (LC-MS/MS) METHODS: Tumor-bearing mice were injected with (13) C6 glucose and the (13) C-labeled and total 6PG and 3PG concentrations measured. (13) C MR spectra of glucose-6-phosphate dehydrogenase deficient (zwf1Δ) and wild-type yeast were acquired following addition of hyperpolarized [U-(2) H, U-(13) C]glucose and again (13) C-labeled and total 6PG and 3PG were measured by LC-MS/MS RESULTS: Tumor (13) C-6PG was more abundant than (13) C-2PG/3PG and the resonance at ∼181 ppm matched more closely that of 6PG. (13) C MR spectra of wild-type and zwf1Δ yeast cells showed a resonance at ∼181 ppm after labeling with hyperpolarized [U-(2) H, U-(13) C]glucose, however, there was no 6PG in zwf1Δ cells. In the wild-type cells 3PG was approximately four-fold more abundant than 6PG CONCLUSION: The resonance at ∼181 ppm in (13) C MR spectra following injection of hyperpolarized [U-(2) H, U-(13) C]glucose originates predominantly from 6PG in EL4 tumors and 3PG in yeast cells. © 2014 Wiley Periodicals, Inc.

  11. Human regulator of telomere elongation helicase 1 (RTEL1) is required for the nuclear and cytoplasmic trafficking of pre-U2 RNA.

    Science.gov (United States)

    Schertzer, Michael; Jouravleva, Karina; Perderiset, Mylene; Dingli, Florent; Loew, Damarys; Le Guen, Tangui; Bardoni, Barbara; de Villartay, Jean-Pierre; Revy, Patrick; Londoño-Vallejo, Arturo

    2015-02-18

    Hoyeraal-Hreidarsson syndrome (HHS) is a severe form of Dyskeratosis congenita characterized by developmental defects, bone marrow failure and immunodeficiency and has been associated with telomere dysfunction. Recently, mutations in Regulator of Telomere ELongation helicase 1 (RTEL1), a helicase first identified in Mus musculus as being responsible for the maintenance of long telomeres, have been identified in several HHS patients. Here we show that RTEL1 is required for the export and the correct cytoplasmic trafficking of the small nuclear (sn) RNA pre-U2, a component of the major spliceosome complex. RTEL1-HHS cells show abnormal subcellular partitioning of pre-U2, defects in the recycling of ribonucleotide proteins (RNP) in the cytoplasm and splicing defects. While most of these phenotypes can be suppressed by re-expressing the wild-type protein in RTEL1-HHS cells, expression of RTEL1 mutated variants in immortalized cells provokes cytoplasmic mislocalizations of pre-U2 and other RNP components, as well as splicing defects, thus phenocopying RTEL1-HHS cellular defects. Strikingly, expression of a cytoplasmic form of RTEL1 is sufficient to correct RNP mislocalizations both in RTEL1-HHS cells and in cells expressing nuclear mutated forms of RTEL1. This work unravels completely unanticipated roles for RTEL1 in RNP trafficking and strongly suggests that defects in RNP biogenesis pathways contribute to the pathology of HHS. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

  12. ‘New Ways to Frame the Mammoth Horror’: Media First Responders and the Katrina Event

    Directory of Open Access Journals (Sweden)

    Sara Knox

    2011-04-01

    Full Text Available This article explores the state of emergency following Hurrican Katrina or ‘the Katrina Event’ with reference to the role of media first responders. Throughout the ensuing disaster the performance of the media (including celebrity advocates like Oprah Winfrey, Geraldo Rivera and Kanye West worked as a mechanism for technical remastery in the face of systemic breakdown. This re-mediation of panic and of the state of emergency shifted attention from the local (that is, from the acts of witness by Katrina’s victims to national reactions (as figured by advocates of the cause of the neglected poor of New Orleans. In this way even as voice was given to the failure of the nation to rise to the needs of its most vulnerable citizens, the figure of the nation as carer was re-instantiated in the televised outrage and frustration of talk show hosts, news anchors, and charity fund-raising celebrities.

  13. Self-reference enhances relational memory in young and older adults.

    Science.gov (United States)

    Hou, Mingzhu; Grilli, Matthew D; Glisky, Elizabeth L

    2017-11-27

    The present study investigated the influence of self-reference on two kinds of relational memory, internal source memory and associative memory, in young and older adults. Participants encoded object-location word pairs using the strategies of imagination and sentence generation, either with reference to themselves or to a famous other (i.e., George Clooney or Oprah Winfrey). Both young and older adults showed memory benefits in the self-reference conditions compared to other-reference conditions on both tests, and the self-referential effects in older adults were not limited by low memory or executive functioning. These results suggest that self-reference can benefit relational memory in older adults relatively independently of basic memory and executive functions.

  14. Shifting the balance: the contemporary narrative of obesity.

    Science.gov (United States)

    Shugart, Helene A

    2011-01-01

    In this essay, I assess the narrative of obesity as articulated in representative contemporary mainstream media fare--namely, The Oprah Winfrey Show, The Biggest Loser, and Big Medicine. I contend that the emergent narrative of obesity across these programs signals a shift from the historically received narrative in light of its intersection with the concurrent culturally resonant narratives of addiction and self-actualization. In particular, the proposed "problem" and "solution" to obesity, both historically attributed to personal responsibility, appear to be shifting in favor of cultural explanations that describe obesity as symptomatic of and secondary to broader issues related to community, emotionality, and agency. This suggests novel cultural understandings, practices, and policies regarding the mounting "obesity epidemic."

  15. THE WRITTEN DISCOURSE OF INTERVIEWING STYLE FOR A MAGAZINE INTERVIEW

    Directory of Open Access Journals (Sweden)

    Jessie Barrot

    2012-07-01

    Full Text Available Abstract: This paper examines the written discourse of interviewing style for the purpose of print publication. Specifically, this paper sought to describe and explain the phases of interviewing procedures, the typology of the questions, and the transitional strategies executed by Oprah Winfrey during her interviews for O Magazine. One hundred and ten (110 response-soliciting statements were subjected to discourse analytic procedure to determine the features of such utterances. The results showed that her interview procedure follows a certain pattern that contributes to her ability to maintain the intimacy, familiarity, and dynamics of conversation. Further, results revealed that the interviewer employs a variety of response-soliciting strategies and transitional strategies that unconsciously put the control and authority in the conversation to the interviewees. Finally, some pedagogical implications were also presented for classroom use. Keywords: discourse analysis, interviewing style, interview questions, written discourse

  16. The illusion of fame: how the nonfamous become famous.

    Science.gov (United States)

    Landau, Joshua D; Leed, Stacey A

    2012-01-01

    This article reports 2 experiments in which nonfamous faces were paired with famous (e.g., Oprah Winfrey) or semifamous (e.g., Annika Sorenstam) faces during an initial orienting task. In Experiment 1, the orienting task directed participants to consider the relationship between the paired faces. In Experiment 2, participants considered distinctive qualities of the paired faces. Participants then judged the fame level of old and new nonfamous faces, semifamous faces, and famous faces. Pairing a nonfamous face with a famous face resulted in a higher fame rating than pairing a nonfamous face with a semifamous face. The fame attached to the famous people was misattributed to their nonfamous partners. We discuss this pattern of results in the context of current theoretical explanations of familiarity misattributions.

  17. Concerted evolution of the tandemly repeated genes encoding primate U2 small nuclear RNA (the RNU2 locus) does not prevent rapid diversification of the (CT){sub n} {center_dot} (GA){sub n} microsatellite embedded within the U2 repeat unit

    Energy Technology Data Exchange (ETDEWEB)

    Liao, D.; Weiner, A.M. [Yale Univ., New Haven, CT (United States)

    1995-12-10

    The RNU2 locus encoding human U2 small nuclear RNA (snRNA) is organized as a nearly perfect tandem array containing 5 to 22 copies of a 5.8-kb repeat unit. Just downstream of the U2 snRNA gene in each 5.8-kb repeat unit lies a large (CT){sub n}{center_dot}(GA){sub n} dinucleotide repeat (n {approx} 70). This form of genomic organization, in which one repeat is embedded within another, provides an unusual opportunity to study the balance of forces maintaining the homogeneity of both kinds of repeats. Using a combination of field inversion gel electrophoresis and polymerase chain reaction, we have been able to study the CT microsatellites within individual U2 tandem arrays. We find that the CT microsatellites within an RNU2 allele exhibit significant length polymorphism, despite the remarkable homogeneity of the surrounding U2 repeat units. Length polymorphism is due primarily to loss or gain of CT dinucleotide repeats, but other types of deletions, insertions, and substitutions are also frequent. Polymorphism is greatly reduced in regions where pure (CT){sub n} tracts are interrupted by occasional G residues, suggesting that irregularities stabilize both the length and the sequence of the dinucleotide repeat. We further show that the RNU2 loci of other catarrhine primates (gorilla, chimpanzee, ogangutan, and baboon) contain orthologous CT microsatellites; these also exhibit length polymorphism, but are highly divergent from each other. Thus, although the CT microsatellite is evolving far more rapidly than the rest of the U2 repeat unit, it has persisted through multiple speciation events spanning >35 Myr. The persistence of the CT microsatellite, despite polymorphism and rapid evolution, suggests that it might play a functional role in concerted evolution of the RNU2 loci, perhaps as an initiation site for recombination and/or gene conversion. 70 refs., 5 figs.

  18. Dihydroptychantol A, a macrocyclic bisbibenzyl derivative, induces autophagy and following apoptosis associated with p53 pathway in human osteosarcoma U2OS cells

    International Nuclear Information System (INIS)

    Li Xia; Wu, William K.K.; Sun Bin; Cui Min; Liu Shanshan; Gao Jian; Lou Hongxiang

    2011-01-01

    Dihydroptychantol A (DHA), a novel macrocyclic bisbibenzyl compound extracted from liverwort Asterella angusta, has antifungal and multi-drug resistance reversal properties. Here, the chemically synthesized DHA was employed to test its anti-cancer activities in human osteosarcoma U2OS cells. Our results demonstrated that DHA induced autophagy followed by apoptotic cell death accompanied with G 2 /M-phase cell cycle arrest in U2OS cells. DHA-induced autophagy was morphologically characterized by the formation of double membrane-bound autophagic vacuoles recognizable at the ultrastructural level. DHA also increased the levels of LC3-II, a marker of autophagy. Surprisingly, DHA-mediated apoptotic cell death was potentiated by the autophagy inhibitor 3-methyladenine, suggesting that autophagy may play a protective role that impedes the eventual cell death. Furthermore, p53 was shown to be involved in DHA-meditated autophagy and apoptosis. In this connection, DHA increased nuclear expression of p53, induced p53 phosphorylation, and upregulated p53 target gene p21 Waf1/Cip1 . In contrast, cytoplasmic p53 was reduced by DHA, which contributed to the stimulation of autophagy. In relation to the cell cycle, DHA decreased the expression of cyclin B 1 , a cyclin required for progression through the G 2 /M phase. Taken together, DHA induces G 2 /M-phase cell cycle arrest and apoptosis in U2OS cells. DHA-induced apoptosis was preceded by the induction of protective autophagy. DHA-mediated autophagy and apoptosis are associated with the cytoplasmic and nuclear functions of p53.

  19. Induction of polyploidy by nuclear fusion mechanism upon decreased expression of the nuclear envelope protein LAP2β in the human osteosarcoma cell line U2OS.

    Science.gov (United States)

    Ben-Shoshan, Shirley Oren; Simon, Amos J; Jacob-Hirsch, Jasmine; Shaklai, Sigal; Paz-Yaacov, Nurit; Amariglio, Ninette; Rechavi, Gideon; Trakhtenbrot, Luba

    2014-01-28

    Polyploidy has been recognized for many years as an important hallmark of cancer cells. Polyploid cells can arise through cell fusion, endoreplication and abortive cell cycle. The inner nuclear membrane protein LAP2β plays key roles in nuclear envelope breakdown and reassembly during mitosis, initiation of replication and transcriptional repression. Here we studied the function of LAP2β in the maintenance of cell ploidy state, a role which has not yet been assigned to this protein. By knocking down the expression of LAP2β, using both viral and non-viral RNAi approaches in osteosarcoma derived U2OS cells, we detected enlarged nuclear size, nearly doubling of DNA content and chromosomal duplications, as analyzed by fluorescent in situ hybridization and spectral karyotyping methodologies. Spectral karyotyping analyses revealed that near-hexaploid karyotypes of LAP2β knocked down cells consisted of not only seven duplicated chromosomal markers, as could be anticipated by genome duplication mechanism, but also of four single chromosomal markers. Furthermore, spectral karyotyping analysis revealed that both of two near-triploid U2OS sub-clones contained the seven markers that were duplicated in LAP2β knocked down cells, whereas the four single chromosomal markers were detected only in one of them. Gene expression profiling of LAP2β knocked down cells revealed that up to a third of the genes exhibiting significant changes in their expression are involved in cancer progression. Our results suggest that nuclear fusion mechanism underlies the polyploidization induction upon LAP2β reduced expression. Our study implies on a novel role of LAP2β in the maintenance of cell ploidy status. LAP2β depleted U2OS cells can serve as a model to investigate polyploidy and aneuploidy formation by nuclear fusion mechanism and its involvement in cancerogenesis.

  20. Development of a numerical code for the analysis of the linear stability of the U1 and U2 reactors of the CNLV

    International Nuclear Information System (INIS)

    Espinosa P, G.; Estrada P, C.E.; Nunez C, A.; Amador G, R.

    2001-01-01

    The computer code ANESLI-1 developed by the CNSNS and UAM-I, has the main goal of making stability analysis of nuclear reactors of the BWR type, more specifically, the reactors of the U1 and U2 of the CNLV. However it can be used for another kind of applications. Its capacity of real time simulator, allows the prediction of operational transients, and conditions of dynamic steady states. ANESLI-1 was developed under a modular scheme, which allows to extend or/and to improve its scope. The lineal stability analysis predicts the instabilities produced by the wave density phenomenon. (Author)

  1. Magnetic hyperfine interactions of U2 center in CaF2, SrF2 and BaF2

    International Nuclear Information System (INIS)

    Graf, C.J.F.

    1976-02-01

    The magnetic hyperfine parameters of the U 2 center in CaF 2 , SeF 2 and BaF 2 , using a molecular orbitals scheme have been calculated. The need for the inclusion of mechanisms such as Pauli Repulsion and Covalence in order to describe the electronic structure of the defect has been shown. In the molecular orbitals model a weak covalence parameter has been phenomenologically introduced, mixing the is atomic wavefunction of hydrogen with a properly symmetrized linear combination of 2p F - functions centered on the ions of the first fluorine shell. The results obtained are compared with experimental measurements of EPR and ENDOR. (Author) [pt

  2. Electronic structure of crystalline uranium nitrides UN, U2N3 and UN2: LCAO calculations with the basis set optimization

    International Nuclear Information System (INIS)

    Evarestov, R A; Panin, A I; Bandura, A V; Losev, M V

    2008-01-01

    The results of LCAO DFT calculations of lattice parameters, cohesive energy and bulk modulus of the crystalline uranium nitrides UN, U 2 N 3 and UN 2 are presented and discussed. The LCAO computer codes Gaussian03 and Crystal06 are applied. The calculations are made with the uranium atom relativistic effective small core potential by Stuttgart-Cologne group (60 electrons in the core). The calculations include the U atom basis set optimization. Powell, Hooke-Jeeves, conjugated gradient and Box methods are implemented in the author's optimization package, being external to the codes for molecular and periodic calculations. The basis set optimization in LCAO calculations improves the agreement of the lattice parameter and bulk modulus of UN crystal with the experimental data, the change of the cohesive energy due to the optimization is small. The mixed metallic-covalent chemical bonding is found both in LCAO calculations of UN and U 2 N 3 crystals; UN 2 crystal has the semiconducting nature

  3. The U2 snDNA Is a Useful Marker for B Chromosome Detection and Frequency Estimation in the Grasshopper Abracris flavolineata.

    Science.gov (United States)

    Milani, Diogo; Palacios-Gimenez, Octavio M; Cabral-de-Mello, Diogo C

    2017-01-01

    In this study, we describe a strategy to determine the presence of B chromosomes in the living grasshopper Abracris flavolineata by FISH using U2 snDNA as a probe in interphase hemolymph nuclei. In individuals without B chromosomes, (0B) 2 dot signals were noticed, corresponding to A complement U2 snDNA clusters. In +1B and +2B individuals, 4 or 8 additional signals were noticed, respectively. In all cases, the absence or presence of 1 or 2 B chromosomes correlated in hemolymph and in somatic or germline tissues, validating the efficiency of the marker. Our data suggest that the B chromosome of A. flavolineata is present in all somatic tissues. B-carrying individuals showed the same number of B chromosomes in germ and somatic cells, suggesting that the B is mitotically stable. The marker was used to compare B chromosome frequency in the analyzed population with a sample collected previously, in order to test for B frequency changes and differences of B chromosome prevalence among sexes, but no statistically significant differences were noticed. The identification of living animals harboring B chromosomes will be very useful in future studies of B chromosome transmission, as well as in functional studies involving RNA analysis, thus contributing to the understanding of evolutionary history and the possible role of the B chromosome in A. flavolineata. © 2017 S. Karger AG, Basel.

  4. Dosage of the Abcg1-U2af1 region modifies locomotor and cognitive deficits observed in the Tc1 mouse model of Down syndrome.

    Directory of Open Access Journals (Sweden)

    Damien Marechal

    Full Text Available Down syndrome (DS results from one extra copy of human chromosome 21 and leads to several alterations including intellectual disabilities and locomotor defects. The transchromosomic Tc1 mouse model carrying an extra freely-segregating copy of human chromosome 21 was developed to better characterize the relation between genotype and phenotype in DS. The Tc1 mouse exhibits several locomotor and cognitive deficits related to DS. In this report we analyzed the contribution of the genetic dosage of 13 conserved mouse genes located between Abcg1 and U2af1, in the telomeric part of Hsa21. We used the Ms2Yah model carrying a deletion of the corresponding interval in the mouse genome to rescue gene dosage in the Tc1/Ms2Yah compound mice to determine how the different behavioral phenotypes are affected. We detected subtle changes with the Tc1/Ms2Yah mice performing better than the Tc1 individuals in the reversal paradigm of the Morris water maze. We also found that Tc1/Ms2Yah compound mutants performed better in the rotarod than the Tc1 mice. This data support the impact of genes from the Abcg1-U2af1 region as modifiers of Tc1-dependent memory and locomotor phenotypes. Our results emphasize the complex interactions between triplicated genes inducing DS features.

  5. Fisetin, a dietary flavonoid induces apoptosis via modulating the MAPK and PI3K/Akt signalling pathways in human osteosarcoma (U-2 OS cells

    Directory of Open Access Journals (Sweden)

    Jian-Ming Li

    2015-12-01

    Full Text Available Human osteosarcoma is the most prevalent primary malignant bone tumor with high frequency of invasion and metastasis. Strong resistance coupled with toxicity of the currently available chemotherapeutic drugs poses challenge in treatment. The study aimed to investigate if fisetin, a dietary flavonoid induced apoptosis in human osteosarcoma (U-2 OS cells. Fisetin at 20-100 µM effectively reduced the viability of OS cells, and induced apoptosis by significantly inducing the expression of caspases (Caspases- 3,-8 and -9 and pro-apoptotic proteins (Bax and Bad with subsequent down-regulation of Bcl-xL and Bcl-2. While fisetin inhibited PI3K/Akt pathway and ERK1/2, it caused enhanced expressions of p-JNK, p-c-Jun and p-p38. Fisetin-induced ROS generation and decrease in mitochondrial membrane potential would have also contributed to rise in apoptotic cell counts. The observations suggest that fisetin was able to effectively induce apoptosis of U-2 OS cells through ROS generation and modulation of MAPK and PI3K/Akt signalling cascades.

  6. tavgU_2d_flx_Nx: MERRA 2D IAU Diagnostic, Surface Fluxes, Diurnal 0.667 x 0.5 degree V5.2.0 (MATUNXFLX) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The MATUNXFLX or tavgU_2d_flx_Nx data product is the MERRA Data Assimilation System 2-Dimensional surface turbulence flux diagnostic that is time averaged...

  7. Low-temperature structural transition in the quasi-one-dimensional spin-1/2 compound L i2C u2O (SO4) 2

    Science.gov (United States)

    Rousse, G.; Rodríguez-Carvajal, J.; Giacobbe, C.; Sun, M.; Vaccarelli, O.; Radtke, G.

    2017-04-01

    A thorough structural exploration has been made on the quasi-one-dimensional S =1 /2 compound L i2C u2O (SO4) 2 by neutron and synchrotron x-ray diffraction. It reveals the occurrence of a structural transition at 125 K, characterized by a lowering of symmetry from P 42/m to P 1 ¯ , which is possibly driven by an exchange striction mechanism. This transition involves a dimerization of some Cu in the edge-sharing tetrahedral Cu chains. A symmetry mode analysis indicates that one representation, Γ3+Γ4+ , dominates the structural transition. Interestingly, no intermediate structure with P 112 /m symmetry is observed experimentally. Lastly, temperature dependent magnetic susceptibility measurements and neutron diffraction reveal that the magnetic ground state of this compound is a spin-singlet with a spin gap, characterized by the absence of long-range magnetic order down to 1.7 K.

  8. Thermal compatibility of U-2wt.%Mo and U-10wt.%Mo fuel prepared by centrifugal atomization for high density research reactor fuels

    International Nuclear Information System (INIS)

    Kim Ki Hwan; Lee Don Bae; Kim Chang Kyu; Kuk Il Hyun; Hofman, G.E.

    1997-01-01

    Research on the intermetallic compounds of uranium was revived in 1978 with the decision by the international research reactor community to develop proliferation-resistant fuels. The reduction of 93% 235 U (HEU) to 20% 235 U (LEU) necessitates the use of higher U-loading fuels to accommodate the addition 238 U in the LEU fuels. While the vast majority of reactors can be satisfied with U 3 Si 2 -Al dispersion fuel, several high performance reactors require high loadings of up to 8-9 g U cm -3 . Consequently, in the renewed fuel development program of the Reduced Enrichment for Research and Test Reactors (RERTR) Program, attention has shifted to high density uranium alloys. Early irradiation experiments with uranium alloys showed promise of acceptable irradiation behavior, if these alloys can be maintained in their cubic γ-U crystal structure. It has been reported that high density atomized U-Mo powders prepared by rapid cooling have metastable isotropic γ-U phase saturated with molybdenum, and good γ-U phase stability, especially in U-10wt.%Mo alloy fuel. If the alloy has good thermal compatibility with aluminium, and this metastable gamma phase can be maintained during irradiation, U-Mo alloy would be a prime candidate for dispersion fuel for research reactors. In this paper, U-2w.%Mo and U-10w.%Mo alloy powder which have high density (above 15 g-U/cm 3 ), are prepared by centrifugal atomization. The U-Mo alloy fuel meats are made into rods extruding the atomized powders. The characteristics related to the thermal compatibility of U-2w.%Mo and U-10w.%Mo alloy fuel meat at 400 o C for time up to 2000 hours are examined. (author)

  9. Development and characterization of monolithic fuel miniplate alloy U-2.5Zr-7.5Nb, coated in zircaloy; Desenvolvimento e caracterizacao do combustivel nuclear tipo placa monolitico da liga U-2,5Zr-7,5Nb revestido em zircaloy

    Energy Technology Data Exchange (ETDEWEB)

    Machado, Geraldo Correa

    2014-06-01

    The autocthonal production of nuclear fuel in Brazil for test and research reactors is restricted to MTR (Material Test Reactor) fuel type dispersion plate, using U3Si2 alloy, coated and dispersed in aluminum, developed by IPEN-SP for use in IEA-R1 reactor. Moreover, the UO{sub 2} fuel rod type for power reactors is manufactured by Rezende (RJ) with a German technology by INB under license. Currently, Brazil is performing two programs of developing reactors. Currently, Brazil is developing two reactors. One of them is the development, by CNEN, the Brazilian Multipurpose Reactor (RMB), for testing, research and radioisotope production. The other one is the development a power reactor for naval propulsion, conducted by the Brazilian Navy. This dissertation presents the development and characterization of monolithic fuel miniplate alloy U-2.5Zr-7.5Nb, coated in zircaloy (ZRY), on a laboratory scale. Due to its innovative features and properties, this fuel can be used as fuel in both test reactors, research and producing radioisotopes for power reactors as small and medium sizes. Thus, this high potential fuel can be used in domestic reactors currently under development. The development of monolithic fuel plate type is made using the technique called 'picture-frame' where a sandwich composed of a monolith alloy U-2.5Zr- 7.5Nb coupled to a frame and coated sheets of Zry is obtained. The alloy U-2.5Zr-7.5Nb was obtained by melting in an induction furnace and then was cast into rectangular ingots of graphite, thus achieving an ingot with approximate dimensions of 170 x 50 x 60 mm. The obtained ingot was hot rolled at 850 ºC, with a 50 % reduction in thickness, in order to refine the raw structure of fusion. Samples cut from the alloy U-2.5Zr-7.5Nb, with dimensions 20 x 20 x 6 mm were placed in frames and plates Zry and joined by TIG (Tungsten Inert Gas) under an atmosphere of argon, obtaining a set of 10 mm thick, 45 mm wide and 100 mm long. The sandwiches were

  10. Impaired STING Pathway in Human Osteosarcoma U2OS Cells Contributes to the Growth of ICP0-Null Mutant Herpes Simplex Virus.

    Science.gov (United States)

    Deschamps, Thibaut; Kalamvoki, Maria

    2017-05-01

    Human herpes simplex virus 1 (HSV-1) is a widespread pathogen, with 80% of the population being latently infected. To successfully evade the host, the virus has evolved strategies to counteract antiviral responses, including the gene-silencing and innate immunity machineries. The immediately early protein of the virus, infected cell protein 0 (ICP0), plays a central role in these processes. ICP0 blocks innate immunity, and one mechanism is by degrading hostile factors with its intrinsic E3 ligase activity. ICP0 also functions as a promiscuous transactivator, and it blocks repressor complexes to enable viral gene transcription. For these reasons, the growth of a ΔICP0 virus is impaired in most cells, except cells of the human osteosarcoma cell line U2OS, and it is only partially impaired in cells of the human osteosarcoma cell line Saos-2. We found that the two human osteosarcoma cell lines that supported the growth of the ΔICP0 virus failed to activate innate immune responses upon treatment with 2'3'-cyclic GAMP (2'3'-cGAMP), the natural agonist of STING (i.e., stimulator of interferon genes) or after infection with the ΔICP0 mutant virus. Innate immune responses were restored in these cells by transient expression of the STING protein but not after overexpression of interferon-inducible protein 16 (IFI16). Restoration of STING expression resulted in suppression of ΔICP0 virus gene expression and a decrease in viral yields. Overexpression of IFI16 also suppressed ΔICP0 virus gene expression, albeit to a lesser extent than STING. These data suggest that the susceptibility of U2OS and Saos-2 cells to the ΔICP0 HSV-1 is in part due to an impaired STING pathway. IMPORTANCE The DNA sensor STING plays pivotal role in controlling HSV-1 infection both in cell culture and in mice. The HSV-1 genome encodes numerous proteins that are dedicated to combat host antiviral responses. The immediate early protein of the virus ICP0 plays major role in this process as it targets

  11. Development of a numerical code for the analysis of the linear stability of the U1 and U2 reactors of the CNLV; Desarrollo de un codigo numerico para el analisis de estabilidad lineal de los reactores de las U1 y U2 de la CNLV

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa P, G.; Estrada P, C.E. [Universidad Autonoma Metropolitana-Iztapalapa, 09000 Mexico D.F. (Mexico); Nunez C, A.; Amador G, R. [Comision Nacional de Seguridad Nuclear y Salvaguardias, Mexico D.F. (Mexico)

    2001-07-01

    The computer code ANESLI-1 developed by the CNSNS and UAM-I, has the main goal of making stability analysis of nuclear reactors of the BWR type, more specifically, the reactors of the U1 and U2 of the CNLV. However it can be used for another kind of applications. Its capacity of real time simulator, allows the prediction of operational transients, and conditions of dynamic steady states. ANESLI-1 was developed under a modular scheme, which allows to extend or/and to improve its scope. The lineal stability analysis predicts the instabilities produced by the wave density phenomenon. (Author)

  12. Investigation of phase transformations of U2.5Zr7.5Nb and U3Zr9Nb alloys aging at 600 deg C

    International Nuclear Information System (INIS)

    Cantagalli, Natalia Mattar; Tanure, Leandro Paulo de Almeida Reis; Braga, Daniel Martins; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa

    2009-01-01

    Investigation has been made of the effects of high-temperature aging (600 deg C) on the phase transformations in the U2.5Zr7.5Nb and U3Zr9Nb alloys. These alloys have been produced with vacuum induction melting (VIM) furnace in cast ingots. The ingots were homogenized at 1000 deg C for 24 hours in vacuum of -4 torr, and cooled to room temperature at a rate of 3 deg C/min. Specimens from these homogeneous materials, cut in 3 mm high and 10 mm diameter, were reheated to γ phase at 850 deg C, for 1 hour, and aging at 600 deg C at different times from 0.5 to 24 hours. The phases decomposition were characterized by X-ray diffraction (XRD), metallographic, micro-probe analyze by energy dispersive spectrometry (EDS) and microhardness methods. It was verified that the decomposition of the δ phase proceeds in two steps. The first is a discontinuous precipitation of a lamellar two-phase aggregate composed of alpha solid solution and a metastable gamma phase. The metastable gamma phase has a constant composition at given temperature. After longer annealing, it decomposes eutectoidally into the equilibrium (α + δ 2 ) phases mixture. During this process a modification of the original lamellar microstructure takes place. The obtained metastable phases of these alloys of different compositions were analyzed in relation to their constitution, heat treatability and micrographic features and the results confronted with available distinct uranium alloys data from literature. (author)

  13. Analysis of U2 small nuclear RNA fragments in the bile differentiates cholangiocarcinoma from primary sclerosing cholangitis and other benign biliary disorders.

    Science.gov (United States)

    Baraniskin, Alexander; Nöpel-Dünnebacke, Stefanie; Schumacher, Brigitte; Gerges, Christian; Bracht, Thilo; Sitek, Barbara; Meyer, Helmut E; Gerken, Guido; Dechene, Alexander; Schlaak, Jörg F; Schroers, Roland; Pox, Christian; Schmiegel, Wolff; Hahn, Stephan A

    2014-07-01

    Up to now the diagnosis of early stage cholangiocarcinoma (CC) has remained difficult, with low sensitivities reported for current diagnostic methods. Based on recent promising findings about circulating U2 small nuclear RNA fragments (RNU2-1f) as novel blood-based biomarkers for pancreatic and colorectal adenocarcinoma, we studied the utility of RNU2-1f as a diagnostic marker of CC in bile fluid. Bile fluid was collected from patients with CC (n = 12), controls (patients with choledocholithiasis) (n = 11) and with primary sclerosing cholangitis (PSC; n = 11). RNU2-1f levels were measured by real-time polymerase chain reaction normalized to cel-54. Measurement of RNU2-1f levels in bile fluids enabled the differentiation of patients with CC from controls in all cases. Furthermore, RNU2-1f levels in bile fluids of patients with CC were significantly higher than in patients with PSC, resulting in a receiver-operating characteristic curve area of 0.856, with sensitivity of 67 % and specificity of 91 %. Our data suggest that the measurement of RNU2-1 fragments detected in the bile fluid can be used as a diagnostic marker for CC and should be included in future prospective diagnostic studies for this disease entity.

  14. Analysis of a cDNA clone expressing a human autoimmune antigen: full-length sequence of the U2 small nuclear RNA-associated B antigen

    International Nuclear Information System (INIS)

    Habets, W.J.; Sillekens, P.T.G.; Hoet, M.H.; Schalken, J.A.; Roebroek, A.J.M.; Leunissen, J.A.M.; Van de Ven, W.J.M.; Van Venrooij, W.J.

    1987-01-01

    A U2 small nuclear RNA-associated protein, designated B'', was recently identified as the target antigen for autoimmune sera from certain patients with systemic lupus erythematosus and other rheumatic diseases. Such antibodies enabled them to isolate cDNA clone λHB''-1 from a phage λgt11 expression library. This clone appeared to code for the B'' protein as established by in vitro translation of hybrid-selected mRNA. The identity of clone λHB''-1 was further confirmed by partial peptide mapping and analysis of the reactivity of the recombinant antigen with monospecific and monoclonal antibodies. Analysis of the nucleotide sequence of the 1015-base-pair cDNA insert of clone λHB''-1 revealed a large open reading frame of 800 nucleotides containing the coding sequence for a polypeptide of 25,457 daltons. In vitro transcription of the λHB''-1 cDNA insert and subsequent translation resulted in a protein product with the molecular size of the B'' protein. These data demonstrate that clone λHB''-1 contains the complete coding sequence of this antigen. The deduced polypeptide sequence contains three very hydrophilic regions that might constitute RNA binding sites and/or antigenic determinants. These findings might have implications both for the understanding of the pathogenesis of rheumatic diseases as well as for the elucidation of the biological function of autoimmune antigens

  15. Obtaining of U-2.5Zr7.5Nb and U-3Zr-9Nb alloys by sintering process

    International Nuclear Information System (INIS)

    Mazzeu, Thiago de Oliveira; Paula, Joao Bosco de; Ferraz, Wilmar Barbosa; Santos, Ana Maria Matildes dos; Brina, Jose Giovanni Mascarenhas

    2011-01-01

    The development of metallic fuels with low enrichment to be used in research and test reactors, as well in the future pressurized water reactors, focuses on the search for uranium alloys of high density. Alloying elements such as Zr, Nb and Mo are added to uranium to improve fuel performance in reactors. In this context, the Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) in Belo Horizonte is developing the U-2.5Zr-7.5Nb and U- 3Zr-9Nb (weight %) alloys by the innovative process of sintering that utilizes raw materials in the form of powders. The powders were pressed at 400MPa and then sintered under a vacuum of about 5 x 10-6 Torr at temperatures ranging from 1050 deg to 1300 deg C. The densities of the alloys were measured geometrically and by hydrostatic method using water. The microstructures of the pellets were observed by scanning electron microscopy (SEM) and the elements of alloying were identified by energy dispersive X-ray spectroscopy (SEM/EDS) analysis. The obtained results showed a small increasing density with rising sintering temperature. The highest density achieved was approximately 80% of theoretical density. It was also qualitatively observed that the superficial oxidation of the pellets increased with increasing sintering temperature thus avoiding the fusion of the alloys at higher temperatures. (author)

  16. Abundance of dioxygenase genes similar to Ralstonia sp strain U2 nagAc is correlated with naphthalene concentrations in coal tar-contaminated freshwater sediments

    Energy Technology Data Exchange (ETDEWEB)

    Dionisi, H.M.; Chewning, C.S.; Morgan, K.H.; Menn, F.M.; Easter, J.P; Sayler, G.S. [University of Tennessee, Knoxville, TN (United States). Center for Environmental Biotechnology

    2004-07-01

    We designed a real-time PCR assay able to recognize dioxygenase large-subunit gene sequences with more than 90% similarity to the Ralstonia sp. strain U2 nagAc gene (nagAc-like gene sequences) in order to study the importance of organisms carrying these genes in the biodegradation of naphthalene. Sequencing of PCR products indicated that this real-time PCR assay was specific and able to detect a variety of nagAc-like gene sequences. One to 100 ng of contaminated-sediment total DNA in 25-{mu}l reaction mixtures produced an amplification efficiency of 0.97 without evident PCR inhibition. The assay was applied to surficial freshwater sediment samples obtained in or in close proximity to a coal tar-contaminated Superfund site. Naphthalene concentrations in the analyzed samples varied between 0.18 and 106 mg/kg of dry weight sediment. The assay for nagAc-like sequences indicated the presence of (4.1 {+-} 0.7) X 10{sup 3} to (2.9 {+-} 0.3) X 10{sup 5} copies of nagAc-like dioxygenase genes per mug of DNA extracted from sediment samples. These values corresponded to (1.2 {+-} 0.6) X 10{sup 5} to (5.4 {+-} 0.4) X 10{sup 7} copies of this target per g of dry weight sediment when losses of DNA during extraction were taken into account. There was a positive correlation between naphthalene concentrations and nagAc-like gene copies per microgram of DNA = 0.89) and per gram of dry weight sediment = 0.77). These results provide evidence of the ecological significance of organisms carrying nagAc-like genes in the biodegradation of naphthalene.

  17. Study of phase transformation of U-2,5Zr-7,5Nb e U-3Zr-9Nb alloys for application in advanced nuclear fuel

    International Nuclear Information System (INIS)

    Pais, Rafael Witter Dias

    2015-01-01

    Metal fuels are relevant in the nuclear area due to the versatility of its use in the nuclear fuel cycle. Among the alloys of uranium investigated with high potential for use in nuclear power reactors, U-Zr-Nb alloys appear as an important alternative because of their superior physico-chemical and metallurgical properties. These alloys have also potential for use in nuclear testing, research and production radioisotopes of high performance nuclear reactors. Therefore, the development of these alloys is strategic since they are planned to be used in national reactors as RMB (Brazilian Multipurpose Reactor) and LABGENE (Electrical Generation Core Laboratory), currently under development in Brazil. In this work it was realized a extensive study in the scope of the manufacturing, heat treatment and phase transformations of U-2,5Zr-7,5Nb (m/m%) and U-3ZR-9NB (m/m%) fuel alloys. Ingots of both alloys were produced employing a specific methodology developed in this study. This methodology comprised the melting process in a vacuum induction furnace at high temperatures (1500 °C) and thermal-mechanical processing to break the as-cast structure. Samples with typical dimensions (17 x 7 x 2.5 mm) free from macrostructural defects were homogenized at 1000 °C in vacuum of 10 -5 torr for 17.5 hours with a 10°C/min cooling rate until to 820 °C and, subsequently, quenched in water. The samples, randomly selected, were subjected to isothermal treatment tests under different conditions of time and temperature. Isothermal treatments for transformation and retention phases were carried out in a special assembly designed for this work. After the tests, the samples were characterized by the usual phase characterization techniques with particular emphasis for the X-ray diffraction technique. In this way, the Rietveld refinement method was applied. In the case of uranium based alloys it is quite challenging due to the lack of data in the literature. In this work a strategy for the

  18. Finding the chiral gravitational wave background of an axion-S U (2 ) inflationary model using CMB observations and laser interferometers

    Science.gov (United States)

    Thorne, Ben; Fujita, Tomohiro; Hazumi, Masashi; Katayama, Nobuhiko; Komatsu, Eiichiro; Shiraishi, Maresuke

    2018-02-01

    A detection of B-mode polarization of the cosmic microwave background (CMB) anisotropies would confirm the presence of a primordial gravitational wave background (GWB). In the inflation paradigm, this would be an unprecedented probe of the energy scale of inflation as it is directly proportional to the power spectrum of the GWB. However, similar tensor perturbations can be produced by the matter fields present during inflation, breaking the simple relationship between energy scale and the tensor-to-scalar ratio r . It is therefore important to find ways of distinguishing between the generation mechanisms of the GWB. Without doing a full model selection, we analyze the detectability of a new axion-S U (2 ) gauge field model by calculating the signal-to-noise ratio of future CMB and interferometer observations sensitive to the chirality of the tensor spectrum. We forecast the detectability of the resulting CMB temperature and B-mode (TB) or E-mode and B-mode (EB) cross-correlation by the LiteBIRD satellite, considering the effects of residual foregrounds, gravitational lensing, and assess the ability of such an experiment to jointly detect primordial TB and EB spectra and self-calibrate its polarimeter. We find that LiteBIRD will be able to detect the chiral signal for r*>0.03 , with r* denoting the tensor-to-scalar ratio at the peak scale, and that the maximum signal-to-noise ratio for r*advanced stage of a LISA-like mission, which is designed to be sensitive to the intensity and polarization of the GWB. We find that such experiments would complement CMB observations as they would be able to detect the chirality of the GWB with high significance on scales inaccessible to the CMB. We conclude that CMB two-point statistics are limited in their ability to distinguish this model from a conventional vacuum fluctuation model of GWB generation, due to the fundamental limits on their sensitivity to parity violation. In order to test the predictions of such a model as

  19. Characterisation and dissolution studies on the uranium pyrochlore mineral betafite (Ca,U)_2(Nb,Ti,Ta)_2O_7

    International Nuclear Information System (INIS)

    McMaster, S.; Ram, R.; Tardio, J.; Bhargava, S.

    2014-01-01

    The pyrochlore group mineral, betafite (nominally (Ca,U)_2(Nb,Ti,Ta)_2O_7); is a refractory uranium mineral found in many ore deposits, including the currently mined deposit at Rössing, Namibia and the currently unmined deposit at Saima Massif, China. The decreasing abundance of “easy to leach” uranium minerals (i.e. uraninite), has led to interest in the extraction of uranium from refractory uranium minerals such as betafite. In the current study, three naturally occurring betafite mineral samples (obtained from Ambatofotsky and Miarinarivo, Madagascar (BAM and BMM respectively) and Silver Crater Mine, Canada (BSC)) were characterised using ex-situ high temperature X-Ray Diffraction (XRD), multi acid digestion / ICP-MS analysis (composition) and X-Ray Photoelectron Spectroscopy (XPS). Dissolution of the three samples was also investigated under conditions similar to those used in commercial tank based uranium leaching processes. XRD analysis showed that all three samples were highly metamict. Samples BMM and BSC showed no assignable diffraction lines before heat treating, whereas the XRD pattern obtained for sample BAM contained diffraction lines that confirmed the presence of crystalline anatase (TiO_2). Heat treatment studies on the samples showed that the betafite in the samples was converted into a crystalline form at 700°C in all 3 samples. Gangue minerals, rutile, Nb-rutile, UTiNb_2O_1_0, and studitite were also found to be present in the heat treated samples. Multi acid digestion ICP-MS analysis showed the natural samples contained between 16 and 26% w/w uranium as well as all the major elements present typically in betafite. XPS analysis was conducted on the unheated betafite samples. XPS analysis showed that the uranium in the samples was predominately in U"5"+ oxidation state. Some U"6"+ was also identified though this was most likely restricted to the outer surface of the samples. Dissolution studies (batch mode) were conducted under the following

  20. Study of phase transformation of U-2,5Zr-7,5Nb e U-3Zr-9Nb alloys for application in advanced nuclear fuel; Estudo das transformacoes de fases nas ligas U-2,5Zr-7,5Nb e U-3Zr-9Nb para aplicacao em combustivel nuclear avancado

    Energy Technology Data Exchange (ETDEWEB)

    Pais, Rafael Witter Dias

    2015-07-01

    Metal fuels are relevant in the nuclear area due to the versatility of its use in the nuclear fuel cycle. Among the alloys of uranium investigated with high potential for use in nuclear power reactors, U-Zr-Nb alloys appear as an important alternative because of their superior physico-chemical and metallurgical properties. These alloys have also potential for use in nuclear testing, research and production radioisotopes of high performance nuclear reactors. Therefore, the development of these alloys is strategic since they are planned to be used in national reactors as RMB (Brazilian Multipurpose Reactor) and LABGENE (Electrical Generation Core Laboratory), currently under development in Brazil. In this work it was realized a extensive study in the scope of the manufacturing, heat treatment and phase transformations of U-2,5Zr-7,5Nb (m/m%) and U-3ZR-9NB (m/m%) fuel alloys. Ingots of both alloys were produced employing a specific methodology developed in this study. This methodology comprised the melting process in a vacuum induction furnace at high temperatures (1500 °C) and thermal-mechanical processing to break the as-cast structure. Samples with typical dimensions (17 x 7 x 2.5 mm) free from macrostructural defects were homogenized at 1000 °C in vacuum of 10{sup -5} torr for 17.5 hours with a 10°C/min cooling rate until to 820 °C and, subsequently, quenched in water. The samples, randomly selected, were subjected to isothermal treatment tests under different conditions of time and temperature. Isothermal treatments for transformation and retention phases were carried out in a special assembly designed for this work. After the tests, the samples were characterized by the usual phase characterization techniques with particular emphasis for the X-ray diffraction technique. In this way, the Rietveld refinement method was applied. In the case of uranium based alloys it is quite challenging due to the lack of data in the literature. In this work a strategy for the

  1. Abnormal specific heat enhancement and non-Fermi-liquid behavior in the heavy-fermion system U2Cu17 -xGax (5 ≤x ≤8 )

    Science.gov (United States)

    Svanidze, E.; Amon, A.; Prots, Yu.; Leithe-Jasper, A.; Grin, Yu.

    2018-03-01

    In the antiferromagnetic heavy-fermion compound U2Zn17 , the Sommerfeld coefficient γ can be enhanced if all Zn atoms are replaced by a combination of Cu and Al or Cu and Ga. In the former ternary phase, glassy behavior was observed, while for the latter, conflicting ground-state reports suggest material quality issues. In this work, we investigate the U2Cu17 -xGax substitutional series for 4.5 ≤x ≤9.5 . In the homogeneity range of the phase with the Th2Zn17 -type of crystal structure, all samples exhibit glassy behavior with 0.6 K ≤Tf≤1.8 K . The value of the electronic specific heat coefficient γ in this system exceeds 900 mJ/molUK2. Such a drastic effective-mass enhancement can possibly be attributed to the effects of structural disorder, since the role of electron concentration and lattice compression is likely minimal. Crystallographic disorder is also responsible for the emergence of non-Fermi-liquid behavior in these spin-glass materials, as evidenced by logarithmic divergence of magnetic susceptibility, specific heat, and electrical resistivity.

