Military Dissent: What are the Ethical Implications of Tensions in U.S. Civil-Military Relations?

Science.gov (United States)

2013-06-14

ethical , and political. 22 Pfaff 1999, 8). The beliefs of egoism and post-modern relativism can be...MILITARY DISSENT: WHAT ARE THE ETHICAL IMPLICATIONS OF TENSIONS IN U.S. CIVIL-MILITARY RELATIONS? A thesis presented to the...JUN 2013 4. TITLE AND SUBTITLE Military Dissent: What are the Ethical Implications of Tensions in U.S. Civil-Military Relations? 5a. CONTRACT

Phenomenological implications of the flipped SU(5) x U(1) superstring model

Energy Technology Data Exchange (ETDEWEB)

Tamvakis, K. (Physics Dept., Univ. of Ioannina (Greece))

1991-07-01

We study in detail gauge symmetry breaking in the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSO(6) superstring model, solving the D and F-flatness conditions and taking into account quartic and quintic superpotential terms. We find that, to this order, the model describes two massive generations of quarks and leptons as well as a massless generation expected to receive naturally suppressed masses from higher order non-renormalizable terms. D and F-flatness restricts the number of massless isodoublets to four. We solve the coupled renormalization group equations for the gauge and Yukawa couplings in the two-loop approximation and obtain the top-quark mass as a function of two parameters of the model which could be chosen to be ratios of singlet v.e.v's associated with the surplus (U(1)){sup 4} breaking. We obtain a heavy top-quark with 150GeV {<=} m{sub 1} < 200GeV, for most part of the parameter space, while lower values are possible only in a very small extermal region. We also compute the allowed range of unification parameters (M{sub x}, sin{sup 2} {theta}{sub w}, {alpha}{sub 3}(M{sub w})) in the presence of a heavy top quark. (orig.).

Exploring the supersymmetric U(1 ) B -L×U(1 ) R model with dark matter, muon g - 2 , and Z' mass limits

Science.gov (United States)

Frank, Mariana; Özdal, Özer

2018-01-01

We study the low scale predictions of the supersymmetric standard model extended by U (1 )B -L×U (1 )R symmetry, obtained from S O (10 ) breaking via a left-right supersymmetric model, imposing universal boundary conditions. Two singlet Higgs fields are responsible for the radiative U (1 )B -L×U (1 )R symmetry breaking, and a singlet fermion S is introduced to generate neutrino masses through an inverse seesaw mechanism. The lightest neutralino or sneutrino emerge as dark matter candidates, with different low scale implications. We find that the composition of the neutralino lightest supersymmetric particle (LSP) changes considerably depending on the neutralino LSP mass, from roughly half U (1 )R bino, half minimal supersymmetric model (MSSM) bino, to a singlet higgsino, or completely dominated by the MSSM higgsino. The sneutrino LSP is statistically much less likely, and when it occurs it is a 50-50 mixture of right-handed sneutrino and the scalar S ˜. Most of the solutions consistent with the relic density constraint survive the XENON 1T exclusion curve for both LSP cases. We compare the two scenarios and investigate parameter space points and find consistency with the muon anomalous magnetic moment only at the edge of a 2 σ deviation from the measured value. However, we find that the sneutrino LSP solutions could be ruled out completely by the strict reinforcement of the recent Z' mass bounds. We finally discuss collider prospects for testing the model.

Implications of Nb/U, Th/U and Sm/Nd in plume magmas for the relationship between continental and oceanic crust formation and the development of the depleted mantle

Science.gov (United States)

Campbell, Ian H.

2002-05-01

-mantle boundary. When the two components reach thermal equilibrium with their surroundings, the lighter depleted component separates from the denser basaltic component. Both are eventually returned to the upper mantle, but the lighter depleted component has a shorter residence time in the lower mantle than the denser basaltic component. If the difference in the recycling times for the basaltic and depleted components is ˜1.0 to 1.5 Ga, a basaltic reservoir is created in the lower mantle, equivalent to the amount of basalt that is subducted in 1.0 to 1.5 Ga, and that reservoir is isolated from the upper mantle. It is this reservoir that is responsible for the Sm/Nd ratio of the upper mantle lying above the trend predicted by extraction of continental crust on the plot of Sm/Nd against Nb/U.

Drosophila SMN complex proteins Gemin2, Gemin3, and Gemin5 are components of U bodies

International Nuclear Information System (INIS)

Cauchi, Ruben J.; Sanchez-Pulido, Luis; Liu, Ji-Long

2010-01-01

Uridine-rich small nuclear ribonucleoproteins (U snRNPs) play key roles in pre-mRNA processing in the nucleus. The assembly of most U snRNPs takes place in the cytoplasm and is facilitated by the survival motor neuron (SMN) complex. Discrete cytoplasmic RNA granules called U bodies have been proposed to be specific sites for snRNP assembly because they contain U snRNPs and SMN. U bodies invariably associate with P bodies, which are involved in mRNA decay and translational control. However, it remains unknown whether other SMN complex proteins also localise to U bodies. In Drosophila there are four SMN complex proteins, namely SMN, Gemin2/CG10419, Gemin3 and Gemin5/Rigor mortis. Drosophila Gemin3 was originally identified as the Drosophila orthologue of human and yeast Dhh1, a component of P bodies. Through an in silico analysis of the DEAD-box RNA helicases we confirmed that Gemin3 is the bona fide Drosophila orthologue of vertebrate Gemin3 whereas the Drosophila orthologue of Dhh1 is Me31B. We then made use of the Drosophila egg chamber as a model system to study the subcellular distribution of the Gemin proteins as well as Me31B. Our cytological investigations show that Gemin2, Gemin3 and Gemin5 colocalise with SMN in U bodies. Although they are excluded from P bodies, as components of U bodies, Gemin2, Gemin3 and Gemin5 are consistently found associated with P bodies, wherein Me31B resides. In addition to a role in snRNP biogenesis, SMN complexes residing in U bodies may also be involved in mRNP assembly and/or transport.

Drosophila SMN complex proteins Gemin2, Gemin3, and Gemin5 are components of U bodies

Energy Technology Data Exchange (ETDEWEB)

Cauchi, Ruben J.; Sanchez-Pulido, Luis [MRC Functional Genomics Unit, Department of Physiology, Anatomy and Genetics, University of Oxford, Oxford OX1 3QX (United Kingdom); Liu, Ji-Long, E-mail: jilong.liu@dpag.ox.ac.uk [MRC Functional Genomics Unit, Department of Physiology, Anatomy and Genetics, University of Oxford, Oxford OX1 3QX (United Kingdom)

2010-08-15

Uridine-rich small nuclear ribonucleoproteins (U snRNPs) play key roles in pre-mRNA processing in the nucleus. The assembly of most U snRNPs takes place in the cytoplasm and is facilitated by the survival motor neuron (SMN) complex. Discrete cytoplasmic RNA granules called U bodies have been proposed to be specific sites for snRNP assembly because they contain U snRNPs and SMN. U bodies invariably associate with P bodies, which are involved in mRNA decay and translational control. However, it remains unknown whether other SMN complex proteins also localise to U bodies. In Drosophila there are four SMN complex proteins, namely SMN, Gemin2/CG10419, Gemin3 and Gemin5/Rigor mortis. Drosophila Gemin3 was originally identified as the Drosophila orthologue of human and yeast Dhh1, a component of P bodies. Through an in silico analysis of the DEAD-box RNA helicases we confirmed that Gemin3 is the bona fide Drosophila orthologue of vertebrate Gemin3 whereas the Drosophila orthologue of Dhh1 is Me31B. We then made use of the Drosophila egg chamber as a model system to study the subcellular distribution of the Gemin proteins as well as Me31B. Our cytological investigations show that Gemin2, Gemin3 and Gemin5 colocalise with SMN in U bodies. Although they are excluded from P bodies, as components of U bodies, Gemin2, Gemin3 and Gemin5 are consistently found associated with P bodies, wherein Me31B resides. In addition to a role in snRNP biogenesis, SMN complexes residing in U bodies may also be involved in mRNP assembly and/or transport.

Components in models of learning: Different operationalisations and relations between components

Directory of Open Access Journals (Sweden)

Mirkov Snežana

2013-01-01

Full Text Available This paper provides the presentation of different operationalisations of components in different models of learning. Special emphasis is on the empirical verifications of relations between components. Starting from the research of congruence between learning motives and strategies, underlying the general model of school learning that comprises different approaches to learning, we have analyzed the empirical verifications of factor structure of instruments containing the scales of motives and learning strategies corresponding to these motives. Considering the problems in the conceptualization of the achievement approach to learning, we have discussed the ways of operational sing the goal orientations and exploring their role in using learning strategies, especially within the model of the regulation of constructive learning processes. This model has served as the basis for researching learning styles that are the combination of a large number of components. Complex relations between the components point to the need for further investigation of the constructs involved in various models. We have discussed the findings and implications of the studies of relations between the components involved in different models, especially between learning motives/goals and learning strategies. We have analyzed the role of regulation in the learning process, whose elaboration, as indicated by empirical findings, can contribute to a more precise operationalisation of certain learning components. [Projekat Ministarstva nauke Republike Srbije, br. 47008: Unapređivanje kvaliteta i dostupnosti obrazovanja u procesima modernizacije Srbije i br. 179034: Od podsticanja inicijative, saradnje i stvaralaštva u obrazovanju do novih uloga i identiteta u društvu

U(1) x U(1) x U(1) symmetry of the Kimura 3ST model and phylogenetic branching processes

International Nuclear Information System (INIS)

Bashford, J D; Jarvis, P D; Sumner, J G; Steel, M A

2004-01-01

An analysis of the Kimura 3ST model of DNA sequence evolution is given on the basis of its continuous Lie symmetries. The rate matrix commutes with a U(1) x U(1) x U(1) phase subgroup of the group GL(4) of 4 x 4 invertible complex matrices acting on a linear space spanned by the four nucleic acid base letters. The diagonal 'branching operator' representing speciation is defined, and shown to intertwine the U(1) x U(1) x U(1) action. Using the intertwining property, a general formula for the probability density on the leaves of a binary tree under the Kimura model is derived, which is shown to be equivalent to established phylogenetic spectral transform methods. (letter to the editor)

Single field inflation in supergravity with a U(1) gauge symmetry

Energy Technology Data Exchange (ETDEWEB)

Heurtier, L. [Centre de Physique Théorique, École Polytechnique, CNRS, 91128 Palaiseau (France); Khalil, S.; Moursy, A., E-mail: lucien.heurtier@polytechnique.edu, E-mail: skhalil@zewailcity.edu.eg, E-mail: amoursy@zewailcity.edu.eg [Center for Fundamental Physics, Zewail City of Science and Technology, 6 October City, Cairo (Egypt)

2015-10-01

A single field inflation based on a supergravity model with a shift symmetry and U(1) extension of the MSSM is analyzed. We show that one of the real components of the two U(1) charged scalar fields plays the role of inflaton with an effective scalar potential similar to the ''new chaotic inflation'' scenario. Both non-anomalous and anomalous (with Fayet-Iliopoulos term) U(1) are studied. We show that the non-anomalous U(1) scenario is consistent with data of the cosmic microwave background and recent astrophysical measurements. A possible kinetic mixing between U(1) and U(1){sub B−L} is considered in order to allow for natural decay channels of the inflaton, leading to a reheating epoch. Upper limits on the reheating temperature thus turn out to favour an intermediate (∼ O(10{sup 13}) GeV) scale B−L symmetry breaking.