  2. Determination of uranium concentrations and "2"3"4U/"2"3"8U activity ratio in some granitic rock samples by alpha spectrometry: application of a radiochemical procedure

    International Nuclear Information System (INIS)

    Khattab, Mahmoud R.

    2016-01-01

    The present study is an application of a radiochemical procedure using alpha spectrometry technique for determination of uranium isotopes "2"3"8U, "2"3"4U and "2"3"5U on 13 granitic samples. These samples were collected from Gabal Gattar area, Northeastern Desert, Egypt. The collected samples were digested using microwave technique with aqua regia and spiked with "2"3"2U for chemical yield and activity calculation. Separation of uranium isotopes from the samples was done by Dowex 1 x 4 (50-100 mesh) resin followed by source preparation using microprecipitation technique. The concentrations of "2"3"8U were ranged between 28.9±0.9 and 134.8±1.8 Bq/g, and the "2"3"4U concentrations were between 24±0.6 and 147.7±2.2 Bq/g. For the "2"3"5U, the activity concentrations were between 1.3±0.2 and 6.7±1.2 Bq/g. The activity ratio of "2"3"4U/"2"3"8U was calculated and varied from 0.80 to 1.30. (author)

  3. Global S U (3 )C×S U (2 )L×U (1 )Y linear sigma model: Axial-vector Ward-Takahashi identities and decoupling of certain heavy BSM particles due to the Goldstone theorem

    Science.gov (United States)

    Lynn, Bryan W.; Starkman, Glenn D.

    2017-09-01

    In the S U (2 )L×S U (2 )R linear sigma model with partially conserved axial-vector currents, a tower of Ward-Takahashi identities (WTI) have long been known to give relations among 1-scalar-particle-irreducible (1 -ϕ -I ) Green's functions, and among I-scalar-particle-reducible (1 -ϕ -R ) transition-matrix (T-matrix) elements for external scalars [i.e. the Brout-Englert-Higgs (BEH) scalar H , and three pseudoscalars π →]. In this paper, we extend these WTI and the resulting relations to the S U (3 )C×S U (2 )L×U (1 )Y linear sigma model including the heaviest generation of Standard Model (SM) fermions—the ungauged (i.e. global) Standard Model SMtb τ ντ G —supplemented with the minimum necessary neutrino content—right-handed neutrinos and Yukawa-coupling-induced Dirac neutrino mass—to obtain the charge-parity (C P )-conserving νDSMtb τ ντ G , and extract powerful constraints on the effective Lagrangian: e.g. showing that they make separate tadpole renormalization unnecessary, and guarantee infrared finiteness. The crucial observation is that ultraviolet quadratic divergences (UVQD), and all other relevant operators, contribute only to mπ2, a pseudo-Nambu-Goldstone boson (NGB) mass-squared, which appears in intermediate steps of calculations. A WTI between T-matrix elements (or, in this global theory equivalently the Goldstone theorem) then enforces mπ2=0 exactly for the true NGB in the spontaneous symmetry breaking (SSB) mode of the theory. The Goldstone theorem thus causes all relevant operator contributions, originating to all-loop-orders from virtual scalars H ,π → , quarks qLc;tRc;bRc and leptons lL;ντR;τR with (c =r , w , b ), to vanish identically. We show that our regularization-scheme-independent, WTI-driven results are unchanged by the addition of certain S U (3 )C×S U (2 )L×U (1 )Y heavy (MHeavy2≫|q2|,mWeak2 ) C P -conserving matter, such as originate in certain beyond the SM (BSM) models. The global axial-vector WTI

  4. Efficient production of lignocellulolytic enzymes xylanase, β-xylosidase, ferulic acid esterase and β-glucosidase by the mutant strain Aspergillus awamori 2B.361 U2/1

    Directory of Open Access Journals (Sweden)

    Leda Maria Fortes Gottschalk

    2013-01-01

    Full Text Available The production of xylanase, β-xylosidase, ferulic acid esterase and β-glucosidase by Aspergillus awamori 2B.361 U2/1, a hyper producer of glucoamylase and pectinase, was evaluated using selected conditions regarding nitrogen nutrition. Submerged cultivations were carried out at 30 ºC and 200 rpm in growth media containing 30 g wheat bran/L as main carbon source and either yeast extract, ammonium sulfate, sodium nitrate or urea, as nitrogen sources; in all cases it was used a fixed molar carbon to molar nitrogen concentration of 10.3. The use of poor nitrogen sources favored the accumulation of xylanase, β-xylosidase and ferulic acid esterase to a peak concentrations of 44,880; 640 and 118 U/L, respectively, for sodium nitrate and of 34,580, 685 and 170 U/L, respectively, for urea. However, the highest β-glucosidase accumulation of 10,470 U/L was observed when the rich organic nitrogen source yeast extract was used. The maxima accumulation of filter paper activity, xylanase, β-xylosidase, ferulic acid esterase and β-glucosidase by A. awamori 2B.361 U2/1 was compared to that produced by Trichoderma reesei Rut-C30. The level of β-glucosidase was over 17-fold higher for the Aspergillus strain, whereas the levels of xylanase and β-xylosidase were over 2-fold higher. This strain also produced ferulic acid esterase (170 U/L, which was not detected in the T. reesei culture.

  5. Dynamic Contacts of U2, RES, Cwc25, Prp8 and Prp45 Proteins with the Pre-mRNA Branch-Site and 3' Splice Site during Catalytic Activation and Step 1 Catalysis in Yeast Spliceosomes.

    Directory of Open Access Journals (Sweden)

    Cornelius Schneider

    Full Text Available Little is known about contacts in the spliceosome between proteins and intron nucleotides surrounding the pre-mRNA branch-site and their dynamics during splicing. We investigated protein-pre-mRNA interactions by UV-induced crosslinking of purified yeast B(act spliceosomes formed on site-specifically labeled pre-mRNA, and analyzed their changes after conversion to catalytically-activated B* and step 1 C complexes, using a purified splicing system. Contacts between nucleotides upstream and downstream of the branch-site and the U2 SF3a/b proteins Prp9, Prp11, Hsh49, Cus1 and Hsh155 were detected, demonstrating that these interactions are evolutionarily conserved. The RES proteins Pml1 and Bud13 were shown to contact the intron downstream of the branch-site. A comparison of the B(act crosslinking pattern versus that of B* and C complexes revealed that U2 and RES protein interactions with the intron are dynamic. Upon step 1 catalysis, Cwc25 contacts with the branch-site region, and enhanced crosslinks of Prp8 and Prp45 with nucleotides surrounding the branch-site were observed. Cwc25's step 1 promoting activity was not dependent on its interaction with pre-mRNA, indicating it acts via protein-protein interactions. These studies provide important insights into the spliceosome's protein-pre-mRNA network and reveal novel RNP remodeling events during the catalytic activation of the spliceosome and step 1 of splicing.

  6. Disability evaluation of fibromyalgia.

    Science.gov (United States)

    Wolfe, C V

    2001-08-01

    These cases represent individuals who feel they have a severe impairment and are "disabled." They have been labeled with fibromyalgia. They are truly distressed. Their symptoms, their courses, are more chronic and refractory than those of medically ill patients, and they are high users of medical services, laboratory investigations, and surgical procedures. These patients see multiple providers simultaneously and frequently switch physicians. They are difficult to care for, and they reject psychosocial factors as an influence on their symptoms. Such persons "see themselves as victims worthy of a star appearance on the Oprah Winfrey show. A sense of bitterness emerges...." Shorter, a historian, believes that fibromyalgia is "heaven-sent to doctors as a diagnostic label for pain patients who display an important neurotic component in their illness. Our culture increasingly encourages patients to conceive vague and nonspecific symptoms as evidence of real disease and to seek specialist help for them; and the rising ascendancy of the media and the breakdown of the family encourage patients to acquire the fixed belief that they have a given illness...." Regarding the finding of "disability," this is a social construct, and many authors believe it is society and the judicial system who must decide who can work. To remain objective, the physician should report the objective clinical information. Physicians need not and should not sit in judgment of the veracity of another human being.

  7. Influence of preoperative artificial tears on tear film after phacoemulsification on dry eye of diabetes patients

    Directory of Open Access Journals (Sweden)

    Rui Su

    2015-05-01

    Full Text Available AIM: To discuss the artificial tears on the tear film of diabetic patients with dry eye preoperatively, and the influence on the tear film's fuctional after phacoemulsification.METHODS: Fifty-four diabetic patients with dry eye(60 eyeswere followed up before phacoemulsification. Preoperatively, group A(30 eyes in 28 caseswas treated with Hydroxyl Indican eye drops and group B(30 eyes in 26 caseswas not treated. Postoperatively, both group A and B were treated with Tobramycin Dexamethasone eye drops, Oprah Winfrey Ibuprofen eye drops and Hydroxyl Indican eye drops. Dry eye symptoms, break up time(BUT, Schirmer Ⅰ test(S Ⅰ t, fluorescein stain test(FIwere measured at 3d preoperatively, and 1, 7, 30, 90d postoperatively.RESULTS: At 3d preoperatively, there was no statistical differences between the two groups for dry eye symptoms, BUT, SⅠt, FI(P>0.05. At 1 and 7d postoperatively, there were significant statistical differents between the two groups for dry eye symptoms(PPP>0.05.CONCLUSION: Using artificial tears before phacoemulsification can improve symptoms of the diabetic patients with dry eye and accelerate the recovery of the tear film.

  8. Destination memory impairment in older people.

    Science.gov (United States)

    Gopie, Nigel; Craik, Fergus I M; Hasher, Lynn

    2010-12-01

    Older adults are assumed to have poor destination memory-knowing to whom they tell particular information-and anecdotes about them repeating stories to the same people are cited as informal evidence for this claim. Experiment 1 assessed young and older adults' destination memory by having participants tell facts (e.g., "A dime has 118 ridges around its edge") to pictures of famous people (e.g., Oprah Winfrey). Surprise recognition memory tests, which also assessed confidence, revealed that older adults, compared to young adults, were disproportionately impaired on destination memory relative to spared memory for the individual components (i.e., facts, faces) of the episode. Older adults also were more confident that they had not told a fact to a particular person when they actually had (i.e., a miss); this presumably causes them to repeat information more often than young adults. When the direction of information transfer was reversed in Experiment 2, such that the famous people shared information with the participants (i.e., a source memory experiment), age-related memory differences disappeared. In contrast to the destination memory experiment, older adults in the source memory experiment were more confident than young adults that someone had shared a fact with them when a different person actually had shared the fact (i.e., a false alarm). Overall, accuracy and confidence jointly influence age-related changes to destination memory, a fundamental component of successful communication. (c) 2010 APA, all rights reserved).

  9. Self-esteem matters: racial & gender differences among rural southern adolescents.

    Science.gov (United States)

    Hendricks, C S; Tavakoli, A; Hendricks, D L; Harter, N R; Campbell, K P; L'Ecuyer, R I; Geddings, A A; Hackett, D; Byrd, L; Mathis, D

    2001-12-01

    Self-esteem does matter! It matters so much that Oprah dedicated an entire issue of "O" magazine to address the subject. "It's a woman's most treasured possession" (Winfrey, 2000a). Self-esteem has a profound influence on adolescent health promotion behaviors. This study contributes to understanding the role self-esteem plays in the behavior of adolescents. Utilizing a secondary data analysis, race and gender self-esteem differences among adolescents were investigated. The sample of 1,237 students (46% African-American and 52% White) from rural southern areas consisted of 744 females and 493 males. Self-esteem was assessed using the Miller Self-esteem Questionnaire (SEQ). The Hendricks Perceptual Health Promoting Determinants Model (HPHD) provided the theoretical framework for the study. The results of the study revealed a statistically significant difference in various aspects of self-esteem according to race and gender. African-Americans and males had a higher self-esteem which is consistent with many prior studies.

  10. Hydrophysical Evaluation of Wells TW-B, TW-7, UE-6d, U-2gg PSE 3A, U-10L 1, and UE-6e in Yucca Flat

    Energy Technology Data Exchange (ETDEWEB)

    Pohlmann, Karl [Desert Research Inst. (DRI), Las Vegas, NV (United States); Healey, John [Desert Research Inst. (DRI), Las Vegas, NV (United States); Lyles, Bred [Desert Research Inst. (DRI), Reno, NV (United States); Cooper, Clay [Desert Research Inst. (DRI), Reno, NV (United States); Hershey, Ronald L. [Desert Research Inst. (DRI), Reno, NV (United States)

    2017-05-01

    This study evaluated six wells in Yucca Flat in support of the Underground Test Area (UGTA) Activity conducted by the U.S. Department of Energy (DOE) at the Nevada National Security Site (NNSS). Accessibility and groundwater sampling conditions were assessed and if conditions permitted, samples were collected for tritium analysis. Four of the wells, TW-B, UE-6d, UE-6e, and TW-7 were sampled in support of UGTA responses to recommendations made by the Yucca Flat/Climax Mine External Peer Review Committee (Navarro, 2016). In addition to its role in support of these responses, TW-7 was included because it is listed in the NNSS Integrated Groundwater Sampling Plan (DOE, 2014) as a required sampling location, although it had not been sampled since 1994. U-2gg PSE 3A and U-10L 1 were evaluated to determine whether deteriorating well conditions can be addressed so that these wells can be used as additional sampling points in Yucca Flat.

  11. Monte Carlo analysis of the oxygen knock-on effects induced by synchrotron x-ray radiation in the B i2S r2CaC u2O8 +δ superconductor

    Science.gov (United States)

    Torsello, Daniele; Mino, Lorenzo; Bonino, Valentina; Agostino, Angelo; Operti, Lorenza; Borfecchia, Elisa; Vittone, Ettore; Lamberti, Carlo; Truccato, Marco

    2018-01-01

    We investigate the microscopic mechanism responsible for the change of macroscopic electrical properties of the B i2S r2CaC u2O8 +δ high-temperature superconductor induced by intense synchrotron hard x-ray beams. The possible effects of secondary electrons on the oxygen content via the knock-on interaction are studied by Monte Carlo simulations. The change in the oxygen content expected from the knock-on model is computed convoluting the fluence of photogenerated electrons in the material with the Seitz-Koehler cross section. This approach has been adopted to analyze several experimental irradiation sessions with increasing x-ray fluences. A close comparison between the expected variations in oxygen content and the experimental results allows determining the irradiation regime in which the knock-on mechanism can satisfactorily explain the observed changes. Finally, we estimate the threshold displacement energy of loosely bound oxygen atoms in this material Td=0 .15-0.01+0.025eV .

  12. Evaluation of the electrochemical behavior of U2.5Zr7.5Nb and U3Zr9Nb uranium alloys in relation to the pH and the solution aeration

    International Nuclear Information System (INIS)

    Mansur, Fabio Abud; Santos, Ana Maria Matildes dos; Ferraz, Wilmar Barbosa; Figueiredo, Celia de Araujo

    2011-01-01

    The Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) is developing, in cooperation with the Centro Tecnologico da Marinha (CTMSP), the advanced nuclear plate type fuel for the second core of the land-based reactor prototype of the Laboratorio de Geracao Nucleo-Eletrica (LABGENE). Recent investigations have shown that the fuel made of uranium-based niobium and zirconium alloys reaches the best performance relative to other fuels, e.g. UO 2 . Niobium and Zirconium also increase the corrosion resistance and the mechanical strength of the uranium alloys. By means of electrochemical techniques the corrosion behavior of alloys U 2 . 5 Zr 7.5 Nb and U 3 Zr 9 Nb, developed at CDTN and heat treated in the temperature range of 200 deg C to 600 deg C, was assessed. The effect of the parameters pH and solution aeration was studied as well as the influence of zirconium and niobium alloying elements in the corrosion of uranium. The techniques used were open circuit potential, electrochemical impedance and potentiodynamic anodic polarization at room temperature. The tests were performed in a three-electrode electrochemical cell with Ag/AgCl (3M KCl) as the reference electrode and a platinum plate as the auxiliary electrode. The potentiodynamic polarization curves of uranium and its alloys in acidic solutions showed regions with anodic currents limited by a passive film. The presence of niobium and zirconium contributed for the formation of this film. The impedance data showed the presence of two semicircles in the Bode diagram, indicating the occurrence of two distinct electrochemical processes. The data were fitted to an equivalent circuit model in order to obtain parameters of the electrochemical processes and evaluate the effect of the studied variables. (author)

  13. Rare earth ruthenium gallides with the ideal composition Ln_2Ru_3Ga_5 (Ln = La-Nd, Sm) crystallizing with U_2Mn_3Si_5 (Sc_2Fe_3Si_5) type structure

    International Nuclear Information System (INIS)

    Jeitschko, Wolfgang; Schlueter, Martin

    2010-01-01

    The rare earth ruthenium gallides Ln_2Ru_3Ga_5 (Ln = La, Ce, Pr, Nd, Sm) were prepared by arc-melting of cold-pressed pellets of the elemental components. They crystallize with a tetragonal structure (P4/mnc, Z = 4) first reported for U_2Mn_3Si_5. The crystal structures of the cerium and samarium compounds were refined from single-crystal X-ray data, resulting in significant deviations from the ideal compositions: Ce_2Ru_2_._3_1_(_1_)Ga_5_._6_9_(_1_), a = 1135.10(8) pm, c = 580.58(6) pm, R_F = 0.022 for 742 structure factors; Sm_2Ru_2_._7_3_(_2_)Ga_5_._2_7_(_2_), a = 1132.95(9) pm, c = 562.71(6) pm, R_F = 0.026 for 566 structure factors and 32 variable parameters each. The deviations from the ideal compositions 2:3:5 are discussed. A mixed Ru/Ga occupancy occurs only for one atomic site. The displacement parameters are relatively large for atoms with mixed occupancy within their coordination shell and small for atoms with no neighboring sites of mixed occupancy. Chemical bonding is analyzed on the basis of interatomic distances. Ln-Ga bonding is stronger than Ln-Ru bonding. Ru-Ga bonding is strong and Ru-Ru bonding is weak. The Ga-Ga interactions are of similar strength as in elemental gallium. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  14. Quantification of "2"3"2Th, "2"3"4U, "2"3"5U and "2"3"8U in river mollusks by magnetic sector mass spectrometry with inductively coupled plasma source (Icp-SFMS)

    International Nuclear Information System (INIS)

    Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N.; Alfaro de la T, M. C.

    2016-09-01

    The present work deals with the methodology established for the quantification of "2"3"2Th, "2"3"4U, "2"3"8U and "2"3"5U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO_3 minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of "2"3"2Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ("2"3"2Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of "2"3"2Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)

  15. Transmissibility of the Ice Bucket Challenge among globally influential celebrities: retrospective cohort study

    Science.gov (United States)

    Chan, Brandford H Y; Leung, Gabriel M; Lau, Eric H Y; Pang, Herbert

    2014-01-01

    Objectives To estimate the transmissibility of the Ice Bucket Challenge among globally influential celebrities and to identify associated risk factors. Design Retrospective cohort study. Setting Social media (YouTube, Facebook, Twitter, Instagram). Participants David Beckham, Cristiano Ronaldo, Benedict Cumberbatch, Stephen Hawking, Mark Zuckerberg, Oprah Winfrey, Homer Simpson, and Kermit the Frog were defined as index cases. We included contacts up to the fifth generation seeded from each index case and enrolled a total of 99 participants into the cohort. Main outcome measures Basic reproduction number R0, serial interval of accepting the challenge, and odds ratios of associated risk factors based on fully observed nomination chains; R0 is a measure of transmissibility and is defined as the number of secondary cases generated by a single index in a fully susceptible population. Serial interval is the duration between onset of a primary case and onset of its secondary cases. Results Based on the empirical data and assuming a branching process we estimated a mean R0 of 1.43 (95% confidence interval 1.23 to 1.65) and a mean serial interval for accepting the challenge of 2.1 days (median 1 day). Higher log (base 10) net worth of the participants was positively associated with transmission (odds ratio 1.63, 95% confidence interval 1.06 to 2.50), adjusting for age and sex. Conclusions The Ice Bucket Challenge was moderately transmissible among a group of globally influential celebrities, in the range of the pandemic A/H1N1 2009 influenza. The challenge was more likely to be spread by richer celebrities, perhaps in part reflecting greater social influence. PMID:25514905

  16. Transmissibility of the Ice Bucket Challenge among globally influential celebrities: retrospective cohort study.

    Science.gov (United States)

    Ni, Michael Y; Chan, Brandford H Y; Leung, Gabriel M; Lau, Eric H Y; Pang, Herbert

    2014-12-16

    To estimate the transmissibility of the Ice Bucket Challenge among globally influential celebrities and to identify associated risk factors. Retrospective cohort study. Social media (YouTube, Facebook, Twitter, Instagram). David Beckham, Cristiano Ronaldo, Benedict Cumberbatch, Stephen Hawking, Mark Zuckerberg, Oprah Winfrey, Homer Simpson, and Kermit the Frog were defined as index cases. We included contacts up to the fifth generation seeded from each index case and enrolled a total of 99 participants into the cohort. Basic reproduction number R0, serial interval of accepting the challenge, and odds ratios of associated risk factors based on fully observed nomination chains; R0 is a measure of transmissibility and is defined as the number of secondary cases generated by a single index in a fully susceptible population. Serial interval is the duration between onset of a primary case and onset of its secondary cases. Based on the empirical data and assuming a branching process we estimated a mean R0 of 1.43 (95% confidence interval 1.23 to 1.65) and a mean serial interval for accepting the challenge of 2.1 days (median 1 day). Higher log (base 10) net worth of the participants was positively associated with transmission (odds ratio 1.63, 95% confidence interval 1.06 to 2.50), adjusting for age and sex. The Ice Bucket Challenge was moderately transmissible among a group of globally influential celebrities, in the range of the pandemic A/H1N1 2009 influenza. The challenge was more likely to be spread by richer celebrities, perhaps in part reflecting greater social influence. © Ni et al 2014.

  17. U1/U2 crib groundwater biological treatment demonstration project

    International Nuclear Information System (INIS)

    Koegler, S.S.; Brouns, T.M.; Heath, W.O.

    1989-11-01

    The primary objective of the biological treatment project is to develop and demonstrate a process for Hanford groundwater remediation. Biodenitrification using facultative anaerobic microorganisms is a promising technology for the simultaneous removal of nitrates and organics from contaminated aqueous streams. During FY 1988, a consortium of Hanford groundwater microorganisms was shown to degrade both nitrates and carbon tetrachloride (CC1 4 ). A pilot-scale treatment system was designed and constructed based on the results of laboratory-and-bench-scale testing. This report summarizes the results of biological groundwater treatment studies performed during FY 1989 at the pilot-scale. These tests were conducted using a simulated Hanford groundwater with a continuous stirred-tank bioreactor, and a fluidized-bed bioreactor that was added to the pilot-scale treatment system in FY 1989. The pilot-scale system demonstrated continuous degradation of nitrates and CC1 4 in a simulated groundwater. 4 refs., 7 figs., 1 tab

  18. U-2g0 cyclotron operational experience and improvement

    International Nuclear Information System (INIS)

    Gigal, B.N.; Gul'bekyan, G.G.; Kozlov, S.I.; Oganesyan, R.Ts.

    1983-01-01

    Brief description of main syste's of the U-200 isochronous 2-m cyclotron put into opera ion in 1968 is given and its operational characteristics a e presented. The cyclotron is used for conducting inve tigations in the field of nuclear physics. Ions from d uterium to argon have been accelerated in the cyclotro'. Annual time of target irradiation constitutes 2000-4000. The specific features of the cyclotron are: high l vel of a magnetic field (of about 20 kOe), possibili y of acceleration of ions with different mass-to-charge ratio a low correcting winding power, simple and high-e fective beam extraction by the method of charge exchange on a thin target allowing to vary smoothly energy of extracted ons. An experience in the U-200 cyclotron development and o eration is used as the basis for designing and choosing basic parameters of the U-200P, U-250, U-400 heavy ion cyclotrons

  19. Pro-apoptotic and pro-autophagic effects of the Aurora kinase A inhibitor alisertib (MLN8237 on human osteosarcoma U-2 OS and MG-63 cells through the activation of mitochondria-mediated pathway and inhibition of p38 MAPK/PI3K/Akt/mTOR signaling pathway

    Directory of Open Access Journals (Sweden)

    Niu NK

    2015-03-01

    mesenchymal transition (EMT and the underlying mechanisms in two human OS cell lines U-2 OS and MG-63. The results showed that ALS had potent growth inhibitory, pro-apoptotic, pro-autophagic, and EMT inhibitory effects on U-2 OS and MG-63 cells. ALS remarkably induced G2/M arrest and down-regulated the expression levels of cyclin-dependent kinases 1 and 2 and cyclin B1 in both U-2 OS and MG-63 cells. ALS markedly induced mitochondria-mediated apoptosis with a significant increase in the expression of key pro-apoptotic proteins and a decrease in main anti-apoptotic proteins. Furthermore, ALS promoted autophagic cell death via the inhibition of phosphatidylinositol 3-kinase (PI3K/protein kinase B (Akt/mammalian target of rapamycin (mTOR and p38 mitogen-activated protein kinase (p38 MAPK signaling pathways, and activation of 5'-AMP-dependent kinase (AMPK signaling pathway. Inducers or inhibitors of apoptosis or autophagy simultaneously altered ALS-induced apoptotic and autophagic death in both U-2 OS and MG-63 cells, suggesting a crosstalk between these two primary modes of programmed cell death. Moreover, ALS suppressed EMT-like phenotypes with a marked increase in the expression of E-cadherin but a decrease in N-cadherin in U-2 OS and MG-63 cells. ALS treatment also induced reactive oxygen species (ROS generation but inhibited the expression levels of sirtuin 1 and nuclear factor-erythroid-2-related factor 2 (Nrf2 in both cell lines. Taken together, these findings show that ALS promotes apoptosis and autophagy but inhibits EMT via PI3K/Akt/mTOR, p38 MAPK, and AMPK signaling pathways with involvement of ROS- and sirtuin 1-associated pathways in U-2 OS and MG-63 cells. ALS is a promising anticancer agent in OS treatment and further studies are needed to confirm its efficacy and safety in OS chemotherapy. Keywords: ALS, autophagy, apoptosis, osteosarcoma, PI3K/Akt/mTOR pathway, EMT

  20. Fibromyalgia syndrome and myofascial pain syndrome. Do they exist?

    Science.gov (United States)

    Bohr, T W

    1995-05-01

    lawyers for help. Although "Chronic Fatigue Syndrome" and FS are not considered by everyone to be the same malady, the "National Institute of Health (sic) has lumped these two conditions together. This could work in your favor." (A U.S. political advocacy packet is available for $8, but a list of U.S. senators with Washington, DC addresses is freely provided.) These persons see themselves as victims worthy of a star appearance on the Oprah Winfrey show. A sense of bitterness emerges; one literally bed-bound Texas homemaker writes in Parents magazine that "Some doctors may give up and tell you that you are a hypochondriac."(ABSTRACT TRUNCATED AT 400 WORDS)

  1. Scaling properties for the first RE-like mixed valence examples in uranium compounds: U2Ru2Sn and U2RuGa8

    International Nuclear Information System (INIS)

    Troc, Robert

    2006-01-01

    The present study was motivated by the scaling characterization of the first example of mixed valence (MV) RE-like behaviour found recently among intermetallic ternary uranium compounds. The χ(T) function for both title compounds has been fitted to the interconfigurational fluctuation (ICF) model of Sales and Wohlleben in order to determine the characteristic fluctuation temperatures T sf and interconfigurational excitation energies E ex . A good scaling, with similar values of T sf like from those derived from the ICF model, has been achieved for both these ternaries by plotting Tχ(T)/C against the reduced T/T sf . Moreover, this scaling follows almost exactly those found earlier in a number of MV- RE compounds

  2. Optimization of reloading Laguna Verde Central U1/U2, Federal Electricity Commission; Optimizacion de recargas Central Laguna Verde U1/U2, Comision Federal de Electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa G, J.M. [Central Nucleoelectrica Laguna Verde, Carretera Cardel-Nautla Km. 45.5, Municipio de Alto Lucero, Veracruz (Mexico)

    2006-07-01

    The Laguna Verde Central from the beginning of the commercial operation settled down as maximum priority 'the total safety in its operation' taking in consideration the so much experience of the good operation and of multiple recharges made in a sure and reliable way, and without separate us of the safety mystic of the CLV, but looking for to be better every day a new challenge it settled down 'to compare us with the best plants in the world' and certainly to work to classify us like one of them. For this we established a 4.0 year old plan (2003/2006) for the effectiveness all the processes in the power station that allowed us to measure our acting with the same parameters that settle down at international level (nuclear safety, industrial safety, radiological safety, capacity factor, readiness factor, cleaning of the power station, attachment to procedures, attention to the detail and certainly to be competitive in the economic aspect, summing up means to be good in all the aspects). All the above mentioned would allow us to qualify us as level 1 of WANO (world proprietors association of nuclear centrals) at the end of the year 2006 and to pass to be part of this select group. After analyzing the acting record of the power station, evaluating our technical and economic capacity, the location of the installation besides revising the international experiences was defined that one of the concepts that impact considerably so much to the capacity factors and availability besides the dose and production cost is the duration of the recharge periods, for this reason the present work is elaborated. (Author)

  3. Operational Plan for Underground Storage Tank 322 R2U2

    Energy Technology Data Exchange (ETDEWEB)

    Griffin, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-06-07

    This Operational Plan provides the operator of the tank system with guidelines relating to the safe and compliant operation and maintenance of the tank system. The tank system schematic and list of emergency contacts shall be posted near the tank so they are visible to tank personnel. This Operational Plan shall be kept on file by the Facility Supervisor. It should be understood when managing this tank system that it is used to store hazardous waste temporarily for 90 calendar days or less. The rinsewater handled in the tank system is considered hazardous and may exhibit the characteristic of toxicity.

  4. White Matter Hyperintensities on MRI in High-Altitude U-2 Pilots

    Science.gov (United States)

    2013-08-19

    SUBJECT TERMS MRI; white matter hyperintensities; hypobaric exposure; neurological decompression sickness 16. SECURITY CLASSIFICATION OF: 17...normal controls and did not increase with age in pilots, suggesting that hypobaric exposure produces white matter damage different from that occurring in...relapse we observed in 3 NDCS pilots after successful hyperbaric treatment (US Navy Treatment Table 6; 100% fraction of inspired oxygen; 2.8 atm absolute

  5. Optimization of reloading Laguna Verde Central U1/U2, Federal Electricity Commission

    International Nuclear Information System (INIS)

    Espinosa G, J.M.

    2006-01-01

    The Laguna Verde Central from the beginning of the commercial operation settled down as maximum priority 'the total safety in its operation' taking in consideration the so much experience of the good operation and of multiple recharges made in a sure and reliable way, and without separate us of the safety mystic of the CLV, but looking for to be better every day a new challenge it settled down 'to compare us with the best plants in the world' and certainly to work to classify us like one of them. For this we established a 4.0 year old plan (2003/2006) for the effectiveness all the processes in the power station that allowed us to measure our acting with the same parameters that settle down at international level (nuclear safety, industrial safety, radiological safety, capacity factor, readiness factor, cleaning of the power station, attachment to procedures, attention to the detail and certainly to be competitive in the economic aspect, summing up means to be good in all the aspects). All the above mentioned would allow us to qualify us as level 1 of WANO (world proprietors association of nuclear centrals) at the end of the year 2006 and to pass to be part of this select group. After analyzing the acting record of the power station, evaluating our technical and economic capacity, the location of the installation besides revising the international experiences was defined that one of the concepts that impact considerably so much to the capacity factors and availability besides the dose and production cost is the duration of the recharge periods, for this reason the present work is elaborated. (Author)

  6. Seismic qualification tests of fans of the NPP of Laguna Verde U-1 and U-2

    International Nuclear Information System (INIS)

    Jarvio C, G.; Garcia H, E. E.; Arguelles F, R.; Vela H, A.; Naranjo U, J. L.

    2013-10-01

    This work presents the results of the seismic qualification tests applied to the fans that will be installed in the control panels of the three divisions of the diesel generators of the nuclear power plant (NPP) of Laguna Verde, Unit-1 and Unit-2. This seismic qualification process of the fans was carried out using two specimens that were tested in the seismic table (vibrating) of the Engineering Institute of Universidad Nacional Autonoma de Mexico (UNAM), in accordance with the requirements of the standard IEEE 344-1975, to satisfy the established requirements of seismic qualification in the technical specifications and normative documents required by the nuclear standards, in order to demonstrate its application in the diesel generators Divisions I, II and III of the NPP. The seismic qualification tests were developed on specimens that were retired of the NPP of Laguna Verde recently with a service life of 7.75 years. (Author)

  7. Caffeinated Tube Food Effect on Pilot Performance During a 9-Hour, Simulated Nighttime U-2 Mission

    Science.gov (United States)

    2006-10-01

    first dose), 02:00, 04:00 (second dose), and 06:00. Each dose of tube food contained either caffeinated chocolate pudding (200 mg) or plain chocolate ...on alertness and mood . Psychopharmacol- ogy 1993; 112:359–65. 19. Smith AP. Effects of caffeine on human behaviour. Food Cosmet Toxicol 2002; 40:1243...Journal Article 3. DATES COVERED (From - To) 19 Jun 2002 – 1 Sep 2006 4. TITLE AND SUBTITLE Caffeinated Tube Food Effect on Pilot Performance During a

  8. 46 CFR 54.01-5 - Scope (modifies U-1 and U-2).

    Science.gov (United States)

    2010-10-01

    ... into Classes I, I-L (low temperature), II, II-L (low temperature), and III. Table 54.01-5(b) describes these classes and sets out additional requirements for welded pressure vessels. (c) The requirements for...-177 or part 64 of this chapter. (3) Except as provided in paragraph (c)(4) of this section, Classes I...

  9. Representations of U(2∞ and the Value of the Fine Structure Constant

    Directory of Open Access Journals (Sweden)

    William H. Klink

    2005-12-01

    Full Text Available A relativistic quantum mechanics is formulated in which all of the interactions are in the four-momentum operator and Lorentz transformations are kinematic. Interactions are introduced through vertices, which are bilinear in fermion and antifermion creation and annihilation operators, and linear in boson creation and annihilation operators. The fermion-antifermion operators generate a unitary Lie algebra, whose representations are fixed by a first order Casimir operator (corresponding to baryon number or charge. Eigenvectors and eigenvalues of the four-momentum operator are analyzed and exact solutions in the strong coupling limit are sketched. A simple model shows how the fine structure constant might be determined for the QED vertex.

  10. Oxidation behavior of U-2wt%Nb, Ti, and Ni alloys in air

    International Nuclear Information System (INIS)

    Ju, J. S.; Yoo, K. S.; Jo, I. J.; Gug, D. H.; Su, H. S.; Lee, E. P.; Bang, K. S.; Kim, H. D.

    2003-01-01

    For the long term storage safety study of the metallic spent fuel, U-Nb, U-Ti, U-Ni, U-Zr, and U-Hf simulated metallic uranium alloys, known as corrosion resistant alloys, were fabricated and oxidized in oxygen gas at 200 .deg. C-300 .deg. C. Simulated metallic uranium alloys were more corrosion resistant than pure uranium metal, and corrosion resistance increases Nb, Ni, Ti in that order. The oxidation rates of uranium alloys determined and activation energy was calculated for each alloy. The matrix microstructure of the test specimens were analyzed using OM, SEM, and EPMA. It was concluded that Nb was the best acceptable alloying elements for reducing corrosion of uranium metal considered to suitable as candidate

  11. Postpartum Resumption of Sexual Activity, Sexual Morbidity and ...

    African Journals Online (AJOL)

    Socio‑demographic and obstetric features, menstrual and breastfeeding ... looseness and discharge, loss of sexual desire and bleeding or ..... Abnormal vaginal discharge. 12 .... Borda MR, Winfrey W, McKaig C. Return to sexual activity and ...

  12. Seismic qualification tests of fans of the NPP of Laguna Verde U-1 and U-2; Pruebas de calificacion sismica de ventiladores de la Central Laguna Verde U1 and U2

    Energy Technology Data Exchange (ETDEWEB)

    Jarvio C, G.; Garcia H, E. E.; Arguelles F, R.; Vela H, A. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Naranjo U, J. L., E-mail: gilberto.jarvio@inin.gob.mx [Comision Federal de Electricidad, Gerencia de Centrales Nucleoelectricas, Subgerencia de Ingenieria, Carretera Veracruz-Medellin Km 7.5, Dos Bocas, Veracruz (Mexico)

    2013-10-15

    This work presents the results of the seismic qualification tests applied to the fans that will be installed in the control panels of the three divisions of the diesel generators of the nuclear power plant (NPP) of Laguna Verde, Unit-1 and Unit-2. This seismic qualification process of the fans was carried out using two specimens that were tested in the seismic table (vibrating) of the Engineering Institute of Universidad Nacional Autonoma de Mexico (UNAM), in accordance with the requirements of the standard IEEE 344-1975, to satisfy the established requirements of seismic qualification in the technical specifications and normative documents required by the nuclear standards, in order to demonstrate its application in the diesel generators Divisions I, II and III of the NPP. The seismic qualification tests were developed on specimens that were retired of the NPP of Laguna Verde recently with a service life of 7.75 years. (Author)

  13. Measured air overpressures, soil-particle pressures, and slumps during the pre-ASIAGO U2Ar stemming experiment

    Energy Technology Data Exchange (ETDEWEB)

    Freynik, H.S. Jr.; Roach, D.R.; Dittbenner, G.R.

    1978-01-04

    On November 15, 1976, Lawrence Livermore Laboratory completed its first comprehensive stemming experiment for measuring downhole parameters while varying fill material and rate. Stemming can be defined as backfilling a hole in which a device has been placed to prevent leakage of radioactive materials or gases to the surface. A computer code is being developed for stemming operations, and this experiment was designed to measure parameters under different stemming conditions so the code could be verified and modified. The experiment was conducted in the lower half of a steel-cased, 4-ft-diam, 2000-ft-deep hole at Nevada Test Site. The two stemming materials used in the experiment, Overton sand and LLL II mix, were tested at three fill rates. Significant results of this experiment included successful measurement of downhole air overpressures, vertical and horizontal soil-particle pressures, and temperature. Vertical soil-particle pressures were higher than expected. All surface measurements were valid. The slump-displacement measurements system provided a timing mark to indicate the occurrence of a slump. A major slump occurred on the third day of stemming; a minor slump occurred on the fourth day.

  14. CO Cleavage and CO2 Functionalization under Mild Conditions by a Multimetallic CsU2 Nitride Complex.

    Science.gov (United States)

    Falcone, Marta; Chatelain, Lucile; Scopelliti, Rosario; Mazzanti, Marinella

    2017-04-26

    Novel efficient chemical processes involving cheap and widely accessible carbon dioxide or carbon monoxide under mild conditions for the production of valuable chemical products are highly desirable in the current energetic context. Uranium nitride materials act as high activity catalysts in the Haber-Bosch process but the reactivity of molecular nitride compounds remains unexplored. Here we review recent results obtained in our group showing that a multimetallic nitride complex [Cs{[U(OSi(OtBu)3)3]2(μ-N)}] (1) with a CsUIV-N-UIV core, is able to promote N-C bond formation due to its strong nucleophile behaviour. In particular, complex 1, in the presence of excess CO2 leads to a remarkable dicarbamate product. The multimetallic CsUIV-N-UIV nitride also readily cleaves the C≡O bond under mild conditions.

  15. The U2U Corn Growing Degree Day tool: Tracking corn growth across the US Corn Belt

    Directory of Open Access Journals (Sweden)

    James R. Angel

    2017-01-01

    Full Text Available The Corn Growing Degree Day (Corn GDD tool is a web-based product that can provide decision support on a variety of issues throughout the entire growing season by integrating current conditions, historical climate data, and projections of Corn GDD through the end of the growing season based on both National Weather Service computer model forecasts and climatology. The Corn GDD tool can help agricultural producers make a variety of important decisions before and during the growing season. This support can include: assessing the risk of early and late frosts and freezes that can cause crop damage; comparing corn hybrid maturity requirements and Corn GDD projections to select seed varieties and plan activities such as spraying; guiding marketing decisions based on historical and projected Corn GDDs when considering forward crop pricing (i.e., futures market. The Corn GDD tool provides decision support for corn producers in the central U.S. corn-producing states. Survey results, web statistics, and user feedback indicate that this tool is being actively used by decision makers.

  16. Method and equipment for continuous transformation of UF6 into (NH4)2U2O7

    International Nuclear Information System (INIS)

    Fuller, R.R.

    1975-01-01

    Uranium hexafluoride is, in a three-stage method, transformed into ammonium diuvanate which can be calcined to UO 2 of good ceramic quality. At the solution of UF 6 in water, UO 2 F 2 and HF form in condsiderably acid solution. This aqueous hydrolysis solution is with standardized using NH 4 O 4 (24-29% NH 3 ) at a pH-value between 5.0 and 6.0 and brought into a precipitation tank. The bulk of the ammonium diuvanate then precipitating is drained in the lower portion of the tank and added again to the suspension, close to the surface of the fluid, under intensive pressure. The intensive vigorous revolution of the entire tank content affects the size of the particles and the size of the surface of the precipitating uranate as well. The equipment for the calcination of the ammonium diuvanate is described. The method represents an improvement of the method described in OS 2162578; the pellets produced are more satisfying to critical requirements. (UWI) [de

  17. Targeting Werner syndrome protein sensitizes U-2 OS osteosarcoma cells to selenium-induced DNA damage response and necrotic death

    DEFF Research Database (Denmark)

    Cheng, Wen-Hsing; Wu, Ryan T Y; Wu, Min

    2012-01-01

    to MSeA-induced necrotic death. Co-treatment with the ataxia-telangiectasia mutated (ATM) kinase inhibitor KU55933 desensitized the control shRNA cells, but not WRN shRNA cells, to MSeA treatment. WRN did not affect MSeA-induced ATM phosphorylation on Ser-1981 or H2A.X phosphorylation on Ser-139...

  18. The Investigation of Organization Structure o f t he 2013 U - 2 0 World’s Cup i n Turkey

    Directory of Open Access Journals (Sweden)

    Cengiz ÇIYAN

    2015-08-01

    Full Text Available This research was conducted so as to determine how FIFA U - 20 World Cup 2013 Turkey organization was held; who had what responsibilities; and what kind of difficulties were experienced during the organiz ation. In this research, the data was collected according to qualitative research techniques. The general data of the resea rch was obtained from the articl es and books about this subject and up - to - date web sites; the application of the research was prepared after having a detailed and fac e - to - face interview with organiz ation tournament director in Turkey. At the end of the research, the organiz ation wa s evaluated in general and it was concluded that FIFA succeeded in reaching the standard level in this tournament. Because the stadiums were nice and the floors of them were good; there was a favourable media interest; everyb ody did their jobs really well. In addition, this organisation contributed to the advertising of Turkey. It also helped many cities to have a lot of new plants. The organisation promoted the country’s economic development, as well. However, th e biggest failure of the organiz ation was th at this tournament was the one where there were the fewest spectators with tickets with an average of 5.230 per match among all World Cups under 20 year - olds.

  19. Thermodinamic study the uranium-oxygen system within the composition range 2,61 < O/U < 2,67

    International Nuclear Information System (INIS)

    Caneiro, Alberto.

    1983-01-01

    Oxygen partial pressures (Psub(O2)) as a function of composition and temperature were studied in order to determine the thermodynamic properties of the Uranium-Oxygen (U-O) system. To measure and control Psub(O2), an electrochemical system was used, consisting of an oxygen electrochemical pump and a zirconia gauge which allowed a very accurate determination of the CO + 1/2O 2 = CO 2 reaction. In order to determine oxygen composition, a symmetrical thermogravimetric system a Cahn 1000 electrobalance was constructed and coupled to the system for controlling and measuring Psub(O2) so as to constitute an experimental set-up, which is unique in its type at the present. This facility allowed to determine the thermodynamic properties of the (U-O) system within the composition-temperature range 2,61 3 O 8 ) and of a non-stoichiometric phase (U 8 Osub(21+x)), both being separated by a narrow region of coexistence. Analytical expressions were established for the oxygen chemical potential as a function of composition and temperature, for the stable equilibrium states of the U 8 Osub(21+x) phase and for the metastable ones obtained by oxidation of U 8 Osub(21+x). (M.E.L.) [es

  20. Circulating U2 small nuclear RNA fragments as a novel diagnostic biomarker for pancreatic and colorectal adenocarcinoma

    DEFF Research Database (Denmark)

    Baraniskin, Alexander; Nöpel-Dünnebacke, Stefanie; Ahrens, Maike

    2013-01-01

    Improved non-invasive strategies for early cancer detection are urgently needed to reduce morbidity and mortality. Non-coding RNAs, such as microRNAs and small nucleolar RNAs, have been proposed as biomarkers for non-invasive cancer diagnosis. Analyzing serum derived from nude mice implanted...... with primary human pancreatic ductal adenocarcinoma (PDAC), we identified 15 diagnostic microRNA candidates. Of those miR-1246 was selected based on its high abundance in serum of tumor carrying mice. Subsequently, we noted a cross reactivity of the established miR-1246 assays with RNA fragments derived from U...... that hsa-miR-1246 is likely a pseudo microRNA. In a next step, RNU2-1f was measured by qRT-PCR and normalized to cel-54 in 191 serum/plasma samples from PDAC and colorectal carcinoma (CRC) patients. In comparison to 129 controls, we were able to classify samples as cancerous with a sensitivity...

  1. Measured air overpressures, soil-particle pressures, and slumps during the pre-ASIAGO U2Ar stemming experiment

    International Nuclear Information System (INIS)

    Freynik, H.S. Jr.; Roach, D.R.; Dittbenner, G.R.

    1978-01-01

    On November 15, 1976, Lawrence Livermore Laboratory completed its first comprehensive stemming experiment for measuring downhole parameters while varying fill material and rate. Stemming can be defined as backfilling a hole in which a device has been placed to prevent leakage of radioactive materials or gases to the surface. A computer code is being developed for stemming operations, and this experiment was designed to measure parameters under different stemming conditions so the code could be verified and modified. The experiment was conducted in the lower half of a steel-cased, 4-ft-diam, 2000-ft-deep hole at Nevada Test Site. The two stemming materials used in the experiment, Overton sand and LLL II mix, were tested at three fill rates. Significant results of this experiment included successful measurement of downhole air overpressures, vertical and horizontal soil-particle pressures, and temperature. Vertical soil-particle pressures were higher than expected. All surface measurements were valid. The slump-displacement measurements system provided a timing mark to indicate the occurrence of a slump. A major slump occurred on the third day of stemming; a minor slump occurred on the fourth day

  2. Ultrasonic meters in the feedwater flow to recover thermal power in the reactor of nuclear power plant of Laguna Verde U1 and U2

    International Nuclear Information System (INIS)

    Tijerina S, F.

    2008-01-01

    The engineers in nuclear power plants BWRs and PWRs based on the development of the ultrasonic technology for the measurement of the mass, volumetric flow, density and temperature in fluids, have applied this technology in two primary targets approved by the NRC: the use for the recovery of thermal power in the reactor and/or to be able to realize an increase of thermal power licensed in a 2% (MUR) by 1OCFR50 Appendix K. The present article mentions the current problem in the measurement of the feedwater flow with Venturi meters, which affects that the thermal balance of reactor BWRs or PWRs this underestimated. One in broad strokes describes the application of the ultrasonic technology for the ultrasonic measurement in the flow of the feedwater system of the reactor and power to recover thermal power of the reactor. One is to the methodology developed in CFE for a calibration of the temperature transmitters of RTD's and the methodology for a calibration of the venturi flow transmitters using ultrasonic measurement. Are show the measurements in the feedwater of reactor of the temperature with RTD's and ultrasonic measurement, as well as the flow with the venturi and the ultrasonic measurement operating the reactor to the 100% of nominal thermal power, before and after the calibration of the temperature transmitters and flow. Finally, is a plan to be able to realize a recovery of thermal power of the reactor, showing as carrying out their estimations. As a result of the application of ultrasonic technology in the feedwater of reactor BWR-5 in Laguna Verde, in the Unit 1 cycle 13 it was recover an equivalent energy to a thermal power of 25 MWt in the reactor and an exit electrical power of 6 M We in the turbogenerator. Also in the Unit 2 cycle 10 it was recover an equivalent energy to a thermal power of 40 MWt in the reactor and an exit electrical power of 16 M We in the turbogenerator. (Author)

  3. Unwilling U-U bonding in U-2@C-80: cage-driven metal-metal bonds in di-uranium fullerenes

    Czech Academy of Sciences Publication Activity Database

    Foroutan-Nejad, C.; Vícha, J.; Marek, R.; Patzschke, M.; Straka, Michal

    2015-01-01

    Roč. 17, č. 37 (2015), s. 24182-24192 ISSN 1463-9076 R&D Projects: GA ČR(CZ) GA14-03564S Institutional support: RVO:61388963 Keywords : actinide-actinide bond * endohedral actinide fullerene * cage-driven bonding Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.449, year: 2015 http://pubs.rsc.org/en/content/articlepdf/2015/cp/c5cp04280a

  4. Human regulator of telomere elongation helicase 1 (RTEL1) is required for the nuclear and cytoplasmic trafficking of pre-U2 RNA

    OpenAIRE

    Schertzer , Michael; Jouravleva , Karina; Perderiset , Mylène; Dingli , Florent; Loew , Damarys; Le Guen , Tangui; Bardoni , Barbara; De Villartay , Jean-Pierre; Revy , Patrick; Londono-Vallejo , Arturo

    2015-01-01

    International audience; Hoyeraal-Hreidarsson syndrome (HHS) is a severe form of Dyskeratosis congenita characterized by developmental defects, bone marrow failure and im-munodeficiency and has been associated with telom-ere dysfunction. Recently, mutations in Regulator of Telomere ELongation helicase 1 (RTEL1), a helicase first identified in Mus musculus as being responsible for the maintenance of long telomeres, have been identified in several HHS patients. Here we show that RTEL1 is require...

  5. Ultrasonic meters in the feedwater flow to recover thermal power in the reactor of nuclear power plant of Laguna Verde U1 and U2; Medidores ultrasonicos en el flujo de agua de alimentacion para recuperar potencia termica en el reactor de la Central Nuclear Laguna Verde U1 and U2

    Energy Technology Data Exchange (ETDEWEB)

    Tijerina S, F. [CFE, Central Laguna Verde, Km. 42.5 Carretera Cardel-Nautla, Veracruz (Mexico)]. e-mail: francisco.tijerina@cfe.gob.mx

    2008-07-01

    The engineers in nuclear power plants BWRs and PWRs based on the development of the ultrasonic technology for the measurement of the mass, volumetric flow, density and temperature in fluids, have applied this technology in two primary targets approved by the NRC: the use for the recovery of thermal power in the reactor and/or to be able to realize an increase of thermal power licensed in a 2% (MUR) by 1OCFR50 Appendix K. The present article mentions the current problem in the measurement of the feedwater flow with Venturi meters, which affects that the thermal balance of reactor BWRs or PWRs this underestimated. One in broad strokes describes the application of the ultrasonic technology for the ultrasonic measurement in the flow of the feedwater system of the reactor and power to recover thermal power of the reactor. One is to the methodology developed in CFE for a calibration of the temperature transmitters of RTD's and the methodology for a calibration of the venturi flow transmitters using ultrasonic measurement. Are show the measurements in the feedwater of reactor of the temperature with RTD's and ultrasonic measurement, as well as the flow with the venturi and the ultrasonic measurement operating the reactor to the 100% of nominal thermal power, before and after the calibration of the temperature transmitters and flow. Finally, is a plan to be able to realize a recovery of thermal power of the reactor, showing as carrying out their estimations. As a result of the application of ultrasonic technology in the feedwater of reactor BWR-5 in Laguna Verde, in the Unit 1 cycle 13 it was recover an equivalent energy to a thermal power of 25 MWt in the reactor and an exit electrical power of 6 M We in the turbogenerator. Also in the Unit 2 cycle 10 it was recover an equivalent energy to a thermal power of 40 MWt in the reactor and an exit electrical power of 16 M We in the turbogenerator. (Author)

  6. The University of Amsterdam at TREC 2012

    Science.gov (United States)

    2012-11-01

    lady , weight, ap, loss, major, insurance, rate, role, response, plays, atlanta, rising, oprah, childhood, crescent Table 5: Example topics and their...by the CLARIN-nl program, the Dutch national program COMMIT, the ESF Research Net- work Program ELIAS, the Elite Network Shifts project funded by the...Royal Dutch Academy of Sciences (KNAW), and the Netherlands eScience Center under project number 027.012.105. 6 References [1] Balasubramanian, N. and

  7. tavgU_2d_chm_Fx: MERRA Chem 2D IAU Diagnostics, Fluxes and Meteorology, Diurnal 1.25 x 1 degree V5.2.0 (MATUFXCHM) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The MATUFXCHM or tavgU_3d_chm_Fx data product is the MERRA Data Assimilation System Chemistry 2-Dimensional chemistry that is time averaged, single-level, at reduced...

  8. FeatureViewer, a BioJS component for visualization of position-based annotations in protein sequences [v1; ref status: indexed, http://f1000r.es/2u2

    Directory of Open Access Journals (Sweden)

    Leyla Garcia

    2014-02-01

    Full Text Available Summary: FeatureViewer is a BioJS component that lays out, maps, orients, and renders position-based annotations for protein sequences. This component is highly flexible and customizable, allowing the presentation of annotations by rows, all centered, or distributed in non-overlapping tracks. It uses either lines or shapes for sites and rectangles for regions. The result is a powerful visualization tool that can be easily integrated into web applications as well as documents as it provides an export-to-image functionality. Availability: https://github.com/biojs/biojs/blob/master/src/main/javascript/Biojs.FeatureViewer.js; http://dx.doi.org/10.5281/zenodo.7719

  9. The transport characteristics of "2"3"8U, "2"3"2Th, "2"2"6Ra, and "4"0K in the production cycle of phosphate rock

    International Nuclear Information System (INIS)

    Jung, Yoon Hee; Lim, Jong Myoung; Ji, Young Yong; Chung, Kun Ho; Kang, Mun Ja

    2017-01-01

    Phosphate rock and its by-product are widely used in various industries to produce phosphoric acid, gypsum, gypsum board, and fertilizer. Owing to its high level of natural radioactive nuclides (e.g., 238U and 226Ra), the radiological safety of workers who work with phosphate rock should be systematically managed. In this study, 238U, 232Th, 226Ra, and 40K levels were measured to analyze the transport characteristics of these radionuclides in the production cycle of phosphate rock. Energy dispersive X-ray fluorescence and gamma spectrometry were used to determine the activity of 238U, 232Th, 226Ra, and 40K. To evaluate the extent of secular disequilibrium, the analytical results were compared using statistical methods. Finally, the distribution of radioactivity across different stages of the phosphate rock production cycle was evaluated. The concentration ratios of 226Ra and 238U in phosphate rock were close to 1.0, while those found in gypsum and fertilizer were extremely different, reflecting disequilibrium after the chemical reaction process. The nuclide with the highest activity level in the production cycle of phosphate rock was 40K, and the median 40K activity was 8.972 Bq·g−1 and 1.496 Bq·g−1, respectively. For the 238U series, the activity of 238U and 226Ra was greatest in phosphate rock, and the distribution of activity values clearly showed the transport characteristics of the radionuclides, both for the byproducts of the decay sequences and for their final products. Although the activity of 40K in k-related fertilizer was relatively high, it made a relatively low contribution to the total radiological effect. However, the activity levels of 226Ra and 238U in phosphate rock were found to be relatively high, near the upper end of the acceptable limits. Therefore, it is necessary to systematically manage the radiological safety of workers engaged in phosphate rock processing

  10. Technical assistance in relationship with the reloading analysis of the Laguna Verde Unit 2 reactor. Executive abstract; Asistencia tecnica en relacion con el analisis de recargas de la CNLV U-2

    Energy Technology Data Exchange (ETDEWEB)

    Alonso V, G.; Castro B, M.; Gallegos E, R.; Hernandez L, H.; Montes T, J.L.; Ortiz S, J. J.; Perusquia C, R. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1993-11-15

    The objective of the report was to carry out a comparative analysis of costs of energy generation among the designs GE9B of General Electric, 9X9-IX of SIEMENS and SVEA-96 of ABB ATOM, proposed to be used as recharge fuel in the Unit 2 of the Laguna Verde Nuclear Power station. (Author)

  11. Solubility Determination of Uranium (IV) Oxalates U(C2O4)2.6H2O and M2U2(C2O4)5.nH2O (M = mono-charged cation)

    International Nuclear Information System (INIS)

    Costenoble, Sylvain; Grandjean, Stephane; Arab-Chapelet, Benedicte; Abraham, Francis

    2008-01-01

    The solubility of uranium (IV) oxalate compounds was studied in order to have a precise insight of the behaviour of An(IV)-An(III) (An(IV) = U, Np or Pu and An(III) = Pu or Am) mixed oxalate in the context of oxalic co-conversion for actinide co-management. Concepts of thermodynamics of aqueous-solid solution are reviewed by introducing LIPPMANN theory and THORSTENSON and PLUMMER 'stoichiometric saturation' model in a way to understand and model the system of interest. Different analytical techniques have been developed in order to titrate uranium and/or other actinides at trace levels in solution. This thorough investigation is the basis of further experiments on the solubility of mixed U(IV)- An(III) oxalate solid solutions as a function of the nature of the trivalent actinide and the An(III)/U(IV) ratio. (authors)

  12. Multivariate Regression of Liver on Intestine of Mice: A ...

    African Journals Online (AJOL)

    FIRST LADY

    pairs recovered. Linear, semi-logarithmic and logarithmic-logarithmic (log- log) regressions were performed. He chose the log-log curves because its variance was more uniform. The statistical comparison of .... E(U1| U2 = u2) is the regression function of U1 on U2, and Var (U1|U2 = u2) is the conditional covariance matrix.

  13. Membrane potential and conductance of frog skin gland acinar cells in resting conditions and during stimulation with agonists of macroscopic secretion

    DEFF Research Database (Denmark)

    Sørensen, Jakob B.; Larsen, Erik Hviid

    1999-01-01

    Adrenaline; carbachol; Cl- secretion; exocrine gland; isoproterenol; noradrenaline; prostaglandin E*U2......Adrenaline; carbachol; Cl- secretion; exocrine gland; isoproterenol; noradrenaline; prostaglandin E*U2...

  14. A note on stability of motion of a projectile

    Indian Academy of Sciences (India)

    Springer Verlag Heidelberg #4 2048 1996 Dec 15 10:16:45

    S D Naik. K3 = −ε. (. B ς2f1p + g1. K2 t. ) +. ( gxl u. )2. + gxl u2 ε. K2 t g2 − ε. ( gxl u2. ) (. 2CA − f1. ) ,. K4 = εςB. (. CA − f1 + g1p. K2 t. ) − B ς. ( gxl u2. ) − ες. ( gxl u2. )(.

  15. Self-consistent chaos in the beam-plasma instability

    International Nuclear Information System (INIS)

    Tennyson, J.L.; Meiss, J.D.

    1993-01-01

    The effect of self-consistency on Hamiltonian systems with a large number of degrees-of-freedom is investigated for the beam-plasma instability using the single-wave model of O'Neil, Winfrey, and Malmberg.The single-wave model is reviewed and then rederived within the Hamiltonian context, which leads naturally to canonical action- angle variables. Simulations are performed with a large (10 4 ) number of beam particles interacting with the single wave. It is observed that the system relaxes into a time asymptotic periodic state where only a few collective degrees are active; namely, a clump of trapped particles oscillating in a modulated wave, within a uniform chaotic sea with oscillating phase space boundaries. Thus self-consistency is seen to effectively reduce the number of degrees- of-freedom. A simple low degree-of-freedom model is derived that treats the clump as a single macroparticle, interacting with the wave and chaotic sea. The uniform chaotic sea is modeled by a fluid waterbag, where the waterbag boundaries correspond approximately to invariant tori. This low degree-of-freedom model is seen to compare well with the simulation

  16. Prostaglandin E2 release from dermis regulates sodium permeability of frog skin epithelium

    DEFF Research Database (Denmark)

    Rytved, Klaus A.; Brodin, Birger; Nielsen, Robert

    1995-01-01

    Arachidonic acid, cAMP, epithelium, frog skin, intracellular calcium, prostaglandin E*U2, sodium transport, tight epithelium.......Arachidonic acid, cAMP, epithelium, frog skin, intracellular calcium, prostaglandin E*U2, sodium transport, tight epithelium....

  17. Plaadid / Toomas Puna

    Index Scriptorium Estoniae

    Puna, Toomas, 1975-

    2007-01-01

    Uutest heliplaatidest Electronic "Get the message", U2 "U2: 18 singles", Jamiroquai "High Times", Sugababes "Overloaded", Staind "1996-2006 The Singles", Crowded House "Farewelll to the world", "Rock romantika"

  18. A note on analytical solutions of nonlinear fractional 2D heat ...

    Indian Academy of Sciences (India)

    2016-09-09

    Sep 9, 2016 ... In the same way, um(x,t) for m = 4,5,6,... can be obtained using symbolic mathematics package/ symbolic computation software such as Mathematica. For example, to compute u3(x,t), the following for- mula is used: u3(x,y,t) = χ. ∗. 3 u2 +hI α t. [. Pα t u2 −u0(u2)xx −u1(u1)xx. −u2(u0)xx − 2(u0)x(u2)x − (u1). 2.

  19. A Case Study of the Neti Pot's Rise, Americanization, and Rupture as Integrative Medicine in U.S. Media Discourse.

    Science.gov (United States)

    Ho, Evelyn Y; Cady, Kathryn A; Robles, Jessica S

    2016-10-01

    In a period of only one decade in the United States, the neti pot shifted from obscure Ayurvedic health device to mainstream complementary and integrative medicine (CIM), touted by celebrities and sold widely in drug stores. We examine the neti pot as a case study for understanding how a foreign health practice became mainstreamed, and what that process reveals about more general discourses of health in the United States. Using discourse analysis of U.S. popular press and new media news (1999-2012) about the neti pot, we trace the development of discourses from neti's first introduction in mainstream news, through the hype following Dr. Oz's presentation on Oprah, to 2011 when two adults tragically died after using Naegleria fowleri amoeba-infested tap water in their neti pots. Neti pot discourses are an important site for communicative analysis because of the pot's complexity as an intercultural artifact: Neti pots and their use are enfolded into the biomedical practice of nasal irrigation and simultaneously Orientalized as exotic/magical and suspect/dangerous. This dual positioning as normal and exotic creates inequitable access for using the neti pot as a resource for increasing cultural health capital (CHC). This article contributes to work that critically theorizes the transnationalism of CIM, as the neti pot became successfully Americanized. These results have implications for understanding global health practices' incorporation or co-optation in new contexts, and the important role that popularly mediated health communication can play in framing what health care products and practices mean for consumers.

  20. "Less Than A Wife": A Study of Polycystic Ovary Syndrome Content in Teen and Women's Digital Magazines.

    Science.gov (United States)

    Sanchez, Ninive; Jones, Hillary

    2016-06-02

    Polycystic ovary syndrome (PCOS) is a major public health problem that affects women's physical and mental health. According to the US National Institutes of Health Office of Disease Prevention, there is a need to improve public awareness of the syndrome among health care providers and the public. Women's magazines are a type of "edutainment" that publish health content in addition to beauty, fashion, and entertainment content. These media have the potential to expose primarily female readers to content on PCOS and influence readers' beliefs and attitudes about women with PCOS. The objective of this study was to explore how digital (online) teen and women's magazines portray women with PCOS. We used data from the Alliance for Audited Media to identify popular digital teen and women's magazines with circulation rates ≥1,000,001. We also included magazines with circulation rates 100,001-1,000,000 directed toward racial and ethnic minority readers. A search of magazine websites over a 1-month period in 2015 yielded 21 magazines (eg, Glamour, Cosmopolitan en Español, Essence, and O, The Oprah Magazine) and 170 articles containing "PCOS" and "polycystic ovary syndrome." Textual analysis using a grounded theory approach was used to identify themes. Articles depicted PCOS symptoms as a hindrance to women's social roles as wives and mothers and largely placed personal responsibility on women to improve their health. To a lesser extent, women were depicted as using their personal experience with PCOS to advocate for women's health. Experiences of Latina and African American women and adolescents with PCOS were absent from women's magazine articles. The findings can inform health education programs that teach women to be critical consumers of PCOS-related content in digital women's magazines. Future research on PCOS content in digital teen and women's magazines can help researchers, patients, and consumer groups engage with the media to increase public awareness of PCOS.

  1. Rigidity of minimal submanifolds with flat normal bundle

    Indian Academy of Sciences (India)

    Rigidity of minimal submanifolds with flat normal bundle. 461. = a. ∫. M u2(1+q)+ 2 a f 2 − 2. ∫. M u2q+1f 〈∇f, ∇u〉. − (2q + 1). ∫. M u2qf 2|∇u|2, which gives a .... that depends on n, ϵ and q. We now try to transform (2.15) the right hand side only involved u in the power two. For that, we use Young's inequality: ab ≤ βsas.

  2. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QIQKDFDLFYQDIFVHVAKLGQINDMAVCENENHLSGHVYIKFNDYNDAI 262 ... DENHPVLTDEQIQKDFDLFYQDIFVHVAKLGQINDMA...VCENENHLSGHVYIKFNDYNDAI Sbjct: 1 ... DENHPVLTDEQIQKDFDLFYQDIFVHVAKLGQINDMAVCENENHLSGHVYIKFNDYNDAI 60 ... ...osomal U2AF small subunit ... [Candida albicans SC5314] ... Length = 82 ... Query: 203 DENHPVLTDE

  3. New exact solutions for two nonlinear equations

    International Nuclear Information System (INIS)

    Wang Quandi; Tang Minying

    2008-01-01

    In this Letter, we investigate two nonlinear equations given by u t -u xxt +3u 2 u x =2u x u xx +uu xxx and u t -u xxt +4u 2 u x =3u x u xx +uu xxx . Through some special phase orbits we obtain four new exact solutions for each equation above. Some previous results are extended

  4. Dual Mechanism of Action of Resveratrol in Notch Signaling ...

    African Journals Online (AJOL)

    activation of Notch signaling in osteosarcoma cells. ... HeyL in U2OS cells. Treatment of U2OS cells with 20 µM concentration of resveratrol for 48 h induced a ... Cell lines and culture .... concentration of resveratrol required for induced.

  5. RNA processing and ribonucleoprotein assembly studied in vivo by RNA transfection

    International Nuclear Information System (INIS)

    Kleinschmidt, A.M.; Pederson, T.

    1990-01-01

    The authors present a method for studying RNA processing and ribonucleoprotein assembly in vivo, by using RNA synthesized in vitro. SP6-transcribed 32 P-labeled U2 small nuclear RNA precursor molecules were introduced into cultured human 293 cells by calcium phosphate-mediated uptake, as in standard DNA transfection experiments. RNase protection mapping demonstrated that the introduced pre-U2 RNA underwent accurate 3' end processing. The introduced U2 RNA was assembled into ribonucleoprotein particles that reacted with an antibody specific for proteins known to be associated with the U2 small nuclear ribonucleoprotein particle. The 3' end-processed, ribonucleoprotein-assembled U2 RNA accumulated in the nuclear fraction. When pre-U2 RNA with a 7-methylguanosine group at the 5' end was introduced into cells, it underwent conversion to a 2,2,7-trimethylguanosine cap structure, a characteristic feature of the U-small nuclear RNAs. Pre-U2 RNA introduced with an adenosine cap (Ap-ppG) also underwent processing, small nuclear ribonucleoprotein assembly, and nuclear accumulation, establishing that a methylated guanosine cap structure is not required for these steps in U2 small nuclear ribonucleprotein biosynthesis. Beyond its demonstrated usefulness in the study of small nuclear ribonucleoprotein biosynthesis, RNA transfection may be of general applicability to the investigation of eukaryotic RNA processing in vivo and may also offer opportunities for introducing therapeutically targeted RNAs (ribozymes or antisense RNA) into cells

  6. Blinding the Eagle: Potential Loss of Strategic ISR in the 21st Century

    Science.gov (United States)

    2016-03-08

    Military Strategy of the United States of America2015, p. 9 43 HAF, FY16-20 Planning Choices High Altitude Transition, p.1 44 Mahta , Aaron. “Who to...test U-2 sensors on Global Hawk. IHS Jane’s Defence Weekly. 29 April 2015 Mahta , Aaron. “Who to Save? Battle Between U-2 Spyplane and GLOBAL HAWK

  7. Sequence Classification: 893627 [

    Lifescience Database Archive (English)

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|6325043|ref|NP_015111.1| Component of U2 snRNP; disrupti...on causes reduced U2 snRNP levels; physically interacts with Msl1p; putative homolo

  8. Spectral properties of the accretion discs around rotating black holes

    Indian Academy of Sciences (India)

    Samir Mandal

    2018-02-10

    Feb 10, 2018 ... spectral characteristics due to a free-fall flow and a transonic flow. We notice significant ..... (iii) pressure balance: W+ + + u2. + = W− + − u2. − ... this hot and dense flow controls the high energy spectral characteristic of the ...

  9. Coordinates of the quantum plane as q-tensor operators in Uq (su(2) * su(2))

    International Nuclear Information System (INIS)

    Biedenharn, L.C.; Lohe, M.A.

    1995-01-01

    The relation between the set of transformations M q (2) of the quantum plane and the quantum universal enveloping algebra U q (u(2)) is investigated by constructing representations of the factor algebra U q (u(2) * u(2)). The non-commuting coordinates of M q (2), on which U q (2) * U q (2) acts, are realized as q-spinors with respect to each U q (u(2)) algebra. The representation matrices of U q (2) are constructed as polynomials in these spinor components. This construction allows a derivation of the commutation relations of the noncommuting coordinates of M q (2) directly from properties of U q (u(2)). The generalization of these results to U q (u(n)) and M q (n) is also discussed

  10. “Less Than A Wife”: A Study of Polycystic Ovary Syndrome Content in Teen and Women’s Digital Magazines

    Science.gov (United States)

    Jones, Hillary

    2016-01-01

    Background Polycystic ovary syndrome (PCOS) is a major public health problem that affects women’s physical and mental health. According to the US National Institutes of Health Office of Disease Prevention, there is a need to improve public awareness of the syndrome among health care providers and the public. Women’s magazines are a type of “edutainment” that publish health content in addition to beauty, fashion, and entertainment content. These media have the potential to expose primarily female readers to content on PCOS and influence readers’ beliefs and attitudes about women with PCOS. Objective The objective of this study was to explore how digital (online) teen and women’s magazines portray women with PCOS. Methods We used data from the Alliance for Audited Media to identify popular digital teen and women’s magazines with circulation rates ≥1,000,001. We also included magazines with circulation rates 100,001–1,000,000 directed toward racial and ethnic minority readers. A search of magazine websites over a 1-month period in 2015 yielded 21 magazines (eg, Glamour, Cosmopolitan en Español, Essence, and O, The Oprah Magazine) and 170 articles containing “PCOS” and “polycystic ovary syndrome.” Textual analysis using a grounded theory approach was used to identify themes. Results Articles depicted PCOS symptoms as a hindrance to women’s social roles as wives and mothers and largely placed personal responsibility on women to improve their health. To a lesser extent, women were depicted as using their personal experience with PCOS to advocate for women’s health. Experiences of Latina and African American women and adolescents with PCOS were absent from women’s magazine articles. Conclusions The findings can inform health education programs that teach women to be critical consumers of PCOS-related content in digital women’s magazines. Future research on PCOS content in digital teen and women’s magazines can help researchers

  11. Когнитивно - дискурсивные аспекты функционирования англо - американских паремий в дискурсе печатного интервью - портрета

    OpenAIRE

    Константинова, А.

    2011-01-01

    В статье представлены результаты исследования, посвященного изучению процесса функционирования паремий в дискурсе печатного интервью-портрета и выполненного в рамках когнитивно-дискурсивного подхода. Материалом послужили интервью-портреты О. Уинфри, опубликованные в журнале «O, The Oprah Magazine». Выявлены особенности дискурса интервью-портрета О. Уинфри, описаны когнитивно-дискурсивные функции, выполняемые в нем паремиями....

  12. Exact solitary and periodic wave solutions for a generalized nonlinear Schroedinger equation

    International Nuclear Information System (INIS)

    Sun Chengfeng; Gao Hongjun

    2009-01-01

    The generalized nonlinear Schroedinger equation (GNLS) iu t + u xx + β | u | 2 u + γ | u | 4 u + iα (| u | 2 u) x + iτ(| u | 2 ) x u = 0 is studied. Using the bifurcation of travelling waves of this equation, some exact solitary wave solutions were obtained in [Wang W, Sun J,Chen G, Bifurcation, Exact solutions and nonsmooth behavior of solitary waves in the generalized nonlinear Schroedinger equation. Int J Bifucat Chaos 2005:3295-305.]. In this paper, more explicit exact solitary wave solutions and some new smooth periodic wave solutions are obtained.

  13. Flavour physics and flavour symmetries after the first LHC phase

    International Nuclear Information System (INIS)

    Barbieri, R.; Buttazzo, D.; Sala, F.; Straub, D.M.

    2014-01-01

    Based on flavour symmetries only, there are two ways to give rise to an effective description of flavour physics in the quark sector close to the CKM picture: one is based on U(3)_q×U(3)_u×U(3)_d (or equivalent) and the other on U(2)_q×U(2)_u×U(2)_d (or equivalent). In this context we analyze the current status of flavour physics measurements and we compare their impact, in the specific case of supersymmetry, with the direct searches of new particles at the LHC, present or foreseen

  14. Characterization of High Altitude Turbulence for Air Force Platforms

    National Research Council Canada - National Science Library

    Ruggiero, Frank H; Werne, Joe; Mahalov, Alex; Nichols, Basil; Wroblewski, Donald E

    2007-01-01

    ...) on systems that operate at or propagate through those attitudes. Examples of systems affected by HAT include surveillance aircraft such as the U-2 and the unmanned Global Hawk, developing weapons systems such as the Airborne Laser (ABL...

  15. tavgM_2d_ocn_Nx: MERRA 2D IAU Ocean Surface Diagnostic, Diurnal 0.667 x 0.5 degree V5.2.0 (MATUNXOCN) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The MATUNXOCN or tavgU_2d_ocn_Nx data product is the MERRA Data Assimilation System 2-Dimensional ocean surface single-level diagnostics that is monthly mean...

  16. DVD-muusika / Mart Normet

    Index Scriptorium Estoniae

    Normet, Mart, 1979-

    2005-01-01

    Uutest heliplaatidest U2 "Vertigo 2005: Live in Chicago", Alicia Keys "Unplugged", Within Temptation "The Silent Force Tour", Usher "Behind The Truth: Truth Tour", Kylie Minogue "Showgirl", Erasure "Live In Cologne", Jon Anderson "Tour Of The Universe"

  17. Data of evolutionary structure change: 1A0UA-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A0UA-2ZLWD 1A0U 2ZLW A D -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...R VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL.../index> 2ZLW D 2ZLWD

  18. 78 FR 44106 - Combined Notice of Filings #1

    Science.gov (United States)

    2013-07-23

    .... Applicants: CMS Energy Resource Management Company. Description: CMS ERM Company--MBR--Compliance to be.... Docket Numbers: ER13-1981-000. Applicants: PJM Interconnection, L.L.C. Description: Queue Positions U2...

  19. MERRA 2D IAU Diagnostic, Surface Fluxes, Diurnal (2/3x1/2L1) V5.2.0

    Data.gov (United States)

    National Aeronautics and Space Administration — The MATUNXFLX or tavgU_2d_flx_Nx data product is the MERRA Data Assimilation System 2-Dimensional surface turbulence flux diagnostic that is time averaged...

  20. Muusika : Muusika igaks asendiks ja meeleoluks. Plaadid kauplusest Lasering

    Index Scriptorium Estoniae

    2005-01-01

    Heliplaatidest: Robbie Williams "Greatest Hits", Gotan Project "Insipracion Espiracion", Manic Street Preachers "Lifeblood", Daddy G "DJ Kicks", Eminem "Encore", Kalm "Generalissimus Kalm", U2 "How to dismantle an atomic bomb"

  1. Thermal properties of nonstoichiometry uranium dioxide

    Science.gov (United States)

    Kavazauri, R.; Pokrovskiy, S. A.; Baranov, V. G.; Tenishev, A. V.

    2016-04-01

    In this paper, was developed a method of oxidation pure uranium dioxide to a predetermined deviation from the stoichiometry. Oxidation was carried out using the thermogravimetric method on NETZSCH STA 409 CD with a solid electrolyte galvanic cell for controlling the oxygen potential of the environment. 4 samples uranium oxide were obtained with a different ratio of oxygen-to-metal: O / U = 2.002, O / U = 2.005, O / U = 2.015, O / U = 2.033. For the obtained samples were determined basic thermal characteristics of the heat capacity, thermal diffusivity, thermal conductivity. The error of heat capacity determination is equal to 5%. Thermal diffusivity and thermal conductivity of the samples decreased with increasing deviation from stoichiometry. For the sample with O / M = 2.033, difference of both values with those of stoichiometric uranium dioxide is close to 50%.

  2. MERRA 2D IAU Diagnostic, Vertical Integrals and Budget Terms, Diurnal (2/3x1/2L1) V5.2.0

    Data.gov (United States)

    National Aeronautics and Space Administration — The MATUNXINT or tavgU_2d_int_Nx data product is the MERRA Data Assimilation System 2-Dimensional vertical integral that is time averaged single-level at the native...

  3. MERRA 2D IAU Diagnostic, Radiation Surface and TOA, Diurnal (2/3x1/2L1) V5.2.0

    Data.gov (United States)

    National Aeronautics and Space Administration — The MATUNXRAD or tavgU_2d_rad_Nx data product is the MERRA Data Assimilation System 2-Dimensional surface and TOA radiation flux that is time averaged single-level...

  4. MERRA IAU 2D Vertical Integrals and Budget Terms, Instantaneous Diurnal (2/3x1/2L1) V5.2.0

    Data.gov (United States)

    National Aeronautics and Space Administration — The MAIUNXINT or instU_2d_int_Nx data product is the MERRA Data Assimilation System 2-Dimensional vertical integral that is time averaged single-level at the native...

  5. MERRA 2D IAU Diagnostic, Single Level Meteorology, Diurnal (2/3x1/2L1) V5.2.0

    Data.gov (United States)

    National Aeronautics and Space Administration — The MATUNXSLV or tavgU_2d_slv_Nx data product is the MERRA Data Assimilation System 2-Dimensional atmospheric single-level diagnostics that is time averaged...

  6. MERRA 2D IAU Ocean Surface Diagnostic, Single Level, Diurnal (2/3x1/2L1) V5.2.0

    Data.gov (United States)

    National Aeronautics and Space Administration — The MATUNXOCN or tavgU_2d_ocn_Nx data product is the MERRA Data Assimilation System 2-Dimensional ocean surface single-level diagnostics that is monthly mean...

  7. SwissProt search result: AK105856 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105856 001-203-H06 (Q890U2) Glucosamine--fructose-6-phosphate aminotransferase [i...) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph GLMS_CLOTE 1e-50 ...

  8. Phenomena of Blowup and Global Existence of the Solution to a Nonlinear Schrödinger Equation

    Directory of Open Access Journals (Sweden)

    Xiaowei An

    2013-01-01

    Full Text Available We consider the following Cauchy problem: -iut=Δu-V(xu+f(x,|u|2u+(W(x⋆|u|2u, x∈ℝN,t>0, u(x, 0=u0(x,x∈ℝN, where V(x and W(x are real-valued potentials and V(x≥0 and W(x is even, f(x,|u|2 is measurable in x and continuous in |u|2, and u0(x is a complex-valued function of x. We obtain some sufficient conditions and establish two sharp thresholds for the blowup and global existence of the solution to the problem.

  9. Effect of Spent Lubricating Oil on the Composition and Abundance ...

    African Journals Online (AJOL)

    Journal of Applied Sciences and Environmental Management ... The Modified Berlese-Tullgren Funnel method was used for the extraction of soil arthropod fauna. ... Soil arthropod taxa and abundance were significantly lower (u(2) = 51, ...

  10. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4748 >orf19.4748; Contig19-10215; complement(47336.....47731); MSL1*; U2 snRNA-associated protein; MPSTKRSSSTEYSHKDSKKKVKLDYVNLKPSQTLYVKNLNTKINKKILLHNLYLLFSAFGDIISINLQNGFAFIIFSNLNSATLALRNLKNQDFFDKPLVLNYAVKESKAISQEKQKLQDENDEEVMPSYE*

  11. Task 1: Correlation of satellite and ground data in air pollution studies. Task 2: Investigation to relate the chlorophyll and suspended sediment content in the waters of the lower Chesapeake Bay to ERTS-1 imagery. Task 3: The use of ERTS-1 to more fully utilize and apply marine station data to the study of productivity along the Eastern Shelf expanded waters of the United States

    Science.gov (United States)

    Copeland, G. E. (Principal Investigator); Bandy, A. R.; Fleischer, P.; Ludwick, J. C. (Principal Investigator); Hanna, W. J.; Gosink, T. A.; Bowker, D. W.; Marshall, H. G. (Principal Investigator)

    1972-01-01

    The author has identified the following significant results. Analysis of U-2 imagery of CARETS site indicates smoke plumes can be easily detected. First look at selected ERTS-1 color composites demonstrates plumes from forest fires can be detected.

  12. George Smoot

    Science.gov (United States)

    instruments carried by balloon, on U-2 spy planes, and finally by satellite, Smoot has spent the last twenty discussing philosophy. He detailed the history of cosmology and his own experiences studying the universe in

  13. Meson-mass generation by instantons, 2

    Energy Technology Data Exchange (ETDEWEB)

    Saito, T [Kyoto Prefectural Univ. of Medicine (Japan); Shigemoto, K

    1979-05-01

    In a previous work we discussed how pseudo-scalar mesons and scalar mesons acquire their masses by instantons in the colored gauge field. We considered there the two-flavor model with chiral U(2) x U(2) symmetry. In the present paper the same problem is discussed, including the chiral flavor U(3) x U(3) symmetry. An importance of non-local effects due to instantons is emphasized.

  14. Custodial vector model

    Science.gov (United States)

    Becciolini, Diego; Franzosi, Diogo Buarque; Foadi, Roshan; Frandsen, Mads T.; Hapola, Tuomas; Sannino, Francesco

    2015-07-01

    We analyze the Large Hadron Collider (LHC) phenomenology of heavy vector resonances with a S U (2 )L×S U (2 )R spectral global symmetry. This symmetry partially protects the electroweak S parameter from large contributions of the vector resonances. The resulting custodial vector model spectrum and interactions with the standard model fields lead to distinct signatures at the LHC in the diboson, dilepton, and associated Higgs channels.

  15. Thermodynamic data for uranium fluorides

    International Nuclear Information System (INIS)

    Leitnaker, J.M.

    1983-03-01

    Self-consistent thermodynamic data have been tabulated for uranium fluorides between UF 4 and UF 6 , including UF 4 (solid and gas), U 4 F 17 (solid), U 2 F 9 (solid), UF 5 (solid and gas), U 2 F 10 (gas), and UF 6 (solid, liquid, and gas). Included are thermal function - the heat capacity, enthalpy, and free energy function, heats of formation, and vaporization behavior

  16. checkCIF/PLATON report Datablock: complex1

    Indian Academy of Sciences (India)

    Moiety formula C16 H20 N10 O8 U, 2(H2 O) C16 H20 N10 O8 U, 2(H2 O) ... PLAT250_ALERT_2_C Large U3/U1 Ratio for Average U(i,j) Tensor .... 2.7 ... outliers and unusual parameters, but every test has its limitations and alerts that are not ...

  17. Metal-metal bonds involving the f elements. 4. Molecular orbital studies of metal-metal and metal-ligand interactions in dinuclear uranium(V) systems

    International Nuclear Information System (INIS)

    Cayton, R.H.; Novo-Gradac, K.J.; Bursten, B.E.

    1991-01-01

    The electronic structures of a series of dinuclear uranium(V) complexes have been investigated using Xα-SW molecular orbital calculations including quasirelativistic corrections. Complexes of the formula U 2 H 10 and U 2 (OH) 10 were used to model the metal-ligand σ and π interactions, respectively, in the known species U 2 (O-i-Pr) 10 . Two basic geometries were investigated: a vertex-sharing bioctahedron with only terminal ligands (D 4h symmetry) and an edge-sharing bioctahedron containing two bridging ligands (D 2h symmetry). The latter geometry, which is that of U 2 (O-i-Pr) 10 , was also examined at U-U bonding and nonbonding distances. The calculations indicate that the U-U interactions are significantly perturbed when H is replaced by OH, owing to strong donation from the OH pπ orbitals into selected U 5f orbitals. The result is a lack of any appreciable U-U interaction for U 2 (OH) 10 in either the D 4h or D 2h geometry. In addition, the overall OH π donation to the U 5f levels is enhanced in the D 2h geometry. The electronic structure of a hypothetical U(V) dimer, Cp 2 U 2 O 4 , was also examined in both bridged and unsupported geometries. The unbridged geometry, like that for U 2 (OH) 10 , suffered from a destabilization of the U-U σ orbital due to ligand π donation and revealed no net U-U bonding. However, the geometry exhibiting two bridging oxo ligands maintains the U-U σ-bonding MO as its lowest energy U 5f orbital. 21 refs., 8 figs., 8 tabs

  18. First observations of tritium in ground water outside chimneys of underground nuclear explosions, Yucca Flat, Nevada Test Site

    International Nuclear Information System (INIS)

    Crow, N.B.

    1976-01-01

    Abnormal levels of radionuclides had not been detected in ground water at the Nevada Test Site beyond the immediate vicinity of underground nuclear explosions until April 1974, when above-background tritium activity levels were detected in ground-water inflow from the tuff beneath Yucca Flat to an emplacement chamber being mined in hole U2aw in the east-central part of Area 2. No other radionuclides were detected in a sample of water from the chamber. In comparison with the amount of tritium estimated to be present in the ground water in nearby nuclear chimneys, the activity level at U2aw is very low. To put the tritium activity levels at U2aw into proper perspective, the maximum tritium activity level observed was significantly less than the maximum permissible concentration (MPC) for a restricted area, though from mid-April 1974 until the emplacement chamber was expended in September 1974, the tritium activity exceeded the MPC for the general public. Above-background tritium activity was also detected in ground water from the adjacent exploratory hole, Ue2aw. The nearest underground nuclear explosion detonated beneath the water table, believed to be the source of the tritium observed, is Commodore (U2am), located 465 m southeast of the emplacement chamber in U2aw. Commodore was detonated in May 1967. In May 1975, tritium activity May significantly higher than regional background. was detected in ground water from hole Ue2ar, 980 m south of the emplacement chamber in U2aw and 361 m from a second underground nuclear explosion, Agile (U2v), also detonated below the water table, in February 1967. This paper describes these occurrences of tritium in the ground water. A mechanism to account for the movement of tritium is postulated

  19. Effect and Mechanism of EGFL7 Downregulation in Human Osteosarcoma Cells on the Biological Function of Co-cultured HUVEC

    Directory of Open Access Journals (Sweden)

    Xia Li

    2018-03-01

    Full Text Available Background: Even though epidermal growth factor-like domain 7 is known to be overexpressed in osteosarcoma and is associated with poor clinical outcome, few reports are available regarding its mechanism. Aims: The objective of this study was to explore the effect and mechanism of downregulating epidermal growth factor-like domain 7 expression in a human osteosarcoma cell line on the biological function of co-cultured human umbilical vein endothelial cells. Study Design: Cell study. Methods: In the present study, human osteosarcoma cell lines U2OS, Saos-2, HOS, and MG63, and normal human osteoblasts were cultured in Dulbecco’s Modified Eagle Medium containing 10% fetal bovine serum and 1x antibiotics at 37 °C and 5% CO2 in an incubator. Of the four osteosarcoma cell lines, U2OS expresses the highest level of epidermal growth factor-like domain 7 mRNA as determined using quantitative reverse transcription polymerase chain reaction. With the knockdown of epidermal growth factor-like domain 7 in U2OS and human umbilical vein endothelial cells by lentivirus, the proliferation and apoptosis of U2OS and human umbilical vein endothelial cells were investigated using MTT and flow cytometry assays. After the co-culture of human umbilical vein endothelial cells and epidermal growth factor-like domain 7-knockdown U2OS, the in vitro effects on cell proliferation, apoptosis, adhesion, migration, and the angiogenic ability of human umbilical vein endothelial cells were detected using MTT, flow cytometry, Transwell, and tube formation assays, respectively. The expressions of phosphoinositide 3-kinase, phospho-Akt, total Akt, and vascular endothelial growth factor in human umbilical vein endothelial cells were detected using western blot assay. Results: Lentivirus with epidermal growth factor-like domain 7 shRNA could not significantly affect the proliferation and apoptosis of both U2OS and human umbilical vein endothelial cells, whereas the knockdown of

  20. Evidence That Graves' Ophthalmopathy Immunoglobulins Do Not Directly Activate IGF-1 Receptors.

    Science.gov (United States)

    Marcus-Samuels, Bernice; Krieger, Christine C; Boutin, Alisa; Kahaly, George J; Neumann, Susanne; Gershengorn, Marvin C

    2018-05-01

    Graves' ophthalmopathy (GO) pathogenesis involves thyrotropin (TSH) receptor (TSHR)-stimulating autoantibodies. Whether there are autoantibodies that directly stimulate insulin-like growth factor 1 receptors (IGF-1Rs), stimulating insulin-like growth factor receptor antibodies (IGFRAbs), remains controversial. This study attempted to determine whether there are stimulating IGFRAbs in patients with GO. Immunoglobulins (Igs) were purified from normal volunteers (NV-Igs) and patients with GO (GO-Igs). The effects of TSH, IGF-1, NV-Igs, and GO-Igs on pAKT and pERK1/2, members of pathways used by IGF-1R and TSHR, were compared in orbital fibroblasts from GO patients (GOFs) and U2OS-TSHR cells overexpressing TSHRs, and U2OS cells that express TSHRs at very low endogenous levels. U2OS-TSHR and U2OS cells were used because GOFs are not easily manipulated using molecular techniques such as transfection, and U2OS cells because they express TSHRs at levels that do not measurably stimulate signaling. Thus, comparing U2OS-TSHR and U2OS cells permits specifically distinguishing signaling mediated by the TSHR and IGF-1R. In GOFs, all GO-Igs stimulated pERK1/2 formation and 69% stimulated pAKT. In U2OS-TSHR cells, 15% of NV-IGs and 83% of GO-Igs stimulated increases in pERK1/2, whereas all NV-Igs and GO-Igs stimulated increases in pAKT. In U2OS cells, 70% of GO-Igs stimulated small increases in pAKT. Knockdown of IGF-1R caused a 65 ± 6.3% decrease in IGF-1-stimulated pAKT but had no effect on GO-Igs stimulation of pAKT. Thus, GO-Igs contain factor(s) that stimulate pAKT formation. However, this factor(s) does not directly activate IGF-1R. Based on the findings analyzing these two signaling pathways, it is concluded there is no evidence of stimulating IGFRAbs in GO patients.