Single field inflation in supergravity with a U(1) gauge symmetry

Energy Technology Data Exchange (ETDEWEB)

Heurtier, L. [Centre de Physique Théorique, École Polytechnique, CNRS,91128 Palaiseau (France); Khalil, S. [Center for Fundamental Physics, Zewail City of Science and Technology,6 October City, Cairo (Egypt); Department of Mathematics, Faculty of Science, Ain Shams University,Cairo, 11566 (Egypt); Moursy, A. [Center for Fundamental Physics, Zewail City of Science and Technology,6 October City, Cairo (Egypt)

2015-10-19

A single field inflation based on a supergravity model with a shift symmetry and U(1) extension of the MSSM is analyzed. We show that one of the real components of the two U(1) charged scalar fields plays the role of inflaton with an effective scalar potential similar to the “new chaotic inflation” scenario. Both non-anomalous and anomalous (with Fayet-Iliopoulos term) U(1) are studied. We show that the non-anomalous U(1) scenario is consistent with data of the cosmic microwave background and recent astrophysical measurements. A possible kinetic mixing between U(1) and U(1){sub B−L} is considered in order to allow for natural decay channels of the inflaton, leading to a reheating epoch. Upper limits on the reheating temperature thus turn out to favour an intermediate (∼O(10{sup 13}) GeV) scale B−L symmetry breaking.

Implicit Tariffs on Imported Dairy Product Components in the United States

OpenAIRE

Tellioglu, Isin; Bailey, Kenneth W.; Blandford, David

2007-01-01

The majority of the dairy products imported by the United States are intermediate products used in food processing. As such, they are demanded for their components such as milk fat and protein. The implications of the U.S. tariff structure for import demand must be viewed in terms of the tariff's effects upon the relative prices of imported milk components. In this article we examine the implications of the current tariff structure and proposed changes under the Doha Round of international tr...

The development and evaluation of options for improving future U.K. blood component labelling--outcome of the 2013 U.K. hospital survey.

Science.gov (United States)

Nightingale, M J; Brazier, A M; McArthur, K; Jones, J; Cardigan, R; Lodge, L; Maclennan, S

2014-04-01

U.K. blood component labels have evolved to accommodate a plethora of information. Concern has, however, been expressed that current U.K. labelling is too 'cluttered', detracting from the clarity of critical information. This prompted a holistic review of labelling and available information technology (IT) with the aim of improving the situation. A survey was circulated requiring U.K. hospital participants to rank each item of information on the label according to its 'criticality' and assess three novel 'future' and one 'transition' prototype labels. Prototypes were based on applicable regulatory standards, best practice guidance, international benchmark data and U.K. expert input. The prototypes support steps towards 'full face' label printing and utilise 2D and quick response (QR) barcodes. Two-hundred eleven completed surveys were received identifying 110 contributing hospitals with 41% from clinical staff, 37% from transfusion laboratory staff and 22% from transfusion practitioners. There was excellent agreement between the three groups on the critical information, i.e., blood group, expiry date, blood component name, unique donation identification number (DIN) and blood component volume but far less on the other information, especially the various warning messages. Of the 'future' labels, option 3 (closest to the current 'quadrant model') was most popular. Option 1, with its additional inverted section replicating critical information was least popular and prompted significant safety concerns. The prototype labels correctly identified the critical items of information and extensive comments confirmed that this was more prominently and clearly displayed. Laboratory staff commented that the transition label was essential to enable IT systems to be adapted. © 2014 The Authors. Transfusion Medicine © 2014 British Blood Transfusion Society.

Mixed Mediation of Supersymmetry Breaking in Models with Anomalous U(1) Gauge Symmetry

International Nuclear Information System (INIS)

Choi, Kiwoon

2010-01-01

There can be various built-in sources of supersymmetry breaking in models with anomalous U(1) gauge symmetry, e.g. the U(1) D-term, the F-components of the modulus superfield required for the Green-Schwarz anomaly cancellation mechanism and the chiral matter superfields required to cancel the Fayet-Iliopoulos term, and finally the supergravity auxiliary component which can be parameterized by the F-component of chiral compensator. The relative strength between these supersymmetry breaking sources depends crucially on the characteristics of D-flat direction and also on how the D-flat direction is stabilized at a vacuum with nearly vanishing cosmological constant. We examine the possible pattern of the mediation of supersymmetry breaking in models with anomalous U(1) gauge symmetry, and find that various different mixed mediation scenarios can be realized, including the mirage mediation which corresponds to a mixed modulus-anomaly mediation, D-term domination giving a split sparticle spectrum, and also a mixed gauge-D-term mediation scenario.

Biogenic non-crystalline U(IV) revealed as major component in uranium ore deposits

Science.gov (United States)

Bhattacharyya, Amrita; Campbell, Kate M.; Kelly, Shelly D.; Roebbert, Yvonne; Weyer, Stefan; Bernier-Latmani, Rizlan; Borch, Thomas

2017-06-01

Historically, it is believed that crystalline uraninite, produced via the abiotic reduction of hexavalent uranium (U(VI)) is the dominant reduced U species formed in low-temperature uranium roll-front ore deposits. Here we show that non-crystalline U(IV) generated through biologically mediated U(VI) reduction is the predominant U(IV) species in an undisturbed U roll-front ore deposit in Wyoming, USA. Characterization of U species revealed that the majority (~58-89%) of U is bound as U(IV) to C-containing organic functional groups or inorganic carbonate, while uraninite and U(VI) represent only minor components. The uranium deposit exhibited mostly 238U-enriched isotope signatures, consistent with largely biotic reduction of U(VI) to U(IV). This finding implies that biogenic processes are more important to uranium ore genesis than previously understood. The predominance of a relatively labile form of U(IV) also provides an opportunity for a more economical and environmentally benign mining process, as well as the design of more effective post-mining restoration strategies and human health-risk assessment.

Calculation of the thermal neutron flux depression in the loop VISA-1; Izracunavanje depresije fluksa termalnih neutrona u 'petlji' VISA-1

Energy Technology Data Exchange (ETDEWEB)

Martinc, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1961-12-15

Among other applications, the VISA-1 loop is to be used for thermal load testing of materials. For this type of testing one should know the maximum power generated in the loop. This power is determined from the maximum thermal neutron flux in the VK-5 channel and mean flux depression in the fissile component of the loop. Thermal neutron flux depression is caused by neutron absorption in the components of the loop, shape of the components and neutron leaking through gaps as well as properties of the surrounding medium of the core. All these parameters were taken into account for calculating the depression of thermal neutron flux in the VISA-1 loop. Two group diffusion theory was used. Fast neutron from the fission in the loop and slowed down were taken into account. Depression of the thermal neutron flux is expressed by depression factor which represents the ratio of the mean thermal neutron flux in the fissile loop component and the thermal neutron flux in the VK-5 without the loop. Calculation error was estimated and it was recommended to determine the depression factor experimentally as well. [Serbo-Croat] Petlja VISA-1 namenjena je izmedju ostalog ispitivanju materiajala na termicka naprezanja. Za ova ispitivanja potrebno je poznavati maksimalnu snagu koja se razvija u petlji, a ona se odredjuje na osnovu maksimalnog fluksa termalnih neutrona u kanalu VK-5 i srednje depresije fluksa u fisibilnoj komponenti petlje. Depresija fluksa termalnih neutrona uzrokovana je apsorpcijom neutrona u komponentama petlje, geometrijom komponeni i isticanjem neutrona preko supljina u petlji kao i osobinama reaktorske sredine koja okruzuje petlju. Svi ovi faktori uzeti su u obzir pri proracunu depresije fluksa termalnih neutrona u petlji VISA-1. Primenjena je difuziona dvo grupna teorija. Uzeti su u obzir brzi neutroni nastali fisijom u petlji i usporeni u aktivnoj zoni RA. Depresija neutronskog fluksa izrazena je depresionim faktorom, koji predstavlja odnos srednjeg fluksa

7 CFR 51.2541 - U.S. Fancy, U.S. Extra No. 1, U.S. No. 1 And U.S. Select Grades.

Science.gov (United States)

2010-01-01

... PRODUCTS 1,2 (INSPECTION, CERTIFICATION, AND STANDARDS) United States Standards for Grades of Pistachio.... Fancy,” “U.S. Extra No. 1,” “U.S. No. 1,” and “U.S. Select” consists of pistachio nuts in the shell...

Myelodysplastic Syndrome, Unclassifiable (MDS-U) With 1% Blasts Is a Distinct Subgroup of MDS-U With a Poor Prognosis.