  1. Exploring a new S U (4 ) symmetry of meson interpolators

    Science.gov (United States)

    Glozman, L. Ya.; Pak, M.

    2015-07-01

    In recent lattice calculations it has been discovered that mesons upon truncation of the quasizero modes of the Dirac operator obey a symmetry larger than the S U (2 )L×S U (2 )R×U (1 )A symmetry of the QCD Lagrangian. This symmetry has been suggested to be S U (4 )⊃S U (2 )L×S U (2 )R×U (1 )A that mixes not only the u- and d-quarks of a given chirality, but also the left- and right-handed components. Here it is demonstrated that bilinear q ¯q interpolating fields of a given spin J ≥1 transform into each other according to irreducible representations of S U (4 ) or, in general, S U (2 NF). This fact together with the coincidence of the correlation functions establishes S U (4 ) as a symmetry of the J ≥1 mesons upon quasizero mode reduction. It is shown that this symmetry is a symmetry of the confining instantaneous charge-charge interaction in QCD. Different subgroups of S U (4 ) as well as the S U (4 ) algebra are explored.

  2. An in vitro investigation of bacteria-osteoblast competition on oxygen plasma-modified PEEK.

    Science.gov (United States)

    Rochford, Edward T J; Subbiahdoss, Guruprakash; Moriarty, T Fintan; Poulsson, Alexandra H C; van der Mei, Henny C; Busscher, Henk J; Richards, R Geoff

    2014-12-01

    Polyetheretherketone (PEEK) films were oxygen plasma treated to increase surface free energy and characterized by X-ray photoelectron microscopy, atomic force microscopy, and water contact angles. A parallel plate flow chamber was used to measure Staphylococcus epidermidis, Staphylococcus aureus, and U-2 OS osteosarcomal cell-line adhesion to the PEEK films in separate monocultures. In addition, bacteria and U-2 OS cells were cocultured to model competition between osteoblasts and contaminating bacteria for the test surfaces. Plasma treatment of the surfaces increased surface oxygen content and decreased the hydrophobicity of the materials, but did not lead to a significant difference in bacterial or U-2 OS cell adhesion in the monocultures. In the S. epidermidis coculture experiments, the U-2 OS cells adhered in greater numbers on the treated surfaces compared to the untreated PEEK and spread to a similar extent. However, in the presence of S. aureus, cell death of the U-2 OS occurred within 10 h on all surfaces. The results of this study suggest that oxygen plasma treatment of PEEK may maintain the ability of osteoblast-like cells to adhere and spread, even in the presence of S. epidermidis contamination, without increasing the risk of preoperative bacterial adhesion. Therefore, oxygen plasma-treated PEEK remains a promising method to improve implant surface free energy for osseointegration. © 2014 Wiley Periodicals, Inc.

  3. Nonexistence of global solutions to the system of semilinear parabolic equations with biharmonic operator and singular potential

    Directory of Open Access Journals (Sweden)

    Shirmayil Bagirov

    2018-01-01

    Full Text Available In the domain $Q_{R}'= \\{ x:| x| >R\\}\\times( 0,+\\infty$ we consider the problem $$\\displaylines{ \\frac{\\partial u_1}{\\partial t}+\\Delta^2 u_1-\\frac{C_1}{|x| ^4}u_1 =| x| ^{\\sigma _1}| u_2| ^{q_1}, \\quad u_1| _{t=0}=u_{10}( x\\geq0, \\cr \\frac{\\partial u_2}{\\partial t}+\\Delta^2 u_2-\\frac{C_2}{| x| ^4}u_2=| x| ^{\\sigma _2}| u_1| ^{q_2},\\quad u_2| _{t=0}=u_{20}( x\\geq0, \\cr \\int_0^\\infty \\int_{\\partial B_{R}} u_i\\,ds\\,dt\\geq 0, \\quad \\int_0^\\infty \\int_{\\partial B_{R}}\\Delta u_i\\,ds\\,dt\\leq 0, }$$ where $\\sigma_i\\in \\mathbb{R} $, $ q_i>1 $, $ 0\\leq C_i<( \\frac{n( n-4 }{4} ^2$, $ i=1,2 $. Sufficient condition for the nonexistence of global solutions is obtained.The proof is based on the method of test functions.

  4. Effects of polydeoxyribonucleotides (PDRN) on wound healing: Electric cell-substrate impedance sensing (ECIS)

    Energy Technology Data Exchange (ETDEWEB)

    Koo, Youngmi; Yun, Yeoheung, E-mail: yyun@ncat.edu

    2016-12-01

    Polydeoxyribonucleotides (PDRN) have been explored as an effective treatment for tissue repair in peripheral artery occlusive disease, diabetic foot ulcers, and eye lotion. We report on the effect of polydeoxyribonucleotides (PDRN) on wound healing by using the electric cell-substrate impedance sensing (ECIS) system and viability testing. Human osteoblasts (U2OS) and primary human dermal fibroblasts (HDF) were used to study the effect of PDRN on migration and proliferation. ECIS allowed the creation of a wound by applying high current, and then monitoring the healing process by measuring impedance in real time. The traditional culture-insert gap-closure migration assay was performed and compared with the ECIS wound assay. PDRN-treated U2OS and HDF cells affected cell motilities to wounding site. Viability test results show that HDF and U2OS proliferation depended on PDRN concentration. Based on the results, a PDRN compound can be useful in wound healing associated with bone and skin. - Highlights: • Wound-healing study by the electric cell-substrate impedance sensing (ECIS). • Effect of polydeoxyribonucleotides (PDRN) on migration and proliferation of U2OS and HDF. • Effect of PDRN concentration on viability of U2OS and HDF.

  5. The USNO-UKIRT K-band Hemisphere Survey

    Science.gov (United States)

    Dahm, Scott; Bruursema, Justice; Munn, Jeffrey A.; Vrba, Fred J.; Dorland, Bryan; Dye, Simon; Kerr, Tom; Varricatt, Watson; Irwin, Mike; Lawrence, Andy; McLaren, Robert; Hodapp, Klaus; Hasinger, Guenther

    2018-01-01

    We present initial results from the United States Naval Observatory (USNO) and UKIRT K-band Hemisphere Survey (U2HS), currently underway using the Wide Field Camera (WFCAM) installed on UKIRT on Maunakea. U2HS is a collaborative effort undertaken by USNO, the Institute for Astronomy, University of Hawaii, the Cambridge Astronomy Survey Unit (CASU) and the Wide Field Astronomy Unit (WFAU) in Edinburgh. The principal objective of the U2HS is to provide continuous northern hemisphere K-band coverage over a declination range of δ=0o – +60o by combining over 12,700 deg2 of new imaging with the existing UKIRT Infrared Deep Sky Survey (UKIDSS) Large Area Survey (LAS), Galactic Plane Survey (GPS) and Galactic Cluster Survey (GCS). U2HS will achieve a 5-σ point source sensitivity of K~18.4 mag (Vega), over three magnitudes deeper than the Two Micron All Sky Survey (2MASS). In this contribution we discuss survey design, execution, data acquisition and processing, photometric calibration and quality control. The data obtained by the U2HS will be made publicly available through the Wide Field Science Archive (WSA) maintained by the WFAU.

  6. Using the fluorescence red edge effect to assess the long-term stability of lyophilized protein formulations.

    Science.gov (United States)

    Qian, Ken K; Grobelny, Pawel J; Tyagi, Madhusudan; Cicerone, Marcus T

    2015-04-06

    Nanosecond relaxation processes in sugar matrices are causally linked through diffusional processes to protein stability in lyophilized formulations. Long-term protein degradation rates track mean-squared displacement (⟨u(2)⟩) of hydrogen atoms in sugar glasses, a parameter describing dynamics on a time scale of picoseconds to nanoseconds. However, measurements of ⟨u(2)⟩ are usually performed by neutron scattering, which is not conducive to rapid formulation screening in early development. Here, we present a benchtop technique to derive a ⟨u(2)⟩ surrogate based on the fluorescence red edge effect. Glycerol, lyophilized trehalose, and lyophilized sucrose were used as model systems. Samples containing 10(-6) mole fraction of rhodamine 6G, a fluorophore, were excited at either 532 nm (main peak) or 566 nm (red edge), and the ⟨u(2)⟩ surrogate was determined based the corresponding Stokes shifts. Results showed reasonable agreement between ⟨u(2)⟩ from neutron scattering and the surrogate from fluorescence, although deviations were observed at very low temperatures. We discuss the sources of the deviations and suggest technique improvements to ameliorate these. We expect that this method will be a valuable tool to evaluate lyophilized sugar matrices with respect to their ability to protect proteins from diffusion-limited degradation processes during long-term storage. Additionally, the method may have broader applications in amorphous pharmaceutical solids.

  7. Effects of polydeoxyribonucleotides (PDRN) on wound healing: Electric cell-substrate impedance sensing (ECIS)

    International Nuclear Information System (INIS)

    Koo, Youngmi; Yun, Yeoheung

    2016-01-01

    Polydeoxyribonucleotides (PDRN) have been explored as an effective treatment for tissue repair in peripheral artery occlusive disease, diabetic foot ulcers, and eye lotion. We report on the effect of polydeoxyribonucleotides (PDRN) on wound healing by using the electric cell-substrate impedance sensing (ECIS) system and viability testing. Human osteoblasts (U2OS) and primary human dermal fibroblasts (HDF) were used to study the effect of PDRN on migration and proliferation. ECIS allowed the creation of a wound by applying high current, and then monitoring the healing process by measuring impedance in real time. The traditional culture-insert gap-closure migration assay was performed and compared with the ECIS wound assay. PDRN-treated U2OS and HDF cells affected cell motilities to wounding site. Viability test results show that HDF and U2OS proliferation depended on PDRN concentration. Based on the results, a PDRN compound can be useful in wound healing associated with bone and skin. - Highlights: • Wound-healing study by the electric cell-substrate impedance sensing (ECIS). • Effect of polydeoxyribonucleotides (PDRN) on migration and proliferation of U2OS and HDF. • Effect of PDRN concentration on viability of U2OS and HDF.

  8. Chimaphilin inhibits human osteosarcoma cell invasion and metastasis through suppressing the TGF-β1-induced epithelial-to-mesenchymal transition markers via PI-3K/Akt, ERK1/2, and Smad signaling pathways.

    Science.gov (United States)

    Dong, Feng; Liu, Tingting; Jin, Hao; Wang, Wenbo

    2018-01-01

    Epithelial-to-mesenchymal transition is a cellular process associated with cancer invasion and metastasis. However, the antimetastatic effects of chimaphilin remain elusive. In this study, we attempted to investigate the potential use of chimaphilin as an inhibitor of TGF-β1-induced epithelial-to-mesenchymal transition in U2OS cells. We found that TGF-β1 induced epithelial-to-mesenchymal transition to promote U2OS cell invasion and metastasis. Western blotting demonstrated that chimaphilin inhibited U2OS cell invasion and migration, increased the expression of the epithelial phenotype marker E-cadherin, repressed the expression of the mesenchymal phenotype marker vimentin, as well as decreased the level of epithelial-to-mesenchymal-inducing transcription factors Snail1 and Slug during the initiation of TGF-β1-induced epithelial-to-mesenchymal transition. In this study, we revealed that chimaphilin up-regulated the E-cadherin expression level and inhibited the production of vimentin, Snail1, and Slug in TGF-β1-induced U2OS cells by blocking PI-3K/Akt and ERK 1/2 signaling pathway. Additionally, the TGF-β1-mediated phosphorylated levels of Smad2/3 were inhibited by chimaphilin pretreatment. Above all, we conclude that chimaphilin represents an effective inhibitor of the metastatic potential of U2OS cells through suppression of TGF-β1-induced epithelial-to-mesenchymal transition.

  9. Isotopic characterization of uranium in soils of the Ipanema National Forest (FLONA-Ipanema)

    International Nuclear Information System (INIS)

    Silva, F.B.; Marques, F.H.; Enzweiler, J.; Ladeira, F.S.B.

    2015-01-01

    The National Forest of Ipanema (FLONA) is situated on a geological anomaly, known as 'Domo de Aracoiaba'. The soils of the area include Oxisols, Inceptsols and Alfisols. The amount of uranium and respective isotope activities in a soil depend on the parental rock and on the pedologic processes. The aim of this study was to investigate the activities for uranium isotopes ("2"3"8U, "2"3"4U, "2"3"5U) and the activity ratio (AR) "2"3"4U/ "2"3"8U or secular equilibrium for different soil types of the area collected at horizons A and B. The amount of uranium showed no significant differences for soils generated from alkaline intrusive rocks and sandstone, however, secular equilibrium was observed for Oxisol (RA = 1), while Inceptsol presented RA> 1 and the other soils, Alfisols, presented RA values <1. (author)

  10. Thermochemical evaluation and preparation of cesium uranates

    International Nuclear Information System (INIS)

    Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku; Sato, Seichi; Ohashi, Hiroshi.

    1997-03-01

    Two kinds of cesium uranates, Cs 2 UO 4 and Cs 2 U 2 O 7 , which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U 3 O 8 and Cs 2 CO 3 for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs 2 UO 4 and Cs 2 U 2 O 7 were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs 2 UO 4 and Cs 2 U 2 O 7 were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)

  11. New ternary transition metal borides containing uranium and rare earth elements

    International Nuclear Information System (INIS)

    Rogl, P.; Delong, L.

    1983-01-01

    The new ternary actinide metal diborides U 2 MoB 6 , U 2 ReB 6 , U 2 OsB 6 , URuB 4 and UOsB 4 were prepared and found to crystallize with either the Y 2 ReB 6 or the ThMoB 4 type of structure. LuRuB 4 and LuOsB 4 crystallize with the YCrB 4 type of structure. In a ternary series of solid solutions YRh 3 Bsub(1-x) (0 0 C), boron was found to stabilize a Cu 3 Au type of structure. The superconductivity of the new uranium compounds and of a series of ternary transition metal borides was investigated; no superconductivity was observed for temperatures as low at 1.3-1.5 K. The cubic perovskite or filled Cu 3 Au structure is discussed as a type which is very unfavorable for the occurrence of superconductivity. (Auth.)

  12. The upregulation of receptor activator NF-kappaB ligand expression by interleukin-1alpha and Porphyromonas endodontalis in human osteoblastic cells.

    Science.gov (United States)

    Chen, S-C; Huang, F-M; Lee, S-S; Li, M-Z; Chang, Y-C

    2009-04-01

    To investigate the receptor activator of nuclear factor-kappa B (NF-kappaB) ligand (RANKL) in osteoblastic cells stimulated with inflammatory mediators. The expression of RANKL in human osteoblastic cell line U2OS stimulated by pro-inflammatory cytokine interleukin (IL)-1alpha and black-pigmented bacteria Porphyromonas endodontalis was investigated by Western blot and enzyme-linked immunosorbent assay (ELISA). The significance of the results obtained from control and treated groups was statistically analysed by the paired Student's t-test. IL-1alpha was found to upregulate RANKL production in U2OS cells (P endodontalis also increased RANKL expression in U2OS cells after 4-h incubation period demonstrated by Western blot and ELISA (P endodontalis may be involved in developing apical periodontitis through the stimulation of RANKL production.

  13. Binuclear trivalent and tetravalent uranium halides and cyanides supported by cyclooctatetraene ligands

    International Nuclear Information System (INIS)

    Wang, Cong-Zhi; Wu, Qun-Yan; Lan, Jian-Hui; Shi, Wei-Qun; Gibson, John K.

    2017-01-01

    Although the first organoactinide chloride Cp_3UCl (Cp = η"5-C_5H_5) was synthesized more than 50 years ago, binuclear uranium halides remain very rare in organoactinide chemistry. Herein, a series of binuclear trivalent and tetravalent uranium halides and cyanides with cyclooctatetraene ligands, (COT)_2U_2X_n (COT = η"8-C_8H_8; X=F, Cl, CN; n=2, 4), have been systematically studied using scalar-relativistic density functional theory (DFT). The structures with bridging halide or cyanide ligands were predicted to be the most stable complexes of (COT)_2U_2X_n, and all the complexes show weak antiferromagnetic interactions between the uranium centers. However, for each species, there is no significant uranium-uranium bonding interaction. The bonding between the metal and the ligands shows some degree of covalent character, especially between the metal and terminal halide or cyanide ligands. The U-5f and 6d orbitals are predominantly involved in the metal-ligand bonding. All the (COT)_2U_2X_n species were predicted to be more stable compared to the mononuclear half-sandwich complexes at room temperature in the gas phase such that (COT)_2U_2X_4 might be accessible through the known (COT)_2U complex. The tetravalent derivatives (COT)_2U_2X_4 are more energetically favorable than the trivalent (COT)_2U_2X_2 analogs, which may be attributed to the greater number of strong metal-ligand bonds in the former complexes.

  14. The prognostic impact of mutations in spliceosomal genes for myelodysplastic syndrome patients without ring sideroblasts

    International Nuclear Information System (INIS)

    Kang, Min-Gu; Kim, Hye-Ran; Seo, Bo-Young; Lee, Jun Hyung; Choi, Seok-Yong; Kim, Soo-Hyun; Shin, Jong-Hee; Suh, Soon-Pal; Ahn, Jae-Sook; Shin, Myung-Geun

    2015-01-01

    Mutations in genes that are part of the splicing machinery for myelodysplastic syndromes (MDS), including MDS without ring sideroblasts (RS), have been widely investigated. The effects of these mutations on clinical outcomes have been diverse and contrasting. We examined a cohort of 129 de novo MDS patients, who did not harbor RS, for mutations affecting three spliceosomal genes (SF3B1, U2AF1, and SRSF2). The mutation rates of SF3B1, U2AF1, and SRSF2 were 7.0 %, 7.8 %, and 10.1 %, respectively. Compared with previously reported results, these rates were relatively infrequent. The SRSF2 mutation strongly correlated with old age (P < 0.001), while the mutation status of SF3B1 did not affect overall survival (OS), progression-free survival (PFS), or acute myeloid leukemia (AML) transformation. In contrast, MDS patients with mutations in U2AF1 or SRSF2 exhibited inferior PFS. The U2AF1 mutation was associated with inferior OS in low-risk MDS patients (P = 0.035). The SRSF2 mutation was somewhat associated with AML transformation (P = 0.083). Our findings suggest that the frequencies of the SF3B1, U2AF1, and SRSF2 splicing gene mutations in MDS without RS were relatively low. We also demonstrated that the U2AF1 and SRSF2 mutations were associated with an unfavorable prognostic impact in MDS patients without RS. The online version of this article (doi:10.1186/s12885-015-1493-5) contains supplementary material, which is available to authorized users

  15. Oleocanthal Modulates Estradiol-Induced Gene Expression Involving Estrogen Receptor α.

    Science.gov (United States)

    Keiler, Annekathrin Martina; Djiogue, Sefirin; Ehrhardt, Tino; Zierau, Oliver; Skaltsounis, Leandros; Halabalaki, Maria; Vollmer, Günter

    2015-09-01

    Oleocanthal is a bioactive compound from olive oil. It has attracted considerable attention as it is anti-inflammatory, antiproliferative, and has been shown to possess neuroprotective properties in vitro and in vivo. Delineated from its polyphenolic structure, the aim of this study was to characterize oleocanthal towards estrogenic properties. This might contribute to partly explain the beneficial effects described for the Mediterranean diet. Estrogenic properties of oleocanthal were assessed by different methods: a) stimulation of reporter gene activity in MVLN or RNDA cells either expressing estrogen receptor α or β, b) stimulation of luciferase reporter gene activity in U2OS osteosarcoma cells expressing estrogen receptor α or β, and c) elucidation of the impact on estradiol-induced gene expression in U2OS cells transduced with both estrogen receptors. Depending on the cell line origin, oleocanthal inhibited luciferase activity (MVLN, U2OS-estrogen receptor β) or weakly induced reporter gene activity at 10 µM in U2OS-estrogen receptor α cells. However, oleocanthal inhibited stimulation of luciferase activity by estradiol from both estrogen receptors. Oleocanthal, if given alone, did not stimulate gene expression in U2OS cells, but it significantly modulated the response of estradiol. Oleocanthal enhanced the effect of estradiol on the regulation of those genes, which are believed to be regulated through heterodimeric estrogen receptors. As the estrogenic response pattern of oleocanthal is rather unique, we compared the results obtained with oleacein. Oleocanthal binds to both estrogen receptors inducing estradiol-agonistic or antiagonistic effects depending on the cell line. Regarding regulation of gene expression in U2OS-estrogen receptor α/β cells, oleocanthal and oleacein enhanced estradiol-mediated regulation of heterodimer-regulated genes. Georg Thieme Verlag KG Stuttgart · New York.

  16. Estrogen receptor β exhibited anti-tumor effects on osteosarcoma cells by regulating integrin, IAP, NF-kB/BCL-2 and PI3K/Akt signal pathway

    Directory of Open Access Journals (Sweden)

    Minfei Yang

    2017-11-01

    Full Text Available This study aimed to investigate the effects of Estrogen receptor β (ERβ on osteosarcoma cells, and explore the regulatory mechanisms involved in this process. Osteosarcoma U2-OS cells consisted four groups, and treated by E2, E2 + LY294002 (ERβ agonists, E2 + ERβ siRNA, E2 + ERβ siRNA + LY294002, respectively. Cell counting kit 8 (CCK-8 assay was performed to detect the cell viability of U2-OS cells in each group. The effects of ERβ on the migration and invasion ability of U2-OS cells were examined by wound healing assay and transwell cell culture chamber, respectively. The expression of Inhibitor of apoptosis protein (IAP and integrin α5 in U2-OS cells of each group was detected by quantitative RT-PCR, and the expression of phosphorylated p65 (p-p65, p-AKT and Bcl-2 was detected by western blotting. The cell viability, migration and invasion ability of U2-OS cells were significantly increased by ERβ siRNA, but inhibited by ERβ agonists LY294002 (p < 0.05. ERβ siRNA significantly downregulated Integrin α5 and unregulated IAP in U2-OS cells (p < 0.05. The expression of p-p65, p-AKT and Bcl-2 was significantly reduced by LY294002, but increased by ERβ siRNA (p < 0.05. In conclusion, ERβ exhibited obvious anti-tumor effects on osteosarcoma cells by regulating integrin, IAP, NF-kBBCL-2 and PI3K/Akt signal pathway. Keywords: Estrogen receptor β, Osteosarcoma, Anti-tumor, Regulatory mechanism

  17. Effects of changing climate on reference crop evapotranspiration over 1961-2013 in Xinjiang, China

    Science.gov (United States)

    Yao, Ning; Li, Yi; Sun, Changfeng

    2018-01-01

    To know the importance of different climate variables on reference crop evapotranspiration ( ET o), a step-by-step sensitivity analysis of ET o to single, two, and multi-climate variables ( C) was conducted. ET o in north, south, and entire Xinjiang Province, China, over 1961-2013 was estimated using the Penman-Monteith equation. Trends in the involved six Cs (i.e., minimum temperature— T min, average temperature— T ave, maximum temperature— T max, wind speed at 2 m— U 2, sunshine hour— n, and relative humidity— RH) were detected by the modified Mann-Kendall test. Nineteen scenarios of changed Cs were preset to obtain recalculated ET o values considering the actual trend in each C and the Pearson's correlation relationship between ET o and Cs. The results showed that ET o was mostly sensitive to T max, U 2, and n. Sensitivity of ET o to the two overlapped changes of T min and T max caused larger increases in ET o than T max and T ave, T ave and T max, T max and (- n), T max and RH, T max and (- U 2), and T min and T ave, but the overlapped changes (- U 2) and (- n) caused larger decreases in ET o than the other two C scenarios. The simultaneously increased T max, T min, T ave, and RH plus decreased U 2 and n had caused the actual decreases in ET o in Xinjiang. In general, the effects of decreased U 2 and n on decreasing ET o compensated the effects of increased T max on decreasing ET o in Xinjiang.

  18. Initial Incidence of White Matter Hyperintensities on MRI in Astronauts

    Science.gov (United States)

    Norcross, Jason; Sherman, Paul; McGuire, Steve; Kochunov, Peter

    2016-01-01

    Introduction: Previous literature has described the increase in white matter hyperintensity (WMH) burden associated with hypobaric exposure in the U-2 and altitude chamber operating personnel. Although astronauts have similar hypobaric exposure pressures to the U2 pilot population, astronauts have far fewer exposures and each exposure would be associated with a much lower level of decompression stress due to rigorous countermeasures to prevent decompression sickness. Therefore, we postulated that the WMH burden in the astronaut population would be less than in U2 pilots. Methods: Twenty-one post-flight de-identified astronaut MRIs (5 mm slice thickness FLAIR sequences) were evaluated for WMH count and volume. The only additional data provided was an age range of the astronauts (43-57) and if they had ever performed an EVA (13 yes, 8 no). Results: WMH count in these 21 astronaut MRI was 21.0 +/- 24.8 (mean+/- SD) and volume was 0.382 +/- 0.602 ml, which was significantly higher than previously published results for the U2 pilots. No significant differences between EVA and no EVA groups existed. Age range of astronaut population is not directly comparable to the U2 population. Discussion: With significantly less frequent (sometimes none) and less stressful hypobaric exposures, yet a much higher incidence of increased WMH, this indicates the possibility of additional mechanisms beyond hypobaric exposure. This increase unlikely to be attributable just to the differences in age between astronauts and U2 pilots. Forward work includes continuing review of post-flight MRI and evaluation of pre to post flight MRI changes if available. Data mining for potential WMH risk factors includes collection of age, sex, spaceflight experience, EVA hours, other hypobaric exposures, hyperoxic exposures, radiation, high performance aircraft experience and past medical history. Finally, neurocognitive and vision/eye results will be evaluated for any evidence of impairment linked to

  19. Decay scheme of the U235

    International Nuclear Information System (INIS)

    Gaeta, R.

    1965-01-01

    A study of the Th 2 31 excited levels from the alpha decay of the U 2 35, is carried out. The alpha particle spectrum was measured by means of a semiconductor counter spectrometer with an effective resolution of 18 keV. Nineteen new lines were identified. The gamma-ray spectrum was measured with thin samples of U 2 35, free from decay products, and in such geometrical conditions, that most of the interference effects were eliminated. The gamma-gamma coincidence spectra have made easier a better knowledge of the transition between the several levels. (Author) 110 refs

  20. IFPE/FUMEX-II/CASE27, 7 idealised cases for functional dependence of FGR predictions

    International Nuclear Information System (INIS)

    Turnbull, J.A.; Rossiter, Glyn; Sontheimer, Fritz; Tayal, Mukesh

    2004-01-01

    Description: Seven idealised cases to illustrate the functional dependence of fission gas release (FGR) predictions. (1) Temperature vs Bu for onset of FGR (draft available); (2a) FGR for constant 15 kW/m to 100 MWd/kgU; (2b) FGR for 20 kW/m at BOL decreasing linearly to 10 kW/m at 100 MWd/kgU; (2c) FGR for more realistic power histories supplied by BNFL; (2d) FGR for idealized 'real' histories supplied by FANP; (3a) Candu-Effect of Power on Fission Gas Release; (3b) Candu-Effect of Power Envelope on Fuel Performance

  1. A new derivation of the highest-weight polynomial of a unitary lie algebra

    International Nuclear Information System (INIS)

    P Chau, Huu-Tai; P Van, Isacker

    2000-01-01

    A new method is presented to derive the expression of the highest-weight polynomial used to build the basis of an irreducible representation (IR) of the unitary algebra U(2J+1). After a brief reminder of Moshinsky's method to arrive at the set of equations defining the highest-weight polynomial of U(2J+1), an alternative derivation of the polynomial from these equations is presented. The method is less general than the one proposed by Moshinsky but has the advantage that the determinantal expression of the highest-weight polynomial is arrived at in a direct way using matrix inversions. (authors)

  2. The Equation Δ u + ∇φ· ∇u = 8πc(1-heu) on a Riemann Surface

    International Nuclear Information System (INIS)

    Wang Meng

    2009-12-01

    Let M be a compact Riemann surface, h(x) a positive smooth function on M, and φ(x) a smooth function on M which satisfies that ∫ M e φ dV g = 1. In this paper, we consider the functional J(u) = 2 1 ∫ M |∇u| 2 e φ dV g +8πc ∫ M ue φ dV g -8πclog ∫ M he u+φ dV g . We give a sufficient condition under which J achieves its minimum for c ≤ inf xelement ofM Φ(x). (author)

  3. Local-in-space blow-up criteria for a class of nonlinear dispersive wave equations

    Science.gov (United States)

    Novruzov, Emil

    2017-11-01

    This paper is concerned with blow-up phenomena for the nonlinear dispersive wave equation on the real line, ut -uxxt +[ f (u) ] x -[ f (u) ] xxx +[ g (u) + f″/(u) 2 ux2 ] x = 0 that includes the Camassa-Holm equation as well as the hyperelastic-rod wave equation (f (u) = ku2 / 2 and g (u) = (3 - k) u2 / 2) as special cases. We establish some a local-in-space blow-up criterion (i.e., a criterion involving only the properties of the data u0 in a neighborhood of a single point) simplifying and precising earlier blow-up criteria for this equation.

  4. Numerical models

    Digital Repository Service at National Institute of Oceanography (India)

    Unnikrishnan, A.S.; Manoj, N.T.

    partialdifft + partialdiffU partialdiffx + partialdiffV partialdiffy = 0; (3.4) partialdiffU partialdifft + partialdiff partialdiffx (uU ) + partialdiff partialdiffy (vU ) =-g(h + eta) partialdiffeta partialdiffx + fV + AH nabla2U - CD U radicalU 2 + V 2 (h... + eta)2 (3.5) partialdiffV partialdifft + partialdiff partialdiffx (uV ) + partialdiff partialdiffy (vV ) =-g(h + eta) partialdiffeta partialdiffy - fU +AH nabla2V - CD V radicalU 2 + V 2 (h + eta)2 (3.6) partialdiffS partialdifft + partialdiff...

  5. Ion channeling in NbC/sub 1-c/: Determination of local atomic displacements around carbon vacancies

    International Nuclear Information System (INIS)

    Kaufmann, R.; Meyer, O.

    1983-01-01

    The results of channeling experiments on NbC/sub 1-c/ single crystals as a function of the vacancy concentration (0.02 1 = 0.12 +- 0.025 A and of the second Nb neighbors of u 2 1 = 0.09 +- 0.007 A and of the second neighbors to values of u 2 < or =0.02 +- 0.007 A. The static displacements determined with the channeling method were in good agreement with the results of x-ray diffraction experiments

  6. New solitary solutions with compact support for Boussinesq-like B(2n, 2n) equations with fully nonlinear dispersion

    International Nuclear Information System (INIS)

    Zhu Yonggui; Lu Chao

    2007-01-01

    In this paper, the Boussinesq-like equations with fully nonlinear dispersion, B(2n, 2n) equations: u tt + (u 2n ) xx + (u 2n ) xxxx 0 which exhibit compactons: solitons with compact support, are studied. New exact solitary solutions with compact support are found. The special case B(2, 2) is chosen to illustrate the concrete scheme of the decomposition method in B(2n, 2n) equations. General formulas for the solutions of B(2n, 2n) equations are established

  7. Surface Impact Simulations of Helium Nanodroplets

    Science.gov (United States)

    2015-06-30

    distorted hcp-like cages at three different target densities: 22.6 nm−3, 27.8 nm−3, and 34.8 nm−3. These densities are respectively 3%, 28%, and 59% higher...M. Lindsay, J. Phys. Chem. C 117, 2358 (2013). [9] A. Boatwright, C. Feng, D. Spence, E. Latimer, C. Binns, A. M. Ellis, and S. Yang, Faraday Discuss...displacement u2 (bohr2) Fig. 3: Probability distributions for the mean squared displacement 〈u2〉 for He atoms in distorted hcp-like cages . The en- semble of

  8. Tumor therapy with a urokinase plasminogen activator-activated anthrax lethal toxin alone and in combination with paclitaxel

    OpenAIRE

    Wein, Alexander N.; Liu, Shihui; Zhang, Yi; McKenzie, Andrew T.; Leppla, Stephen H.

    2012-01-01

    PA-U2, an engineered anthrax protective antigen that is activated by urokinase was combined with wild-type lethal factor in the treatment of Colo205 colon adenocarcinoma in vitro and B16-BL6 mouse melanoma in vitro and in vivo. This therapy was also tested in combination with the small molecule paclitaxel, based on prior reports suggesting synergy between ERK1/2 inhibition and chemotherapeutics. Colo205 was sensitive to PA-U2/LF while B16-BL6 was not. For the combination treatment of B16-BL6,...

  9. High-Accurate, Physics-Based Wake Simulation Techniques

    Science.gov (United States)

    2015-01-27

    then taken further by Kevin Albarado when he purposed the DG method to solve the Hamiltonian for the burning of a two dimensional start solid rocket ...p γ − 1 + ρ 2 ( u2 + v2 + w2 ) (55) For simpler analysis the state and fluxes can be stored into vectors so that the Euler equation breaks down into...time step can be found by ∆t ∼ C ( λmax N2 h + ‖ν‖L∞ N4 h2 ) (77) where λmax represents the maximum characteristic velocity λmax = √ γp/ρ+√ u2 + v2 + w2

  10. Disease: H00858 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Marie-Unna hereditary hypotrichosis: case report and review of the literature. ... ...U2HR mutation in the family from the original 1925 report. ... JOURNAL ... J Am Acad Dermatol 64:e45-50 (2011) DOI:10.1016/j.jaad.2010.06.013

  11. USAF Posture Statement 2013

    Science.gov (United States)

    2013-04-12

    request maintains investments in the DCGS, the MQ-1 Predator, the RC-135 Rivet Joint, the RQ-4 Global Hawk Block 40, and U-2 programs, and makes internal... electromagnetic jamming. Our potential adversaries are also making advances by electronically linking their own combat capabilities, creating new military

  12. 75 FR 50711 - Approval and Promulgation of Air Quality Implementation Plans; Ohio; Final Approval and...

    Science.gov (United States)

    2010-08-17

    ... operations under OAC 3745-21-09(U)(2)(f). For administrative convenience, in a separate rulemaking published... conditional approval of portions of OAC rule 3745-21-09. You can learn more information about the rule... implementing a Federal Standard. National Technology Transfer Advancement Act In reviewing state submissions...

  13. Phenotype abnormality: 46 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 46 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u552i abnormal for trait of behavior.../cria224u2ria224u38i stomatal complex ... abnormal ... response to light stimulus ... behavioral quality

  14. Long Noncoding RNA PANDA Positively Regulates Proliferation of Osteosarcoma Cells.

    Science.gov (United States)

    Kotake, Yojiro; Goto, Taiki; Naemura, Madoka; Inoue, Yasutoshi; Okamoto, Haruna; Tahara, Keiichiro

    2017-01-01

    A long noncoding RNA, p21-associated ncRNA DNA damage-activated (PANDA), associates with nuclear transcription factor Y subunit alpha (NF-YA) and inhibits its binding to promoters of apoptosis-related genes, thereby repressing apoptosis in normal human fibroblasts. Here, we show that PANDA is involved in regulating proliferation in the U2OS human osteosarcoma cell line. U2OS cells were transfected with siRNAs against PANDA 72 h later and they were subjected to reverse transcription-polymerase chain reaction (RT-PCR), quantitative RT-PCR and cell-cycle analysis. PANDA was highly expressed in U2OS cells, and its expression was induced by DNA damage. Silencing PANDA caused arrest at the G 1 phase of the cell cycle, leading to inhibition of cell proliferation. Quantitative RT-PCR showed that silencing PANDA increased mRNA levels of the cyclin-dependent kinase inhibitor p18, which caused G 1 phase arrest. These results suggest that PANDA promotes G 1 -S transition by repressing p18 transcription, and thus promotes U2OS cell proliferation. Copyright© 2017 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.

  15. Automatic/Control Processing Concepts and Their Implications for the Training of Skills.

    Science.gov (United States)

    1982-04-01

    driving a car are examples of automatic processes. Controll p s is comparatively slow, serial, limited by short-term memory, and requires subject effort...development has convinced us that moivation a oftn more Jmportn nti mAn =other iJli velLJoa jjthpgy gI. njj Lautomatic U_2,LLjjk. Motivation Is much more

  16. Results from exploratory drill hole UE2ce, Northwest Yucca Flat, Nevada Test Site, near the NASH Event

    International Nuclear Information System (INIS)

    Pawloski, G.A.

    1982-01-01

    Exploratory drill hole UE2ce was drilled in January 1977 to determine geologic and geophysical characteristics of this site. This report presents geophysical logs, lithology, geologic structure, water table measurements, and physical properties for this drill hole. The data are then extrapolated to the NASH site, an event in U2ce, 55.6 m due north of UE2ce

  17. Recovery of uranium from alkaline ore (Tummalapalle) leach solution using novel precipitating method

    International Nuclear Information System (INIS)

    Biswas, Sujoy; Rupawate, V.H.; Hareendran, K.N.; Roy, S.B.; Chakravartty, J.K.

    2014-01-01

    The aim of present study is recovery of uranium from such ore leach solution containing 2 O 7 at pH ∼12.5. The average particle size of the MgU 2 O 7 particles was 20 micron and overall uranium recovery was 97%. The composition of final precipitate was characterized using XRD and surface morphology was studied using SEM

  18. F4 , E6 and G2 exceptional gauge groups in the vacuum domain structure model

    Science.gov (United States)

    Shahlaei, Amir; Rafibakhsh, Shahnoosh

    2018-03-01

    Using a vacuum domain structure model, we calculate trivial static potentials in various representations of F4 , E6, and G2 exceptional groups by means of the unit center element. Due to the absence of the nontrivial center elements, the potential of every representation is screened at far distances. However, the linear part is observed at intermediate quark separations and is investigated by the decomposition of the exceptional group to its maximal subgroups. Comparing the group factor of the supergroup with the corresponding one obtained from the nontrivial center elements of S U (3 ) subgroup shows that S U (3 ) is not the direct cause of temporary confinement in any of the exceptional groups. However, the trivial potential obtained from the group decomposition into the S U (3 ) subgroup is the same as the potential of the supergroup itself. In addition, any regular or singular decomposition into the S U (2 ) subgroup that produces the Cartan generator with the same elements as h1, in any exceptional group, leads to the linear intermediate potential of the exceptional gauge groups. The other S U (2 ) decompositions with the Cartan generator different from h1 are still able to describe the linear potential if the number of S U (2 ) nontrivial center elements that emerge in the decompositions is the same. As a result, it is the center vortices quantized in terms of nontrivial center elements of the S U (2 ) subgroup that give rise to the intermediate confinement in the static potentials.

  19. 3D kino - IMAXi äärealadelt popkornikinode peavooluks? / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2008-01-01

    Ruumilise e. 3D-kino levikust ja jõudmisest Forum Cinemas kinoketi kinodesse, esialgu Coca Cola Plazasse Tallinnas : 24. oktoobril linastuvad "Kärbsed kuu peale" ja "U2 3-D". Nukufilmil on juba eelmisest aastast digitaalne stereonukufilm "Miriami piknik". 3D-kino lähitulevikust maailmas, eelkõige USAs

  20. Järgmisel nädalal lisandub kinolinale kolmas mõõde / Mart Niineste

    Index Scriptorium Estoniae

    Niineste, Mart, 1983-

    2008-01-01

    Ruumilise e. 3D-kino levikust ja jõudmisest Forum Cinemas kinoketi kinodesse, esialgu Coca Cola Plazasse Tallinnas : 24. oktoobril linastuvad "Kärbsed kuu peale" ja "U2 3-D" . Lisatud sõnum "Eestis on tehtud 3D-nukufilmi"

  1. Phenotype abnormality: 270 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 270 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u775i elongated hypocotyl in environment... of light regimen in environment of light regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u34i hypocotyl ... elongated ...

  2. Phenotype abnormality: 404 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 404 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u908i involute hypocotyl in environment... of red light regimen in environment of red light regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u39i hypocotyl ... involute ...

  3. 78 FR 61997 - Combined Notice of Filings #1

    Science.gov (United States)

    2013-10-10

    ... LLC, Empire Generating Co, LLC, EquiPower Resources Management, LLC, Kincaid Generation, L.L.C., Lake...: Original Service Agreement No. 3647; Queue No. U2-030 to be effective 8/30/2013. Filed Date: 9/30/13...

  4. Electron transport system activity of microfouling material: Relationships with biomass parameters

    Digital Repository Service at National Institute of Oceanography (India)

    Bhosle, N.B.; Tulaskar, A.; Wagh, A.B.

    (ETS). The ETS activity ranged from 720 to 1374 ~kg 0@d2@@ dm@u2@@ d@u-1@@. Microfouling biomass and ETS activity of microfouling material increased with the immersion period. ETS activity was significantly correlated with dry weight, organic carbon...

  5. @u234@@Th scavenging and particle export fluxes from the upper 100 m of the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Sarin, M.M.; Rengarajan, R.; Ramaswamy, V.

    for the upper 100 m yields a mean scavenging residence time of ~k30 days and a removal rate of ~k 3400 dpm m@u-2@@ d@u-1@@ for @u234@@Th, from dissolved to particulate phases. The deficiency of total @u234@@Th (dissolved + particulate) relative to @u238@@U...

  6. Review of thermal expansion and density of uranium and plutonium carbides

    International Nuclear Information System (INIS)

    Andrew, J.F.; Latimer, T.W.

    1975-07-01

    The published literature on linear thermal expansion and density of uranium and plutonium carbide nuclear fuels, including UC, PuC, (U,Pu)C, U 2 C 3 , Pu 2 C 3 , and (U,Pu) 2 C 3 , is critically reviewed. Recommended values are given in tabular form and additional experimental studies needed for completeness are outlined. 16 tables, 52 references

  7. Cole's ansatz and extensions of Burgers' equation

    International Nuclear Information System (INIS)

    Tasso, H.

    1976-01-01

    A sequence of nonlinear partial differential equations is constructed. It contains all equation whose solutions can be obtained from applying the Cole-Hopf transformation to linear partial differential equations. An exemple is usub(t) = (u 3 )sub(x) + 3/2(u 2 )sub(xx) + usub(xxx). (orig.) [de

  8. Experiment list: SRX275506 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimina...ted in 1972, (PMID: 6081590) 21509088,85.2,4.6,831 GSM1133488: U2OS NT p53chip; Hom

  9. Experiment list: SRX351402 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 38 cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimi...nated in 1972, (PMID: 6081590) 7187304,78.3,5.6,7240 GSM1231599: U2OS Miz1 +Dox ChI

  10. Experiment list: SRX351403 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 38 cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimi...nated in 1972, (PMID: 6081590) 6944758,81.0,4.7,7725 GSM1231600: U2OS Miz1 -Dox ChI

  11. Experiment list: SRX275502 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimina...ted in 1972, (PMID: 6081590) 20780970,84.1,9.5,1556 GSM1133484: U2OS DXR p53chip; H

  12. Experiment list: SRX256879 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 8 cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimin...ated in 1972, (PMID: 6081590) 26902849,76.5,44.8,33916 U2OS A477T ChIP-seq collecti

  13. Experiment list: SRX275504 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimina...ted in 1972, (PMID: 6081590) 35786291,92.8,63.7,8020 GSM1133486: U2OS Nutlin p53chi

  14. Experiment list: SRX020506 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimina...ted in 1972, (PMID: 6081590) 4586367,78.1,5.0,4743 GSM542547: U2OS ERb Doxy specifi

  15. Experiment list: SRX256883 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 8 cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimin...ated in 1972, (PMID: 6081590) 11862250,72.1,15.4,31579 U2OS E773R ChIP-seq collecti

  16. Experiment list: SRX275500 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimina...ted in 1972, (PMID: 6081590) 39717260,92.4,31.6,2510 GSM1133482: U2OS DMSO p53chip;

  17. Experiment list: SRX256867 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 8 cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimin...ated in 1972, (PMID: 6081590) 16144013,77.1,45.6,35079 U2OS GRalpha ChIP-seq collec

  18. Experiment list: SRX188790 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 8 cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimin...ated in 1972, (PMID: 6081590) 27983248,67.5,68.3,219 GSM1006655: U2OS.UV.SIRT3; Hom

  19. Experiment list: SRX256880 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 8 cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimin...ated in 1972, (PMID: 6081590) 11433163,75.3,34.4,35935 U2OS 30iiB ChIP-seq collecti

  20. Modular transformations and invariants in the context of fractional level sl-circumflex(2 vertical bar 1;C)

    International Nuclear Information System (INIS)

    Johnstone, Gavin

    2000-01-01

    The modular transformation properties of admissible characters of the affine superalgebra sl-circumflex(2 vertical bar 1;C) at fractional level k=1/u-1, u is a subset of N/1 are presented. All modular invariants for u=2 and u=3 are calculated explicitly and an A-series and D-series of modular invariants emerge

  1. A Survey of Biodynamic Test Devices and Methods,

    Science.gov (United States)

    1984-04-01

    aca-a) *Cavfcr:.,: ( CncD : all tgat A~rply) Rane of Acceir!racion buration v.1 Sne __________ _________ _________ U.2. 1/2 Sn _______ _______ ______ e...State University. Dayton. Ohio 45435, USA. 12. )istribution Statement This document is distributed in accordance with A(VARI) policies and

  2. u-Constacyclic codes over F_p+u{F}_p and their applications of constructing new non-binary quantum codes

    Science.gov (United States)

    Gao, Jian; Wang, Yongkang

    2018-01-01

    Structural properties of u-constacyclic codes over the ring F_p+u{F}_p are given, where p is an odd prime and u^2=1. Under a special Gray map from F_p+u{F}_p to F_p^2, some new non-binary quantum codes are obtained by this class of constacyclic codes.