Science.gov (United States)

Margolskee, Elizabeth; Hasserjian, Robert P; Hassane, Duane; Tam, Wayne; Mathew, Susan; Ok, Chi Young; Wang, Sa A; Oak, Jean; Arber, Daniel A; Orazi, Attilio

2017-07-01

Three situations qualify as myelodysplastic syndrome, unclassifiable (MDS-U): (1) refractory cytopenia with dysplasia and 1% blasts in peripheral blood (BL), (2) pancytopenia with unilineage dysplasia (Pan), and (3) persistent cytopenia, less than 5% bone marrow blasts, and less than 10% dysplastic cells and presence of MDS-defining cytogenetic abnormalities (CG). We compared the clinicopathologic features and mutational profiles for these three groups. MDS-U cases were reviewed at four major academic institutions. Targeted next-generation sequencing for genes implicated in myeloid neoplasms was performed in a subset of cases. Twenty-seven patients were identified (six MDS-U BL, 13 MDS-U Pan, and eight MDS-U CG). Clonal cytogenetic abnormalities were found in six of six, seven of 13, and eight of eight cases in MDS-U BL, Pan, and CG, respectively (P > .05). Overall, four of six patients with MDS-U BL progressed to acute myeloid leukemia; no MDS-U Pan or CG patients did. The rates of progression-free survival and mortality (overall survival) were significantly higher in MDS-U BL compared with Pan and CG (P MDS-U BL is a distinct subset of MDS-U with a poor prognosis, while MDS-U Pan and CG are relatively indolent. Evaluation of peripheral blood smears in patients with MDS is essential for accurate classification and prognosis. © American Society for Clinical Pathology, 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com

U1 small nuclear RNA variants differentially form ribonucleoprotein particles in vitro.

Science.gov (United States)

Somarelli, Jason A; Mesa, Annia; Rodriguez, Carol E; Sharma, Shalini; Herrera, Rene J

2014-04-25

The U1 small nuclear (sn)RNA participates in splicing of pre-mRNAs by recognizing and binding to 5' splice sites at exon/intron boundaries. U1 snRNAs associate with 5' splice sites in the form of ribonucleoprotein particles (snRNPs) that are comprised of the U1 snRNA and 10 core components, including U1A, U1-70K, U1C and the 'Smith antigen', or Sm, heptamer. The U1 snRNA is highly conserved across a wide range of taxa; however, a number of reports have identified the presence of expressed U1-like snRNAs in multiple species, including humans. While numerous U1-like molecules have been shown to be expressed, it is unclear whether these variant snRNAs have the capacity to form snRNPs and participate in splicing. The purpose of the present study was to further characterize biochemically the ability of previously identified human U1-like variants to form snRNPs and bind to U1 snRNP proteins. A bioinformatics analysis provided support for the existence of multiple expressed variants. In vitro gel shift assays, competition assays, and immunoprecipitations (IPs) revealed that the variants formed high molecular weight assemblies to varying degrees and associated with core U1 snRNP proteins to a lesser extent than the canonical U1 snRNA. Together, these data suggest that the human U1 snRNA variants analyzed here are unable to efficiently bind U1 snRNP proteins. The current work provides additional biochemical insights into the ability of the variants to assemble into snRNPs. Copyright © 2014 Elsevier B.V. All rights reserved.

China's Expansion Into and U.S. Withdrawal from Argentina's Telecommunications and Space Industries and the Implications for U.S. National Security

National Research Council Canada - National Science Library

Hulse, Janie

2007-01-01

... up. In this monograph, Ms. Janie Hutse, a Latin Amen can specialist based in Buenos Aires, Argentina, argues that increased Chinese investment in regional telecommunications and space industries has implications for U.S. national security...

U-Pb ages related to uranium mineralization of Lagoa Real, Bahia - Brazil: tectonic implications

Energy Technology Data Exchange (ETDEWEB)

Chaves, Alexandre O.; Rios, Francisco J.; Oliveira, Lucilia A.R.; Alves, James V.; Fuzikawa, Kazuo; Neves, Jose M.C.; Chaves, Adriana M.D.V.; Prates, Sonia P. [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)]. E-mail: aoc@cdtn.br; Tubrett, Michael [Memorial University of Newfoundland, NL (Canada). Inco Innovation Centre. MicroAnalysis Facility; Matos, Evando C. [Industrias Nucleares do Brasil S.A. (INB), Rio de Janeiro, RJ (Brazil)

2007-07-01

The uranium from Lagoa Real (Bahia/Brazil) is associated with syenitic magmatism (1904 {+-}44 Ma minimum age from upper intercept of zircon U-Pb discordia by LA-ICP-MS) belonging to a mafic/ felsic lithologic association linked to the final stages of 2.05-1.80 Ga Orosirian Orogeny, which acted in the Paramirim Block. These syenitic rocks are rich not only in albite, but also in U-rich titanite (source of uranium). In association with the development of the Orosirian ductile shear zones, the syenites were crystallized and deformed. The metamorphic reactions, which include intense recrystallization of magmatic minerals, led uraninite to precipitate (1868 {+-} 69 Ma; U-Pb by LA-ICP MS) under Redox control. A second population of uraninites was also generated by shear zones reactivation during 0.6-0.5 Ga Brasiliano Orogeny (605 {+-} 170 Ma; U-Pb by LA-ICP-MS). The geotectonic implications are: a) the importance of the Orosirian event in the Paramirim Block during paleoproterozoic Sao Francisco/Congo Craton edification and b) the influence of the Brasiliano event in the Paramirim Block during the West-Gondwana assembly processes, indicated by the 605 {+-} 170 Ma uraninite (second population) age and by the 483 {+-} 100 Ma lower intercept of the metamorphosed syenite U-Pb discordia. (author)

Supersymmetric U boson and the old U(1) problem

International Nuclear Information System (INIS)

Kim, B.R.

1983-01-01

In the supersymmetric SU(3)xSU(2)xU(1)xUsup(')(1) model the new gauge group Usup(')(1) enforces the introduction of mirror fermions. In this note we address the inverse question. If one starts with SU(3)xSU(2)xU(1) including mirror fermions, what physical arguments other than the supersymmetric require the introduction of a new gauge group Usup(')(1). It turns out that the old U(1) problem is closely related with this question. Further we give an estimate for the upper bound for the parameter of the supersymmetric U boson r and x. (orig.)

RNA-binding domain of the A protein component of the U1 small nuclear ribonucleoprotein analyzed by NMR spectroscopy is structurally similar to ribosomal proteins

International Nuclear Information System (INIS)

Hoffman, D.W.; Query, C.C.; Golden, B.L.; White, S.W.; Keene, J.D.

1991-01-01

An RNA recognition motif (RRM) of ∼80 amino acids constitutes the core of RNA-binding domains found in a large family of proteins involved in RNA processing. The U1 RNA-binding domain of the A protein component of the human U1 small nuclear ribonucleoprotein (RNP), which encompasses the RRM sequence, was analyzed by using NMR spectroscopy. The domain of the A protein is a highly stable monomer in solution consisting of four antiparallel β-strands and two α-helices. The highly conserved RNP1 and RNP2 consensus sequences, containing residues previously suggested to be involved in nucleic acid binding, are juxtaposed in adjacent β-strands. Conserved aromatic side chains that are critical for RNA binding are clustered on the surface to the molecule adjacent to a variable loop that influences recognition of specific RNA sequences. The secondary structure and topology of the RRM are similar to those of ribosomal proteins L12 and L30, suggesting a distant evolutionary relationship between these two types of RNA-associated proteins

Prescribed burning consumes key forest structural components: implications for landscape heterogeneity.

Science.gov (United States)

Holland, Greg J; Clarke, Michael F; Bennett, Andrew F

2017-04-01

Prescribed burning to achieve management objectives is a common practice in fire-prone regions worldwide. Structural components of habitat that are combustible and slow to develop are particularly susceptible to change associated with prescribed burning. We used an experimental, "whole-landscape" approach to investigate the effect of differing patterns of prescribed burning on key habitat components (logs, stumps, dead trees, litter cover, litter depth, and understorey vegetation). Twenty-two landscapes (each ~100 ha) were selected in a dry forest ecosystem in southeast Australia. Experimental burns were conducted in 16 landscapes (stratified by burn extent) while six served as untreated controls. We measured habitat components prior to and after burning. Landscape burn extent ranged from 22% to 89% across the 16 burn treatments. With the exception of dead standing trees (no change), all measures of habitat components declined as a consequence of burning. The degree of loss increased as the extent to which a landscape was burned also increased. Prescribed burning had complex effects on the spatial heterogeneity (beta diversity) of structural components within landscapes. Landscapes that were more heterogeneous pre-fire were homogenized by burning, while those that were more homogenous pre-fire tended to display greater differentiation post-burning. Thus, the notion that patch mosaic burning enhances heterogeneity at the landscape-scale depends on prior conditions. These findings have important management implications. Where prescribed burns must be undertaken, effects on important resources can be moderated via control of burn characteristics (e.g., burn extent). Longer-term impacts of prescribed burning will be strongly influenced by the return interval, given the slow rate at which some structural components accumulate (decades to centuries). Management of habitat structural components is important given the critical role they play in (1) provision of habitat

U1 Adaptor Oligonucleotides Targeting BCL2 and GRM1 Suppress Growth of Human Melanoma Xenografts In Vivo

Directory of Open Access Journals (Sweden)

Rafal Goraczniak

2013-01-01

Full Text Available U1 Adaptor is a recently discovered oligonucleotide-based gene-silencing technology with a unique mechanism of action that targets nuclear pre-mRNA processing. U1 Adaptors have two distinct functional domains, both of which must be present on the same oligonucleotide to exert their gene-silencing function. Here, we present the first in vivo use of U1 Adaptors by targeting two different human genes implicated in melanomagenesis, B-cell lymphoma 2 (BCL2 and metabotropic glutamate receptor 1 (GRM1, in a human melanoma cell xenograft mouse model system. Using a newly developed dendrimer delivery system, anti-BCL2 U1 Adaptors were very potent and suppressed tumor growth at doses as low as 34 µg/kg with twice weekly intravenous (iv administration. Anti-GRM1 U1 Adaptors suppressed tumor xenograft growth with similar potency. Mechanism of action was demonstrated by showing target gene suppression in tumors and by observing that negative control U1 Adaptors with just one functional domain show no tumor suppression activity. The anti-BCL2 and anti-GRM1 treatments were equally effective against cell lines harboring either wild-type or a mutant V600E B-RAF allele, the most common mutation in melanoma. Treatment of normal immune-competent mice (C57BL6 indicated no organ toxicity or immune stimulation. These proof-of-concept studies represent an in-depth (over 800 mice in ~108 treatment groups validation that U1 Adaptors are a highly potent gene-silencing therapeutic and open the way for their further development to treat other human diseases.