  3. United States Airline Transport Pilot International Flight Language Experiences, Report 2: Word Meaning and Pronunciation

    Science.gov (United States)

    2010-04-01

    for me to understand are the female Taiwanese controllers; and I think they speak Mandarin, or Cantonese . But they have sibilant – they make “S’s... Social Sciences. Research Product 89-20. stinet.dtic.mil/cgi-bin/GetTRDo c?AD=ADA212365&Location=U2&doc=GetT RDoc.pdf. Accessed 26 March 2008

  4. Geochemistry of ferromanganese micronodules and associated Mn and trace metals diagenesis at high terrigenous depositional site of middle fan region, Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Chauhan, O

    The influence of sedimentation on the morphology, growth and geochemistry of the micronodules, and on Mn enrichment in the sediments of the Bay of Bengal has been evaluated. Mn accumulation is 307-219 mg cm u2 kyr u-1 in cores having 20-17 cm kyr u...

  5. Dual Mechanism of Action of Resveratrol in Notch Signaling ...

    African Journals Online (AJOL)

    Results: The results revealed that resveratrol treatment exhibited dual mechanisms of action on the activation of Notch signaling in osteosarcoma cells. The osteosarcoma cell lines, MG-63 and U2OS, when exposed to 20 μM concentration of resveratrol for 48 h showed significant toxicity compared to untreated cells.

  6. GenBank blastx search result: AK103983 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK103983 001-017-F09 U49859.1 Anabaena variabilis Mo-nitrogenase operon NifB2, NifS2, NifU2, dinitrogen...ase reductase (nifH2), dinitrogenase alpha subunit (nifD2), dinitrogenase beta subunit (

  7. GenBank blastx search result: AK058791 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058791 001-002-F06 U49859.1 Anabaena variabilis Mo-nitrogenase operon NifB2, NifS2, NifU2, dinitrogen...ase reductase (nifH2), dinitrogenase alpha subunit (nifD2), dinitrogenase beta subunit (

  8. GenBank blastx search result: AK060074 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060074 006-306-B05 U49859.1 Anabaena variabilis Mo-nitrogenase operon NifB2, NifS2, NifU2, dinitrogen...ase reductase (nifH2), dinitrogenase alpha subunit (nifD2), dinitrogenase beta subunit (

  9. GenBank blastx search result: AK059171 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059171 001-023-F01 U49859.1 Anabaena variabilis Mo-nitrogenase operon NifB2, NifS2, NifU2, dinitrogen...ase reductase (nifH2), dinitrogenase alpha subunit (nifD2), dinitrogenase beta subunit (

  10. GenBank blastx search result: AK062234 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062234 001-047-D11 U49859.1 Anabaena variabilis Mo-nitrogenase operon NifB2, NifS2, NifU2, dinitrogen...ase reductase (nifH2), dinitrogenase alpha subunit (nifD2), dinitrogenase beta subunit (

  11. Data of evolutionary structure change: 1C5UA-2OQUA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available A 2OQUA ence>SLQYRSGSSWAHTCG... A 2OQUA ence>PLHCLVNGQYAVHG.../index> 2OQU A 2OQUA ence>MVCAG-GDGVR...1C5UA-2OQUA 1C5U 2OQU A A IVGGYTCGANTVPYQVSLNSG-----YHFCGGSLINSQW...entryIDChain>1C5UA ence>SLNSG-----YHFCGence> EEE ----- EE

  12. Pop / Tõnis Kahu

    Index Scriptorium Estoniae

    Kahu, Tõnis, 1962-

    2002-01-01

    Heliplaatidest: Nirvana "Nirvana", U2 ", "The Best of 1990-2000", Future Sound of London "The Isness", Björk "Greatest Hits", ODOT.LAMM "My Favourite Things", David Gray "A New Day at Midnight", Toto "Through The Looking Glass", Stone Roses "Very Best of", Ernst Jandl "13 radiophone texte & das röcheln der mona lisa"

  13. Soliton solutions for a quasilinear Schrodinger equation

    Directory of Open Access Journals (Sweden)

    Duchao Liu

    2013-12-01

    Full Text Available In this article, critical point theory is used to show the existence of nontrivial weak solutions to the quasilinear Schrodinger equation $$ -\\Delta_p u-\\frac{p}{2^{p-1}}u\\Delta_p(u^2=f(x,u $$ in a bounded smooth domain $\\Omega\\subset\\mathbb{R}^{N}$ with Dirichlet boundary conditions.

  14. Local well-posedness for a higher order nonlinear Schrodinger equation in Sobolev spaces of negative indices

    Directory of Open Access Journals (Sweden)

    Xavier Carvajal

    2004-01-01

    Full Text Available We prove that the initial value problem associated with $$ partial_tu+ialpha partial^2_x u+Beta partial^3_x u +igamma|u|^2u = 0, quad x,t in mathbb{R}, $$ is locally well-posed in $H^s$ for $s>-1/4$.

  15. Müncheni metroo punane liin / Marje Tammert

    Index Scriptorium Estoniae

    Tammert, Marje

    2004-01-01

    1999. a. avatud Müncheni uude messikeskusesse viiva allmaaraudteeliini U2 pikenduse ootesaalide kujundus. Metroopeatuse Messestadt West arhitektuurne välislahendus on Kopenhaageni büroolt BBP-Arkitekter, ootesaali värvikujunduse autor Heribert Heindl. Moosfeldi ootesaali valgusprojekti autor Ingo Maurer. Truderingi ootesaalis Sophie Kaiseri projekt "Tattoo + Spiele". 3 ill

  16. Antibacterial activity of the crude extract of Chinese green tea ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-05-16

    May 16, 2008 ... green tea (Camellia sinensis) on Listeria monocytogenes. Mbata, T. I.1*, Debiao, L. U.2 and Saikia, A.3. 1Department of Applied Microbiology and Brewing, Nnamdi Azikiwe University, P. M. B 5025, Awka, Nigeria. 2Cash Crops Bureau, Zhejianq Provincial Department of Agriculture, Hangzhou, 310020, ...

  17. Perceived Barriers and Opportunities to the Linkage of Research ...

    African Journals Online (AJOL)

    Unknown User

    assumed to be non-negative truncated of the half-normal distribution Ν(µ, σu. 2). .... percent increase in seed rate increased output by 4.1 percent. On the other hand .... picks up the effects of physical strength as well as farming experience of.

  18. In vivo and in vitro translation of the RNAs of four tobamoviruses

    DEFF Research Database (Denmark)

    Beier, H; Mundry, K W; Issinger, O G

    1980-01-01

    The RNAs from four tobamoviruses [tobacco mosaic virus(TMV) vulgare, TMV dahlemense, TMV U2, and the cowpea strain of TMV (CcTMV)] were translated in a cell-free ribosome system from reticulocytes. Among the translation products found were two polypeptides with molecular weights of 170,000 and 120...

  19. Molten salt e.m.f. cell measurements on U-Ga alloys

    International Nuclear Information System (INIS)

    Prabhakara Reddy, B.; Kandan, R.; Nagarajan, K.; Vasudeva Rao, P.R.

    2000-01-01

    The Gibbs free energy of formation of intermetallic compounds, UGa 3 , UGa 2 and U 2 Ga 3 were determined by using high temperature molten salt galvanic cell measurements in the temperature range of 644-988 K, 751-947 K and 800-950 K, respectively. (author)

  20. Ammonia Generation via a Graphene-Coated Nickel Catalyst

    Directory of Open Access Journals (Sweden)

    Fei Lu

    2017-05-01

    Full Text Available A novel graphene-coated Ni electrode was developed in this investigation to improve corrosion resistance while unexpectedly enhancing the ammonia generation rate in the electrochemically induced urea to ammonia (eU2A process, which is an electrochemical onsite ammonia generation method. The development of the electrode is crucial for the eU2A reactions since in the ammonia generation process, the concentration of ammonia is inevitably high on the surface of the electrode, leading to severe corrosion of the electrode and the loss of generated ammonia as well. In this paper, the graphene was derived from raw coal by using the chemical vapor deposition method and self-lifted onto a Ni electrode to form a protective layer for corrosion prevention. Transmission electron microscopy showed the synthesized graphene had few-layers and Raman spectroscopy indicated that the coating of graphene was stable during the eU2A reaction. As a result, the ammonia corrosion of the Ni electrode was dramatically reduced by ~20 times with the graphene coating method. More importantly, a higher ammonia generation rate (~2 times was achieved using the graphene-coated Ni working electrode compared to a bare Ni electrode in the eU2A process.

  1. Mass spectrometry–based relative quantification of proteins in precatalytic and catalytically active spliceosomes by metabolic labeling (SILAC), chemical labeling (iTRAQ), and label-free spectral count

    Science.gov (United States)

    Schmidt, Carla; Grønborg, Mads; Deckert, Jochen; Bessonov, Sergey; Conrad, Thomas; Lührmann, Reinhard; Urlaub, Henning

    2014-01-01

    The spliceosome undergoes major changes in protein and RNA composition during pre-mRNA splicing. Knowing the proteins—and their respective quantities—at each spliceosomal assembly stage is critical for understanding the molecular mechanisms and regulation of splicing. Here, we applied three independent mass spectrometry (MS)–based approaches for quantification of these proteins: (1) metabolic labeling by SILAC, (2) chemical labeling by iTRAQ, and (3) label-free spectral count for quantification of the protein composition of the human spliceosomal precatalytic B and catalytic C complexes. In total we were able to quantify 157 proteins by at least two of the three approaches. Our quantification shows that only a very small subset of spliceosomal proteins (the U5 and U2 Sm proteins, a subset of U5 snRNP-specific proteins, and the U2 snRNP-specific proteins U2A′ and U2B′′) remains unaltered upon transition from the B to the C complex. The MS-based quantification approaches classify the majority of proteins as dynamically associated specifically with the B or the C complex. In terms of experimental procedure and the methodical aspect of this work, we show that metabolically labeled spliceosomes are functionally active in terms of their assembly and splicing kinetics and can be utilized for quantitative studies. Moreover, we obtain consistent quantification results from all three methods, including the relatively straightforward and inexpensive label-free spectral count technique. PMID:24448447

  2. Impulse Response of the Ocean Floor Nonlinear Techniques for Measurement Enhancement

    Science.gov (United States)

    1983-04-01

    Although there is current interest in detection of broadband energy in the ocean, most ASW systems are designed for discrete frequency emissions from...M«U2CDZ«’TZ — n HHO I-" (- UJ*UJ0 uj.»>- Z-- 3^ II I/IO U OZ CL*Q.HH LOS-^+CN

  3. Accelerator mass spectrometry of the heaviest long-lived ...

    Indian Academy of Sciences (India)

    A first step towards the heavier ions was done by a 129I ... dionuclides and first results of the two interesting radionuclides 236U (2.34 x107 a) and .... anywhere, and are mounted on a flat Cu mesh (1.2µm wire thickness) of 90% transmission.

  4. Cu and Al co-substituted cobalt ferrite: structural analysis ...

    Indian Academy of Sciences (India)

    ... 400 cm−1 (v2). They are attributed to the tetrahedral and octahedral group complexes of the spinel .... Intensity (a.u.). 2 (degree) ... Heating iron-hydroxides in air is known to yield haematite ... M–O distance in tetrahedral and octahedral sites.

  5. When is f(x1,x2,... ,xn)

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    When is f(x1,x2,... ,xn) = u1(x1) + u2(x2) +···+ un(xn)? ... (i) there exist non-zero integers p1,p2,... ,pk such that ..... probability measure for the countable collection of functions 1Ai , i = 1, 2, 3,. .... For question (B) a sufficient condition is that.

  6. Tumor therapy with a urokinase plasminogen activator-activated anthrax lethal toxin alone and in combination with paclitaxel.

    Science.gov (United States)

    Wein, Alexander N; Liu, Shihui; Zhang, Yi; McKenzie, Andrew T; Leppla, Stephen H

    2013-02-01

    PA-U2, an engineered anthrax protective antigen that is activated by urokinase was combined with wildtype lethal factor in the treatment of Colo205 colon adenocarcinoma in vitro and B16-BL6 mouse melanoma in vitro and in vivo. This therapy was also tested in combination with the small molecule paclitaxel, based on prior reports suggesting synergy between ERK1/2 inhibition and chemotherapeutics. Colo205 was sensitive to PA-U2/LF while B16-BL6 was not. For the combination treatment of B16-BL6, paclitaxel showed a dose response in vitro, but cells remained resistant to PA-U2/LF even in the presence of paclitaxel. In vivo, each therapy slowed tumor progression, and an additive effect between the two was observed. Since LF targets tumor vasculature while paclitaxel is an antimitotic, it is possible the agents were acting against different cells in the stroma, precluding a synergistic effect. The engineered anthrax toxin PA-U2/LF warrants further development and testing, possibly in combination with an antiangiogenesis therapy such as sunitinib or sorafinib.

  7. Experiment list: SRX1003126 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available amination was detected and eliminated in 1972, (PMID: 6081590) 31781873,97.7,4.1,777 GSM1664369: ORCA knockd...m a bone cancer patient || cell line=U2OS || chip antibody=input || treatment=ORCA knock

  8. Spliceosomal gene aberrations are rare, coexist with oncogenic mutations, and are unlikely to exert a driver effect in childhood MDS and JMML

    NARCIS (Netherlands)

    S. Hirabayashi (Shinsuke); C. Flotho (Christian); J. Moetter (Jessica); M. Heuser (Michael); H. Hasle (Henrik); B. Gruhn (Bernd); T. Klingebiel (Thomas); F. Thol (Felicitas); B. Schlegelberger (Brigitte); I. Baumann (Irith); B. Strahm (Brigitte); J. Stary (Jan); F. Locatelli (Franco); M. Zecca (Marco); E. Bergstraesser (Eva); M.N. Dworzak (Michael); M.M. van den Heuvel-Eibrink (Marry); B. de Moerloose (Barbara); S. Ogawa (Susumu); C.M. Niemeyer (Charlotte); M. Wlodarski (Marcin)

    2012-01-01

    textabstractSomatic mutations of the spliceosomal machinery occur frequently in adult patients with myelodysplastic syndrome (MDS). We resequenced SF3B1, U2AF35, and SRSF2 in 371 children with MDS or juvenile myelomonocytic leukemia. We found missense mutations in 2 juvenile myelomonocytic leukemia

  9. Manned Airborne Intelligence, Surveillance, and Reconnaissance: Strategic, Tactical . . . Both?

    Science.gov (United States)

    2012-12-01

    Program, 1996), 97, http://www.dtic.mil /cgi-bin/GetTRDoc?AD=ADA442835&Location=U2&doc=GetTRDoc.pdf. 17. Quoted in William E. Burrows , By Any Means...41. Larry Tart and Robert Keefe, The Price of Vigilance: Attacks on American Surveillance Flights (New York: Ballantine Books, 2001), 196. 42. Ibid

  10. Evaluation of autophagy as a mechanism involved in air pollutant-induced pulmonary injury

    Science.gov (United States)

    Evaluation of autophagy as a mechanism involved in air pollutant-induced pulmonary injuryHenriquez, A.1, Snow, S.2, Miller, D1.,Schladweiler, M.2 and Kodavanti, U2.1 Curriculum in Toxicology, UNC, Chapel Hill, NC. 2 EPHD/NHEERL, US EPA, RTP, Durham, NC. ...

  11. Role of Glycol Chitosan-incorporated Ursolic Acid Nanoparticles in ...

    African Journals Online (AJOL)

    Purpose: To investigate the effect of ursolic acid (UA)-incorporated glycol chitosan (GC) nanoparticles on inhibition of human osteosarcoma. Methods: U2OS and Saos-2 osteosarcoma cells were transfected with ursolic acid (UA) incorporated glycol chitosan (GC) nanoparticles. Ultraviolet (UV) spectrophotometry was used ...

  12. The Harmon Memorial Lectures in Military History 1959-1987

    Science.gov (United States)

    1988-01-01

    Farrand, ed., Records of the Federal Convention of 1787 (New Haven, 1911-1937), 111, 85, 86n. 4. Pogue, Marshall, 1, 323; Larry 1. Bland and Sharon R...569, iU2, 573 Boulogne camp: 316, 317 594 INDEX Bourke , John G.: 26 Chamberlain, Neville: 572 Bradley, Omar N.: 163, 166, 167, 185, 190, Charles

  13. Muusika DVD-d / Mart Normet

    Index Scriptorium Estoniae

    Normet, Mart, 1979-

    2006-01-01

    Uutest DVD-dest U2 "ZooTV: Live From Sydney", Cool D "Legaalselt eetris", Pink Floyd "Pulse", Depeche Mode "Touring The Angel: Live In Milan", Rammstein "Völkerball", Metsatöll "Lahinguväljal näeme, raisk"

  14. CryoEM structures of two spliceosomal complexes: starter and dessert at the spliceosome feast.

    Science.gov (United States)

    Nguyen, Thi Hoang Duong; Galej, Wojciech P; Fica, Sebastian M; Lin, Pei-Chun; Newman, Andrew J; Nagai, Kiyoshi

    2016-02-01

    The spliceosome is formed on pre-mRNA substrates from five small nuclear ribonucleoprotein particles (U1, U2, U4/U6 and U5 snRNPs), and numerous non-snRNP factors. Saccharomyces cerevisiae U4/U6.U5 tri-snRNP comprises U5 snRNA, U4/U6 snRNA duplex and approximately 30 proteins and represents a substantial part of the spliceosome before activation. Schizosaccharomyces pombe U2.U6.U5 spliceosomal complex is a post-catalytic intron lariat spliceosome containing U2 and U5 snRNPs, NTC (nineteen complex), NTC-related proteins (NTR), U6 snRNA, and an RNA intron lariat. Two recent papers describe near-complete atomic structures of these complexes based on cryoEM single-particle analysis. The U4/U6.U5 tri-snRNP structure provides crucial insight into the activation mechanism of the spliceosome. The U2.U6.U5 complex reveals the striking architecture of NTC and NTR and important features of the group II intron-like catalytic RNA core remaining after spliced mRNA is released. These two structures greatly advance our understanding of the mechanism of pre-mRNA splicing. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  15. Detsibill : MTV, so what? White label : Ska Faktor - Isemoodi tüdruk/Püha õhtusöömaaeg. Kuula / DJ Pickney Tiger

    Index Scriptorium Estoniae

    DJ Pickney Tiger, pseud., 1970-

    2006-01-01

    MTVst ja MTV Eestist. Ansambli Ska Faktor heliplaadist. Heliplaatidest: Oasis "Stop the Clocks", Killers "Sam's Town" ja "Panic! At the Disco "A fever you can't sweat out"", U2 "18 Singles", Rammstein "Völkerball", Juliette And The Licks "Four on the Floor", Cradles Of Filth "Thornography", ABBA "Number Ones", Ost Klub "Kapiel 1", Beenie Man "Undisputed", Charlotte Gainsbourg "5:55"

  16. Universalidad de la computación cuántica geométrica modelo de tres estados Universalidad de la computación cuántica geométrica: modelo de tres estados

    Directory of Open Access Journals (Sweden)

    Andrés Sicard

    2005-04-01

    Full Text Available El modelo de tres estados es un modelo de computación cuántica geométrica. Se ilustra que éste es un modelo de computación cuántica universal, con base en el trabajo desarrollado por Niskanen, Nakahara y Salomaa [16]. Las universalidades U(2 y U(2n≥ 1 del modelo se obtienen a partir de la construcción de las compuertas de rotación Rx(α y R(α, y de las compuertas de Hadamard H y de fase B(η, respectivamente. Para cada compuerta, se presenta explícitamente el operador de holonomía ΓAy(γ y el ciclo γ sobre el cual es construída.The three state model is a geometric quantum computation model. We show that this one is an universal quantum computation model, with base in the work developed by Niskanen, Nakahara and Salomaa [16]. The U(2 and U(2n≥1 universalities are obtained from the construction of the rotations gates Rx(α and Ry(α, and the Hadamard gate H and the phase gates B(η, respectively. For every quantum gate, we explicitly show the holonomy operator ΓA(γ and the loop γ on which this is built.

  17. Synthetic Strategies for the Synthesis of Ternary Uranium(IV) and Thorium(IV) Fluorides.

    Science.gov (United States)

    Klepov, Vladislav V; Felder, Justin B; Zur Loye, Hans-Conrad

    2018-04-10

    A series of new U(IV) and Th(IV) fluorides, Na 7 U 6 F 31 (1), NaUF 5 (2), NaU 2 F 9 (3), KTh 2 F 9 (4), NaTh 2 F 9 (5), (H 3 O)Th 3 F 13 (6), and (H 3 O)U 3 F 13 (7), was obtained using hydrothermal and low-temperature flux methods. Mild hydrothermal reactions with uranyl acetate as a precursor yielded 1, 7, and the monoclinic polymorph of NaU 2 F 9 , whereas direct reactions between UF 4 and NaF led to the formation of 2 and orthorhombic NaU 2 F 9 (3). This highlights an unexpected difference in reaction products when different starting uranium sources are used. All seven compounds were characterized by single-crystal X-ray diffraction, and their structures are compared on the basis of cation topology, revealing a close topological resemblance between fluorides on the basis of the layers observed in NaUF 5 (H 2 O). Phase-pure samples of 1, 2, and both polymorphs of NaU 2 F 9 were obtained, and their spectroscopic and magnetic properties were measured. The UV-vis data are dominated by the presence of U 4+ cations and agree well with the electronic transitions. Effective magnetic moments of the studied compounds were found to range from 3.08 to 3.59 μ B .

  18. Non-commutative geometry and supersymmetry 2

    International Nuclear Information System (INIS)

    Hussain, F.; Thompson, G.

    1991-05-01

    Following the general construction of supersymmetric models, the model based on the idea of non-commutative geometry is formulated as a Yang-Mills theory of the graded Lie algebra U(2/1) over a graded space-time manifold. 4 refs

  19. Triplex DNA-binding proteins are associated with clinical outcomes revealed by proteomic measurements in patients with colorectal cancer

    Directory of Open Access Journals (Sweden)

    Nelson Laura D

    2012-06-01

    Full Text Available Abstract Background Tri- and tetra-nucleotide repeats in mammalian genomes can induce formation of alternative non-B DNA structures such as triplexes and guanine (G-quadruplexes. These structures can induce mutagenesis, chromosomal translocations and genomic instability. We wanted to determine if proteins that bind triplex DNA structures are quantitatively or qualitatively different between colorectal tumor and adjacent normal tissue and if this binding activity correlates with patient clinical characteristics. Methods Extracts from 63 human colorectal tumor and adjacent normal tissues were examined by gel shifts (EMSA for triplex DNA-binding proteins, which were correlated with clinicopathological tumor characteristics using the Mann-Whitney U, Spearman’s rho, Kaplan-Meier and Mantel-Cox log-rank tests. Biotinylated triplex DNA and streptavidin agarose affinity binding were used to purify triplex-binding proteins in RKO cells. Western blotting and reverse-phase protein array were used to measure protein expression in tissue extracts. Results Increased triplex DNA-binding activity in tumor extracts correlated significantly with lymphatic disease, metastasis, and reduced overall survival. We identified three multifunctional splicing factors with biotinylated triplex DNA affinity: U2AF65 in cytoplasmic extracts, and PSF and p54nrb in nuclear extracts. Super-shift EMSA with anti-U2AF65 antibodies produced a shifted band of the major EMSA H3 complex, identifying U2AF65 as the protein present in the major EMSA band. U2AF65 expression correlated significantly with EMSA H3 values in all extracts and was higher in extracts from Stage III/IV vs. Stage I/II colon tumors (p = 0.024. EMSA H3 values and U2AF65 expression also correlated significantly with GSK3 beta, beta-catenin, and NF- B p65 expression, whereas p54nrb and PSF expression correlated with c-Myc, cyclin D1, and CDK4. EMSA values and expression of all three splicing factors correlated

  20. The rate of lactate production from glucose in hearts is not altered by per-deuteration of glucose

    Science.gov (United States)

    Funk, Alexander M.; Anderson, Brian L.; Wen, Xiaodong; Hever, Thomas; Khemtong, Chalermchai; Kovacs, Zoltan; Sherry, A. Dean; Malloy, Craig R.

    2017-11-01

    This study was designed to determine whether perdeuterated glucose experiences a kinetic isotope effect (KIE) as glucose passes through glycolysis and is further oxidized in the tricarboxylic acid (TCA) cycle. Metabolism of deuterated glucose was investigated in two groups of perfused rat hearts. The control group was supplied with a 1:1 mixture of [U-13C6]glucose and [1,6-13C2]glucose, while the experimental group received [U-13C6,U-2H7]glucose and [1,6-13C2]glucose. Tissue extracts were analyzed by 1H, 2H and proton-decoupled 13C NMR spectroscopy. Extensive 2H-13C scalar coupling plus chemical shift isotope effects were observed in the proton-decoupled 13C NMR spectra of lactate, alanine and glutamate. A small but measureable (∼8%) difference in the rate of conversion of [U-13C6]glucose vs. [1,6-13C2]glucose to lactate, likely reflecting rates of Csbnd C bond breakage in the aldolase reaction, but conversion of [U-13C6]glucose versus [U-13C6,U-2H7]glucose to lactate did not differ. This shows that the presence of deuterium in glucose does not alter glycolytic flux. However, there were two distinct effects of deuteration on metabolism of glucose to alanine and oxidation of glucose in the TCA. First, alanine undergoes extensive exchange of methyl deuterons with solvent protons in the alanine amino transferase reaction. Second, there is a substantial kinetic isotope effect in metabolism of [U-13C6,U-2H7]glucose to alanine and glutamate. In the presence of [U-13C6,U-2H7]glucose, alanine and lactate are not in rapid exchange with the same pool of pyruvate. These studies indicate that the appearance of hyperpolarized 13C-lactate from hyperpolarized [U-13C6,U-2H7]glucose is not substantially influenced by a deuterium kinetic isotope effect.

  1. Associations between maternal experiences of intimate partner violence and child nutrition and mortality: findings from Demographic and Health Surveys in Egypt, Honduras, Kenya, Malawi and Rwanda.

    Science.gov (United States)

    Rico, Emily; Fenn, Bridget; Abramsky, Tanya; Watts, Charlotte

    2011-04-01

    If effective interventions are to be used to address child mortality and malnutrition, then it is important that we understand the different pathways operating within the framework of child health. More attention needs to be given to understanding the contribution of social influences such as intimate partner violence (IPV). To investigate the relationship between maternal exposure to IPV and child mortality and malnutrition using data from five developing countries. Population data from Egypt, Honduras, Kenya, Malawi and Rwanda were analysed. Logistic regression analysis was used to generate odds ratios of the associations between several categories of maternal exposure to IPV since the age of 15 and three child outcomes: under-2-year-old (U2) mortality and moderate and severe stunting (Honduras) to 46.2% (Kenya). For child stunting, prevalence ranged from 25.4% (Egypt) to 58.0% (Malawi) and for U2 mortality from 3.6% (Honduras) to 15.2% (Rwanda). In Kenya, maternal exposure to IPV was associated with higher U2 mortality (adjusted odds ratio (OR)=1.42, 95% CI 1.18 to 1.71) and child stunting (adjusted OR=1.36, 95% CI 1.16 to 1.61). In Malawi and Honduras, marginal associations were observed between IPV and severe stunting and U2 mortality, respectively, with strength of associations varying by type of violence. The relationship between IPV and U2 mortality and stunting in Kenya, Honduras and Malawi suggests that, in these countries, IPV plays a role in child malnutrition and mortality. This contributes to a growing body of evidence that broader public health benefits may be incurred if efforts to address IPV are incorporated into a wider range of maternal and child health programmes; however, the authors highlight the need for more research that can establish temporality, use data collected on the basis of the study's objectives, and further explore the causal framework of this relationship using more advanced statistical analysis.

  2. Working Together to Deliver Usable Climate Information to Agricultural Producers and Advisors in the U.S. Corn Belt

    Science.gov (United States)

    Prokopy, L. S.; Widhalm, M.

    2012-12-01

    Weather and climate patterns are a driving force behind the success or failure of cropping systems. With U.S. corn and soybean production accounting for nearly one-third of global supplies and contributing $100 billion annually to the national economy, the ability to successfully produce crops under more variable climate conditions is critical. Useful to Usable (U2U): Transforming Climate Variability and Change Information for Cereal Crop Producers is a USDA-funded research and extension project focused on delivering to producers and farm advisors the resources and training they need to more effectively manage variable climate conditions. The U2U team is a diverse and uniquely qualified group of climatologists, crop modelers, agronomists, economists, and social scientists from 10 Midwestern universities and two NOAA Regional Climate Centers. Together, we strive to help producers make better long-term plans on what, when and where to plant and also how to manage crops for maximum yields and minimum environmental damage. Under development are tools that will allow the agricultural community to examine the financial, production, and environmental outcomes of different management options and climate scenarios so farmers can choose strategies that fit their capabilities and acceptable levels of risk. Researchers are currently using existing data and agro-climate models to investigate the impact of climate conditions on key topics such as crop yields, fieldwork opportunities, nitrogen management, and the cost-effectiveness of irrigation and tiling. To ensure relevance and usability of U2U products, our social science team is using a number of techniques including surveys and focus groups to integrate stakeholder interests, needs, and concerns into all aspects of U2U research. It is through this coupling of physical and social science disciplines that we strive to transform existing climate information into actionable knowledge. This presentation will elaborate on U2U

  3. Computer-aided detection of small pulmonary nodules in multidetector spiral computed tomography (MSCT) in children

    International Nuclear Information System (INIS)

    Honnef, D.; Behrendt, F.F.; Hohl, C.; Mahnken, A.H.; Guenther, R.W.; Das, M.; Mertens, R.; Stanzel, S.

    2008-01-01

    Purpose: Retrospective evaluation of computer-aided detection software (CAD) for automated detection (LungCAD, Siemens Medical solutions, Forchheim, Germany) and volumetry (LungCARE) of pulmonary nodules in dose-reduced pediatric MDCT. Materials and Methods: 30 scans of 24 children (10.4±5.9 years, 13 girls, 11 boys, 39.7±29.3 kg body weight) were performed on a 16-MDCT for tumor staging (n=18), inflammation (n=9), other indications (n=3). Tube voltage 120 kVp and effective mAs were adapted to body weight. Slice thickness 2 mm, increment 1 mm. A pediatric radiologist (U1), a CAD expert (U2) and an inexperienced radiologist (U3) independently analyzed the lung window images without and with the CAD as a second reader. In a consensus decision U1 and U2 were the reference standard. Results: Five examinations had to be excluded from the study due to other underlying lung disease. A total of 24 pulmonary nodules were found in all data sets with a minimal diameter of 0.35 mm to 3.81 mm (mean 1.7±0.85 mm). The sensitivities were as follows: U1 95.8% and 100% with CAD; U2 91.7% U3 66.7%. U2 and U3 did not detect further nodules with CAD. The sensitivity of CAD alone was 41.7% with 0.32 false-positive findings per examination. Interobserver agreement between U1/U2 regarding nodule detection with CAD was good (k=0.6500) and without CAD very good (k=0.8727). For the rest (U1/U3; U2/U3 with and without CAD), it was weak (k=0.0667-0.1884). Depending on the measured value (axial measurement, volume), there is a significant correlation (p=0.0026-0.0432) between nodule size and CAD detection. Undetected pulmonary nodules (mean 1.35 mm; range 0.35-2.61 mm) were smaller than the detected ones (mean 2.19 mm; range 1.35-3.81 mm). No significant correlation was found between CAD findings and patient age (p=0.9263) and body weight (p=0.9271) as well as nodule location (subpleural, intraparenchymal; p=1.0) and noise/SNR. (orig.)

  4. Evidence in Variscan Corsica of a brief and voluminous Late Carboniferous to Early Permian volcanic-plutonic event contemporaneous with a high-temperature/low-pressure metamorphic peak in the lower crust

    International Nuclear Information System (INIS)

    Rossi, Philippe; Cocherie, Alain; Fanning, C. Mark

    2015-01-01

    The U2 group of plutonic rocks constituting the main exposed part of the Corsica-Sardinia batholith (CSB) was emplaced from 308 to 275 Ma (the early Visean U1 group of Mg-K intrusions is not considered here). Field evidence earlier established volcanic-plutonic relationships in the U2 group of calc-alkaline intrusions of the CSB, though detailed chronological data were still lacking. Large outcrops of U2 volcanic formations are restricted to the less eroded zone north-west of the Porto-Ponte Leccia line in Corsica, but volcanic and volcano-sedimentary formations were widely eroded elsewhere since Permian times. They probably covered most of the batholith before the Miocene, as testified by the volcanic nature of the pebbles that form much of the Early Miocene conglomerates of eastern Corsica. U-Pb zircon dating (SHRIMP) was used for deciphering the chronology and duration of different volcanic pulses and for better estimating the time overlap between plutonic and volcanic rock emplacement in the CSB. The obtained ages fit well with field data, showing that most of the U2 and U3 volcanic formations were emplaced within a brief time span of roughly 15 m.y., from 293 to 278 Ma, coeval with most U2 monzo-granodiorites and leuco-monzo-granites (295-280 Ma), alkaline U3 complexes (about 288 Ma), and mafic-ultramafic tholeiitic complexes (295-275 Ma). The same chronological link between deep-seated magma chambers and eruptions was identified in the Pyrenees. These results correlate with U-Pb zircon dating of HT-LP granulites from the Variscan deep crust exhumed along the 'European' margin of the thinned Tethys margin in Corsica and Calabria. Here, the peak of the low-pressure/high-temperature metamorphism was dated at about 285-280 Ma. Our results throw light on the condition of magma production during the orogenic collapse in the southern Variscan realm. While juvenile tholeiitic basaltic magma was produced by the melting of spinel mantle lithosphere, all

  5. Impact of substrate corrugation on the sliding friction levels of adsorbed films.

    Science.gov (United States)

    Coffey, T; Krim, J

    2005-08-12

    We report a quartz crystal microbalance (QCM) study of sliding friction for solid xenon monolayers at 77 K on Cu(111), Ni(111), graphene/Ni(111), and C(60) substrates. Simulations have predicted a strong dependence of phononic friction coefficient (eta) on surface corrugation in systems with similar lattice spacing, eta approximately U(2)(0), but this has never before been shown experimentally. In order to make direct comparisons with theory, substrates with similar lattice spacing but varying amplitudes of surface corrugation were studied. QCM data reveal friction levels proportional to U(2)(0), validating current theoretical and numerical predictions. Measurements of Xe/C(60) are also included for comparison purposes.

  6. Two-field Born–Infeld with diverse dualities

    Directory of Open Access Journals (Sweden)

    S. Ferrara

    2016-11-01

    Full Text Available We elaborate on how to build, in a systematic fashion, two-field Abelian extensions of the Born–Infeld Lagrangian. These models realize the non-trivial duality groups that are allowed in this case, namely U(2, SU(2 and U(1×U(1. For each class, we also construct an explicit example. They all involve an overall square root and reduce to the Born–Infeld model if the two fields are identified, but differ in quartic and higher interactions. The U(1×U(1 and SU(2 examples recover some recent results obtained with different techniques, and we show that the U(1×U(1 model admits an N=1 supersymmetric completion. The U(2 example includes some unusual terms that are not analytic at the origin of field space.

  7. Ore-forming environment identification and uranium metallogenic features in Manite depression

    International Nuclear Information System (INIS)

    Liu Zhengyi; Liu Wusheng; Jia Licheng; Shi Qingping; Peng Cong; Chen Hua

    2014-01-01

    By using limonitization, the important indicator of uranium ore-forming identification as the product of acid water transportation from the reducing environment to the oxidation environment, based on the specimen examination naked eye, microscopic identification, electron microscopy, electron microprobe were used to study the major elements, trace elements, organic carbon, total sulfur, uranium valence and uranium, thorium isotope "2"3"4U/"2"3"8U, "2"3"0Th/"2"3"2Th ratio, hydrocarbons especially clay mineral species and the total amount, V/(V + Ni) water stratification and bottom hydrodynamic environment and other factors, which can indicate the microphase environment of all types of rocks in Manite depression, and uranium ore-forming factors were identified and evaluation are discussed and some suggestions were submitted. (authors)

  8. Matrix factorisations for rational boundary conditions by defect fusion

    International Nuclear Information System (INIS)

    Behr, Nicolas; Fredenhagen, Stefan

    2015-01-01

    A large class of two-dimensional N=(2,2) superconformal field theories can be understood as IR fixed-points of Landau-Ginzburg models. In particular, there are rational conformal field theories that also have a Landau-Ginzburg description. To understand better the relation between the structures in the rational conformal field theory and in the Landau-Ginzburg theory, we investigate how rational B-type boundary conditions are realised as matrix factorisations in the SU(3)/U(2) Grassmannian Kazama-Suzuki model. As a tool to generate the matrix factorisations we make use of a particular interface between the Kazama-Suzuki model and products of minimal models, whose fusion can be realised as a simple functor on ring modules. This allows us to formulate a proposal for all matrix factorisations corresponding to rational boundary conditions in the SU(3)/U(2) model.

  9. Determination of natural radioactivity levels in sediments: Caravelas river, BA, Brazil

    International Nuclear Information System (INIS)

    Carmo, R.F.; Trindade Filho, O.L.; Delgado, J.U.; Peixoto, J.G. P.; Evangelista, H.

    2016-01-01

    Due to intensive human activity in the region and disorderly occupation, the Caravelas River estuary has not yet evaluated the contribution of natural radioactivity. In order to determine the natural radioactivity levels in sediments, the activities of "2"3"8U, "2"3"2Th and "4"0K, were calculated using a gamma spectrometry system for measuring the concentration of radiation in samples. Results for "2"3"8U, "2"3"2Th and "4"0K ranged from (18.03 to 191.51), (28.57 to 118.25) and (134.06 to 186.80) Bq.kg"-"1, respectively, within of detection limits. The estimated uncertainty levels were less than 10% (k = 1). (author)

  10. Multicomponent synthesis of unsymmetrical unsaturated N-heterocyclic carbene precursors and their related transition-metal complexes

    KAUST Repository

    Queval, Pierre

    2013-12-04

    A low-cost, modular, and easily scalable multicomponent procedure affording access in good yields and excellent selectivity (up to 93 %) to a wide range of (a)chiral unsymmetrical 1-aryl-3-cycloalkyl-imidazolium salts is disclosed. Electronic and steric properties of the corresponding unsymmetrical unsaturated N-heterocyclic carbene (U2-NHC) ligands were evaluated and evidenced strong electron donor ability, high steric discrimination, and modular steric demand. A low-cost, modular, and easily scalable multicomponent procedure, affording access to a wide range of (a)chiral unsymmetrical 1-aryl-3-cycloalkyl- imidazolium salts in good yields and excellent selectivities, is disclosed. Electronic and steric properties of the corresponding unsymmetrical unsaturated N-heterocyclic carbene (U2-NHC) ligands were evaluated and evidenced strong electron-donor ability, high steric discrimination, and modular steric demand. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. The swirl turbine

    International Nuclear Information System (INIS)

    Haluza, M; Pochylý, F; Rudolf, P

    2012-01-01

    In the article is introduced the new type of the turbine - swirl turbine. This turbine is based on opposite principle than Kaplan turbine. Euler equation is satisfied in the form gHη h = −u 2 v u2 . From this equation is seen, that inflow of liquid into the runner is without rotation and on the outflow is a rotation of liquid opposite of rotation of runner. This turbine is suitable for small head and large discharge. Some constructional variants of this turbine are introduced in the article and theoretical aspects regarding losses in the draft tube. The theory is followed by computational simulations in Fluent and experiments using laser Doppler anemometry.

  12. On the performance of Usain Bolt in the 100 m sprint

    Science.gov (United States)

    Hernández Gómez, J. J.; Marquina, V.; Gómez, R. W.

    2013-09-01

    Many university texts on mechanics consider the effect of air drag force, using the slowing down of a parachute as an example. Very few discuss what happens when the drag force is proportional to both u and u2. In this paper we deal with a real problem to illustrate the effect of both terms on the speed of a runner: a theoretical model of the world-record 100 m sprint of Usain Bolt during the 2009 World Championships in Berlin is developed, assuming a drag force proportional to u and to u2. The resulting equation of motion is solved and fitted to the experimental data obtained from the International Association of Athletics Federations, which recorded Bolt's position with a laser velocity guard device. It is worth noting that our model works only for short sprints.

  13. Reaction of nickel with uranium mononitride

    International Nuclear Information System (INIS)

    Anselin, F.; Calais, D.; Lorenzelli, N.; Passefort, J.C.

    1965-01-01

    UN-Ni system has been investigated in solid phase by diffusion couples UN-Ni or by mixed powders pressed and sintered. Studies have been carried out by micrography, X-rays and microanalysis with a CASTAING microprobe. UN-Ni compatibility is quite good up to 600 C; beyond this temperature diffusion zones corresponding to UNi 5 and U 2 N 3 appear in the couples either reaction : 3 U N + 5 Ni → U 2 N 3 + UNi 5 ; UN + 5 Ni → UNi 5 + 1/2 N 2 takes place from 700 C according to nitrogen pressure involved. For temperatures between 800 and 1000 C nickel solubility in uranium nitride is 1500 ± 500 wt ppm. (authors) [fr

  14. Lattice functions, wavelet aliasing, and SO(3) mappings of orthonormal filters

    Science.gov (United States)

    John, Sarah

    1998-01-01

    A formulation of multiresolution in terms of a family of dyadic lattices {Sj;j∈Z} and filter matrices Mj⊂U(2)⊂GL(2,C) illuminates the role of aliasing in wavelets and provides exact relations between scaling and wavelet filters. By showing the {DN;N∈Z+} collection of compactly supported, orthonormal wavelet filters to be strictly SU(2)⊂U(2), its representation in the Euler angles of the rotation group SO(3) establishes several new results: a 1:1 mapping of the {DN} filters onto a set of orbits on the SO(3) manifold; an equivalence of D∞ to the Shannon filter; and a simple new proof for a criterion ruling out pathologically scaled nonorthonormal filters.

  15. Effect of boron and gadolinium concentration on the calculated neutron multiplication factor of U(3)O2 fuel pins in optimum geometries

    International Nuclear Information System (INIS)

    Thomas, J.T.

    1984-10-01

    The KENO-Va improved Monte Carlo criticality program is used to calculate the neutron multiplication factor for TMI-U2 fuel compositions in a variety of configurations and to display parametric regions giving rise to maximum reactivity contributions. The lattice pitch of UO 2 fuel pins producing a maximum k/sub eff/ is determined as a function of boron concentrations in the coolant for infinite and finite systems. The characteristics of U 3 O 8 -coolant mixtures of interest to modeling the rubble region of the core are presented. Several disrupted core configurations are calculated and comparisons made. The results should be useful to proposed defueling of the TMI-U2 reactor

  16. Higher order effects of pseudoparticles in QCD

    International Nuclear Information System (INIS)

    Hietarinta, J.; Palmer, W.F.

    1977-01-01

    Gauge invariant Green's functions of quark-antiquark bilinear densities in massless, two-color QCD are studied. Nonzero-energy fermion modes, pseudoparticle solutions with topological charge absolute value ν > 1, and n-point functions with n > 2. Some general properties of the O(Dirac constant) approximation are developed, enabling one to isolate and define the terms which contribute to a general n-point function. The higher effects it is found preserve the symmetry breakdown found earlier in the 2-point function (U(2) x U(2) → SU(2) x SU(2) x U(1)). It is shown that a previous 2-point function analysis is exact to order Dirac constant

  17. Communication: Fast dynamics perspective on the breakdown of the Stokes-Einstein law in fragile glassformers.

    Science.gov (United States)

    Puosi, F; Pasturel, A; Jakse, N; Leporini, D

    2018-04-07

    The breakdown of the Stokes-Einstein (SE) law in fragile glassformers is examined by Molecular-Dynamics simulations of atomic liquids and polymers and consideration of the experimental data concerning the archetypical ortho-terphenyl glassformer. All the four systems comply with the universal scaling between the viscosity (or the structural relaxation) and the Debye-Waller factor ⟨u 2 ⟩, the mean square amplitude of the particle rattling in the cage formed by the surrounding neighbors. It is found that the SE breakdown is scaled in a master curve by a reduced ⟨u 2 ⟩. Two approximated expressions of the latter, with no and one adjustable parameter, respectively, are derived.