Global implications of U.S. power deregulation

International Nuclear Information System (INIS)

Maschoff, D.C.

1996-01-01

With U.S. power deregulation remaining a topic that is dominating the entire North American energy marketplace, this paper provides an update of events occurring in U.S. electric power markets, offering some observations about changes due to increasing competition in electric power markets, and discusses some reasons why the events in U.S. electric power markets will soon transform global energy markets. How quickly is the move from local service territory to global markets proceeding? More than fifty U.S. utility companies with revenues of over $1 billion (U.S.) will soon be actively seeking and participating in global business opportunities. Using the same logic that led them to pursue utility initiatives nationally, U.S. utilities will use their core capabilities to compete in global energy services markets. In connection with these global initiatives, U.S. utilities will bring the same fuel-neutral, gas-electric perspective to international electric power and natural gas markets. (Author)

U2AF1 mutations alter splice site recognition in hematological malignancies.

Science.gov (United States)

Ilagan, Janine O; Ramakrishnan, Aravind; Hayes, Brian; Murphy, Michele E; Zebari, Ahmad S; Bradley, Philip; Bradley, Robert K

2015-01-01

Whole-exome sequencing studies have identified common mutations affecting genes encoding components of the RNA splicing machinery in hematological malignancies. Here, we sought to determine how mutations affecting the 3' splice site recognition factor U2AF1 alter its normal role in RNA splicing. We find that U2AF1 mutations influence the similarity of splicing programs in leukemias, but do not give rise to widespread splicing failure. U2AF1 mutations cause differential splicing of hundreds of genes, affecting biological pathways such as DNA methylation (DNMT3B), X chromosome inactivation (H2AFY), the DNA damage response (ATR, FANCA), and apoptosis (CASP8). We show that U2AF1 mutations alter the preferred 3' splice site motif in patients, in cell culture, and in vitro. Mutations affecting the first and second zinc fingers give rise to different alterations in splice site preference and largely distinct downstream splicing programs. These allele-specific effects are consistent with a computationally predicted model of U2AF1 in complex with RNA. Our findings suggest that U2AF1 mutations contribute to pathogenesis by causing quantitative changes in splicing that affect diverse cellular pathways, and give insight into the normal function of U2AF1's zinc finger domains. © 2015 Ilagan et al.; Published by Cold Spring Harbor Laboratory Press.

Screening apatites for (U-Th)/He thermochronometry via continuous ramped heating: He age components and implications for age dispersion

Science.gov (United States)

McDannell, Kalin T.; Zeitler, Peter K.; Janes, Darwin G.; Idleman, Bruce D.; Fayon, Annia K.

2018-02-01

Old slowly-cooled apatites often yield dispersed (U-Th)/He ages for a variety of reasons, some well understood and some not. Analytical protocols like careful grain selection can reduce the impact of this dispersion but add costs in time and resources and too often have proven insufficient. We assess a new analytical protocol that utilizes static-gas measurement during continuous ramped heating (CRH) as a means to rapidly screen apatite samples. In about the time required for a conventional total-gas analysis, this method can discriminate between samples showing expected volume-diffusion behavior and those showing anomalous release patterns inconsistent with their direct use in thermochronologic applications. This method also appears able to discriminate between the radiogenic and extraneous 4He fractions released by a sample, potentially allowing ages to be corrected. Well-behaved examples such as the Durango standard and other apatites with good age reproducibility show the expected smooth, sigmoidal gas-release curves predicted for volume diffusion using typical apatite kinetics, with complete exhaustion by ∼900 °C for linear heating at 20 °C/min. Secondary factors such as U and Th zoning and alpha-loss distribution have a relatively minor impact on such profiles. In contrast, samples having greater age dispersion show significant He release in the form of outgassing spikes and He release deferred to higher temperatures. Screening results for a range of samples permit us to assess the degree to which CRH screening can identify misbehaving grains, give insight into the source of extraneous He, and suggest that in some cases it may be possible to correct ages for the presence of such components.

The Light-time Effect in the Eclipsing Binaries with Early-type Components U CrB and RW Tau

Science.gov (United States)

Khaliullina, A. I.

2018-04-01

A detailed study of the orbital-period variations of the Algol-type eclipsing binaries with earlyspectral- type primary components U CrB and RW Tau has been performed. The period variations in both systems can be described as a superposition of secular and cyclic variations of the period. A secular period increase at a rate of 2.58d × 10-7/year is observed for U CrB, which can be explained if there is a uniform flow of matter from the lower-mass to the higher-mass component, with the total angular momentum conserved. RW Tau features a secular period decrease at a rate of -8.6d × 10-7/year; this could be due to a loss of angular momentum by the binary due to magnetic braking. The cyclic orbital-period variations of U CrB and RWTau can be explained by the motion of the eclipsing binary systems along their long-period orbits. In U CrB, this implies that the eclipsing binary moves with a period of 91.3 years around a third body with mass M 3 > 1.13 M ⊙; in RW Tau, the period of the motion around the third body is 66.6 years, and the mass of the third body is M 3 > 1.24 M ⊙. It also cannot be ruled out that the variations are due to the magnetic cycles of the late-type secondaries. The residual period variations could be a superposition of variations due to non-stationary ejection of matter and effects due to magnetic cycles.

Upgrades toward high-heat flux, liquid lithium plasma-facing components in the NSTX-U

Energy Technology Data Exchange (ETDEWEB)

Jaworski, M.A., E-mail: mjaworsk@pppl.gov [Princeton Plasma Physics Laboratory, Princeton, NJ 08543 (United States); Brooks, A.; Kaita, R. [Princeton Plasma Physics Laboratory, Princeton, NJ 08543 (United States); Lopes-Cardozo, N. [TU/Eindhoven, Eindhoven (Netherlands); Menard, J.; Ono, M. [Princeton Plasma Physics Laboratory, Princeton, NJ 08543 (United States); Rindt, P. [TU/Eindhoven, Eindhoven (Netherlands); Tresemer, K. [Princeton Plasma Physics Laboratory, Princeton, NJ 08543 (United States)

2016-11-15

Highlights: • An upgrade path for the NSTX-U tokamak is proposed that maintains scientific productivity while enabling exploration of novel, liquid metal PFC. • Pre-filled liquid metal divertor targets are proposed as an intermediate step that mitigates technical and scientific risks associated with liquid metal PFC. • Analysis of leading edge features show a strong link between engineering design considerations and expected performance as a PFC. • A method for optimizing porous liquid metal targets restrained by capillary forces is provided indicating pore-sizes well within current technical capabilities. - Abstract: Liquid metal plasma-facing components (PFCs) provide numerous potential advantages over solid-material components. One critique of the approach is the relatively less developed technologies associated with deploying these components in a fusion plasma-experiment. Exploration of the temperature limits of liquid lithium PFCs in a tokamak divertor and the corresponding consequences on core operation are a high priority informing the possibilities for future liquid lithium PFCs. An all-metal NSTX-U is envisioned to make direct comparison between all high-Z wall operation and liquid lithium PFCs in a single device. By executing the all-metal upgrades incrementally, scientific productivity will be maintained while enabling physics and engineering-science studies to further develop the solid- and liquid-metal components. Six major elements of a flowing liquid-metal divertor system are described and a three-step program for implementing this system is laid out. The upgrade steps involve the first high-Z divertor target upgrade in NSTX-U, pre-filled liquid metal targets and finally, an integrated, flowing liquid metal divertor target. Two example issues are described where the engineering and physics experiments are shown to be closely related in examining the prospects for future liquid metal PFCs.

19 CFR 10.26 - Articles assembled or processed in a beneficiary country in whole of U.S. components or...

Science.gov (United States)

2010-04-01

..., material, ingredient, or article remained under the control of the customs authority of the non-beneficiary... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles assembled or processed in a beneficiary... textile components cut to shape in the United States. 10.26 Section 10.26 Customs Duties U.S. CUSTOMS AND...

Mpn1, Mutated in Poikiloderma with Neutropenia Protein 1, Is a Conserved 3′-to-5′ RNA Exonuclease Processing U6 Small Nuclear RNA

Directory of Open Access Journals (Sweden)

Vadim Shchepachev

2012-10-01

Full Text Available Clericuzio-type poikiloderma with neutropenia (PN is a rare genodermatosis associated with mutations in the C16orf57 gene, which codes for the uncharacterized protein hMpn1. We show here that, in both fission yeasts and humans, Mpn1 processes the spliceosomal U6 small nuclear RNA (snRNA posttranscriptionally. In Mpn1-deficient cells, U6 molecules carry 3′ end polyuridine tails that are longer than those in normal cells and lack a terminal 2′,3′ cyclic phosphate group. In mpn1Δ yeast cells, U6 snRNA and U4/U6 di-small nuclear RNA protein complex levels are diminished, leading to precursor messenger RNA splicing defects, which are reverted by expression of either yeast or human Mpn1 and by overexpression of U6. Recombinant hMpn1 is a 3′-to-5′ RNA exonuclease that removes uridines from U6 3′ ends, generating terminal 2′,3′ cyclic phosphates in vitro. Finally, U6 degradation rates increase in mpn1Δ yeasts and in lymphoblasts established from individuals affected by PN. Our data indicate that Mpn1 promotes U6 stability through 3′ end posttranscriptional processing and implicate altered U6 metabolism as a potential mechanism for PN pathogenesis.

U-series component dating for late pleistocene basalt Longgang, Jilin province

International Nuclear Information System (INIS)

Yu Fusheng; Yuan Wanming; Han Song

2003-01-01

Longgang volcanic swarm belongs to one of volcanic areas which have been active since modern times. In view of multiple eruptions during histories, it is very important to determine age of every eruption for evaluating volcanic hazards. The alkaline basalt samples taken from Dayizishan and diaoshuihu are analyzed by U-series component method, after magnetic separation. The ages of the two samples are (71 ± 9) ka, (106 ± 13) ka before presence, respectively. These data indicate that there exist intensively eruptive activities during late Pleistocene

The uPA/uPAR system regulates the bioavailability of PDGF-DD: implications for tumour growth.