  18. Anomalous decay f1(1285 )→π+π-γ in the Nambu-Jona-Lasinio model

    Science.gov (United States)

    Osipov, A. A.; Volkov, M. K.

    2018-04-01

    Using the Nambu-Jona-Lasinio model with the U (2U (2 ) chiral symmetric effective four-quark interactions, we derive the amplitude of the radiative decay f1(1285 )→π+π-γ , find the decay width Γ (f1→π+π-γ )=346 keV and obtain the spectral dipion effective mass distribution. It is shown that in contrast to the majority of theoretical estimates (which consider the a1(1260 ) meson exchange as the dominant one), the most relevant contribution to this process is the ρ0-resonance exchange related with the triangle f1ρ0γ anomaly. The spectral function is obtained to be confronted with the future empirical data.

  19. The effect of the Polyakov loop on the chiral phase transition

    Directory of Open Access Journals (Sweden)

    Szép Zs.

    2011-04-01

    Full Text Available The Polyakov loop is included in the S U(2L × S U(2R chiral quark-meson model by considering the propagation of the constituent quarks, coupled to the (σ, π meson multiplet, on the homogeneous background of a temporal gauge field, diagonal in color space. The model is solved at finite temperature and quark baryon chemical potential both in the chiral limit and for the physical value of the pion mass by using an expansion in the number of flavors Nf. Keeping the fermion propagator at its tree-level, a resummation on the pion propagator is constructed which resums infinitely many orders in 1/Nf, where O(1/Nf represents the order at which the fermions start to contribute in the pion propagator. The influence of the Polyakov loop on the tricritical or the critical point in the µq – T phase diagram is studied for various forms of the Polyakov loop potential.

  20. Explaining the DAMPE e+e- excess using the Higgs triplet model with a vector dark matter

    Science.gov (United States)

    Chen, Chuan-Hung; Chiang, Cheng-Wei; Nomura, Takaaki

    2018-03-01

    We explain the e+e- excess observed by the DAMPE Collaboration using a dark matter model based upon the Higgs triplet model and an additional hidden S U (2 )X gauge symmetry. Two of the S U (2 )X gauge bosons are stable due to a residual discrete symmetry and serve as the dark matter candidate. We search the parameter space for regions that can explain the observed relic abundance, and compute the flux of e+e- coming from a nearby dark matter subhalo. With the inclusion of background cosmic rays, we show that the model can render a good fit to the entire energy spectrum covering the AMS-02, Fermi-LAT, CALET and DAMPE data.

  1. Matrix factorisations for rational boundary conditions by defect fusion

    Energy Technology Data Exchange (ETDEWEB)

    Behr, Nicolas [Department of Mathematics, Heriot-Watt University,Riccarton, Edinburgh, EH14 4AS (United Kingdom); Maxwell Institute for Mathematical Sciences,Edinburgh (United Kingdom); Fredenhagen, Stefan [Max-Planck-Institut für Gravitationsphysik, Albert-Einstein-Institut,D-14424 Golm (Germany)

    2015-05-11

    A large class of two-dimensional N=(2,2) superconformal field theories can be understood as IR fixed-points of Landau-Ginzburg models. In particular, there are rational conformal field theories that also have a Landau-Ginzburg description. To understand better the relation between the structures in the rational conformal field theory and in the Landau-Ginzburg theory, we investigate how rational B-type boundary conditions are realised as matrix factorisations in the SU(3)/U(2) Grassmannian Kazama-Suzuki model. As a tool to generate the matrix factorisations we make use of a particular interface between the Kazama-Suzuki model and products of minimal models, whose fusion can be realised as a simple functor on ring modules. This allows us to formulate a proposal for all matrix factorisations corresponding to rational boundary conditions in the SU(3)/U(2) model.

  2. Multiple normalized solutions for a planar gauged nonlinear Schrödinger equation

    Science.gov (United States)

    Luo, Xiao

    2018-06-01

    We study the existence, multiplicity, quantitative property and asymptotic behavior of normalized solutions for a gauged nonlinear Schrödinger equation arising from the Chern-Simons theory Δ u + ω u +|x|^2u+ λ ( {{h^2}(| x | )}/{{{| x | ^2}}} + \\int \\limits _{| x | }^{ + ∞} {{h(s)}/s} {u^2}(s)ds) u = {| u | ^{p - 2}}u,\\quad x\\in R^2, where ω \\in R, λ >0, p>4 and h(s) = 1/2\\int \\limits _0^s {r{u^2}(r)dr} . Combining constraint minimization method and minimax principle, we prove that the problem possesses at least two normalized solutions: One is a ground state and the other is an excited state. Furthermore, the asymptotic behavior and quantitative property of the ground state are analyzed.

  3. Semialigned two Higgs doublet model

    Science.gov (United States)

    Haba, Naoyuki; Umeeda, Hiroyuki; Yamada, Toshifumi

    2018-02-01

    In the left-right symmetric model based on S U (2 )L×S U (2 )R×U (1 )B -L gauge symmetry, there appear heavy neutral scalar particles mediating quark flavor changing neutral currents (FCNCs) at tree level. We consider a situation where such FCNCs give the only sign of the left-right model while WR gauge boson is decoupled, and name it "semialigned two Higgs doublet model" because the model resembles a two Higgs doublet model with mildly aligned Yukawa couplings to quarks. We predict a correlation among processes induced by quark FCNCs in the model, and argue that future precise calculation of meson-antimeson mixings and C P violation therein may hint at the semialigned two Higgs doublet model and the left-right model behind it.

  4. Stress corrosion cracking of uranium--niobium alloys

    International Nuclear Information System (INIS)

    Magnani, N.J.

    1978-03-01

    The stress corrosion cracking behavior of U-2 1 / 4 , 4 1 / 2 , 6 and 8 wt % Nb alloys was evaluated in laboratory air and in aqueous Cl - solutions. Thresholds for crack propagation were obtained in these environments. The data showed that Cl - solutions are more deleterious than air environments. Tests were also conducted in pure gases to identify the species in the air responsible for cracking. These data showed the primary stress corrodent is water vapor for the most reactive alloy, U-2 1 / 4 % Nb, while O 2 is primarily responsible for cracking in the more corrosion resistant alloys, U-6 and 8% Nb. The 4 1 / 2 % alloy was found to be susceptible in both H 2 O and O 2 environments

  5. Assessing Independent Variables Used in Econometric Modeling Forest Land Use or Land Cover Change: A Meta-Analysis

    Science.gov (United States)

    J Jeuck; F. Cubbage; R. Abt; R. Bardon; J. McCarter; J. Coulston; M. Renkow

    2014-01-01

    : We conducted a meta-analysis on 64 econometric models from 47 studies predicting forestland conversion to agriculture (F2A), forestland to development (F2D), forestland to non-forested (F2NF) and undeveloped (including forestland) to developed (U2D) land. Over 250 independent econometric variables were identified from 21 F2A models, 21 F2D models, 12 F2NF models, and...

  6. Annual Report of the Secretary of Defense to the President and the Congress, January 1994

    Science.gov (United States)

    1994-01-01

    Navy has assumed the lead on the ATARS program. The 1U-2 program was transferred back to DoD from the National Foreign Intelligence Program (NFIP...Activities - Civil Affairs ,Speciai Activities Psychological Operations -Coalition Suppor SOF’s Role in Support of D~efense Strategy SOF will...operations that misled the enemy about the coalition’s operational plan. According to information obtained from prisoners of war, psychological

  7. Countering Air and Missile Threats

    Science.gov (United States)

    2012-03-23

    and surveillance, targeting, AR, and EW (e.g., AWACS, Rivet Joint, JSTARS, Compass Call, Cobra Ball, U-2, E-2C, and EP-3). Depending on the defensive...This list is a critical tool in the management of the use of the electromagnetic spectrum, and it specifies protected frequencies that should not be...means may be either active or passive. (a) Active means include EA, directed energy, electromagnetic jamming, electromagnetic deception, expendables

  8. Thin Metallic Films from Solvated Metal Atoms.

    Science.gov (United States)

    1987-07-14

    Departamento de Quimica , Universidad de Concepcion, Cassilla 3-:, c oncepcion, Chile. -I{ - ~ *~.’JS*~M 4 .~4\\ 821 19 the gold particles were negatively...1:i, 7 J. AdpI. Radiat. s toD.. 21(l),36-8 (1970). 12. L. G. Colombetti, D. A. Goadwin, and R. J. Hermanson, Nuclear Aed. 10, 597-6u2. (1C69). 13. L

  9. Study of the Impact of the Global Positioning System on Army Survey

    Science.gov (United States)

    1976-09-01

    be introduced to those who will be in positions of leadership and/or decision making at the time of system implementation. This is particularly true...These officers may well be in positions of decision making relative to methods, techniques and unit missions employing GPS. Maintenance, and...the time cf measurement with the aid of auxillary equipment. . TeU2wometeA MRA-1) - This is the oldest type of microwave instrument is the Army

  10. Extending The Calibration In The Underwater Sound Reference Division (USRD) Reciprocity Coupler To Incorporate Phase

    Science.gov (United States)

    2016-09-01

    x = k jωρ (A sin(k x) − B cos(k x))e jωt . (2.11) The network variables p1, p2, U1, and U2 (Figure 2.4) are related to p(x, t) and u(x, t) by p1 = p...in the compliance term can vary with pressure and temperature. The varia - tion in uncertainty across the pressure range is negligible. The variation

  11. Phenotype abnormality: 403 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 403 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u907i involute hypocotyl in environment... of far red light regimen in environment of far red light regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u32i hypocotyl ... involute ...

  12. Axial-Centrifugal Compressor Program

    Science.gov (United States)

    1975-10-01

    Assembly . .. . .... ..... 33 5 Tie Bolt...... .. .. .. .. . *.. .. .. .. .. .. ... 34 6 Axial Compressor Rotor Assembly Runouts . . .. . 34 7 CCV Blow...1.796 Impeller Slip Factor ’Ce2/U 2 ) .91 Impeller Wheel Speed ft/sec 1992.2 Impellet ’.ip Radius in. 3.780 Blade Tip Metal Angle- deg 0 Numbec of Blades...test item to the next Phase V component test. The test vehicle final balance levels and rotor runouts were normal at teardown, and no rubsI were

  13. Occupational Survey Report. AFSC 4M0X1 Aerospace Physiology

    Science.gov (United States)

    2002-05-01

    Chamber NCOIC Job Hyperbaric Chamber Specialist Job • Perform Type 2, 4 and 1 chamber flights • Perform inside observer duties during hypobaric ...78% Hyperbaric Chamber Specialist Independent Job 4% Not Grouped 2% U2 Aerospace Physiology Cluster 10% Job Structure Sample size: 168 Aerospace...Altitude Chamber Cluster (N=130) Hypobaric Chamber Instructor/Monitor Job HAAMS Job Altitude Chamber Apprentice Job 78% UPT Parasail Job Altitude

  14. Microbial Communities and Their Predicted Metabolic Functions in Growth Laminae of a Unique Large Conical Mat from Lake Untersee, East Antarctica

    Directory of Open Access Journals (Sweden)

    Hyunmin Koo

    2017-08-01

    Full Text Available In this study, we report the distribution of microbial taxa and their predicted metabolic functions observed in the top (U1, middle (U2, and inner (U3 decadal growth laminae of a unique large conical microbial mat from perennially ice-covered Lake Untersee of East Antarctica, using NextGen sequencing of the 16S rRNA gene and bioinformatics tools. The results showed that the U1 lamina was dominated by cyanobacteria, specifically Phormidium sp., Leptolyngbya sp., and Pseudanabaena sp. The U2 and U3 laminae had high abundances of Actinobacteria, Verrucomicrobia, Proteobacteria, and Bacteroidetes. Closely related taxa within each abundant bacterial taxon found in each lamina were further differentiated at the highest taxonomic resolution using the oligotyping method. PICRUSt analysis, which determines predicted KEGG functional categories from the gene contents and abundances among microbial communities, revealed a high number of sequences belonging to carbon fixation, energy metabolism, cyanophycin, chlorophyll, and photosynthesis proteins in the U1 lamina. The functional predictions of the microbial communities in U2 and U3 represented signal transduction, membrane transport, zinc transport and amino acid-, carbohydrate-, and arsenic- metabolisms. The Nearest Sequenced Taxon Index (NSTI values processed through PICRUSt were 0.10, 0.13, and 0.11 for U1, U2, and U3 laminae, respectively. These values indicated a close correspondence with the reference microbial genome database, implying high confidence in the predicted metabolic functions of the microbial communities in each lamina. The distribution of microbial taxa observed in each lamina and their predicted metabolic functions provides additional insight into the complex microbial ecosystem at Lake Untersee, and lays the foundation for studies that will enhance our understanding of the mechanisms responsible for the formation of these unique mat structures and their evolutionary significance.

  15. Procedures of amino acid sequencing of peptides in natural proteins collection of knowledge and intelligence for construction of reliable chemical inference system

    OpenAIRE

    Kudo, Yoshihiro; Kanaya, Shigehiko

    1994-01-01

    In order to establish a reliable chemical inference system on amino acid sequencing of natural peptides, as various kinds of relevant knowledge and intelligence as possible are collected. Topics are on didemnins, dolastatin 3, TL-119 and/or A-3302-B, mycosubtilin, patellamide A, duramycin (and cinnamycin), bottoromycin A 2, A19009, galantin I, vancomycin, stenothricin, calf speleen profilin, neocarzinostatin, pancreatic spasmolytic polypeptide, cerebratulus toxin B-IV, RNAase U 2, ferredoxin ...

  16. PENGARUH LAJU PENDINGINAN, SUHU, DAN LAMA KRISTALISASI PADA PROFIL TRIASILGLISEROL DAN SIFAT PELELEHAN PRODUK FRAKSIONASI MINYAK KELAPA

    Directory of Open Access Journals (Sweden)

    Mursalin

    2013-04-01

    Full Text Available Dry fractionation will produce a fraction of olein and stearin with different composition of high melting and low melting as well the distribution of triacylglycerol (TAG in the form of trisaturated (St3, disaturated (St2U and monosaturated (StU2. This research aimed to study the effect of critical cooling rate and crystallization temperature on the composition and profile of TAG changes as well the melting properties of the fractionated coconut oil products. Coconut oilwas heated at 70°C then cooledat differentcooling rate to reach various crystalization temperatures. The oil was then stirred at 15rpm and allowed to crystallize at different period of time, and finally fractionated by vacuum filtration using Whatman #40 paper. Fractionation temperatures were the same as crystalization temperatures. The results showed that the critical cooling rate was proportional to the solid-like to liquid-like ratio, the content of St3 and SFC profile of olein fraction but inversely proportional to the content of St2U and StU2 TAG. Interval crystallization temperature between 21.30 and 21.73 °C produced the S/L ratio, the content of St3 TAG and SFC profiles of olein fractions lower and the content of St2U and StU2 TAG higher than the temperature interval below or above it. Coconut oil fractionation more effective in higher crystallization temperature or lower critical cooling rate. In these cooling treatments, St3 TAG which has high melting pointwould be concentrated at stearin fraction, while St2U and StU2 TAG and MCTwould be at olein fraction. Therefore, it will increase melting properties of stearin fraction and decrease olein fraction.

  17. Properties of the Excited States of Molecular Ions.

    Science.gov (United States)

    1981-04-13

    FIg. 1). techniques have beest applied to the study of quartet states of Oi. The four potential curves most relevant Guyon et al., using a synchrotron...8217 a’ a a C ’U ~ ~ ~ ~ ~ ~ ~ 2 2,~ C a ’I C~- C ’ 𔃺 𔃺 𔃺 ’ ’ C- ~ C-E-38- ’- u A() A09a 265 SRI INTERNATIONAL 14FNLO PARK CA MOLECULAR PHYSICS LAB F

  18. Small Molecule Protection of Bone Marrow Hematopoietic Stem Cells

    Science.gov (United States)

    2016-10-01

    human CD34+ cells Determine formaldehyde dose-dependent survival on FANCG-deficient/control CD34+ cells in culture 9 - 15 Dr. Monnat – 4...molecule provides aldehyde dose-dependent protection in human cells in culture . Next steps: In the next award period we will: - extend above...U2-OS human osteosarcoma cells (Expt. 2) that were either untransduced (untx), transduced with and expressing a scrambled shRNA (shCTR), or

  19. Characterization of traffic-generated pollutants in Bucharest

    Energy Technology Data Exchange (ETDEWEB)

    Raducan, G. [University of Bucharest, Faculty of Physics, Department of Atmospheric Physics, Magurele, Bucharest (Romania)]. E-mail: gabi_raducan@yahoo.com; Stefan, S. [University of Bucharest, Faculty of Physics, Department of Atmospheric Physics, Magurele, Bucharest (Romania)

    2009-01-15

    European Union Council directive 96/62/EC on ambient air quality assessment and management requires the development of action plans for zones where the concentrations of pollutants in ambient air exceed limit values. In the urban areas the limit values are exceeded, especially due to the traffic. In this paper, we analyzed the temporal variability levels of concentration of NO{sub X}, O{sub 3} and SO{sub 2} in two street canyons. The distribution of concentrations proves that traffic is the most important source of NO{sub X}, this pollutant being emitted during running of the vehicle engines. The level of pollution within U2 street is 25% less than U1 street, even though the measured traffic within U2 street is 50% less than within U1 street. This happen because the streets geometry and locations are different. [Spanish] La directiva 96/62/EC del Consejo de la Union Europea sobre determinacion y manejo de la calidad del aire ambiental establece que deben existir planes de accion para las zonas donde la concentracion de contaminantes excede los valores limite. En las areas urbanas dichos valores limite se rebasan en especial debido al trafico. En este trabajo analizamos la variabilidad temporal de los niveles de concentracion de NO{sub X}, O{sub 3} y SO{sub 2} en dos canones urbanos. La distribucion de las concentraciones demuestra que el trafico es la fuente mas importante de NO{sub X}, contaminante que se emite por la operacion de los motores vehiculares. El nivel de contaminacion en la calle U2 es 25% menor que el de la calle U1, aun cuando el trafico cuantificado en la calle U2 es 50% menor que el de la U1. Esto se debe a que la geometria y la ubicacion de las calles es diferente.

  20. Investigation of the effects of excipients on technological properties tablets of pyrola rotundifolia extract

    OpenAIRE

    Darzuli, Natalia; Hroshovyi, Taras; Sokolova, Kateryna; Podpletnyaya, Elena

    2018-01-01

    Aim of the work. To study the influence of excipients on the pharmacological and technological properties of round-leaved wintergreen extract tablets.Methods. The subject of the study were 27 series of round-leaved wintergreen extract tablets. The study of the influence of excipients on the pharmacological and technological properties of tablets, namely: abrasion, strength, disintegration, homogeneity were carried out in accordance with the requirements of SPhU 2 edition. The appearance of ta...

  1. Uus plaat

    Index Scriptorium Estoniae

    2005-01-01

    Uutest plaatidest A-Ha "The Singles 1984-2004", Andrea Bocelli "Andrea", Def Leppard "Best Of", Elton John "Peachtree Road", Eminem "Encore", ERA "The Very Best Of", Jay-Z and Linkin Park "Callision Course", Kylie Minogue "Ultimate Kylie", Scooter "Mind the Gap", Shania Twain "Greatest Hits", Tina Turner "All The Best", "True Love 2", U2 "How To Dismantle An Atomic Bomb", "Bridget Jones. Soundtrack"

  2. Magnetic properties of Np2T2Sn compounds

    International Nuclear Information System (INIS)

    Sanchez, J.P.; Colineau, E.; Jeandey, C.; Oddou, J.L.; Rebizant, J.; Seret, A.; Spirlet, J.C.

    1994-01-01

    The magnetic properties of the Np 2 T 2 Sn series investigated by 237 Np Moessbauer spectroscopy are reported. Magnetic ordering is shown to occur for T = Ni, Pd, Pt, whereas the Np ions do not carry a local moment when T = Co, Ru, Rh. Comparison is made with the corresponding Np 2 T 2 In and U 2 T 2 Sn compounds. (authors). 5 refs., 3 figs

  3. Metastable He2- ions formed by two-electron attachment to the excited He2+ Σg+ (1σg22σg1) core

    International Nuclear Information System (INIS)

    Adamowicz, L.; Pluta, T.

    1991-01-01

    Four metastable states (1 4 Π u , 2 4 Π u , 4 Φ u , and 4 I u ), resulting from two-electron attachments to the excited He 2 + core ( 2 Σ g + ), are characterized using the numerical Hartree-Fock method. It is determined that such metastable states are formed when both valence electrons are placed into equally diffused orbitals, which have bonding charter, and whose angular momentum quantum numbers do not differ by more than 1

  4. Perspective: Semantic Data Management for the Home

    Science.gov (United States)

    2009-02-01

    ten to the new U2 album off of Harry’s music player on the nice stereo speakers, while he is visiting. Crash: Mike’s young nephew Oliver...files where owner=Greg. However, it cannot deter- mine the relationship between the queries all files where type= Music and all files where album =The... music , images, videos, as well as more conventional files (e.g., financial records and contact lists). In-home networks enable these de- vices to

  5. Non-local matrix generalizations of W-algebras

    International Nuclear Information System (INIS)

    Bilal, A.

    1995-01-01

    There is a standard way to define two symplectic (hamiltonian) structures, the first and second Gelfand-Dikii brackets, on the space of ordinary m th -order linear differential operators L=-d m +U 1 d m-1 +U 2 d m-2 +..+U m . In this paper, I consider in detail the case where the U k are nxn-matrix-valued functions, with particular emphasis on the (more interesting) second Gelfand-Dikii bracket. Of particular interest is the reduction to the symplectic submanifold U 1 =0. This reduction gives rise to matrix generalizations of (the classical version of) the non-linear W m -algebras, called V n,m -algebras. The non-commutativity of the matrices leads to non-local terms in these V n,m -algebras. I show that these algebras contain a conformal Virasoro subalgebra and that combinations W k of the U k can be formed that are nxn-matrices of conformally primary fields of spin k, in analogy with the scalar case n=1. In general however, the V m,n -algebras have a much richer structure than the W m -algebras as can be seen on the examples of the non-linear and non-local Poisson brackets {(U 2 ) ab (σ),(U 2 ) cd (σ')}, {(U 2 ) ab (σ),(W 3 ) cd (σ')} and {(W 3 ) ab (σ),(W 3 ) cd (σ')} which I work out explicitly for all m and n. A matrix Miura transformation is derived, mapping these complicated (second Gelfand-Dikii) brackets of the U k to a set of much simpler Poisson brackets, providing the analogue of the free-field representation of the W m -algebras. (orig.)

  6. Encyclopedia of Explosives and Related Items. Volume 7. H2 to Lysol

    Science.gov (United States)

    1975-01-01

    29, 263 (1934) 11) Dr. (Ref 10) Konrad, Nitrocellulose 5, 124 (1934) Impact Sensitivity, it is v sens to impact even 12) Nuevos Explosivos Industriales...INTERACTION 1a) PRESSURE-DISTANCE PROFILE BEFORE INTERACTION HUGONIOT FOR MATERIAL R / MIRROR LINE- A HUGNOT FOR HUGONIOT FOR I MATERIALL (P2 u 2) STATE2...CHARACTERISTIC ’.| ’$,"(P u REFLECTION FOR MATERIAL L / 2" " 2- CHARACTERISTIC MIRROR LINE FOR MATERIALL STATE PARTICLE VELOCITY, u PARTICLE VELOCITY. u (b

  7. Diagnóstico molecular para Leishmaniasis

    Directory of Open Access Journals (Sweden)

    Ysabel Montoya

    1997-01-01

    Full Text Available El potencial diagnóstico de epitopes inmunodominantes seleccionados fue ensayado satisfactoriamente a fin de obtener una prueba serodiagnóstica alternativa para la Leishmaniasis Tegumentaria Americana. Dos proteínas recombinantes prometedoras de L. (v. peruviana referidas como T-26-U2/T26-U4 fueron reconocidas por sueros individuales de pacientes con Leishmaniasis Tegumentaria Americana usando Western Blot. La sensibilidad de la prueba fue de 86% con sueros permanentes con Leishmaniasis peruana.

  8. Pop nädal : Popuudised. Raadio 2 annab rohkem alternatiivmuusikat / J. L.

    Index Scriptorium Estoniae

    J. L.

    2002-01-01

    Ansambli Toto uuest albumist "Trough the Looking Glass", mis tuleb müügile 14. okt. ning Toto Euroopa-maailmaturneest alates 27. oktoobrist ja lõpetades 2003. aastal. Ansambli The Breeders uuest albumist "Son of Three". Ansambli The Hives' lepingust plaadifirmaga Universal Records. 21. okt. müügile saabuvast Richard Ashcrofti plaadist "Human Conditions" ja singlist "Check the Meaning". Ansambli U2 uuest singlist "Electrical Storm". Raadio 2 poolt pakutavast moodsast klubimuusikast

  9. Barometric pressure transient testing applications at the Nevada Test Site: formation permeability analysis. Final report

    International Nuclear Information System (INIS)

    Hanson, J.M.

    1984-12-01

    The report evaluates previous investigations of the gas permeability of the rock surrounding emplacement holes at the Nevada Test Site. The discussion sets the framework from which the present uncertainty in gas permeability can be overcome. The usefulness of the barometric pressure testing method has been established. Flow models were used to evaluate barometric pressure transients taken at NTS holes U2fe, U19ac and U20ai. 31 refs., 103 figs., 18 tabs

  10. Spectroscopic Characterization of a Steam Arc Cutting Torch

    Czech Academy of Sciences Publication Activity Database

    Sember, Viktor; Mašláni, Alan; Křenek, Petr; Heinrich, M.; Nimmervoll, R.; Pauser, H.; Hrabovský, Milan

    2011-01-01

    Roč. 31, č. 5 (2011), s. 755-770 ISSN 0272-4324 R&D Projects: GA ČR GAP205/11/2070 Institutional research plan: CEZ:AV0Z20430508 Keywords : Plasma cutting * Optical emission spectroscopy * Steam arc * Supersonic plasma jet Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.602, year: 2011 http://www.springerlink.com/content/m4185257378320u2/fulltext.pdf

  11. Flare activity on UV Ceti: visible and IUE observations

    International Nuclear Information System (INIS)

    Phillips, K.J.H.; Bromage, G.E.; Dufton, P.L.; Keenan, F.P.; Kingston, A.E.

    1988-01-01

    Simultaneous far-ultraviolet (IUE) spectroscopy and optical photometry and spectrophotometry of a flare on UV Ceti are reported. The flare reached ΔU=2 mag but showed only modest enhancements in the IUE spectra. The optical spectrophotometry indicated broadened Balmer line profiles during the flare, with Hβ and Hγ clearly showing red wings (∼ 100 km s -1 ). The results are compared with other IUE and optical observations of UV Ceti, and their solar analogues. (author)

  12. On a mixed problem for a coupled nonlinear system

    Directory of Open Access Journals (Sweden)

    Marcondes R. Clark

    1997-03-01

    Full Text Available In this article we prove the existence and uniqueness of solutions to the mixed problem associated with the nonlinear system $$ u_{tt}-M(int_Omega |abla u|^2dxDelta u+|u|^ ho u+heta =f $$ $$ heta _t -Delta heta +u_{t}=g $$ where $M$ is a positive real function, and $f$ and $g$ are known real functions.

  13. Is the F-35B the Right Fit for the MAGTF?

    Science.gov (United States)

    2012-05-01

    disproportionate capability unnecessary to executing its self-defined role as the "nation’s 911" and" middleweight force". Fiscal austerity and economic ...from the advanced tactical aerial reconnaissance system ( ATARS ), and infrared imagery Electronic Reconnaissance - used to detect, locate, identify...U2&doc=GetTRDoc.pdf&AD=ADA472773 Congressional Budget Office, The Budget and Economic Outlook: Fiscal Years 2011 to 2021 (Washington, D .C

  14. Boundary controllability of integrodifferential systems in Banach ...

    Indian Academy of Sciences (India)

    solution to state space system, the control must be taken in a space of ... this paper is to study the boundary controllability of nonlinear integrodifferential systems ... be a linear closed and densely defined operator with Dً'ق E and let ( be a linear ... (iv) For all t 2 ً0; bٹ and u 2 U, TًtقBu 2 DًAق. ... The construction of the bounded.

  15. Observation of Arabidopsis phenotype: 8679 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available http://metadb.riken.jp/db/SciNetS_ria143i/cria143u1ria143u4644i ... 16-2562-1: Branching - inflore...scene (Ds tagging line) Branching - inflorescene (line id:16-2562-1) inflorescence,stem:present http://metadb.riken.jp/db/SciNetS_ria143i/cria143u2ria143u105i AT5G43160

  16. Observation of Arabidopsis phenotype: 4821 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available http://metadb.riken.jp/db/SciNetS_ria143i/cria143u1ria143u1433i ... 11-2285-1: Branching - inflore...scene (Ds tagging line) Branching - inflorescene (line id:11-2285-1) inflorescence,stem:present http://metadb.riken.jp/db/SciNetS_ria143i/cria143u2ria143u105i AT5G49360

  17. Simulations of N = 2 super Yang-Mills theory in two dimensions

    International Nuclear Information System (INIS)

    Catterall, Simon

    2006-01-01

    We present results from lattice simulations of N = 2 super Yang-Mills theory in two dimensions. The lattice formulation we use was developed and retains both gauge invariance and an exact (twisted) supersymmetry for any lattice spacing. Results for both U(2) and SU(2) gauge groups are given. We focus on supersymmetric Ward identities, the phase of the Pfaffian resulting from integration over the Grassmann fields and the nature of the quantum moduli space

  18. 3D Oscillator and Coulomb Systems reduced from Kahler spaces

    OpenAIRE

    Nersessian, Armen; Yeranyan, Armen

    2003-01-01

    We define the oscillator and Coulomb systems on four-dimensional spaces with U(2)-invariant Kahler metric and perform their Hamiltonian reduction to the three-dimensional oscillator and Coulomb systems specified by the presence of Dirac monopoles. We find the Kahler spaces with conic singularity, where the oscillator and Coulomb systems on three-dimensional sphere and two-sheet hyperboloid are originated. Then we construct the superintegrable oscillator system on three-dimensional sphere and ...

  19. Nuclear reactor

    International Nuclear Information System (INIS)

    Schulze, I.; Gutscher, E.

    1980-01-01

    The core contains a critical mass of UN or U 2 N 3 in the form of a noncritical solution with melted Sn being kept below a N atmosphere. The lining of the reactor core consists of graphite. If fission progresses part of the melted metal solution is removed and cleaned from fission products. The reactor temperatures lie in the range of 300 to 2000 0 C. (Examples and tables). (RW) [de

  20. The bare uranyl(2+) ion, UO22+

    International Nuclear Information System (INIS)

    Cornehl, H.H.; Heinemann, C.; Marcalo, J.; Pires de Matos, A.; Schwarz, H.

    1996-01-01

    Ion-molecule reactions between U 2+ and oxygen donors or charge-stripping collisions between singly charged UO 2 2 ions and O 2 collision partners generate uranyl(2+) ions in the gas phase. These do not readily dissociate into singly charged fragments. The standard enthalpy of formation for UO 2 2+ is estimated to be 371±60 kcal mol -1 , in accord with the results of ab initio calculations. (orig.)

  1. Protein phosphatase 5 is necessary for ATR-mediated DNA repair

    International Nuclear Information System (INIS)

    Kang, Yoonsung; Cheong, Hyang-Min; Lee, Jung-Hee; Song, Peter I.; Lee, Kwang-Ho; Kim, Sang-Yong; Jun, Jae Yeoul; You, Ho Jin

    2011-01-01

    Research highlights: → Serine/threonine protein phosphatase 5 (PP5) has been shown to participate in ataxia telangiectasia-mutated (ATM)- and ATR (ATM- and Rad3-related)-mediated checkpoint pathways, which plays an important role in the DNA damage response and maintenance of genomic stability. → However, it is not clear exactly how PP5 participates in this process. → Our results indicate that PP5 is more closely related with ATR-mediated pathway than ATM-mediated pathway in DNA damage repair. -- Abstract: Several recent studies have shown that protein phosphatase 5 (PP5) participates in cell cycle arrest after DNA damage, but its roles in DNA repair have not yet been fully characterized. We investigated the roles of PP5 in the repair of ultraviolet (UV)- and neocarzinostatin (NCS)-induced DNA damage. The results of comet assays revealed different repair patterns in UV- and NCS-exposed U2OS-PS cells. PP5 is only essential for Rad3-related (ATR)-mediated DNA repair. Furthermore, the phosphorylation of 53BP1 and BRCA1, important mediators of DNA damage repair, and substrates of ATR and ATM decreased in U2OS-PS cells exposed to UV radiation. In contrast, the cell cycle arrest proteins p53, CHK1, and CHK2 were normally phosphorylated in U2OS and U2OS-PS cells exposed to UV radiation or treated with NCS. In view of these results, we suggest that PP5 plays a crucial role in ATR-mediated repair of UV-induced DNA damage.

  2. Two-dimensional gauge dynamics and the topology of singular determinantal varieties

    Energy Technology Data Exchange (ETDEWEB)

    Wong, Kenny [Department of Applied Mathematics and Theoretical Physics,Centre for Mathematical Sciences, University of Cambridge,Cambridge, CB3 0WA (United Kingdom)

    2017-03-27

    We record an observation about the Witten indices in two families of gauged linear sigma models: the U(2) model for linear sections of Grassmannians, and the U(1) model for quadric complete intersections. We describe how the Witten indices are related to the Euler characteristics of the singular skew-symmetric or symmetric determinantal varieties featuring in the analysis of their opposite phases, and we discuss the extent to which these relationships can be reconciled with standard Born-Oppenheimer arguments.

  3. Existence of solutions to quasilinear Schrodinger equations with indefinite potential

    Directory of Open Access Journals (Sweden)

    Zupei Shen

    2015-04-01

    Full Text Available In this article, we study the existence and multiplicity of solutions of the quasilinear Schrodinger equation $$ -u''+V(xu-(|u| ^2''u=f(u $$ on $\\mathbb{R}$, where the potential $V$ allows sign changing and the nonlinearity satisfies conditions weaker than the classical Ambrosetti-Rabinowitz condition. By a local linking theorem and the fountain theorem, we obtain the existence and multiplicity of solutions for the equation.

  4. Infinitely many large energy solutions of superlinear Schrodinger-Maxwell equations

    Directory of Open Access Journals (Sweden)

    Lin Li

    2012-12-01

    Full Text Available In this article we study the existence of infinitely many large energy solutions for the superlinear Schrodinger-Maxwell equations $$displaylines{ -Delta u+V(xu+ phi u=f(x,u quad hbox{in }mathbb{R}^3,cr -Delta phi=u^2, quad hbox{in }mathbb{R}^3, }$$ via the Fountain Theorem in critical point theory. In particular, we do not use the classical Ambrosetti-Rabinowitz condition.

  5. Synthesis and characterization of low-valence actinide phosphide tellurides and ternary selenium-halide iridium complexes; Synthese und Charakterisierung niedervalenter Actinoidphosphidtelluride und ternaerer Selen-Halogenid-Komplexe des Iridiums

    Energy Technology Data Exchange (ETDEWEB)

    Stolze, Karoline

    2016-04-07

    The thesis on the synthesis and characterization of low-valence actinide phosphide tellurides and ternary selenium-halide iridium complexes includes two parts: a description of the experimental synthesis of UPTe and U2PTe2O and ThPTe and the synthesis of selenium-chloride iridium complexes and selenium-bromide iridium complexes. The characterization included X-ray diffraction and phase studies.

  6. Nongenotoxic p53 activation protects cells against S-phase-specific chemotherapy

    DEFF Research Database (Denmark)

    Kranz, Dominique; Dobbelstein, Matthias

    2006-01-01

    Mutations in the tumor suppressor gene TP53 represent the most frequent genetic difference between tumor cells and normal cells. Here, we have attempted to turn this difference into an advantage for normal cells during therapy. Using the Mdm2 antagonist nutlin-3, we first activated p53 in U2OS an...... a killer to a protector of cells, with the potential to reduce unwanted side effects of chemotherapy....

  7. Break the Kill Chain, not the Budget: How to Avoid U.S. Strategic Retrenchment

    Science.gov (United States)

    2016-06-10

    hour per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and...completing and reviewing this collection of information. Send comments regarding this burden estimate or any other aspect of this collection of...Division built aircraft such as the F-80 Shooting Star, F-104 Starfighter, U-2 Dragon Lady, SR-71 Blackbird , and F-117 Nighthawk that all slipped

  8. Skew cyclic codes over F_q+uF_q+vF_q+uvF_q

    Directory of Open Access Journals (Sweden)

    Ting Yao

    2015-09-01

    Full Text Available In this paper, we study skew cyclic codes over the ring $R=F_q+uF_q+vF_q+uvF_q$, where $u^{2}=u,v^{2}=v,uv=vu$, $q=p^{m}$ and $p$ is an odd prime. We investigate the structural properties of skew cyclic codes over $R$ through a decomposition theorem. Furthermore, we give a formula for the number of skew cyclic codes of length $n$ over $R.$

  9. Exact periodic solutions of the sixth-order generalized Boussinesq equation

    International Nuclear Information System (INIS)

    Kamenov, O Y

    2009-01-01

    This paper examines a class of nonlinear sixth-order generalized Boussinesq-like equations (SGBE): u tt = u xx + 3(u 2 ) xx + u xxxx + αu xxxxxx , α in R, depending on the positive parameter α. Hirota's bilinear transformation method is applied to the above class of non-integrable equations and exact periodic solutions have been obtained. The results confirmed the well-known nonlinear superposition principle.

  10. Finding X-ray counterparts for unidentified sources in the 105 months BAT survey - 1

    Science.gov (United States)

    Stephen, J. B.; Bassani, L.; Malizia, A.; Masetti, N.; Ubertini, P.

    2018-02-01

    We provide X-ray counterparts for the unidentified Swift/BAT sources listed in the 105 month catalogue (Oh et al. 2018, ApJS in press). These associations were found by cross-correlating the list of U1,U2 and U3 sources with the ROSAT Bright (RASSBSC, Voges et al. 1999, A & A, 349, 389) and the XMM-Newton Slew (XMMSlew, Saxton et al. 2008, A & A, 480, 611) catalogues.

  11. Finding X-ray counterparts for unidentified sources in the 105 months BAT survey - 2

    Science.gov (United States)

    Stephen, J. B.; Bassani, L.; Malizia, A.; Masetti, N.; Ubertini, P.

    2018-02-01

    We provide X-ray counterparts for unidentified Swift/BAT sources in the 105 month catalogue (Oh et al. 2018, ApJS in press). They were found by cross-correlating the list of U1,U2 and U3 sources with the ROSAT Bright (RASSBSC, Voges et al. 1999, A & A, 349, 389) and XMM-Newton Slew (XMMSlew, Saxton et al. 2008, A & A, 480, 611) catalogues and optically identified as reported in Atel #11340.

  12. Che-1 gene silencing induces osteosarcoma cell apoptosis by inhibiting mutant p53 expression

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Ming; Wang, Dan, E-mail: danwangwdd@163.com; Li, Ning

    2016-04-22

    The transcriptional cofactor Che-1 is an RNA polymerase II (Pol II) which is involved in tumorigenesis, such as breast cancer and multiple myeloma. Che-1 can also regulate mutant p53 expression, which plays roles in many types of cancer. In this study, we aimed to investigate the effects and specific mechanism of Che-1 in the regulation of osteosarcoma (OS) cell growth. We found that Che-1 is highly expressed in several kinds of OS cells compared with osteoblast hFOB1.19 cells. MTT and flow cytometry assays showed that Che-1 depletion by siRNA markedly suppressed MG-63 and U2OS cell proliferation and promoted apoptosis. The chromatin immunoprecipitation (ChIP) assay verified the presence of Che-1 on the p53 promoter in MG-63 and U2OS cells carrying mutant p53. Further studies showed that Che-1 depletion inhibited mutant p53 expression. Notably, our study showed that the loss of Che-1 inhibits proliferation and promotes apoptosis in MG-63 cells by decreasing the level of mutant p53. Therefore, these findings open the possibility that silencing of Che-1 will have therapeutic benefit in OS. - Highlights: • Che-1 is highly expressed in several kinds of OS cells. • Che-1 depletion suppressed MG-63 and U2OS cell growth. • Che-1 is existed in the p53 promoter in MG-63 and U2OS cells. • Che-1 depletion inhibited mutant p53 expression. • Che-1 depletion inhibits cell growth by decreasing the level of mutant p53.

  13. Of Connections and Fields - II -54 ...

    Indian Academy of Sciences (India)

    More generaliy, the fibre is some group manifold.) Replacing the fibre with some other group such as 8U(2),8U(3) of 8U(N) leads to non-Abelian gauge theories. In the mathematical description, a connection is a rule for horizontally lifting curves in B to £. In general the horizontal lift of closed curves in B may be open in £.

  14. Flare activity on UV CETI: visible and IUE observations

    International Nuclear Information System (INIS)

    Phillips, K.J.H.; Bromage, G.E.; Dufton, P.L.; Keenan, F.P.; Kingston, A.E.

    1988-06-01

    Simultaneous far-ultraviolet (IUE) spectroscopy and optical photometry and spectrophotometry of a flare on UV Ceti are reported. The flare reached ΔU = 2sup(m) but showed only modest enhancements in the IUE spectra. The optical spectrophotometry indicated broadened Balmer line profiles during the flare, with Hβ and Hγ clearly showing red wings. The results are compared with other IUE and optical observations of UV Ceti, and their solar analogues. (author)

  15. Electric heating of a unit for uranium trioxide production

    International Nuclear Information System (INIS)

    Faron, R.; Striff, A.

    1985-01-01

    Ammonium diuranate U 2 O 7 (NH 4 ) 2 containing about 50% of water is dried and transformed by calcination in uranium trioxide UO 3 . Drying and calcination was obtained by air heated by two burners using domestic fuel. In 1984 the plant was transformed for utilization of electric heating improving maintenance cost, decreasing heat losses and by energy saving the payback period on investment is of 2.6 years [fr

  16. Inert two-Higgs-doublet model strongly coupled to a non-Abelian vector resonance

    Science.gov (United States)

    Rojas-Abatte, Felipe; Mora, Maria Luisa; Urbina, Jose; Zerwekh, Alfonso R.

    2017-11-01

    We study the possibility of a dark matter candidate having its origin in an extended Higgs sector which, at least partially, is related to a new strongly interacting sector. More concretely, we consider an i2HDM (i.e., a Type-I two Higgs doublet model supplemented with a Z2 under which the nonstandard scalar doublet is odd) based on the gauge group S U (2 )1×S U (2 )2×U (1 )Y . We assume that one of the scalar doublets and the standard fermion transform nontrivially under S U (2 )1 while the second doublet transforms under S U (2 )2. Our main hypothesis is that standard sector is weakly coupled while the gauge interactions associated to the second group is characterized by a large coupling constant. We explore the consequences of this construction for the phenomenology of the dark matter candidate and we show that the presence of the new vector resonance reduces the relic density saturation region, compared to the usual i2DHM, in the high dark matter mass range. In the collider side, we argue that the mono-Z production is the channel which offers the best chances to manifest the presence of the new vector field. We study the departures from the usual i2HDM predictions and show that the discovery of the heavy vector at the LHC is challenging even in the mono-Z channel since the typical cross sections are of the order of 10-2 fb .

  17. Aquatic Field Survey at Volunteer Army Ammunition Plant, Chattanooga, Tennessee

    Science.gov (United States)

    1977-06-24

    cryptocephala v. venta 137 2.3 Other species 883 15.3 Total 5,775 99-9* U-2 Achnanthes minutissima 22,871 85.4 Fragilaria capucina 1,398 5.2 1...delicatissima 550 2.7 Fragilaria capucina 527 2.6 Anomoeoneis vitrea 435 2.1 Navicula cryptocephala v. venta 205 1.0 Other species 1,168 5.8 Total

  18. Ginsenoside Rg3 induces DNA damage in human osteosarcoma cells and reduces MNNG-induced DNA damage and apoptosis in normal human cells.

    Science.gov (United States)

    Zhang, Yue-Hui; Li, Hai-Dong; Li, Bo; Jiang, Sheng-Dan; Jiang, Lei-Sheng

    2014-02-01

    Panax ginseng is a Chinese medicinal herb. Ginsenosides are the main bioactive components of P. ginseng, and ginsenoside Rg3 is the primary ginsenoside. Ginsenosides can potently kill various types of cancer cells. The present study was designed to evaluate the potential genotoxicity of ginsenoside Rg3 in human osteosarcoma cells and the protective effect of ginsenoside Rg3 with respect to N-methyl-N'-nitro-N-nitrosoguanidine (MNNG)-induced DNA damage and apoptosis in a normal human cell line (human fibroblasts). Four human osteosarcoma cell lines (MG-63, OS732, U-2OS and HOS cells) and a normal human cell line (human fibroblasts) were employed to investigate the cytotoxicity of ginsenosides Rg3 by MTT assay. Alkaline comet assay and γH2AX focus staining were used to detect the DNA damage in MG-63 and U-2OS cells. The extent of cell apoptosis was determined by flow cytometry and a DNA ladder assay. Our results demonstrated that the cytotoxicity of ginsenoside Rg3 was dose-dependent in the human osteosarcoma cell lines, and MG-63 and U-2OS cells were the most sensitive to ginsenoside Rg3. As expected, compared to the negative control, ginsenoside Rg3 significantly increased DNA damage in a concentration-dependent manner. In agreement with the comet assay data, the percentage of γH2AX-positive MG-63 and U-2OS cells indicated that ginsenoside Rg3 induced DNA double-strand breaks in a concentration-dependent manner. The results also suggest that ginsenoside Rg3 reduces the extent of MNNG-induced DNA damage and apoptosis in human fibroblasts.