Science.gov (United States)

Ehnman, M; Li, H; Fredriksson, L; Pietras, K; Eriksson, U

2009-01-29

Members of the platelet-derived growth factor (PDGF) family are mitogens for cells of mesenchymal origin and have important functions during embryonic development, blood vessel maturation, fibrotic diseases and cancer. In contrast to the two classical PDGFs, the novel and less well-characterized members, PDGF-CC and PDGF-DD, are latent factors that need to be processed extracellularly by activating proteases, before they can mediate PDGF receptor activation. Here, we elucidate the structural requirements for urokinase plasminogen activator (uPA)-mediated activation of PDGF-DD, as well as the intricate interplay with uPA receptor (uPAR) signalling. Furthermore, we show that activated PDGF-DD, in comparison to latent, more potently transforms NIH/3T3 cells in vitro. Conversely, xenograft studies in nude mice demonstrate that cells expressing latent PDGF-DD are more tumorigenic than those expressing activated PDGF-DD. These findings imply that a fine-tuned proteolytic activation, in the local milieu, controls PDGF-DD bioavailability. Moreover, we suggest that proteolytic activation of PDGF-DD reveals a retention motif mediating interactions with pericellular components. Our proposed mechanism, where uPA not only generates active PDGF-DD, but also regulates its spatial distribution, provides novel insights into the biological function of PDGF-DD.

Magnetic correlations in UPt3 and U/sub 1-x/Th/sub x/Pt3

International Nuclear Information System (INIS)

Aeppli, G.; Bucher, E.; Goldman, A.I.; Shirane, G.; Broholm, C.; Kjems, J.K.

1988-01-01

Neutron scattering experiments on UPt 3 and U/sub 1-x/Th/sub x/Pt 3 are reviewed. At relatively high energies (/approximately/5 MeV), the magnetic fluctuation spectrum is modulated by the structure factor derived from short-range antiferromagnetic correlations where the two U ions in each unit cell are oppositely polarized. In contrast, at low energies (≤ 1 MeV), the diffuse inelastic scattering is associated with antiferromagnetic correlations where the unit cell is doubled. Nominally pure UPt 3 exhibits magnetic order with the wavevector corresponding to this doubling and a static moment of 0.02 +- 0.01 μ/sub B/. (U/sub 1-x/Th/sub x/)Pt 3 with x ≅ 0.05 exhibits ordering of the same type, but with a much larger static moment, 0.65 +- 0.1 μ/sub B/. Neutron scattering measurements on UPt 3 with implications for superconductivity are surveyed. 23 refs., 7 figs

Design issues and implications for the structural integrity and lifetime of fusion power plant components

International Nuclear Information System (INIS)

Karditas, P.J.

1996-05-01

This review discusses, with example calculations, the criteria, and imposed constraints and limitations, for the design of fusion components and assesses the implications for successful design and power plant operation. The various loading conditions encountered during the operation of a tokamak lead to structural damage and possible failure by such mechanisms as yielding, thermal creep rupture and fatigue due to thermal cycling, plastic strain cycling (ratcheting), crack growth-propagation and radiation induced swelling and creep. Of all the possible damage mechanisms, fatigue, creep and their combination are the most important in the structural design and lifetime of fusion power plant components operating under steady or load varying conditions. Also, the effect of neutron damage inflicted onto the structural materials and the degradation of key properties is of major concern in the design and lifetime prediction of components. Structures are classified by, and will be restricted by existing or future design codes relevant to medium and high temperature power plant environments. The ways in which existing design codes might be used in present and near future design activities, and the implications, are discussed; the desirability of an early start towards the development of fusion-specific design codes is emphasised. (UK)

SU(2) x U(1) x U'(1) models which are slightly different from the Weinberg-Salam model

International Nuclear Information System (INIS)

Gao, C.; Wu, D.

1981-01-01

We discuss SU(2) x U(1) x U'(1) models by a uniform formula which is convenient for their comparison with the standard Weinberg-Salam model. As examples, we give three interesting models which are based on different grand unification models. In one model, U'(1) does not contribute to the electromagnetic interaction; in the other two, both U(1) and U'(1) do contribute to the electromagnetic interaction. Also, the first two models can approach the standard Weinberg-Salam model as close as one wants; but the third model has limitations on it

Advanced BWR core component designs and the implications for SFD analysis

International Nuclear Information System (INIS)

Ott, L.J.

1997-01-01

Prior to the DF-4 boiling water reactor (BWR) severe fuel damage (SFD) experiment conducted at the Sandia National Laboratories in 1986, no experimental data base existed for guidance in modeling core component behavior under postulated severe accident conditions in commercial BWRs. This paper will present the lessons learned from the DF-4 experiment (and subsequent German CORA BWR SFD tests) and the impact on core models in the current generation of SFD codes. The DF-4 and CORA BWR test assemblies were modeled on the core component designs circa 1985; that is, the 8 x 8 fuel assembly with two water rods and a cruciform control blade constructed of B 4 C-filled tubelets. Within the past ten years, the state-of-the-art with respect to BWR core component development has out-distanced the current SFD experimental data base and SFD code capabilities. For example, modern BWR control blade design includes hafnium at the tips and top of each control blade wing for longer blade operating lifetimes; also water rods have been replaced by larger water channels for better neutronics economy; and fuel assemblies now contain partial-length fuel rods, again for better neutronics economy. This paper will also discuss the implications of these advanced fuel assembly and core component designs on severe accident progression and on the current SFD code capabilities

Characterization of kappa opioid binding using dynorphin A1-13 and U69,593 in the rat brain

Energy Technology Data Exchange (ETDEWEB)

Devlin, T.; Shoemaker, W.J. (Univ. of Connecticut Health Center, Farmington (USA))

1990-05-01

Previous studies of kappa opioid binding sites have suggested heterogeneous binding to this class of opioid receptors. To further investigate kappa receptor heterogeneity, we analyzed the binding properties of various kappa-selective ligands in rat brain homogenates. Displacement assays were carried out using (3H)bremazocine in the presence of various displacing ligands under mu and delta receptor-blocked conditions. Homologous displacement of (3H)bremazocine produced shallow displacement which best fit a two-site model of drug-receptor interaction. Dynorphin A1-13 and U69,593 exhibited similar biphasic displacement of (3H)bremazocine. Maximal displacement by these ligands, however, represented only approximately 55% of total (3H)bremazocine binding, which suggests the existence of a third component of (3H)bremazocine binding. Biphasic displacement by dynorphin A1-13 was detected in tissue throughout the brain and the spinal cord, whereas the dynorphin-resistant component of (3H)bremazocine binding was uniquely absent in the spinal cord. U50,488H, tifluadom and ethylketocyclazocine appeared to displace from additional, dynorphin-insensitive sites, as their maximal displacement exceeded that seen with either dynorphin A1-13 or U69,593. These results strongly suggest the existence of at least three components of non-mu, non-delta (3H)bremazocine binding in the rat brain: two with differential affinity for dynorphin A1-13 and U69-593 (kappa-1 and kappa-2 sites), and a third (termed here R1) that was further resolved into two binding sites by bremazocine. Preliminary analysis of the R1 component using naloxone revealed one high-affinity site, which may be opiate in nature, and a second site whose binding properties closely resemble those of the sigma receptor described by others.

39 CFR 1.1 - Establishment of the U.S. Postal Service.

Science.gov (United States)

2010-07-01

... 39 Postal Service 1 2010-07-01 2010-07-01 false Establishment of the U.S. Postal Service. 1.1 Section 1.1 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE POSTAL POLICY (ARTICLE I) § 1.1 Establishment of the U.S. Postal Service. The U.S. Postal Service is...

Contribution of Extracellular Polymeric Substances from Shewanella sp. HRCR-1 Biofilms to U(VI) Immobilization

Energy Technology Data Exchange (ETDEWEB)

Cao, Bin; Ahmed, B.; Kennedy, David W.; Wang, Zheming; Shi, Liang; Marshall, Matthew J.; Fredrickson, Jim K.; Isern, Nancy G.; Majors, Paul D.; Beyenal, Haluk

2011-06-05

The goal of this study was to quantify the contribution of extracellular polymeric substances (EPS) in U(VI) immobilization by Shewanella sp. HRCR-1. Through comparison of U(VI) immobilization using cells with bound EPS (bEPS) and cells without EPS, we showed that i) bEPS from Shewanella sp. HRCR-1 biofilms contributed significantly to U(VI) immobilization, especially at low initial U(VI) concentrations, through both sorption and reduction; ii) bEPS could be considered as a functional extension of the cells for U(VI) immobilization and they likely play more important roles at initial U(VI) concentrations; and iii) U(VI) reduction efficiency was found to be dependent upon initial U(VI) concentration and the efficiency decreased at lower concentrations. To quantify relative contribution of sorption and reduction in U(VI) immobilization by EPS fractions, we isolated loosely associated EPS (laEPS) and bEPS from Shewanella sp. HRCR-1 biofilms grown in a hollow fiber membrane biofilm reactor and tested their reactivity with U(V). We found that, when in reduced form, the isolated cell-free EPS fractions could reduce U(VI). Polysaccharides in the EPS likely contributed to U(VI) sorption and dominated reactivity of laEPS while redox active components (e.g., outer membrane c-type cytochromes), especially in bEPS, might facilitate U(VI) reduction.

Contribution of extracellular polymeric substances from Shewanella sp. HRCR-1 biofilms to U(VI) immobilization.

Science.gov (United States)

Cao, Bin; Ahmed, Bulbul; Kennedy, David W; Wang, Zheming; Shi, Liang; Marshall, Matthew J; Fredrickson, Jim K; Isern, Nancy G; Majors, Paul D; Beyenal, Haluk

2011-07-01

The goal of this study was to quantify the contribution of extracellular polymeric substances (EPS) to U(VI) immobilization by Shewanella sp. HRCR-1. Through comparison of U(VI) immobilization using cells with bound EPS (bEPS) and cells with minimal EPS, we show that (i) bEPS from Shewanella sp. HRCR-1 biofilms contribute significantly to U(VI) immobilization, especially at low initial U(VI) concentrations, through both sorption and reduction; (ii) bEPS can be considered a functional extension of the cells for U(VI) immobilization and they likely play more important roles at lower initial U(VI) concentrations; and (iii) the U(VI) reduction efficiency is dependent upon the initial U(VI) concentration and decreases at lower concentrations. To quantify the relative contributions of sorption and reduction to U(VI) immobilization by EPS fractions, we isolated loosely associated EPS (laEPS) and bEPS from Shewanella sp. HRCR-1 biofilms grown in a hollow fiber membrane biofilm reactor and tested their reactivity with U(VI). We found that, when reduced, the isolated cell-free EPS fractions could reduce U(VI). Polysaccharides in the EPS likely contributed to U(VI) sorption and dominated the reactivity of laEPS, while redox active components (e.g., outer membrane c-type cytochromes), especially in bEPS, possibly facilitated U(VI) reduction.

Summarizing components of U.S. Department of the Interior vulnerability assessments to focus climate adaptation planning

Science.gov (United States)

Thompson, Laura M.; Staudinger, Michelle D.; Carter, Shawn L.

2015-09-29

A secretarial order identified climate adaptation as a critical performance objective for future management of U.S. Department of the Interior (DOI) lands and resources in response to global change. Vulnerability assessments can inform climate adaptation planning by providing insight into what natural resources are most at risk and why. Three components of vulnerability—exposure, sensitivity, and adaptive capacity—were defined by the Intergovernmental Panel on Climate Change (IPCC) as necessary for identifying climate adaptation strategies and actions. In 2011, the DOI requested all internal bureaus report ongoing or completed vulnerability assessments about a defined range of assessment targets or climate-related threats. Assessment targets were defined as freshwater resources, landscapes and wildlife habitat, native and cultural resources, and ocean health. Climate-related threats were defined as invasive species, wildfire risk, sea-level rise, and melting ice and permafrost. Four hundred and three projects were reported, but the original DOI survey did not specify that information be provided on exposure, sensitivity, and adaptive capacity collectively as part of the request, and it was unclear which projects adhered to the framework recommended by the IPCC. Therefore, the U.S. Geological Survey National Climate Change and Wildlife Science Center conducted a supplemental survey to determine how frequently each of the three vulnerability components was assessed. Information was categorized for 124 of the 403 reported projects (30.8 percent) based on the three vulnerability components, and it was discovered that exposure was the most common component assessed (87.9 percent), followed by sensitivity (68.5 percent) and adaptive capacity (33.1 percent). The majority of projects did not fully assess vulnerability; projects focused on landscapes/wildlife habitats and sea-level rise were among the minority that simultaneously addressed all three vulnerability

Underground storage tank 291-D1U1: Closure plan

Energy Technology Data Exchange (ETDEWEB)

Mancieri, S.; Giuntoli, N.

1993-09-01

The 291-D1U1 tank system was installed in 1983 on the north side of Building 291. It supplies diesel fuel to the Building 291 emergency generator and air compressor. The emergency generator and air compressor are located southwest and southeast, respectively, of the tank (see Appendix B, Figure 2). The tank system consists of a single-walled, 2,000- gallon, fiberglass tank and a fuel pump system, fill pipe, vent pipe, electrical conduit, and fuel supply and return piping. The area to be excavated is paved with asphalt and concrete. It is not known whether a concrete anchor pad is associated with this tank. Additionally, this closure plan assumes that the diesel tank is below the fill pad. The emergency generator and air compressor for Building 291 and its associated UST, 291-D1U1, are currently in use. The generator and air compressor will be supplied by a temporary above-ground fuel tank prior to the removal of 291-D1U1. An above-ground fuel tank will be installed as a permanent replacement for 291-D1U1. The system was registered with the State Water Resources Control Board on June 27, 1984, as 291-41D and has subsequently been renamed 291-D1U1. Figure 1 (see Appendix B) shows the location of the 291-D1U1 tank system in relation to the Lawrence Livermore National Laboratory (LLNL). Figure 2 (see Appendix B) shows the 291-D1U1 tank system in relation to Building 291. Figure 3 (see Appendix B) shows a plan view of the 291-D1U1 tank system.

Legal, ethical, and economic implications of breaking down once-daily fixed-dose antiretroviral combinations into their single components for cost reduction.

Science.gov (United States)

Ramiro, Miguel A; Llibre, Josep M

2014-11-01

The availability of generic lamivudine in the context of the current economic crisis has raised a new issue in some European countries: breaking up the once-daily fixed-dose antiretroviral combinations (FDAC) of efavirenz/tenofovir/emtricitabine, tenofovir/emtricitabine, or abacavir/lamivudine, in order to administer their components separately, thereby allowing the use of generic lamivudine instead of branded emtricitabine or lamivudine. The legal, ethical, and economic implications of this potential strategy are reviewed, particularly in those patients receiving a once-daily single-tablet regimen. An unfamiliar change in antiretroviral treatment from a successful patient-friendly FDAC into a more complex regimen including separately the components to allow the substitution of one (or some) of them for generic surrogates (in the absence of a generic bioequivalent FDAC) could be discriminatory because it does not guarantee access to equal excellence in healthcare to all citizens. Furthermore, it could violate the principle of non-maleficence by potentially causing harm both at the individual level (hindering adherence and favouring treatment failure and resistance), and at the community level (hampering control of disease transmission and transmission of HIV-1 resistance). Replacing a FDAC with the individual components of that combination should only be permitted when the substituting medication has the same qualitative and quantitative composition of active ingredients, pharmaceutical form, method of administration, dosage and presentation as the medication being replaced, and a randomized study has demonstrated its non-inferiority. Finally, a strict pharma-economic study supporting this change, comparing the effectiveness and the cost of a specific intervention with the best available alternative, should be undertaken before its potential implementation. Copyright © 2013 Elsevier España, S.L.U. y Sociedad Española de Enfermedades Infecciosas y Microbiolog

Two-dimensional gauge model with vector U(1) and axial-vector U(1) symmetries

International Nuclear Information System (INIS)

Watabiki, Y.

1989-01-01

We have succeeded in constructing a two-dimensional gauge model with both vector U(1) and axial-vector U(1) symmetries. This model is exactly solvable. The Schwinger term vanishes in this model as a consequence of the above symmetries, and negative-norm states appear. However, the norms of physical states are always positive semidefinite due to the gauge symmetries

U(N) instantons on N=(1/2) superspace: Exact solution and geometry of moduli space

International Nuclear Information System (INIS)

Britto, Ruth; Feng Bo; Lunin, Oleg; Rey, Soo-Jong

2004-01-01

We construct the exact solution of one (anti-)instanton in N=(1/2) super Yang-Mills theory defined on non(anti-)commutative superspace. We first identify N=(1/2) superconformal invariance as maximal spacetime symmetry. For the gauge group U(2), the SU(2) part of the solution is given by the standard (anti-)instanton, but the U(1) field strength also turns out to be nonzero. The solution is SO(4) rotationally symmetric. For the gauge group U(N), in contrast with the U(2) case, we show that the entire U(N) part of the solution is deformed by non(anti-)commutativity and fermion zero modes. The solution is no longer rotationally symmetric; it is polarized into an axially symmetric configuration because of the underlying non(anti-)commutativity. We compute the 'information metric' of one (anti-)instanton. We find that the moduli space geometry is deformed from the hyperbolic space H 5 (Euclidean anti-de Sitter space) in a way anticipated from reduced spacetime symmetry. Remarkably, the volume measure of the moduli space turns out to be independent of the non(anti-)commutativity. Implications for D branes in the Ramond-Ramond flux background and the gauge-gravity correspondence are discussed

GLUT-1-independent infection of the glioblastoma/astroglioma U87 cells by the human T cell leukemia virus type 1

International Nuclear Information System (INIS)

Jin Qingwen; Agrawal, Lokesh; VanHorn-Ali, Zainab; Alkhatib, Ghalib

2006-01-01

of HTLV-1 infection of U87 cells. The results may have important implications for HTLV-1 neurotropism and pathogenesis

Deletion of SNURF/SNRPN U1B and U1B* upstream exons in a ...

Indian Academy of Sciences (India)

RESEARCH ARTICLE. Deletion of SNURF/SNRPN U1B and U1B* upstream exons in a child ... whereby genes are expressed in a parent-of-origin dependent manner. One of the ... lity, neurodevelopmental delay, features of attention deficit hyperactivity .... Received 16 December 2015; accepted 8 January 2016. Unedited ...

U isotopes distribution in the Lower Rhone River and its implication on radionuclides disequilibrium within the decay series.

Science.gov (United States)

Zebracki, Mathilde; Cagnat, Xavier; Gairoard, Stéphanie; Cariou, Nicolas; Eyrolle-Boyer, Frédérique; Boulet, Béatrice; Antonelli, Christelle

2017-11-01

The large rivers are main pathways for the delivery of suspended sediments into coastal environments, affecting the biogeochemical fluxes and the ecosystem functioning. The radionuclides from 238 U and 232 Th-series can be used to understand the dynamic processes affecting both catchment soil erosion and sediment delivery to oceans. Based on annual water discharge the Rhone River represents the largest river of the Mediterranean Sea. The Rhone valley also represents the largest concentration in nuclear power plants in Europe. A radioactive disequilibrium between particulate 226 Ra (p) and 238 U (p) was observed in the suspended sediment discharged by the Lower Rhone River (Eyrolle et al. 2012), and a fraction of particulate 234 Th was shown to derive from dissolved 238 U (d) (Zebracki et al. 2013). This extensive study has investigated the dissolved U isotopes distribution in the Lower Rhone River and its implication on particulate radionuclides disequilibrium within the decay series. The suspended sediment and filtered river waters were collected at low and high water discharges. During the 4-months of the study, two flood events generated by the Rhone southern tributaries were monitored. In river waters, the total U (d) concentration and U isotopes distribution were obtained through Q-ICP-MS measurements. The Lower Rhone River has displayed non-conservative U-behavior, and the variations in U (d) concentration between southern tributaries were related to the differences in bedrock lithology. The artificially occurring 236 U was detected in the Rhone River at low water discharges, and was attributed to the liquid releases from nuclear industries located along the river. The ( 235 U/ 238 U) (d) activity ratio (=AR) in river waters was representative of the 235 U natural abundance on Earth. The ( 226 Ra/ 238 U) (p) AR in suspended sediment has indicated a radioactive disequilibrium (average 1.3 ± 0.1). The excess of 234 Th in suspended sediment =( 234 Th xs

Path integral for coherent states of the dynamical U2 group and U2/1 supergroup

International Nuclear Information System (INIS)

Kochetov, E.A.