  19. Effectiveness of a computer-aided neuroanatomy program for entry-level physical therapy students: anatomy and clinical examination of the dorsal column-medial lemniscal system.

    Science.gov (United States)

    McKeough, D Michael; Mattern-Baxter, Katrin; Barakatt, Edward

    2010-01-01

    The purpose of this study was to determine if a computer-aided instruction learning module improves students' knowledge of the neuroanatomy/physiology and clinical examination of the dorsal column-medial lemniscal (DCML) system. Sixty-one physical therapy students enrolled in a clinical neurology course in entry-level PT educational programs at two universities participated in the study. Students from University-1 (U1;) had not had a previous neuroanatomy course, while students from University-2 (U2;) had taken a neuroanatomy course in the previous semester. Before and after working with the learning module, students took a paper-and-pencil test on the neuroanatomy/physiology and clinical examination of the DCML system. Kruskal-Wallis one-way ANOVA and Mann-Whitney tests were used to determine if differences existed between neuroanatomy/physiology examination scores and clinical examination scores before and after taking the learning module, and between student groups based on university attended. For students from U1, neuroanatomy/physiology post-test scores improved significantly over pre-test scores (p Neuroanatomy/physiology pre-test scores from U2 were significantly better than those from U1 (p < 0.001); there was no significant difference in post-test scores (p = 0.062). Clinical examination pre-test and post-test scores from U2 were significantly better than those from U1 (p < 0.001). Clinical examination post-test scores improved significantly from the pre-test scores for both U1 (p < 0.001) and U2 (p < 0.001).

  20. In vitro incorporation studies of 99mTc-alendronate sodium at different bone cell lines

    International Nuclear Information System (INIS)

    Evren Gundogdu; Derya Ilem-Ozdemir; Makbule Asikoglu

    2014-01-01

    Bisphosphonates can be labeled with Technetium-99m ( 99m Tc) and are used for bone imaging because of their good localization in the skeleton and rapid clearance from soft tissues. Over the last decades bone scintigraphy has been used extensively in the evaluation of oncological patients to provide information about the sites of bone lesions, their prognosis and the effectiveness of therapy by showing the sequential changes in tracer uptake. Since the lesion visualization and lesion/bone ratio are important utilities for a bone scanning radiopharmaceutic; in this study incorporation of 99m Tc labeled alendronate sodium ( 99m Tc-ALD) was evaluated in U 2 OS (human bone osteosarcoma) and NCI-H209 (human bone carcinoma) cell lines. ALD was directly labeled by 99m Tc, radiochemical purity and stability of the complex were analyzed by radioactive thin layer chromatography and radioactive high performance liquid chromatography studies. For cell incorporation study, NCI-H209 and U 2 OS cell lines were used with standard cell culture methods. The six well plates were used for all experiments and the integrity of each cell monolayer was checked by measuring its transepithelial electrical resistance (TEER) with an epithelial voltammeter. Results confirmed that ALD was successfully radiolabeled with 99m Tc. 99m Tc-ALD incorporated with NCI-H209 and U 2 OS cells. The uptake percentages of 99m Tc-ALD in NCI-H209 and U 2 OS cell lines were found significantly different. Since 99m Tc-ALD highly uptake in cancer cell line, the results demonstrated that radiolabeled ALD may be a promising agent for bone cancer diagnosis. (author)

  1. Direct containment heating experiments in Zion Nuclear Power Plant geometry using prototypic materials

    International Nuclear Information System (INIS)

    Binder, J.L.; McUmber, L.M.; Spencer, B.W.

    1993-01-01

    Direct Containment Heating (DCH) experiments have been completed which utilize prototypic core materials. The experiments reported on here are a continuation of the Integral Effects Testing (IET) DCH program. The experiments incorporated a 1/40 scale model of the Zion Nuclear Power Plant containment structures. The model included representations of the primary system volume, RPV lower head, cavity and instrument tunnel, and the lower containment structures. The experiments were steam driven. Iron-alumina thermite with chromium was used as a core melt stimulant in the earlier IET experiments. These earlier IET experiments at Argonne National Laboratory (ANL) and Sandia National Laboratories (SNL) provided useful data on the effect of scale on DCH phenomena; however, a significant question concerns the potential experiment distortions introduced by the use of non-prototypic iron/alumina thermite. Therefore, further testing with prototypic materials has been carried out at ANL. Three tests have been completed, DCH-U1A, U1B and U2. DCH-U1A and U1B employed an inerted containment atmosphere and are counterpart to the IET-1RR test with iron/alumina thermite. DCH-U2 employed nominally the same atmosphere composition of its counterpart iron/alumina test, IET-6. All tests, with prototypic material, have produced lower peak containment pressure rises; 45, 111 and 185 kPa in U1A, U1B and U2, compared to 150 and 250 kPa IET-1RR and 6. Hydrogen production, due to metal-steam reactions, was 33% larger in U1B and U2 compared to IET-1RR and IET-6. The pressurization efficiency was consistently lower for the corium tests compared to the IET tests

  2. Fulltext PDF

    Indian Academy of Sciences (India)

    ART

    Indian classical music. In this article, w e com pute ... be the R iem ann integral of the function f (x ) ´ 1 over th e u n it b allS n . T hen V .... T he function Á (u ) ´. 1 p2 ¼ e¡u 2 = 2 is called the standard norm al(G aussian) probability density. It is ofgreat im - portance in probability theory and statistics and m any areas of science.

  3. The Occupational Health Nurse (OHN) and the Implications for Nursing Education

    Science.gov (United States)

    1992-01-01

    539-556. Yancey, W. B., Jr., & Williams, R. C. Jr. (1991). Laboratory tests for rheumatic diseases . Postgraduate Medici., _U(2), 93-6, 99-100, 103. OHN...Cardiovascular disease : hypertension, coronary artery disease , acute myocardial infarction 6. Disorders of reproduction infertility , spontaneous abortion...88 Appendix F: The 10 Leading Work-related Diseases and Injuries, USA, 1982................... 89 Appendix G: The Leading Causes of Death in the

  4. Sensitivity analysis of monthly reference crop evapotranspiration trends in Iran: a qualitative approach

    Science.gov (United States)

    Mosaedi, Abolfazl; Ghabaei Sough, Mohammad; Sadeghi, Sayed-Hossein; Mooshakhian, Yousof; Bannayan, Mohammad

    2017-05-01

    The main objective of this study was to analyze the sensitivity of the monthly reference crop evapotranspiration (ETo) trends to key climatic factors (minimum and maximum air temperature ( T max and T min), relative humidity (RH), sunshine hours ( t sun), and wind speed ( U 2)) in Iran by applying a qualitative detrended method, rather than the historical mathematical approach. Meteorological data for the period of 1963-2007 from five synoptic stations with different climatic characteristics, including Mashhad (mountains), Tabriz (mountains), Tehran (semi-desert), Anzali (coastal wet), and Shiraz (semi-mountains) were used to address this objective. The Mann-Kendall test was employed to assess the trends of ETo and the climatic variables. The results indicated a significant increasing trend of the monthly ETo for Mashhad and Tabriz for most part of the year while the opposite conclusion was drawn for Tehran, Anzali, and Shiraz. Based on the detrended method, RH and U 2 were the two main variables enhancing the negative ETo trends in Tehran and Anzali stations whereas U 2 and temperature were responsible for this observation in Shiraz. On the other hand, the main meteorological variables affecting the significant positive trend of ETo were RH and t sun in Tabriz and T min, RH, and U 2 in Mashhad. Although a relative agreement was observed in terms of identifying one of the first two key climatic variables affecting the ETo trend, the qualitative and the quantitative sensitivity analysis solutions did never coincide. Further research is needed to evaluate this interesting finding for other geographic locations, and also to search for the major causes of this discrepancy.

  5. Quantum fluctuations of D5d polarons on C60 molecules

    International Nuclear Information System (INIS)

    Wang Chui-Lin; Wang Wenzheng; Liu Yuliang; Su Zhaobin; Yu Lu.

    1994-06-01

    The dynamic Jahn-Teller splitting of the six equivalent D 5d polarons due to quantum fluctuations is studied in the framework of the Bogoliubov-de Gennes formalism. The tunneling induced level splittings are determined to be 2 T 1u + 2 T 2u and 1 A g + 1 H g for C 1- 60 and C -2 60 , respectively, which should give rise to observable effects in experiments. (author). 17 refs, 2 tabs

  6. Down-regulation of long non-coding RNA TUG1 inhibits osteosarcoma cell proliferation and promotes apoptosis.

    Science.gov (United States)

    Zhang, Qiang; Geng, Pei-Liang; Yin, Pei; Wang, Xiao-Lin; Jia, Jin-Peng; Yao, Jie

    2013-01-01

    To investigate the expression level of TUG1 and one of its transcript variants (n377360) in osteosarcoma cells and assess the role of TUG1 in proliferation and apoptosis in the U2OS cell line. TUG1 and n377360 expression levels in patients with osteosarcomas and the U2OS human osteosarcoma cell line were evaluated using real-time quantitative PCR. U2OS cells were transected with TUG1 and n377360 siRNA or non-targeting siRNA. MTS was performed to assess the cell proliferation and flow cytometry was applied to analyze apoptosis. We found significantly higher TUG1 and n377360 expression levels in osteosarcoma tissues compared with matched non-tumorous tissues. In line with this, suppression of TUG1 and n377360 expression by siRNA significantly impaired the cell proliferation potential of osteosarcoma cells. Furthermore, inhibition of TUG1 expression significantly promoted osteosarcoma cell apoptosis. The overexpression of TUG1 and n377360 in osteosarcoma specimens and the functional role of TUG1 and n377360 regarding cell proliferation and apoptosis in an osteosarcoma cell line provided evidence that the use of TUG1 or n377360 may be a viable but an as yet unexplored therapeutic strategy in tumors that over express these factors.

  7. U12 type introns were lost at multiple occasions during evolution

    Directory of Open Access Journals (Sweden)

    Bartschat Sebastian

    2010-02-01

    Full Text Available Abstract Background Two categories of introns are known, a common U2 type and a rare U12 type. These two types of introns are removed by distinct spliceosomes. The phylogenetic distribution of spliceosomal RNAs that are characteristic of the U12 spliceosome, i.e. the U11, U12, U4atac and U6atac RNAs, suggest that U12 spliceosomes were lost in many phylogenetic groups. We have now examined the distribution of U2 and U12 introns in many of these groups. Results U2 and U12 introns were predicted by making use of available EST and genomic sequences. The results show that in species or branches where U12 spliceosomal components are missing, also U12 type of introns are lacking. Examples are the choanoflagellate Monosiga brevicollis, Entamoeba histolytica, green algae, diatoms, and the fungal lineage Basidiomycota. Furthermore, whereas U12 splicing does not occur in Caenorhabditis elegans, U12 introns as well as U12 snRNAs are present in Trichinella spiralis, which is deeply branching in the nematode tree. A comparison of homologous genes in T. spiralis and C. elegans revealed different mechanisms whereby U12 introns were lost. Conclusions The phylogenetic distribution of U12 introns and spliceosomal RNAs give further support to an early origin of U12 dependent splicing. In addition, this distribution identifies a large number of instances during eukaryotic evolution where such splicing was lost.

  8. A simple extension of “An alternative approach to sea surface aerodynamic roughness” by Zhiqiu Gao, Qing Wang, and Shouping Wang

    Science.gov (United States)

    Gao, Zhiqiu; Wang, Linlin; Bi, Xueyan; Song, Qingtao; Gao, Yuchao

    2012-08-01

    Based on the data previously collected during the Humidity Exchange over the Sea Main Experiment (HEXMAX), the methods used to parameterize aerodynamic roughness (z0), friction velocity (u*), and the neutral drag coefficient (CDN) under moderate wind speed conditions originally proposed by Gao et al. (2006) were extended by using the nondimensional significant wave height (gHs/u*2 or gHs/U10N2) instead of wave age (cp/u* or cp/U10N), where g is the acceleration of gravity, Hs is the significant wave height, U10Nis the horizontal wind speed at 10-m height under the neutral atmospheric condition, andcp is the phase velocity of the peak wave spectrum. The results show (1) u* = 0.024U10N(gHs/U10N2)-1/4, (2) z0 = 10 × exp[-4.797(gHs/u*2)1/6] or z0 = 10 × exp[-16.613(gHs/U10N2)1/4], and (3) CDN = 0.007(gHs/u*2)-1/3 or CDN = 5.76 × 10-4(gHs/U10N2)-1/2. The present parameterization schemes were experimentally tested.

  9. Maximal neutrino mixing from a minimal flavor symmetry

    International Nuclear Information System (INIS)

    Aranda, Alfredo; Carone, Christopher D.; Lebed, Richard F.

    2000-01-01

    We study a number of models, based on a non-Abelian discrete group, that successfully reproduce the simple and predictive Yukawa textures usually associated with U(2) theories of flavor. These models allow for solutions to the solar and atmospheric neutrino problems that do not require altering successful predictions for the charged fermions or introducing sterile neutrinos. Although Yukawa matrices are hierarchical in the models we consider, the mixing between second- and third-generation neutrinos is naturally large. We first present a quantitative analysis of a minimal model proposed in earlier work, consisting of a global fit to fermion masses and mixing angles, including the most important renormalization group effects. We then propose two new variant models: The first reproduces all important features of the SU(5)xU(2) unified theory with neither SU(5) nor U(2). The second demonstrates that discrete subgroups of SU(2) can be used in constructing viable supersymmetric theories of flavor without scalar universality even though SU(2) by itself cannot. (c) 2000 The American Physical Society

  10. Canonical form of three-fermion pure-states with six single particle states

    International Nuclear Information System (INIS)

    Chen, Lin; Ž Ðoković, Dragomir; Grassl, Markus; Zeng, Bei

    2014-01-01

    We construct a canonical form for pure states in ∧ 3 (C 6 ), the three-fermion system with six single particle states, under local unitary (LU) transformations, i.e., the unitary group U(6). We also construct a minimal set of generators of the algebra of polynomial U(6)-invariants on ∧ 3 (C 6 ). It turns out that this algebra is isomorphic to the algebra of polynomial LU-invariants of three-qubits which are additionally invariant under qubit permutations. As a consequence of this surprising fact, we deduce that there is a one-to-one correspondence between the U(6)-orbits of pure three-fermion states in ∧ 3 (C 6 ) and the LU orbits of pure three-qubit states when qubit permutations are allowed. As an important byproduct, we obtain a new canonical form for pure three-qubit states under LU transformations U(2) × U(2) × U(2) (no qubit permutations allowed)

  11. Emerging roles of the spliceosomal machinery in myelodysplastic syndromes and other hematological disorders.

    Science.gov (United States)

    Visconte, V; Makishima, H; Maciejewski, J P; Tiu, R V

    2012-12-01

    In humans, the majority of all protein-coding transcripts contain introns that are removed by mRNA splicing carried out by spliceosomes. Mutations in the spliceosome machinery have recently been identified using whole-exome/genome technologies in myelodysplastic syndromes (MDS) and in other hematological disorders. Alterations in splicing factor 3 subunit b1 (SF3b1) were the first spliceosomal mutations described, immediately followed by identification of other splicing factor mutations, including U2 small nuclear RNA auxillary factor 1 (U2AF1) and serine arginine-rich splicing factor 2 (SRSF2). SF3b1/U2AF1/SRSF2 mutations occur at varying frequencies in different disease subtypes, each contributing to differences in survival outcomes. However, the exact functional consequences of these spliceosomal mutations in the pathogenesis of MDS and other hematological malignancies remain largely unknown and subject to intense investigation. For SF3b1, a gain of function mutation may offer the promise of new targeted therapies for diseases that carry this molecular abnormality that can potentially lead to cure. This review aims to provide a comprehensive overview of the emerging role of the spliceosome machinery in the biology of MDS/hematological disorders with an emphasis on the functional consequences of mutations, their clinical significance, and perspectives on how they may influence our understanding and management of diseases affected by these mutations.

  12. Emerging roles of the spliceosomal machinery in myelodysplastic syndromes and other hematologic disorders

    Science.gov (United States)

    Visconte, V; Makishima, H; Maciejewski, JP; Tiu, RV

    2013-01-01

    In humans, the majority of all protein-coding transcripts contain introns that are removed by mRNA splicing carried out by spliceosomes. Mutations in the spliceosome machinery have recently been identified using whole exome/genome technologies in myelodysplastic syndromes (MDS) and in other hematologic disorders. Alterations in Splicing Factor 3 Subunit b1 (SF3b1) were the first spliceosomal mutations described, immediately followed by identification of other splicing factor mutations, including U2 Small Nuclear RNA Auxillary Factor 1 (U2AF1) and Serine Arginine Rich Splicing Factor 2 (SRSF2). SF3b1/U2AF1/SRSF2 mutations occur at varying frequencies in different disease subtypes, each contributing to differences in survival outcomes. However, the exact functional consequences of these spliceosomal mutations in the pathogenesis of MDS and other hematologic malignancies remain largely unknown and subject to intense investigation. For SF3b1, a gain of function mutation may offer the promise of new targeted therapies for diseases that carry this molecular abnormality that can potentially lead to cure. This review aims to provide a comprehensive overview of the emerging role of the spliceosome machinery in the biology of MDS/hematologic disorders with an emphasis on the functional consequences of mutations, their clinical significance, and perspectives on how they may influence our understanding and management of diseases affected by these mutations. PMID:22678168

  13. High temperature interdiffusion and phase equilibria in U-Mo

    International Nuclear Information System (INIS)

    Lundberg, L.B.

    1988-01-01

    Experimental data for interdiffusion and phase equilibria in the U-Mo system have been obtained over the temperature range 1400 to 1525 K as a fallout from compatibility experiments in which UO 2 was decomposed by lithium in closed molybdenum capsules. Composition-position, x-ray diffraction and microstructural data from the interdiffusion zones indicate that the intermediate phase U 2 Mo is found in this temperature range, contrary to the currently accepted equilibrium U-Mo phase diagram. The U-Mo interdiffusion data are in good agreement with published values. Inclusion of the U 2 Mo phase in a theoretical correlation of interdiffusion and phase equilibria data using Darken's equation indicate that high temperature interdiffusion of uranium and molybdenum follows the usual thermodynamic rules. Significant changes in the value of the thermodynamic based Darken factor near the U 2 Mo phase boundary on the high uranium side are indicated from both the new and published interdiffusion data. 9 refs., 10 figs., 3 tabs

  14. On two distinct Reynolds number regimes of a turbulent square jet

    Directory of Open Access Journals (Sweden)

    Minyi Xu

    2015-05-01

    Full Text Available The effects of Reynolds number on both large-scale and small-scale turbulence properties are investigated in a square jet issuing from a square pipe. The detailed velocity fields were measured at five different exit Reynolds numbers of 8×103≤Re≤5×104. It is found that both large-scale properties (e.g., rates of mean velocity decay and spread and small-scale properties (e.g., the dimensionless dissipation rate constant A=εL/〈u2〉3/2 are dependent on Re for Re≤3×104 or Reλ≤190, but virtually become Re-independent with increasing Re or Reλ. In addition, for Reλ>190, the value of A=εL/〈u2〉3/2 in the present square jet converges to 0.5, which is consistent with the observation in direct numerical simulations of box turbulence, but lower than that in circular jet, plate wake flows, and grid turbulence. The discrepancies in critical Reynolds number and A=εL/〈u2〉3/2 among different turbulent flows most likely result from the flow type and initial conditions.

  15. Exponent and scrambling index of double alternate circular snake graphs

    Science.gov (United States)

    Rahmayanti, Sri; Pasaribu, Valdo E.; Nasution, Sawaluddin; Liani Salnaz, Sishi

    2018-01-01

    A graph is primitive if it contains a cycle of odd length. The exponent of a primitive graph G, denoted by exp(G), is the smallest positive integer k such that for each pair of vertices u and v in G there is a uv-walk length k. The scrambling index of a primitive graph G, denoted by k(G), is the smallest positive integer k such that for each pair of vertices u and v in G there is a uv-walk of length 2k. For an even positive integer n and an odd positive integer r, a (n,r)-double alternate circular snake graph, denoted by DA(C r,n ), is a graph obtained from a path u 1 u 2 ... u n by replacing each edge of the form u 2i u 2i+1 by two different r-cycles. We study the exponent and scrambling index of DA(C r,n ) and show that exp(DA(C r,n )) = n + r - 4 and k(DA(C r,n )) = (n + r - 3)/2.

  16. Certainties, Question Marks and Voids in the Present-day Data Concerning the Rotation Period of Asteroids

    Science.gov (United States)

    Alvarez, Eduardo Manuel

    2017-07-01

    There are more than 700,000 asteroids with well-defined orbits. However, the LCDB data base (version Feb 2017) contains rotation period data for only 17,437 asteroids and yet, more than two thirds of those reported measurements still may be uncertain by 30% (U = 2) and another 10% may be completely wrong (U = 1). It should be possible to know the characteristics of asteroid spins without measuring every last one of them, on condition that our sample (1) is unbiased, and (2) it properly includes odd or outlier objects. In principle, U = 2 data should be good enough for both statistical analysis and for identifying oddballs. Wide-field data now comprise the majority ( 63%) of spin rates we have. However, due to the overwhelming volume of W-F data, their corresponding reliability is in practice almost impossible to assess on a case-by-case basis, so that a nominal U = 2 has been basically assigned to them. This poses the question whether including W-F data actually improves or degrades statistical analysis performed using only the smaller but more carefully controlled data from the F-D file. This paper shows that for size ranges where both F-D and W-F data samples contains at least 100 values, the W-F mean significantly differs from the F-D value (with only one exception for the narrow range 1 limitations are reasonably characterized.

  17. Functional Characterisation of Anticancer Activity in the Aqueous Extract of Helicteres angustifolia L. Roots.

    Directory of Open Access Journals (Sweden)

    Kejuan Li

    Full Text Available Helicteres angustifolia L. is a shrub that forms a common ingredient of several cancer treatment recipes in traditional medicine system both in China and Laos. In order to investigate molecular mechanisms of its anticancer activity, we prepared aqueous extract of Helicteres angustifolia L. Roots (AQHAR and performed several in vitro assays using human normal fibroblasts (TIG-3 and osteosarcoma (U2OS. We found that AQHAR caused growth arrest/apoptosis of U2OS cells in a dose-dependent manner. It showed no cytotoxicity to TIG-3 cells at doses up to 50 μg/ml. Biochemical, imaging and cell cycle analyses revealed that it induces ROS signaling and DNA damage response selectively in cancer cells. The latter showed upregulation of p53, p21 and downregulation of Cyclin B1 and phospho-Rb. Furthermore, AQHAR-induced apoptosis was mediated by increase in pro-apoptotic proteins including cleaved PARP, caspases and Bax. Anti-apoptotic protein Bcl-2 showed decrease in AQHAR-treated U2OS cells. In vivo xenograft tumor assays in nude mice revealed dose-dependent suppression of tumor growth and lung metastasis with no toxicity to the animals suggesting that AQHAR could be a potent and safe natural drug for cancer treatment.

  18. Cosmological Analysis of Dynamical Chern-Simons Modified Gravity via Dark Energy Scenario

    Directory of Open Access Journals (Sweden)

    Abdul Jawad

    2015-01-01

    Full Text Available The purpose of this paper is to study the cosmological evolution of the universe in the framework of dynamical Chern-Simons modified gravity. We take pilgrim dark energy model with Hubble and event horizons in interacting scenario with cold dark matter. For this scenario, we discuss cosmological parameters such as Hubble and equation of state and cosmological plane like ωϑ-ωϑ′ and squared speed of sound. It is found that Hubble parameter approaches the ranges 75-0.5+0.5 (for u=2 and (74, 74.30 (for u=1,-1,-2 for Hubble horizon pilgrim dark energy. It implies the ranges 74.80-0.005+0.005 (for u=2 and (73.4, 74 (for u=-2 for event horizon pilgrim dark energy. The equation of state parameter provides consistent ranges with different observational schemes. Also, ωϑ-ωϑ′ planes lie in the range (ωϑ=-1.13-0.25+0.24,ωϑ′<1.32. The squared speed of sound shows stability for all present models in the present scenario. We would like to mention here that our results of various cosmological parameters show consistency with different observational data like Planck, WP, BAO, H0, SNLS, and WMAP.

  19. Biological infrared microspectroscopy at the National Synchrotron Light Source

    International Nuclear Information System (INIS)

    Miller, Lisa M.; Carr, G. Lawrence; Williams, Gwyn P.; Sullivan, Michael; Chance, Mark R.

    2000-01-01

    Beamline U2B at the National Synchrotron Light Source has been designed and built as an infrared beamline dedicated to the study of biomedical problems. In 1997, the horizontal and vertical acceptances of Beamline U2B were increased in order to increase the overall flux of the beamline. A wedged, CVD diamond window separates the UHV vacuum of the VUV ring from the rough vacuum of the beamline. The endstation consists of a Nicolet Magna 860 step-scan FTIR and a NicPlan infrared microscope. The spectrometer is equipped with beamsplitter/detector combinations that permit data collection in the mid-and far-infrared regions. We have also made provisions for mounting an external detector (e.g. bolometer) for far infrared microspectroscopy. Thus far, Beamline U2B has been used to (1) perform chemical imaging of bone tissue and brain cells to address issues related to bone disease and epilepsy, respectively, and (2) examine time-resolved protein structure in the sub-millisecond folding of cytochrome c

  20. Thermogravimetric studies on the silicothermic reduction of uranium tetrafluoride under nitrogen

    International Nuclear Information System (INIS)

    Venkataramani, R.; Bhatt, Y.J.; Krishnamurthy, N.; Garg, S.P.

    1986-01-01

    This paper presents details of the experimental procedure and results obtained by thermogravimetric studies on the preparation of uranium nitrides by silicothermic reduction of uranium tetrafluoride under a nitrogen atmosphere. The folowing sequential steps are involved during the reaction: 4UF 4 +Si->4UF 3 +SiF 4 (g), 2UF 3 +Si+N 2 ->2UNF+SiF 4 (g), 4UNF+Si+N 2 ->2U 2 N 3 +SiF 4 (g), the uranium sesquintride U 2 N 3 obtained in the above process then decomposed at 1370 K under a dynamic vacuum of less than 10 -2 Tor to yield uranium mononitride of purity better than 99.9%, according to reaction 2U 2 N 3 ->4UN+N 2 (g). The chemical composition of the intermediate products formed during the sequential steps of the process, assessed by thermogravimetric and differential thermogravimetric studies, were further confirmed by chemical and X-ray analysis

  1. Kondo Effect of U Impurities in Dilute (YU)2Zn17

    Science.gov (United States)

    Takagi, Shigeru; Suzuki, Hiroyuki; Anzai, Kousuke

    2001-10-01

    Extending previous work on single-site properties of U ions in (LaU)2Zn17, we have investigated, from ρ(T), χ(T) and Cp(T) on single crystals, (Y1-xUx)2Zn17 with x=0.025 and 0.050, which has almost the same unit-cell volume as an antiferromagnetic heavy-electron compound U2Zn17. Remarkable features in the dilute-impurity limit have been clarified, which include Kondo behavior of ρ(T), large and almost isotropic χimp(T), and strongly enhanced Cimp(T)/T with gigantic γimp=2.02 2.05 J/K2·mole-U as T→0 due to a low characteristic energy-scale of the system. It is shown that gross features of the data are explained in terms of the conventional Kondo effect in the presence of the crystal field with the U3+ \\varGamma6 doublet ground state. It is also shown that the variation of γ with the unit-cell volume in related systems is not explained as a volume effect on TK and that even the behavior of fictitious “paramagnetic” U2Zn17 is not described as a collection of U impurities in dilute (YU)2Zn17.

  2. Calculation of fast neutron flux in reactor pressure tubes and experimental facilities

    Energy Technology Data Exchange (ETDEWEB)

    Barnett, P. C. [Canadian General Electric (Canada)

    1968-07-15

    The computer program EPITHET was used to calculate the fast neutron flux (>1 MeV) in several reactor pressure tubes and experimental facilities in order to compare the fast neutron flux in the different cases and to provide a self-consistent set of flux values which may be used to relate creep strain to fast neutron flux . The facilities considered are shown below together with the calculated fast neutron flux (>1 MeV). Fast flux 10{sup 13} n/cm{sup 2}s: NPD 1.14, Douglas Point 2.66, Pickering 2.89, Gentilly 2.35, SGHWR 3.65, NRU U-1 and U-2 3.25'' pressure tube - 19 element fuel 3.05, NRU U-1 and U-2 4.07'' pressure tube - 28 element fuel 3.18, NRU U-1 and U-2 4.07'' pressure tube - 18 element fuel 2.90, NRX X-5 0.88, PRTR Mk I fuel 2.81, PRTR HPD fuel 3.52, WR-1 2.73, Mk IV creep machine (NRX) 0.85, Mk VI creep machine (NRU) 2.04, Biaxial creep insert (NRU U-49) 2.61.

  3. Inverse scattering transform for the KPI equation on the background of a one-line soliton*Inverse scattering transform for the KPI equation on the background of a one-line soliton

    Science.gov (United States)

    Fokas, A. S.; Pogrebkov, A. K.

    2003-03-01

    We study the initial value problem of the Kadomtsev-Petviashvili I (KPI) equation with initial data u(x1,x2,0) = u1(x1)+u2(x1,x2), where u1(x1) is the one-soliton solution of the Korteweg-de Vries equation evaluated at zero time and u2(x1,x2) decays sufficiently rapidly on the (x1,x2)-plane. This involves the analysis of the nonstationary Schrödinger equation (with time replaced by x2) with potential u(x1,x2,0). We introduce an appropriate sectionally analytic eigenfunction in the complex k-plane where k is the spectral parameter. This eigenfunction has the novelty that in addition to the usual jump across the real k-axis, it also has a jump across a segment of the imaginary k-axis. We show that this eigenfunction can be reconstructed through a linear integral equation uniquely defined in terms of appropriate scattering data. In turn, these scattering data are uniquely constructed in terms of u1(x1) and u2(x1,x2). This result implies that the solution of the KPI equation can be obtained through the above linear integral equation where the scattering data have a simple t-dependence.

  4. Clinical usefulness of ursodeoxycholic acid for Japanese patients with autoimmune hepatitis

    Science.gov (United States)

    Torisu, Yuichi; Nakano, Masanori; Takano, Keiko; Nakagawa, Ryo; Saeki, Chisato; Hokari, Atsushi; Ishikawa, Tomohisa; Saruta, Masayuki; Zeniya, Mikio

    2017-01-01

    AIM To evaluate the therapeutic effects of ursodeoxycholic acid (UDCA) on autoimmune hepatitis (AIH). METHODS A total 136 patients who were diagnosed with AIH were included in our study. All of the patients underwent a liver biopsy, and had at least a probable diagnosis on the basis of either the revised scoring system or the simplified scores. Initial treatment included UDCA monotherapy (Group U, n = 48) and prednisolone (PSL) monotherapy (Group P, n = 88). Group U was further classified into two subgroups according to the effect of UDCA: Patients who had achieved remission induction with UDCA monotherapy and showed no sign of relapse (Subgroup U1, n = 34) and patients who additionally received PSL during follow-up (Subgroup U2, n = 14). We compared the clinical and histological findings between each groups, and investigated factors contributing to the response to UDCA monotherapy. RESULTS In Group U, 34 patients (71%) achieved and maintained remission over 49 (range: 8-90) mo (Subgroup U1) and 14 patients (29%) additionally received PSL (Subgroup U2) during follow-up. Two patients in Subgroup U2 achieved remission induction once but additionally required PSL administration because of relapse (15 and 35 mo after the start of treatment). The remaining 12 patients in Subgroup U2 failed to achieve remission induction during follow-up, and PSL was added during 7 (range: 2-18) mo. Compared with Subgroup U2, Subgroup U1 had significantly lower alanine aminotransferase (ALT) levels at onset (124 IU/L vs 262 IU/L, P = 0.023) and a significantly higher proportion of patients with mild inflammation (A1) on histological examination (70.6% vs 35.7%, P = 0.025). When multivariate analysis was performed to identify factors contributing to the response to UDCA monotherapy, only a serum ALT level of 200 IU/L or lower was found to be associated with a significant difference (P = 0.013). CONCLUSION To prevent adverse events related to corticosteroids, UDCA monotherapy for AIH needs

  5. Enhanced tactical radar correlator (ETRAC): true interoperability of the 1990s

    Science.gov (United States)

    Guillen, Frank J.

    1994-10-01

    The enhanced tactical radar correlator (ETRAC) system is under development at Westinghouse Electric Corporation for the Army Space Program Office (ASPO). ETRAC is a real-time synthetic aperture radar (SAR) processing system that provides tactical IMINT to the corps commander. It features an open architecture comprised of ruggedized commercial-off-the-shelf (COTS), UNIX based workstations and processors. The architecture features the DoD common SAR processor (CSP), a multisensor computing platform to accommodate a variety of current and future imaging needs. ETRAC's principal functions include: (1) Mission planning and control -- ETRAC provides mission planning and control for the U-2R and ASARS-2 sensor, including capability for auto replanning, retasking, and immediate spot. (2) Image formation -- the image formation processor (IFP) provides the CPU intensive processing capability to produce real-time imagery for all ASARS imaging modes of operation. (3) Image exploitation -- two exploitation workstations are provided for first-phase image exploitation, manipulation, and annotation. Products include INTEL reports, annotated NITF SID imagery, high resolution hard copy prints and targeting data. ETRAC is transportable via two C-130 aircraft, with autonomous drive on/off capability for high mobility. Other autonomous capabilities include rapid setup/tear down, extended stand-alone support, internal environmental control units (ECUs) and power generation. ETRAC's mission is to provide the Army field commander with accurate, reliable, and timely imagery intelligence derived from collections made by the ASARS-2 sensor, located on-board the U-2R aircraft. To accomplish this mission, ETRAC receives video phase history (VPH) directly from the U-2R aircraft and converts it in real time into soft copy imagery for immediate exploitation and dissemination to the tactical users.

  6. Cytoplasmic assembly of snRNP particles from stored proteins and newly transcribed snRNA's in L929 mouse fibroblasts

    International Nuclear Information System (INIS)

    Sauterer, R.A.; Feeney, R.J.; Zieve, G.W.

    1988-01-01

    Newly synthesized snRNAs appear transiently in the cytoplasm where they assemble into ribonucleoprotein particles, the snRNP particles, before returning permanently to the interphase nucleus. In this report, bona fide cytoplasmic fractions, prepared by cell enucleation, are used for a quantitative analysis of snRNP assembly in growing mouse fibroblasts. The half-lives and abundances of the snRNP precursors in the cytoplasm and the rates of snRNP assembly are calculated in L929 cells. With the exception of U6, the major snRNAs are stable RNA species; U1 is almost totally stable while U2 has a half-life of about two cell cycles. In contrast, the majority of newly synthesized U6 decays with a half-life of about 15 h. The relative abundances of the newly synthesized snRNA species U1, U2, U3, U4 and U6 in the cytoplasm are determined by Northern hybridization using cloned probes and are approximately 2% of their nuclear abundance. The half-lives of the two major snRNA precursors in the cytoplasm (U1 and U2) are approximately 20 min as determined by labeling to steady state. The relative abundance of the snRNP B protein in the cytoplasm is determined by Western blotting with the Sm class of autoantibodies and is approximately 25% of the nuclear abundance. Kinetic studies, using the Sm antiserum to immunoprecipitate the methionine-labeled snRNP proteins, suggest that the B protein has a half-life of 90 to 120 min in the cytoplasm. These data are discussed and suggest that there is a large pool of more stable snRNP proteins in the cytoplasm available for assembly with the less abundant but more rapidly turning-over snRNAs

  7. p53-dependent and p53-independent anticancer activity of a new indole derivative in human osteosarcoma cells

    Energy Technology Data Exchange (ETDEWEB)

    Cappadone, C., E-mail: concettina.cappadone@unibo.it [Department of Pharmacy and Biotechnology, University of Bologna, Bologna (Italy); Stefanelli, C. [Department for Life Quality Studies, University of Bologna, Rimini Campus, Rimini (Italy); Malucelli, E. [Department of Pharmacy and Biotechnology, University of Bologna, Bologna (Italy); Zini, M. [Department of Biomedical and Neuromotor Sciences, University of Bologna, Bologna (Italy); Onofrillo, C. [Department of Experimental, Diagnostic and Specialty Medicine, University of Bologna, Bologna (Italy); Locatelli, A.; Rambaldi, M.; Sargenti, A. [Department of Pharmacy and Biotechnology, University of Bologna, Bologna (Italy); Merolle, L. [ELETTRA–Sincrotrone Trieste S.C.p.A., Trieste (Italy); Farruggia, G. [Department of Pharmacy and Biotechnology, University of Bologna, Bologna (Italy); National Institute of Biostructures and Biosystems, Roma (Italy); Graziadio, A. [Department of Pharmacy and Biotechnology, University of Bologna, Bologna (Italy); Montanaro, L. [Department of Experimental, Diagnostic and Specialty Medicine, University of Bologna, Bologna (Italy); Iotti, S. [Department of Pharmacy and Biotechnology, University of Bologna, Bologna (Italy); National Institute of Biostructures and Biosystems, Roma (Italy)

    2015-11-13

    Osteosarcoma (OS) is the most common primary malignant tumor of bone, occurring most frequently in children and adolescents. The mechanism of formation and development of OS have been studied for a long time. Tumor suppressor pathway governed by p53 gene are known to be involved in the pathogenesis of osteosarcoma. Moreover, loss of wild-type p53 activity is thought to be a major predictor of failure to respond to chemotherapy in various human cancers. In previous studies, we described the activity of a new indole derivative, NSC743420, belonging to the tubulin inhibitors family, capable to induce apoptosis and arrest of the cell cycle in the G2/M phase of various cancer cell lines. However, this molecule has never been tested on OS cell line. Here we address the activity of NSC743420 by examine whether differences in the p53 status could influence its effects on cell proliferation and death of OS cells. In particular, we compared the effect of the tested molecule on p53-wild type and p53-silenced U2OS cells, and on SaOS2 cell line, which is null for p53. Our results demonstrated that NSC743420 reduces OS cell proliferation by p53-dependent and p53-independent mechanisms. In particular, the molecule induces proliferative arrest that culminate to apoptosis in SaOS2 p53-null cells, while it brings a cytostatic and differentiating effect in U2OS cells, characterized by the cell cycle arrest in G0/G1 phase and increased alkaline phosphatase activity. - Highlights: • The indole derivative NSC743420 induces antitumor effects on osteosarcoma cells. • p53 status could drive the activity of antitumor agents on osteosarcoma cells. • NSC743420 induces cytostatic and differentiating effects on U2OS cells. • NSC743420 causes apoptosis on p53-null SaOS2 cells.

  8. The translation initiation factor eIF4E regulates the sex-specific expression of the master switch gene Sxl in Drosophila melanogaster.

    Directory of Open Access Journals (Sweden)

    Patricia L Graham

    2011-07-01

    Full Text Available In female fruit flies, Sex-lethal (Sxl turns off the X chromosome dosage compensation system by a mechanism involving a combination of alternative splicing and translational repression of the male specific lethal-2 (msl-2 mRNA. A genetic screen identified the translation initiation factor eif4e as a gene that acts together with Sxl to repress expression of the Msl-2 protein. However, eif4e is not required for Sxl mediated repression of msl-2 mRNA translation. Instead, eif4e functions as a co-factor in Sxl-dependent female-specific alternative splicing of msl-2 and also Sxl pre-mRNAs. Like other factors required for Sxl regulation of splicing, eif4e shows maternal-effect female-lethal interactions with Sxl. This female lethality can be enhanced by mutations in other co-factors that promote female-specific splicing and is caused by a failure to properly activate the Sxl-positive autoregulatory feedback loop in early embryos. In this feedback loop Sxl proteins promote their own synthesis by directing the female-specific alternative splicing of Sxl-Pm pre-mRNAs. Analysis of pre-mRNA splicing when eif4e activity is compromised demonstrates that Sxl-dependent female-specific splicing of both Sxl-Pm and msl-2 pre-mRNAs requires eif4e activity. Consistent with a direct involvement in Sxl-dependent alternative splicing, eIF4E is associated with unspliced Sxl-Pm pre-mRNAs and is found in complexes that contain early acting splicing factors--the U1/U2 snRNP protein Sans-fils (Snf, the U1 snRNP protein U1-70k, U2AF38, U2AF50, and the Wilms' Tumor 1 Associated Protein Fl(2d--that have been directly implicated in Sxl splicing regulation.

  9. The calculated magnetic, electronic and thermodynamic properties of Ce{sub 3}Co{sub 29}Si{sub 4}B{sub 10} compound

    Energy Technology Data Exchange (ETDEWEB)

    Huo, Jin-Rong [Institute of Applied Physics, Beijing University of Science and Technology, Beijing 100083 (China); Wang, Xiao-Xu [Institute of Applied Physics, Beijing University of Science and Technology, Beijing 100083 (China); Cloud Computing Department, Beijing Computing Center, Beijing 100084 (China); Hu, Yao-Wen [Department of Physics, Tsinghua University, Beijing 100084 (China); Zhang, Guo-Hua; Cheng, Hai-Xia; Li, Lu [Institute of Applied Physics, Beijing University of Science and Technology, Beijing 100083 (China); Qian, Ping, E-mail: qianping@ustb.edu.cn [Institute of Applied Physics, Beijing University of Science and Technology, Beijing 100083 (China)

    2016-05-15

    The magnetic moment, lattice parameter and atom fraction coordinates for Ce{sub 3}Co{sub 29}Si{sub 4}B{sub 10} are calculated by the first-principles GGA+U method, and the results indicate that the calculated and experimental values are basically accordant when U=2.6 eV. We study the interaction effect and orbital hybridization between Co and Ce atoms. The projected density of states at U=2.6 eV which provided by Co-2c, Ce-2b and Ce-4d sites are contrasted with else U values. Meanwhile the electron density of states for different sites and the distance between various atoms are exhibited. In addition, the thermodynamic properties of Ce{sub 3}Co{sub 29}Si{sub 4}B{sub 10} are evaluated by using a series of interatomic pair potentials. - Graphical abstract: Change of the total magnetic moment for Ce{sub 3}Co{sub 29}Si{sub 4}B{sub 10} along with the value of U. There is a sharply decline of the curve at U=2.6 eV and, at the moment, the total magnetic moment of the compound have a good agreement with the experimental data. - Highlights: • We research of quaternary rare earth and transition metal compounds. • We perform the calculation of magnetic moment and electronic structure by GGA+U method. • The orbital hybridization between Co and Ce atoms is displayed and analyzed. • Show the plot of projected density of states for different sites more clearly. • Calculate the thermodynamic property of rare-earth transition metal compound.

  10. Roles of Polypyrimidine Tract Binding Proteins in Major Immediate-Early Gene Expression and Viral Replication of Human Cytomegalovirus▿

    Science.gov (United States)

    Cosme, Ruth S. Cruz; Yamamura, Yasuhiro; Tang, Qiyi

    2009-01-01

    Human cytomegalovirus (HCMV), a member of the β subgroup of the family Herpesviridae, causes serious health problems worldwide. HCMV gene expression in host cells is a well-defined sequential process: immediate-early (IE) gene expression, early-gene expression, DNA replication, and late-gene expression. The most abundant IE gene, major IE (MIE) gene pre-mRNA, needs to be spliced before being exported to the cytoplasm for translation. In this study, the regulation of MIE gene splicing was investigated; in so doing, we found that polypyrimidine tract binding proteins (PTBs) strongly repressed MIE gene production in cotransfection assays. In addition, we discovered that the repressive effects of PTB could be rescued by splicing factor U2AF. Taken together, the results suggest that PTBs inhibit MIE gene splicing by competing with U2AF65 for binding to the polypyrimidine tract in pre-mRNA. In intron deletion mutation assays and RNA detection experiments (reverse transcription [RT]-PCR and real-time RT-PCR), we further observed that PTBs target all the introns of the MIE gene, especially intron 2, and affect gene splicing, which was reflected in the variation in the ratio of pre-mRNA to mRNA. Using transfection assays, we demonstrated that PTB knockdown cells induce a higher degree of MIE gene splicing/expression. Consistently, HCMV can produce more viral proteins and viral particles in PTB knockdown cells after infection. We conclude that PTB inhibits HCMV replication by interfering with MIE gene splicing through competition with U2AF for binding to the polypyrimidine tract in MIE gene introns. PMID:19144709

  11. Roles of polypyrimidine tract binding proteins in major immediate-early gene expression and viral replication of human cytomegalovirus.