1992-01-01

A part-integral formulation in the representation of coherent states for the unitary U 2 group and U 2/1 supergroup is introduced. U 2 and U 2/1 path integrals are shown to be defined on the coset spaces U 2 /U 1 xU 1 and U 2/1 /U 1/1 xU 1 , respectively. These coset appears as curved classical phase spaces. Partition functions are expressed as path integrals over these spaces. In the case when U 2 and U 2/1 are the dynamical groups, the corresponding path integrals are evaluated with the help of linear fractional transformations that appear as the group (supergroup) action in the coset space (superspace). Possible applications for quantum models are discussed. 9 refs

Russia’s Ambiguous Warfare and Implications for the U.S. Marine Corps

Science.gov (United States)

2015-05-01

provision of law , no person shall be subject to a penalty for failing to comply with a collection of information if it does not display a currently...Ambiguous Warfare’ and Implications for the U.S. Marine Corps 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d...Russian-supplied equipment recklessly, as seen in the shoot-down of Malaysian Flight MH-17. Donbass residents able to escape the fighting have done so

Human regulator of telomere elongation helicase 1 (RTEL1) is required for the nuclear and cytoplasmic trafficking of pre-U2 RNA.

Science.gov (United States)

Schertzer, Michael; Jouravleva, Karina; Perderiset, Mylene; Dingli, Florent; Loew, Damarys; Le Guen, Tangui; Bardoni, Barbara; de Villartay, Jean-Pierre; Revy, Patrick; Londoño-Vallejo, Arturo

2015-02-18

Hoyeraal-Hreidarsson syndrome (HHS) is a severe form of Dyskeratosis congenita characterized by developmental defects, bone marrow failure and immunodeficiency and has been associated with telomere dysfunction. Recently, mutations in Regulator of Telomere ELongation helicase 1 (RTEL1), a helicase first identified in Mus musculus as being responsible for the maintenance of long telomeres, have been identified in several HHS patients. Here we show that RTEL1 is required for the export and the correct cytoplasmic trafficking of the small nuclear (sn) RNA pre-U2, a component of the major spliceosome complex. RTEL1-HHS cells show abnormal subcellular partitioning of pre-U2, defects in the recycling of ribonucleotide proteins (RNP) in the cytoplasm and splicing defects. While most of these phenotypes can be suppressed by re-expressing the wild-type protein in RTEL1-HHS cells, expression of RTEL1 mutated variants in immortalized cells provokes cytoplasmic mislocalizations of pre-U2 and other RNP components, as well as splicing defects, thus phenocopying RTEL1-HHS cellular defects. Strikingly, expression of a cytoplasmic form of RTEL1 is sufficient to correct RNP mislocalizations both in RTEL1-HHS cells and in cells expressing nuclear mutated forms of RTEL1. This work unravels completely unanticipated roles for RTEL1 in RNP trafficking and strongly suggests that defects in RNP biogenesis pathways contribute to the pathology of HHS. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

Canisters and nonfuel components at commercial nuclear reactors

International Nuclear Information System (INIS)

Gibbard, K.; Thorpe, J.; Moore, R.S.

1995-01-01

The Energy Information Administration of the U.S. Department of Energy (DOE) collects data annually from commercial nuclear power reactors via the Nuclear Fuel Data survey, Form RW-859. Over the past three years, the survey has collected data on the quantities and types of nonfuel components and on the quantities and contents of canisters in storage at reactor sites. This paper focuses on the annual changes in the data, specific implications of these changes, and lessons that should be applied to future revisions of the study. The total number of canisters reported by utilities for each year from 1986 to 1993 is listed. Changes in the quantities of nonfuel components report by General Reactors from 1992 to 1993 are also provided. Comparisons of canister and nonfuel components components data from year to year and from reactor to reactor point out that survey questions on these topics have been interpreted differently by reactor personnel

U(1) problem

Energy Technology Data Exchange (ETDEWEB)

McDougall, N.A. (Oxford Univ. (UK). Dept. of Theoretical Physics)

1984-08-23

The resolution of the U(1) problem requires the quark condensates to have a specific THETA dependence. We show that the required THETA dependence arises naturally upon application of the index theorem during the calculation of the dynamically generated quark mass.

Higgs phenomenology in the minimal S U (3 )L×U (1 )X model

Science.gov (United States)

Okada, Hiroshi; Okada, Nobuchika; Orikasa, Yuta; Yagyu, Kei

2016-07-01

We investigate the phenomenology of a model based on the S U (3 )c×S U (3 )L×U (1 )X gauge theory, the so-called 331 model. In particular, we focus on the Higgs sector of the model which is composed of three S U (3 )L triplet Higgs fields and is the minimal form for realizing a phenomenologically acceptable scenario. After the spontaneous symmetry breaking S U (3 )L×U (1 )X→S U (2 )L×U (1 )Y , our Higgs sector effectively becomes that with two S U (2 )L doublet scalar fields, in which the first- and the second-generation quarks couple to a different Higgs doublet from that which couples to the third-generation quarks. This structure causes the flavor-changing neutral current mediated by Higgs bosons at the tree level. By taking an alignment limit of the mass matrix for the C P -even Higgs bosons, which is naturally realized in the case with the breaking scale of S U (3 )L×U (1 )X much larger than that of S U (2 )L×U (1 )Y, we can avoid current constraints from flavor experiments such as the B0-B¯ 0 mixing even for the Higgs bosons masses that are O (100 ) GeV . In this allowed parameter space, we clarify that a characteristic deviation in quark Yukawa couplings of the Standard Model-like Higgs boson is predicted, which has a different pattern from that seen in two Higgs doublet models with a softly broken Z2 symmetry. We also find that the flavor-violating decay modes of the extra Higgs boson, e.g., H /A →t c and H±→t s , can be dominant, and they yield the important signature to distinguish our model from the two Higgs doublet models.

750 GeV resonance in the gauged U(1′-extended MSSM

Directory of Open Access Journals (Sweden)

Yun Jiang

2016-08-01

Full Text Available Recently the ATLAS and CMS Collaborations at the LHC announced their observation of a potential 750 GeV di-photon resonance, after analyzing the s=13 TeV LHC data. This observation has significant implications for low-energy supersymmetry. Beyond the MSSM and the NMSSM, we study the MSSM-extensions with an extra U(1′ gauge symmetry. The anomaly cancellation and the spontaneous breaking of the non-decoupled U(1′ generally require introducing vector-like supermultiplets (both colored and color-neutral ones and singlet supermultiplets, respectively. We illustrate that the potential 750 GeV resonance (Y can be accommodated in various mechanisms, as a singlet-like scalar or pseudoscalar. Three benchmark scenarios are presented: (1 vector-like quarks (VLQ mediated pp→Y→γγ; (2 scalar VLQ mediated pp→Y→γγ; (3 heavy scalar (pseudo-scalar H/A associated production pp→H⁎/A⁎→YH/h. Additionally, we notice that the Z′-mediated vector boson fusion production and Z′-associated production pp→Yqq′, if yielding a signal rate of the observed level, might have been excluded by the searches for Z′ via Drell–Yan process at the LHC.

The 17 MeV anomaly in beryllium decays and U(1) portal to dark matter

Science.gov (United States)

Chen, Chian-Shu; Lin, Guey-Lin; Lin, Yen-Hsun; Xu, Fanrong

2017-11-01

The experiment of Krasznahorkay et al. observed the transition of a 8Be excited state to its ground state and accompanied by an emission of an e+e‑ pair with 17 MeV invariant mass. This 6.8σ anomaly can be fitted by a new light gauge boson. We consider the new particle as a U(1) gauge boson, Z‧, which plays as a portal linking dark sector and visible sector. In particular, we study the new U(1) gauge symmetry as a hidden or nonhidden group separately. The generic hidden U(1) model, referred to as dark Z model, is excluded by imposing various experimental constraints. On the other hand, a nonhidden Z‧ is allowed due to the additional interactions between Z‧ and Standard Model fermions. We also study the implication of the dark matter direct search on such a scenario. We found that the search for the DM-nucleon scattering cannot probe the parameter space that is allowed by 8Be-anomaly for the range of DM mass above 500 MeV. However, the DM-electron scattering for DM between 20 MeV and 50 MeV can test the underlying U(1) portal model using the future Si and Ge detectors with the 5e‑ threshold charges.

IMPLICATIONS OF X-RAY LINE VARIATIONS FOR 4U1822-371

International Nuclear Information System (INIS)

Ji, L.; Schulz, N. S.; Nowak, M. A.; Canizares, C. R.

2011-01-01

4U 1822-371 is one of the prototype accretion disk coronal sources with an orbital period of about 5.6 hr. The binary is viewed almost edge-on at a high inclination angle of 83 deg., which makes it a unique candidate to study binary orbital and accretion disk dynamics in high powered X-ray sources. We observed the X-ray source in 4U 1822-371 with the Chandra High Energy Transmission Grating Spectrometer for almost nine binary orbits. X-ray eclipse times provide an update of the orbital ephemeris. We find that our result follows the quadratic function implied by previous observations; however, it suggests a flatter trend. From the orbital line dynamics, we confirm the previous suggestion that recombination emission is located at the impact bulge of the accretion stream. Our observations show that the recombining plasma is confined to this region, and prove that it has to be a very thin layer on top of the accretion disk. Fe XXVI emission is detected at all phases and likely originates from the hot central corona which has optical depth <<1. The implied ionization parameters from both regions strongly suggest that the illuminating source is obscured with respect to the observer and is orders of magnitude brighter than what is actually observed. This is independently confirmed by the best fit of a flat power law with a high-energy cutoff and partial covering absorption with a covering fraction of about 50%. We discuss the implications of our findings with respect to the photoionized line emission and the spectral continuum on basic properties of the X-ray source.

Implications of emission inventory choice for modeling fire-related pollution in the U.S.

Science.gov (United States)

Koplitz, S. N.; Nolte, C. G.; Pouliot, G.