    Science.gov (United States)

    Cosme, Ruth S Cruz; Yamamura, Yasuhiro; Tang, Qiyi

    2009-04-01

    Human cytomegalovirus (HCMV), a member of the beta subgroup of the family Herpesviridae, causes serious health problems worldwide. HCMV gene expression in host cells is a well-defined sequential process: immediate-early (IE) gene expression, early-gene expression, DNA replication, and late-gene expression. The most abundant IE gene, major IE (MIE) gene pre-mRNA, needs to be spliced before being exported to the cytoplasm for translation. In this study, the regulation of MIE gene splicing was investigated; in so doing, we found that polypyrimidine tract binding proteins (PTBs) strongly repressed MIE gene production in cotransfection assays. In addition, we discovered that the repressive effects of PTB could be rescued by splicing factor U2AF. Taken together, the results suggest that PTBs inhibit MIE gene splicing by competing with U2AF65 for binding to the polypyrimidine tract in pre-mRNA. In intron deletion mutation assays and RNA detection experiments (reverse transcription [RT]-PCR and real-time RT-PCR), we further observed that PTBs target all the introns of the MIE gene, especially intron 2, and affect gene splicing, which was reflected in the variation in the ratio of pre-mRNA to mRNA. Using transfection assays, we demonstrated that PTB knockdown cells induce a higher degree of MIE gene splicing/expression. Consistently, HCMV can produce more viral proteins and viral particles in PTB knockdown cells after infection. We conclude that PTB inhibits HCMV replication by interfering with MIE gene splicing through competition with U2AF for binding to the polypyrimidine tract in MIE gene introns.

  12. On the Nature of the Microwave Background at the Lagrange 2 Point. Part II

    Directory of Open Access Journals (Sweden)

    Borissova L.

    2007-10-01

    Full Text Available In this work the mathematical methods of General Relativity are used to answer the following questions: if a microwave background originates from the Earth, what would be its density and associated dipole measured at the altitude of a U2 aeroplane (25 km, the COBE satellite (900 km, and the 2nd Lagrange point (1.5 million km, the position of the WMAP and PLANCK satellites? The first problem is solved via Einstein’s equations for the electromagnetic field of the Earth. The second problem is solved using the geodesic equations for light-like particles (photons which are mediators for electromagnetic radiation. We have determined that a microwave background that originates at the Earth (the Earth microwave background decreases with altitude so that the density of the energy of such a background at the altitude of the COBE orbit (900 km is 0.68 times less than that at the altitude of a U2 aeroplane. The density of the energy of the background at the L2 point is only ~1E-7 of the value detected by a U2 aeroplane or at the COBE orbit. The dipole anisotropy of the Earth microwave background, due to the rapid motion of the Earth relative to the source of another field which isn’t connected to the Earth but is located in depths of the cosmos, doesn’t depend on altitute from the surface of the Earth. Such a dipole will be the same irrespective of the position at which measurements are taken.

  13. Higgs boson as a top-mode pseudo-Nambu-Goldstone boson

    Science.gov (United States)

    Fukano, Hidenori S.; Kurachi, Masafumi; Matsuzaki, Shinya; Yamawaki, Koichi

    2014-09-01

    In the spirit of the top-quark condensation, we propose a model which has a naturally light composite Higgs boson, "tHiggs" (ht0), to be identified with the 126 GeV Higgs discovered at the LHC. The tHiggs, a bound state of the top quark and its flavor (vectorlike) partner, emerges as a pseudo-Nambu-Goldstone boson (NGB), "top-mode pseudo-Nambu-Goldstone boson," together with the exact NGBs to be absorbed into the W and Z bosons as well as another (heavier) top-mode pseudo-Nambu-Goldstone bosons (CP-odd composite scalar, At0). Those five composite (exact/pseudo-) NGBs are dynamically produced simultaneously by a single supercritical four-fermion interaction having U(3)×U(1) symmetry which includes the electroweak symmetry, where the vacuum is aligned by a small explicit breaking term so as to break the symmetry down to a subgroup, U(2)×U(1)', in a way not to retain the electroweak symmetry, in sharp contrast to the little Higgs models. The explicit breaking term for the vacuum alignment gives rise to a mass of the tHiggs, which is protected by the symmetry and hence naturally controlled against radiative corrections. Realistic top-quark mass is easily realized similarly to the top-seesaw mechanism by introducing an extra (subcritical) four-fermion coupling which explicitly breaks the residual U(2)'×U(1)' symmetry with U(2)' being an extra symmetry besides the above U(3)L×U(1). We present a phenomenological Lagrangian of the top-mode pseudo-Nambu-Goldstone bosons along with the Standard Model particles, which will be useful for the study of the collider phenomenology. The coupling property of the tHiggs is shown to be consistent with the currently available data reported from the LHC. Several phenomenological consequences and constraints from experiments are also addressed.

  14. Acute dyskerin depletion triggers cellular senescence and renders osteosarcoma cells resistant to genotoxic stress-induced apoptosis

    International Nuclear Information System (INIS)

    Lin, Ping; Mobasher, Maral E.; Alawi, Faizan

    2014-01-01

    Highlights: • Dyskerin depletion triggers cellular senescence in U2OS osteosarcoma cells. • Dyskerin-depleted cells are resistant to apoptosis induced by genotoxic stress. • Chromatin relaxation sensitizes dyskerin-depleted cells to apoptosis. - Abstract: Dyskerin is a conserved, nucleolar RNA-binding protein implicated in an increasing array of fundamental cellular processes. Germline mutation in the dyskerin gene (DKC1) is the cause of X-linked dyskeratosis congenita (DC). Conversely, wild-type dyskerin is overexpressed in sporadic cancers, and high-levels may be associated with poor prognosis. It was previously reported that acute loss of dyskerin function via siRNA-mediated depletion slowed the proliferation of transformed cell lines. However, the mechanisms remained unclear. Using human U2OS osteosarcoma cells, we show that siRNA-mediated dyskerin depletion induced cellular senescence as evidenced by proliferative arrest, senescence-associated heterochromatinization and a senescence-associated molecular profile. Senescence can render cells resistant to apoptosis. Conversely, chromatin relaxation can reverse the repressive effects of senescence-associated heterochromatinization on apoptosis. To this end, genotoxic stress-induced apoptosis was suppressed in dyskerin-depleted cells. In contrast, agents that induce chromatin relaxation, including histone deacetylase inhibitors and the DNA intercalator chloroquine, sensitized dyskerin-depleted cells to apoptosis. Dyskerin is a core component of the telomerase complex and plays an important role in telomere homeostasis. Defective telomere maintenance resulting in premature senescence is thought to primarily underlie the pathogenesis of X-linked DC. Since U2OS cells are telomerase-negative, this leads us to conclude that loss of dyskerin function can also induce cellular senescence via mechanisms independent of telomere shortening

  15. Investigation and dating of gypsum crystals from Sivrihisar region in Eskisehir by ESR and TL techniques

    International Nuclear Information System (INIS)

    2011-01-01

    Gypsum crystals taken from Sivrihisar-Eskisehir district were investigated and dated by Electron Spin Resonance (ESR) and Thermoluminescence (TL) techniques. The natural ESR spectra of gypsum samples had also the signals of Mn 2 + in addition to the signal at g=2.009. It was observed that the intensity of ESR signal at g=2.009 increased with gamma irradiation dose. This ESR signal (g=2.009) was used as a dating signal in dating of gypsum samples. The only one TL peak at about 278 degree Celsius was observed in TL glow curves of nonirradiated gypsum sample. In the case of irradiated sample, TL peak at 157 degree Celsius was observed in addition of TL peak at 278 degree Celsius. Gypsum samples were irradiated with a 6 0Co gamma source. The ESR spectra and TL glow curve of gypsum samples were recorded by X-band ESR spectrometer and Risφ TL/OSL reader, respectively. For samples, ESR/TL dose-response curves was constructed. Dose-response curves were fitted with an exponential saturation function. Based on this model, accumulated dose (AD) values for dating are determined. 2 38U, 2 32Th and 4 0K analysis was carried out for gypsum crystals and dolomite which enveloped these gypsum crystals. The internal dose rate was calculated from 2 38U, 2 32Th and 4 0K analysis results of gypsum sample. The external dose rate was calculated by using 2 38U, 2 32Th and 4 0K analysis results of dolomite and cosmic dose rate. Internal and external gamma dose-rate was used for dating calculations. Because of successive recrystallization of gypsum sample after formation, calculated age values of gypsum is smaller than expected formation age.

  16. Co-evolution of SNF spliceosomal proteins with their RNA targets in trans-splicing nematodes.

    Science.gov (United States)

    Strange, Rex Meade; Russelburg, L Peyton; Delaney, Kimberly J

    2016-08-01

    Although the mechanism of pre-mRNA splicing has been well characterized, the evolution of spliceosomal proteins is poorly understood. The U1A/U2B″/SNF family (hereafter referred to as the SNF family) of RNA binding spliceosomal proteins participates in both the U1 and U2 small interacting nuclear ribonucleoproteins (snRNPs). The highly constrained nature of this system has inhibited an analysis of co-evolutionary trends between the proteins and their RNA binding targets. Here we report accelerated sequence evolution in the SNF protein family in Phylum Nematoda, which has allowed an analysis of protein:RNA co-evolution. In a comparison of SNF genes from ecdysozoan species, we found a correlation between trans-splicing species (nematodes) and increased phylogenetic branch lengths of the SNF protein family, with respect to their sister clade Arthropoda. In particular, we found that nematodes (~70-80 % of pre-mRNAs are trans-spliced) have experienced higher rates of SNF sequence evolution than arthropods (predominantly cis-spliced) at both the nucleotide and amino acid levels. Interestingly, this increased evolutionary rate correlates with the reliance on trans-splicing by nematodes, which would alter the role of the SNF family of spliceosomal proteins. We mapped amino acid substitutions to functionally important regions of the SNF protein, specifically to sites that are predicted to disrupt protein:RNA and protein:protein interactions. Finally, we investigated SNF's RNA targets: the U1 and U2 snRNAs. Both are more divergent in nematodes than arthropods, suggesting the RNAs have co-evolved with SNF in order to maintain the necessarily high affinity interaction that has been characterized in other species.

  17. LHC signals for singlet neutrinos from a natural warped seesaw mechanism. II

    Science.gov (United States)

    Agashe, Kaustubh; Du, Peizhi; Hong, Sungwoo

    2018-04-01

    A natural seesaw mechanism for obtaining the observed size of SM neutrino masses can arise in a warped extra-dimensional/composite Higgs framework. In a previous paper, we initiated the study of signals at the LHC for the associated ˜TeV mass SM singlet neutrinos, within a canonical model of S U (2 )L×S U (2 )R×U (1 )B-L (LR) symmetry in the composite sector, as motivated by consistency with the EW precision tests. Here, we investigate LHC signals in a different region of parameter space for the same model, where production of singlet neutrinos can occur from particles beyond those in the usual LR models. Specifically, we assume that the composite (B -L ) gauge boson is lighter than all the others in the EW sector. We show that the composite (B -L ) gauge boson can acquire a significant coupling to light quarks simply via mixing with elementary hypercharge gauge boson. Thus, the singlet neutrino can be pair-produced via decays of the(B -L ) gauge boson, without a charged current counterpart. Furthermore, there is no decay for the (B -L ) gauge boson directly into dibosons, unlike for the usual case of WR± and Z'. Independently of the above extension of the EW sector, we analyze production of singlet neutrinos in decays of composite partners of S U (2 )L doublet leptons, which are absent in the usual LR models. In turn, these doublet leptons can be produced in composite WL decays. We show that the 4 -5 σ signal can be achieved for both cases described above for the following spectrum with 3000 fb-1 luminosity: 2-2.5 TeV composite gauge bosons, 1 TeV composite doublet lepton (for the second case) and 500-750 GeV singlet neutrino.

  18. Higgs phenomenology in the minimal S U (3 )L×U (1 )X model

    Science.gov (United States)

    Okada, Hiroshi; Okada, Nobuchika; Orikasa, Yuta; Yagyu, Kei

    2016-07-01

    We investigate the phenomenology of a model based on the S U (3 )c×S U (3 )L×U (1 )X gauge theory, the so-called 331 model. In particular, we focus on the Higgs sector of the model which is composed of three S U (3 )L triplet Higgs fields and is the minimal form for realizing a phenomenologically acceptable scenario. After the spontaneous symmetry breaking S U (3 )L×U (1 )X→S U (2 )L×U (1 )Y , our Higgs sector effectively becomes that with two S U (2 )L doublet scalar fields, in which the first- and the second-generation quarks couple to a different Higgs doublet from that which couples to the third-generation quarks. This structure causes the flavor-changing neutral current mediated by Higgs bosons at the tree level. By taking an alignment limit of the mass matrix for the C P -even Higgs bosons, which is naturally realized in the case with the breaking scale of S U (3 )L×U (1 )X much larger than that of S U (2 )L×U (1 )Y, we can avoid current constraints from flavor experiments such as the B0-B¯ 0 mixing even for the Higgs bosons masses that are O (100 ) GeV . In this allowed parameter space, we clarify that a characteristic deviation in quark Yukawa couplings of the Standard Model-like Higgs boson is predicted, which has a different pattern from that seen in two Higgs doublet models with a softly broken Z2 symmetry. We also find that the flavor-violating decay modes of the extra Higgs boson, e.g., H /A →t c and H±→t s , can be dominant, and they yield the important signature to distinguish our model from the two Higgs doublet models.

  19. p53-dependent and p53-independent anticancer activity of a new indole derivative in human osteosarcoma cells

    International Nuclear Information System (INIS)

    Cappadone, C.; Stefanelli, C.; Malucelli, E.; Zini, M.; Onofrillo, C.; Locatelli, A.; Rambaldi, M.; Sargenti, A.; Merolle, L.; Farruggia, G.; Graziadio, A.; Montanaro, L.; Iotti, S.

    2015-01-01

    Osteosarcoma (OS) is the most common primary malignant tumor of bone, occurring most frequently in children and adolescents. The mechanism of formation and development of OS have been studied for a long time. Tumor suppressor pathway governed by p53 gene are known to be involved in the pathogenesis of osteosarcoma. Moreover, loss of wild-type p53 activity is thought to be a major predictor of failure to respond to chemotherapy in various human cancers. In previous studies, we described the activity of a new indole derivative, NSC743420, belonging to the tubulin inhibitors family, capable to induce apoptosis and arrest of the cell cycle in the G2/M phase of various cancer cell lines. However, this molecule has never been tested on OS cell line. Here we address the activity of NSC743420 by examine whether differences in the p53 status could influence its effects on cell proliferation and death of OS cells. In particular, we compared the effect of the tested molecule on p53-wild type and p53-silenced U2OS cells, and on SaOS2 cell line, which is null for p53. Our results demonstrated that NSC743420 reduces OS cell proliferation by p53-dependent and p53-independent mechanisms. In particular, the molecule induces proliferative arrest that culminate to apoptosis in SaOS2 p53-null cells, while it brings a cytostatic and differentiating effect in U2OS cells, characterized by the cell cycle arrest in G0/G1 phase and increased alkaline phosphatase activity. - Highlights: • The indole derivative NSC743420 induces antitumor effects on osteosarcoma cells. • p53 status could drive the activity of antitumor agents on osteosarcoma cells. • NSC743420 induces cytostatic and differentiating effects on U2OS cells. • NSC743420 causes apoptosis on p53-null SaOS2 cells.

  20. Stability thresholds of a disk-shaped Migma

    International Nuclear Information System (INIS)

    Wong, H.V.; Rosenbluth, M.N.; Berk, H.L.

    1988-08-01

    The stability of a Migma disc is re-examined to determined the threshold to the interchange instability. It is shown that a previous calculation which assumes a rigid mode eigenfunction, is inaccurate at the predicted particle number for marginal stability. As a result the integral equation for the system must be solved. A variational method of solution is developed and is shown to give good agreement with a direct numerical solution is developed and is shown to give good agreement with a direct numerical solution. The threshold for instability is found to be sensitive to the details of the distribution function. For highly focused system, where all ions pass close to the axis, the threshold particle number (N/sup u1/) for instability is substantially below that predicted by rigid mode theory (N/sup rigid/)(by a factor /approximately/8ε 2 where ε = r 1 /r/sub L/, r 1 the spread in the distance of closest approach to the axis and r/sub L/ the ion Larmor radius). At a higher density a second band of stability appears that again destabilizes at yet higher article number (N/sub u2/). If ε /much lt/ 1, N/sub u2/ is substantially below the rigid mode prediction, while for 0.2 < ε < 0.3, N/sub u2/ is comparable to the rigid mode prediction. At moderate values of ε(ε ∼ 0.3 /minus/ 0.4) the second stability band disappears and the instability particle number threshold varies from about .4ε, when ε = 0.4, to .7ε when ε is about unity. The stability criteria wound be consistent with the observed particle storage number obtained in experimental configurations if the spread in ε is sufficiently large. 11 refs., 6 figs., 6 tabs

  1. LncRNA TUG1 is upregulated and promotes cell proliferation in osteosarcoma

    OpenAIRE

    Yun-Bo, Feng; Xiao-Po, Liu; Xiao-Li, Li; Guo-Long, Cao; Pei, Zhang; Fa-Ming, Tian

    2016-01-01

    Abstract Objective: To examine the expression and function of long non-coding RNA taurine up-regulated 1 (TUG1) in human osteosarcoma cells. Methods: Real-time quantitive PCR was used to detect the transcription level of TUG1 in a series of osteosarcoma cell lines. Knockdown of TUG1 in U2OS cells was carried out by transient transfection of siRNAs. MTT assay was performed to access the cell growth rates. Afterwards, RNA and protein of these cells were extracted to analyze the transfection eff...

  2. Landau-Lifshitz sigma-models, fermions and the AdS/CFT correspondence

    OpenAIRE

    Stefanski Jr, B.

    2007-01-01

    We define Landau-Lifshitz sigma models on general coset space $G/H$, with $H$ a maximal stability sub-group of $G$. These are non-relativistic models that have $G$-valued N\\"other charges, local $H$ invariance and are classically integrable. Using this definition, we construct the $PSU(2,2|4)/PS(U(2|2)^2)$ Landau-Lifshitz sigma-model. This sigma model describes the thermodynamic limit of the spin-chain Hamiltonian obtained from the complete one-loop dilatation operator of the N=4 super Yang-M...

  3. Cajal bodies and snRNPs friends with benefits

    Czech Academy of Sciences Publication Activity Database

    Staněk, David

    2017-01-01

    Roč. 14, č. 6 (2017), s. 671-679 ISSN 1547-6286 R&D Projects: GA ČR GA15-00790S Institutional support: RVO:68378050 Keywords : spinal muscular-atrophy * small nuclear-rna * u4/u6.u5 tri-snrnp * xenopus-laevis oocytes * u6 spliceosomal rna * coiled bodies * smn complex * u1 snrnp * u2 snrnp * in-vivo Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 3.900, year: 2016

  4. Concentration of some radionuclides in some popular sudanese medicinal plants

    International Nuclear Information System (INIS)

    Sagiroun, M. I. A.

    2012-10-01

    In this study was measured concentration of naturally occurring radionuclides 2 38U , 2 32T h and 4 0K in samples of sudanese medicinal plants. The radionuclide activity concentrations in samples analyzed ranged from 4.09 to 41.07 Bq kg -1 for 2 38T h and from 353.14 to 2270.21 Bq kg -1 for 4 0k . No trace of artificial radionuclide was determined in all the samples. The effective dose due to the presence of these radionuclides was estimated and found to be 0.524 mSv/year which is well below the permissible levels. (Author)

  5. Dynamics of the Outer Planets

    Science.gov (United States)

    1992-01-01

    this is at least partly an illusion; it is amusing to speculate than the human tendency to prefer (16,17) over (4) is rooted in our natural tendency...1 0u 2 2(27) Ir 80 2r 90 ’I which, as 0 is a periodic coordinate, integrates to 0. Thus J dO = -2--r = 0. (28)kTO atar I I 235 To obtain an energy...ept. of Oceanography l.a Jolla, CA 92093-0175 College Station, TX 77843 Hancock Library of Biology & Oceanography Fisheries-Oceanography Library Alan

  6. Ionization of molecular nitrogen by electron impact in (e, 2e) processes

    Energy Technology Data Exchange (ETDEWEB)

    Toth, I; Nagy, L, E-mail: istvan.toth@phys.ubbcluj.ro, E-mail: lnagy@phys.ubbcluj.ro [Faculty of Physics, Babes-Bolyai University, RO-400084 Cluj-Napoca (Romania)

    2011-10-14

    We have calculated triple differential cross sections (TDCS) for the ionization of the nitrogen molecule by electron impact. The measured recoil-to-binary peak ratio for the outer valence orbitals (3{sigma}{sub g}, 1{pi}{sub u}, 2{sigma}{sub u}) of the target is well reproduced by our models. One of our models is better for the description of the binary region of the TDCS, while the other reproduces a better recoil peak, similar to our previous observation for the CH{sub 4} molecule.

  7. Characterization of the InSTEC's low-background gamma spectrometer for environmental radioactivity studies

    International Nuclear Information System (INIS)

    Diaz Rizo, O.; Lopez Pino, N.; D'Alessandro Rodriguez, K.; Reyes, H.; Padilla Cabal, F.; Arado Lopez, J.O.; Casanova Diaz, A.O.; Gelen Rudnikas, A.; Rodenas Palomino, C.; Gomez Arozamena, J.

    2010-01-01

    The capabilities of the Low-Background Gamma Spectrometer (LBGS) at InSTEC were studied for environmental purposes. Fifty three γ-lines were identified in the LBGS background spectrum. The Minimum Detectable Activity for 2 10 Pb, 2 38 U, 2 26 Ra, 1 37 Cs, 2 32 Th and 4 0K were calculated using the detector's volumetric efficiency simulated by the Monte Carlo method. Validation was performed by absolute and relative analysis of radionuclide activities present in a marine sediment certified material. (author)

  8. Characterization of the InSTEC's low-background gamma spectrometer for environmental radioactivity studies

    International Nuclear Information System (INIS)

    Diaz Rizo, O.; Lopez Pino, N.; D'Alessandro Rodriguez, K.; Reyes, H.; Padilla Cabal, F.; Arado Lopez, J.O.; Casanova Diaz, A.O.; Gelen Rudnikas, A.; Rodenas Palomino, C.; Gomez Arozamena, J.

    2009-01-01

    The capabilities of the Low-Background Gamma Spectrometer (LBGS) at InSTEC were studied for environmental purposes. Fifty three ?-lines were fixed/identified? in the LBGS background spectrum. The Minimum Detectable Activity for 2 10 Pb, 2 38 U, 2 26 Ra, 1 37 Cs, 2 32 Th and 4 0K were calculated using the detector's volumetric efficiency simulated by the Monte Carlo method. The radionuclide activities in a marine sediment standard reference material? were determined by absolute and relative methods for validation./¿absolute and relative validation? (author)

  9. Tetragonal phase in Al-rich region of U-Fe-Al system

    International Nuclear Information System (INIS)

    Meshi, L.; Zenou, V.; Ezersky, V.; Munitz, A.; Talianker, M.

    2005-01-01

    A new ternary aluminide U 2 FeAl 20 with the approximate composition Al-4.2at% Fe-8.5at% U was observed in the Al-rich corner of the U-Al-Fe system. Transmission electron microscopy and electron microdiffraction technique were used for characterization of the structure of this phase. It has a tetragonal unit cell with the parameters a=12.4A and c=10.3A and can be described by the space group I4-bar 2m

  10. Female Reproductive Effects of Exposure to Jet Fuel at U.S. Air Force Bases

    Science.gov (United States)

    1998-11-01

    first breath sample until the Monday morning ofyour final breath sample. Avoid self-service refueling of your vehicle or lawn mower this week (outside of...fuel the lawn mower and mow the lawn for her - Post-pone painting, spraying pesticides/insecticides or using solvents if she might be in the area and...U No U_ 2. In the PAST WEEK, that is, one week ago today, did you... a).. .use the self-service tank when refueling of your vehicle or lawn mower this

  11. Manufacturing Methods and Technology Program Plan, CY 1980.

    Science.gov (United States)

    1980-09-01

    2 , U 2 0 2 - =Z xU L& W42 CL 4 Ua 0 - .4 4.CL0 0 ’. C w C a- . (P. 04 2- WW2 4 2 U z V.40 U In UZ 0 0 UK4 gzU C D .. 0an 4 V2 al 0 U K 4 $-. 4c Ci...millimeter wave and infrared laser systems for all- weather and smoke fighting is being pursued. This will require the development of new control...the ATAC and MISTAF FLIRS (Forward Looking Infrared Systems) and the Thermal Weapon Sight (TWS). Emphasis is also being placed in high energy pulser

  12. The Roots of Regional Ambitions

    Science.gov (United States)

    1992-12-01

    Mercury News, 17 December 1991, p. 16A. The Arab countries that reversed their votes on this topic are: Egypt, Kuwait, Morocco, Tunisia , Oman and Bahrain...developed an increasingly outspoken interest in restoring Jerusalem to Islam.1" ŕ Ahmed Shawky, "Crisis of 73," al- Petrol 17 January 1992, p. 11. For...exchange for Iraqi petrol to rebuild the country. A report from Baghdad by a 2"U2N. : Iraq must Comply," The Herald, 4 June 1992, p. 2A. Those six

  13. Model for shock wave chaos.

    Science.gov (United States)

    Kasimov, Aslan R; Faria, Luiz M; Rosales, Rodolfo R

    2013-03-08

    We propose the following model equation, u(t) + 1/2(u(2)-uu(s))x = f(x,u(s)) that predicts chaotic shock waves, similar to those in detonations in chemically reacting mixtures. The equation is given on the half line, xorder partial differential equation. The chaos arises in the equation thanks to an interplay between the nonlinearity of the inviscid Burgers equation and a novel forcing term that is nonlocal in nature and has deep physical roots in reactive Euler equations.

  14. Electron paramagnetic resonance and optical absorption of uranium ions diluted in CdF2 single crystals

    International Nuclear Information System (INIS)

    Pereira, J.J.C.R.

    1976-08-01

    The electron paramagnetic resonance (EPR) has been studied in conection with the optical absortion spectra of Uranium ions diluted in CdF 2 single crystals. Analyses of the EPR and optical absorption spectra obtained experimentally, and a comparison with known results in the isomorfic CaF 2 , SrF 2 and BaF 2 , allowed the identification of two paramagnetic centers associated with Uranium ions. These are the U(2+) ion in cubic symmetry having the triplet γ 5 as ground state, and the U(3+) ion in cubic symmetry having the dublet γ 6 as ground state. (Author) [pt

  15. Skew-orthogonal polynomials, differential systems and random matrix theory

    International Nuclear Information System (INIS)

    Ghosh, S.

    2007-01-01

    We study skew-orthogonal polynomials with respect to the weight function exp[-2V (x)], with V (x) = Σ K=1 2d (u K /K)x K , u 2d > 0, d > 0. A finite subsequence of such skew-orthogonal polynomials arising in the study of Orthogonal and Symplectic ensembles of random matrices, satisfy a system of differential-difference-deformation equation. The vectors formed by such subsequence has the rank equal to the degree of the potential in the quaternion sense. These solutions satisfy certain compatibility condition and hence admit a simultaneous fundamental system of solutions. (author)

  16. National Dam Safety Program. Alder Pond Dam (Inventory Number N.Y. 1489), Black River Basin, Oneida County, New York. Phase I Inspection Report,

    Science.gov (United States)

    1981-06-17

    CAMAL )57 7) Maximum K~nown Flood 8) At Time of Inspection______ 93-15-4( 9/8C) AL R Po4 PAPA CREST: (CLAT IE) ELEVATION: .7 Type: -AQI H 5 a Width...T - L jR iT BLACK RNE. CAmAL --- Io 1500 A .T- PRO F ILE. T-OP EABA"MEIPT (CANAL) --ECT -14 A-A to/8O 100 I-.U 2O 11 0. 7 22I- co I.)-- LII___ ___ __1

  17. Experimental study of collective processes in REB

    Energy Technology Data Exchange (ETDEWEB)

    Bogdanov, L Yu; Sominskij, G G [St. Petersburg Technical University (Russian Federation)

    1997-12-31

    The role of collective processes at relativistic electron beam formation and transportation was studied experimentally by using new low-disturbing techniques. In particular, local mirror-like enhancements of the external magnetic field were introduced and their influence of the beam space charge oscillations was investigated. The amplitude-frequency characteristics of the space charge oscillations in different parts of the drift channel were measured by a set of high-frequency probes. On the base of the collected experimental data two possible mechanisms of development of the beam space charge oscillations are discussed: the two-stream instability and the diocotron instability. (J.U.). 2 figs., 4 refs.

  18. Solitons in Granular Chains

    International Nuclear Information System (INIS)

    Manciu, M.; Sen, S.; Hurd, A.J.

    1999-01-01

    The authors consider a chain of elastic (Hertzian) grains that repel upon contact according to the potential V = adelta u , u > 2, where delta is the overlap between the grains. They present numerical and analytical results to show that an impulse initiated at an end of a chain of Hertzian grains in contact eventually propagates as a soliton for all n > 2 and that no solitons are possible for n le 2. Unlike continuous, they find that colliding solitons in discrete media initiative multiple weak solitons at the point of crossing

  19. Fermion mass hierarchies and flavor mixing from T' symmetry

    International Nuclear Information System (INIS)

    Ding Guijun

    2008-01-01

    We construct a supersymmetric model based on T ' x Z 3 x Z 9 flavor symmetry. At the leading order, the charged lepton mass matrix is not diagonal, T ' is broken completely, and the hierarchy in the charged lepton masses is generated naturally. Nearly tribimaximal mixing is predicted, and subleading effects induce corrections of order λ 2 , where λ is the Cabibbo angle. Both the up quark and down quark mass matrices' textures of the well-known U(2) flavor theory are produced at the leading order; realistic hierarchies in quark masses and Cabibbo-Kobayashi-Maskawa matrix elements are obtained. The vacuum alignment and subleading corrections are discussed in detail.

  20. Seal Technology in Gas Turbine Engines

    Science.gov (United States)

    1978-08-01

    the case inner wall (Fig.. 6 (a) and 7 (a)) und for shrouded rotors between blade shroud and the came (Figs. 6() snd 7(b)) (b) Blade roots and platforms ...work is required to fully validate these rig tests. Abradable coatings and linings used in turbines, produce wear of the fins on the root platforms ...Division of Rolls-Royce Limited for their permission to publish. ILI w% C - IL I L 2-10 1’t 00z It. ’K 0 0 ý - -C u -4% uj % z. 9 0 < m m wz I- 10 wIx u 2

  1. Naval Reserve Annual Operating Costs

    Science.gov (United States)

    1975-10-29

    C. c ) CPi i 0 0 00 0 le C C.C~r In 1]1 In 00 It .- I to C-38 ’U2 WIX ’W~ - m u. -C-LC m4 C v , v ul FA ?w % -D 1 o r cl jc j, II t %c oK W)i Ir of... platform programs, while Program 11 contains 26 sub-programs each having a separate Reserve program sponsor. The distribution of Program 11 resources is...a mix of specific skills required to bring an active Navy oper-Iating platform to organizational manning. Each SRU is tailored to a specific ship

  2. From topological strings to minimal models

    International Nuclear Information System (INIS)

    Foda, Omar; Wu, Jian-Feng

    2015-01-01

    We glue four refined topological vertices to obtain the building block of 5D U(2) quiver instanton partition functions. We take the 4D limit of the result to obtain the building block of 4D instanton partition functions which, using the AGT correspondence, are identified with Virasoro conformal blocks. We show that there is a choice of the parameters of the topological vertices that we start with, as well as the parameters and the intermediate states involved in the gluing procedure, such that we obtain Virasoro minimal model conformal blocks.

  3. From topological strings to minimal models

    Energy Technology Data Exchange (ETDEWEB)

    Foda, Omar [School of Mathematics and Statistics, University of Melbourne,Royal Parade, Parkville, VIC 3010 (Australia); Wu, Jian-Feng [Department of Mathematics and Statistics, Henan University,Minglun Street, Kaifeng city, Henan (China); Beijing Institute of Theoretical Physics and Mathematics,3rd Shangdi Street, Beijing (China)

    2015-07-24

    We glue four refined topological vertices to obtain the building block of 5D U(2) quiver instanton partition functions. We take the 4D limit of the result to obtain the building block of 4D instanton partition functions which, using the AGT correspondence, are identified with Virasoro conformal blocks. We show that there is a choice of the parameters of the topological vertices that we start with, as well as the parameters and the intermediate states involved in the gluing procedure, such that we obtain Virasoro minimal model conformal blocks.

  4. Warroad Channel Project. Section 107. Detailed Project Report Warroad, Minnesota.

    Science.gov (United States)

    1980-07-01

    1000, gHsm/ U2 .021 11sM = .021 x 5817 = 3.79’" 32.2 Km = 0.78d = .78 x 13.3 = 10.4’ Hrm - Hi 10.4 - 5.6 _4.8 Reduction: R=i - 10.4 5.8 6.6 0.73 rm...shift, and indeed are shifting, toward more fuel-efficient automobiles so that their dri-. ing habits can be maintained. These chances will probably

  5. Preclinical Testing of an Oncolytic Parvovirus: Standard Protoparvovirus H-1PV Efficiently Induces Osteosarcoma Cell Lysis In Vitro

    OpenAIRE

    Carsten Geiss; Zoltán Kis; Barbara Leuchs; Monika Frank-Stöhr; Jörg R. Schlehofer; Jean Rommelaere; Christiane Dinsart; Jeannine Lacroix

    2017-01-01

    Osteosarcoma is the most frequent malignant disease of the bone. On the basis of early clinical experience in the 1960s with H-1 protoparvovirus (H-1PV) in osteosarcoma patients, this effective oncolytic virus was selected for systematic preclinical testing on various osteosarcoma cell cultures. A panel of five human osteosarcoma cell lines (CAL 72, H-OS, MG-63, SaOS-2, U-2OS) was tested. Virus oncoselectivity was confirmed by infecting non-malignant human neonatal fibroblasts and osteoblasts...

  6. Tides in the Gulf of Kutch, India

    Digital Repository Service at National Institute of Oceanography (India)

    Shetye, S.R.

    . (Continued.) and that for momentum can then be written as b Lg Lt "! L(bhu) Lx , (1) Lu Lt #u Lu Lx "!g Lg Lx ! KDuDu h , (2) where t, g, and K are time, acceleration due to gravity, and coe$cient of friction, respectively. We linearize the equations...) and Prandle (1997), we replace the friction term, KDuDu, with r m u when dealing with the tidal constituent M 2 , the most predominant constituent in the Gulf of Kutch; for the other constituents we write KDuDu+(3r m u/2). Eqs. (1) and (2) then take the form...

  7. Relative and single particle diffusion estimates determined from smoke plume photographs

    International Nuclear Information System (INIS)

    Nappo, C.J. Jr.

    1978-01-01

    The formula given by Gifford (1959) for obtaining space-varying values of particle dispersion parameters from photographs of smoke puffs and plumes has been applied to high-altitude U-2 photographs of a long smoke plume generated at the Idaho National Engineering Laboratory near Idaho Falls. The turbulence time scale derived from the photographs was found to be in good agreement with estimates obtained within the framework of single- and two-particle diffusion theory applied to wind speed and direction data from a tower near the smoke source

  8. On defects of the volume and curvature of the Robertson-Walker metric and construction of cosmological models

    International Nuclear Information System (INIS)

    Gackstatter, F.

    1987-01-01

    For the Robertson-Walker metric (RWM) normal coordinates are constructed and the Riemann curvature tensor is determined. Then results on the defects of the volume and curvature, derived formerly, are applied to the RWM and to cosmological models. Finally cosmological models are constructed, they describe different states of the development of the cosmos: p ∼ 0, 1/3u, 2/3u, in a unified form. A Laurent expansion of the density of energy u and pressure p is used to solve the Friedmann equations. (author)

  9. On some labelings of triangular snake and central graph of triangular snake graph

    Science.gov (United States)

    Agasthi, P.; Parvathi, N.

    2018-04-01

    A Triangular snake Tn is obtained from a path u 1 u 2 … u n by joining ui and u i+1 to a new vertex wi for 1≤i≤n‑1. A Central graph of Triangular snake C(T n ) is obtained by subdividing each edge of Tn exactly once and joining all the non adjacent vertices of Tn . In this paper the ways to construct square sum, square difference, Root Mean square, strongly Multiplicative, Even Mean and Odd Mean labeling for Triangular Snake and Central graph of Triangular Snake graphs are reported.

  10. Mechanical design and development aspects of a small AUV - Maya

    Digital Repository Service at National Institute of Oceanography (India)

    Madhan, R.; Desa, E.S.; Prabhudesai, S.; Sebastiao, L.; Pascoal, A.; Desa, E.; Mascarenhas, A.A.M.Q.; Maurya, P.; Navelkar, G.S.; Afzulpurkar, S.; Khalap, S.

    different from the torpedo shaped noses of other small AUVS namely REMUS (USA) or GAVIA (Iceland). The photograph shows Dissolved Oxygen (DO) sensor mounted on tip of nose cone and the sensing part of chlorophyll-turbidity protruding from... at different trolley velocities. The results are shown below: Figure 5: Drag Force (N) against velocity of trolley/AUV The drag force D in Newton (N) is given by: D = 0.5.A f .C d0 . ρ. U 2 [2] Where A f .is the projected frontal...

  11. Bruce A restart (execution and lessons-learned)

    International Nuclear Information System (INIS)

    Soini, J.

    2011-01-01

    Lessons learned with the Bruce Units 3 and 4 restart have been incorporated into the current refurbishment of Units 1 and 2. In addition, lessons learned on the lead unit (U2) are aggressively applied on the lagging unit (U1) to maximize efficiency and productivity. There will be a discussion on how this internal OPEX, along with external lessons learned, are used to continuously improve all aspects of the Bruce A Restart project management cycle, from scope selection, through planning and scheduling, to execution.

  12. Cationic bis-N-heterocyclic carbene (NHC) ruthenium complex: Structure and application as latent catalyst in olefin metathesis

    KAUST Repository

    Rouen, Mathieu

    2014-09-11

    An unexpected cationic bis-N-heterocyclic carbene (NHC) benzylidene ether based ruthenium complex (2 a) was prepared through the double incorporation of an unsymmetrical unsaturated N-heterocyclic carbene (U2-NHC) ligand that bore an N-substituted cyclododecyl side chain. The isolation and full characterization (including X-ray diffraction studies) of key synthetic intermediates along with theoretical calculations allowed us to understand the mechanism of the overall cationization process. Finally, the newly developed complex 2 a displayed interesting latent behavior during ring-closing metathesis, which could be "switched on" under acidic conditions.

  13. What is special about the group of the standard model?

    International Nuclear Information System (INIS)

    Nielsen, H.B.; Brene, N.

    1989-03-01

    The standard model is based on the algebra of U 1 xSU 2 xSU 3 . The systematics of charges of the fundamental fermions seems to suggest the importance of a particular group having this algebra, viz. S(U 2 xU 3 ). This group is distinguished from all other connected compact non semisimple groups with dimensionality up to 12 by a characteristic property: it is very 'skew'. By this we mean that the group has relatively few 'generalised outer automorphisms'. One may speculate about physical reasons for this fact. (orig.)

  14. Modulated Langmuir waves and nonlinear Landau damping

    International Nuclear Information System (INIS)

    Yajima, Nobuo; Oikawa, Masayuki; Satsuma, Junkichi; Namba, Chusei.

    1975-01-01

    The nonlinear Schroedinger euqation with an integral term, iusub(t)+P/2.usub(xx)+Q/u/ 2 u+RP∫sub(-infinity)sup(infinity)[/u(x',t)/ 2 /(x-x')]dx'u=0, which describes modulated Langmuir waves with the nonlinear Landau damping effect, is solved by numerical calculations. Especially, the effects of nonlinear Landau damping on solitary wave solutions are studied. For both cases, PQ>0 and PQ<0, the results show that the solitary waves deform in an asymmetric way changing its velocity. (auth.)

  15. The swirl turbine

    Science.gov (United States)

    Haluza, M.; Pochylý, F.; Rudolf, P.

    2012-11-01

    In the article is introduced the new type of the turbine - swirl turbine. This turbine is based on opposite principle than Kaplan turbine. Euler equation is satisfied in the form gHηh = -u2vu2. From this equation is seen, that inflow of liquid into the runner is without rotation and on the outflow is a rotation of liquid opposite of rotation of runner. This turbine is suitable for small head and large discharge. Some constructional variants of this turbine are introduced in the article and theoretical aspects regarding losses in the draft tube. The theory is followed by computational simulations in Fluent and experiments using laser Doppler anemometry.

  16. Great Lakes Research Review, 1982. Appendices.

    Science.gov (United States)

    1982-11-01

    7D-i53 28 GREAT LAKES RESEARCH REVIEW 1982 PPENDICES (U) / PETROLEUM REFINERY PO INT SOURCE TASK FORCE WINDSOR (ONTARIO) NOV 82UNCLASSIFIED F/G 8...C7 U. 3 X 7 45 1 2 0. ODm C of. C.’ WC.’ L. LI 7 R-Ri53 62B GREAT LKES RESEARCH REVIEW 1982 PPENDICES (U) 2/3 PETROLEUM REFINERY POINT SOURCE TASK...NUMBER ORGANIZATION* TITLE OF PROJECT 001 A** 0300 ERL-D Acute and Early Life Stage Toxicity Testing of Priority Pollutant Chemicals 002 A 0302 ERL-D

  17. The Use of Computers as a Design Tool.

    Science.gov (United States)

    1980-01-01

    sponsor of numerical computing engines for defense needs; there is no such driving sponsorship today. It is concluded that as a result of these changes...coit difficilos A atteindro, soit impossibloc, soit trap faciles A atteindro. Pour cola , ii oct nlcessaire, pour le reeponsable du projot, de d~finir...CRAY I CRAY 1, BURROUGHS6 e70 " BM31/ IB CYER • e0 s 13 c amISS .MDAHL 4 /e oLe./ "B cocas ee/ i v 1,iu 70le o UNIVAC n1 t 1ons,, In 360/78 U 2

  18. A new fluorescence/PET probe for targeting intracellular human telomerase reverse transcriptase (hTERT) using Tat peptide-conjugated IgM

    International Nuclear Information System (INIS)

    Jung, Kyung oh; Youn, Hyewon; Kim, Seung Hoo; Kim, Young-Hwa; Kang, Keon Wook; Chung, June-Key

    2016-01-01

    Despite an increasing need for methods to visualize intracellular proteins in vivo, the majority of antibody-based imaging methods available can only detect membrane proteins. The human telomerase reverse transcriptase (hTERT) is an intracellular target of great interest because of its high expression in several types of cancer. In this study, we developed a new probe for hTERT using the Tat peptide. An hTERT antibody (IgG or IgM) was conjugated with the Tat peptide, a fluorescence dye and "6"4Cu. HT29 (hTERT+) and U2OS (hTERT−) were used to visualize the intracellular hTERT. The hTERT was detected by RT-PCR and western blot. Fluorescence signals for hTERT were obtained by confocal microscopy, live cell imaging, and analyzed by Tissue-FAXS. In nude mice, tumors were visualized using the fluorescence imaging devices Maestro™ and PETBOX. In RT-PCR and western blot, the expression of hTERT was detected in HT29 cells, but not in U2OS cells. Fluorescence signals were clearly observed in HT29 cells and in U2OS cells after 1 h of treatment, but signals were only detected in HT29 cells after 24 h. Confocal microscopy showed that 9.65% of U2OS and 78.54% of HT29 cells had positive hTERT signals. 3D animation images showed that the probe could target intranuclear hTERT in the nucleus. In mice models, fluorescence and PET imaging showed that hTERT in HT29 tumors could be efficiently visualized. In summary, we developed a new method to visualize intracellular and intranuclear proteins both in vitro and in vivo. - Highlights: • We developed new probes for imaging hTERT using Tat-conjugated IgM antibodies labeled with a fluorescent dye and radioisotope. • This probes could be used to overcome limitation of conventional antibody imaging system in live cell imaging. • This system could be applicable to monitor intracellular and intranuclear proteins in vitro and in vivo.

  19. Integrable higher order deformations of Heisenberg supermagnetic model

    International Nuclear Information System (INIS)

    Guo Jiafeng; Yan Zhaowen; Wang Shikun; Wu Ke; Zhao Weizhong

    2009-01-01

    The Heisenberg supermagnet model is an integrable supersymmetric system and has a close relationship with the strong electron correlated Hubbard model. In this paper, we investigate the integrable higher order deformations of Heisenberg supermagnet models with two different constraints: (i) S 2 =3S-2I for S is an element of USPL(2/1)/S(U(2)xU(1)) and (ii) S 2 =S for S is an element of USPL(2/1)/S(L(1/1)xU(1)). In terms of the gauge transformation, their corresponding gauge equivalent counterparts are derived.

  20. Rayleigh Wave Dispersion Due to Spatial (FEM) Discretization of a thin Elastic Solid Having Non-Curved Boundary

    Czech Academy of Sciences Publication Activity Database

    Brepta, R.; Valeš, F.; Červ, Jan; Tikal, B.

    1996-01-01

    Roč. 58, č. 6 (1996), s. 1233-1244 ISSN 0045-7949 R&D Projects: GA ČR(CZ) GA101/93/1195 Institutional research plan: CEZ:AV0Z2076919 Keywords : thin elastic body * Rayleigh waves * grid dispersion Subject RIV: BI - Acoustics Impact factor: 0.254, year: 1996 http://apps.isiknowledge.com/full_record.do?product=UA&search_mode=GeneralSearch&qid=1&SID=U2EJknka3H@mKemE37@&page=1&doc=1&colname=WOS