2017-12-01

Wildland fires are a major source of fine particulate matter (PM2.5), one of the most harmful ambient pollutants for human health globally. Within the U.S., wildland fires can account for more than 30% of total annual PM2.5 emissions. In order to represent the influence of fire emissions on atmospheric composition, regional and global chemical transport models (CTMs) rely on fire emission inventories developed from estimates of burned area (i.e. fire size and location). Burned area can be estimated using a range of top-down and bottom-up approaches, including satellite-derived remote sensing and on-the-ground incident reports. While burned area estimates agree with each other reasonably well in the western U.S. (within 20-30% for most years during 2002-2014), estimates for the southern U.S. vary by more than a factor of 3. Differences in burned area estimation methods lead to significant variability in the spatial and temporal allocation of emissions across fire emission inventory platforms. In this work, we implement fire emission estimates for 2011 from three different products - the USEPA National Emission Inventory (NEI), the Fire INventory of NCAR (FINN), and the Global Fire Emission Database (GFED4s) - into the Community Multiscale Air Quality (CMAQ) model to quantify and characterize differences in simulated fire-related PM2.5 and ozone concentrations across the contiguous U.S. due solely to the emission inventory used. Preliminary results indicate that the estimated contribution to national annual average PM2.5 from wildland fire in 2011 is highest using GFED4s emissions (1.0 µg m-3) followed by NEI (0.7 µg m-3) and FINN (0.3 µg m-3), with comparisons varying significantly by region and season. Understanding the sensitivity of modeling fire-related PM2.5 and ozone in the U.S. to fire emission inventory choice will inform future efforts to assess the implications of present and future fire activity for air quality and human health at national and global

DotU and VgrG, core components of type VI secretion systems, are essential for Francisella LVS pathogenicity.

Directory of Open Access Journals (Sweden)

Jeanette E Bröms

Full Text Available The Gram-negative bacterium Francisella tularensis causes tularemia, a disease which requires bacterial escape from phagosomes of infected macrophages. Once in the cytosol, the bacterium rapidly multiplies, inhibits activation of the inflammasome and ultimately causes death of the host cell. Of importance for these processes is a 33-kb gene cluster, the Francisella pathogenicity island (FPI, which is believed to encode a type VI secretion system (T6SS. In this study, we analyzed the role of the FPI-encoded proteins VgrG and DotU, which are conserved components of type VI secretion (T6S clusters. We demonstrate that in F. tularensis LVS, VgrG was shown to form multimers, consistent with its suggested role as a trimeric membrane puncturing device in T6SSs, while the inner membrane protein DotU was shown to stabilize PdpB/IcmF, another T6SS core component. Upon infection of J774 cells, both ΔvgrG and ΔdotU mutants did not escape from phagosomes, and subsequently, did not multiply or cause cytopathogenicity. They also showed impaired activation of the inflammasome and marked attenuation in the mouse model. Moreover, all of the DotU-dependent functions investigated here required the presence of three residues that are essentially conserved among all DotU homologues. Thus, in agreement with a core function in T6S clusters, VgrG and DotU play key roles for modulation of the intracellular host response as well as for the virulence of F. tularensis.

Principal component analysis of 1/fα noise

International Nuclear Information System (INIS)

Gao, J.B.; Cao Yinhe; Lee, J.-M.

2003-01-01

Principal component analysis (PCA) is a popular data analysis method. One of the motivations for using PCA in practice is to reduce the dimension of the original data by projecting the raw data onto a few dominant eigenvectors with large variance (energy). Due to the ubiquity of 1/f α noise in science and engineering, in this Letter we study the prototypical stochastic model for 1/f α processes--the fractional Brownian motion (fBm) processes using PCA, and find that the eigenvalues from PCA of fBm processes follow a power-law, with the exponent being the key parameter defining the fBm processes. We also study random-walk-type processes constructed from DNA sequences, and find that the eigenvalue spectrum from PCA of those random-walk processes also follow power-law relations, with the exponent characterizing the correlation structures of the DNA sequence. In fact, it is observed that PCA can automatically remove linear trends induced by patchiness in the DNA sequence, hence, PCA has a similar capability to the detrended fluctuation analysis. Implications of the power-law distributed eigenvalue spectrum are discussed

Airborne measurements of western U.S. wildfire emissions: Comparison with prescribed burning and air quality implications: Western U.S. Wildfire Emissions

Energy Technology Data Exchange (ETDEWEB)

Liu, Xiaoxi [School of Earth and Atmospheric Sciences, Georgia Institute of Technology, Atlanta Georgia USA; Now at Cooperative Institute for Research in Environmental Sciences, University of Colorado Boulder, Boulder Colorado USA; Now at Department of Chemistry, University of Colorado Boulder, Boulder Colorado USA; Huey, L. Gregory [School of Earth and Atmospheric Sciences, Georgia Institute of Technology, Atlanta Georgia USA; Yokelson, Robert J. [Department of Chemistry, University of Montana, Missoula Montana USA; Selimovic, Vanessa [Department of Chemistry, University of Montana, Missoula Montana USA; Simpson, Isobel J. [Department of Chemistry, University of California, Irvine California USA; Müller, Markus [Department of Chemistry, University of Montana, Missoula Montana USA; Institute for Ion Physics and Applied Physics, University of Innsbruck, Innsbruck Austria; Jimenez, Jose L. [Cooperative Institute for Research in Environmental Sciences, University of Colorado Boulder, Boulder Colorado USA; Department of Chemistry, University of Colorado Boulder, Boulder Colorado USA; Campuzano-Jost, Pedro [Cooperative Institute for Research in Environmental Sciences, University of Colorado Boulder, Boulder Colorado USA; Department of Chemistry, University of Colorado Boulder, Boulder Colorado USA; Beyersdorf, Andreas J. [NASA Langley Research Center, Hampton Virginia USA; Now at Department of Chemistry, California State University, San Bernardino California USA; Blake, Donald R. [Department of Chemistry, University of California, Irvine California USA; Butterfield, Zachary [Earth and Environmental Sciences Division, Los Alamos National Laboratory, Los Alamos New Mexico USA; Now at Department of Atmospheric, Oceanic, and Space Sciences, University of Michigan, Ann Arbor Michigan USA; Choi, Yonghoon [NASA Langley Research Center, Hampton Virginia USA; Science Systems and Applications, Inc., Hampton Virginia USA; Crounse, John D. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena California USA; Day, Douglas A. [Cooperative Institute for Research in Environmental Sciences, University of Colorado Boulder, Boulder Colorado USA; Department of Chemistry, University of Colorado Boulder, Boulder Colorado USA; Diskin, Glenn S. [NASA Langley Research Center, Hampton Virginia USA; Dubey, Manvendra K. [Earth and Environmental Sciences Division, Los Alamos National Laboratory, Los Alamos New Mexico USA; Fortner, Edward [Center for Aerosol and Cloud Chemistry, Aerodyne Research Inc., Billerica Massachusetts USA; Hanisco, Thomas F. [Atmospheric Chemistry and Dynamics Laboratory, NASA Goddard Space Flight Center, Greenbelt Maryland USA; Hu, Weiwei [Cooperative Institute for Research in Environmental Sciences, University of Colorado Boulder, Boulder Colorado USA; Department of Chemistry, University of Colorado Boulder, Boulder Colorado USA; King, Laura E. [School of Earth and Atmospheric Sciences, Georgia Institute of Technology, Atlanta Georgia USA; Kleinman, Lawrence [Environmental and Climate Sciences Department, Brookhaven National Laboratory, Upton New York USA; Meinardi, Simone [Department of Chemistry, University of California, Irvine California USA; Mikoviny, Tomas [Department of Chemistry, University of Oslo, Oslo Norway; Onasch, Timothy B. [Center for Aerosol and Cloud Chemistry, Aerodyne Research Inc., Billerica Massachusetts USA; Palm, Brett B. [Cooperative Institute for Research in Environmental Sciences, University of Colorado Boulder, Boulder Colorado USA; Department of Chemistry, University of Colorado Boulder, Boulder Colorado USA; Peischl, Jeff [Cooperative Institute for Research in Environmental Sciences, University of Colorado Boulder, Boulder Colorado USA; Earth System Research Laboratory, National Oceanic and Atmospheric Administration, Boulder Colorado USA; Pollack, Ilana B. [Cooperative Institute for Research in Environmental Sciences, University of Colorado Boulder, Boulder Colorado USA; Earth System Research Laboratory, National Oceanic and Atmospheric Administration, Boulder Colorado USA; Now at Department of Atmospheric Science, Colorado State University, Fort Collins Colorado USA; Ryerson, Thomas B. [Earth System Research Laboratory, National Oceanic and Atmospheric Administration, Boulder Colorado USA; Sachse, Glen W. [NASA Langley Research Center, Hampton Virginia USA; Sedlacek, Arthur J. [Environmental and Climate Sciences Department, Brookhaven National Laboratory, Upton New York USA; Shilling, John E. [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland Washington USA; Springston, Stephen [Environmental and Climate Sciences Department, Brookhaven National Laboratory, Upton New York USA; St. Clair, Jason M. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena California USA; Now at Atmospheric Chemistry and Dynamics Laboratory, NASA Goddard Space Flight Center, Greenbelt Maryland USA; Now at Joint Center for Earth Systems Technology, University of Maryland, Baltimore County, Baltimore Maryland USA; Tanner, David J. [School of Earth and Atmospheric Sciences, Georgia Institute of Technology, Atlanta Georgia USA; Teng, Alexander P. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena California USA; Wennberg, Paul O. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena California USA; Division of Engineering and Applied Science, California Institute of Technology, Pasadena California USA; Wisthaler, Armin [Institute for Ion Physics and Applied Physics, University of Innsbruck, Innsbruck Austria; Department of Chemistry, University of Oslo, Oslo Norway; Wolfe, Glenn M. [Atmospheric Chemistry and Dynamics Laboratory, NASA Goddard Space Flight Center, Greenbelt Maryland USA; Joint Center for Earth Systems Technology, University of Maryland, Baltimore County, Baltimore Maryland USA

2017-06-14

Wildfires emit significant amounts of pollutants that degrade air quality. Plumes from three wildfires in the western U.S. were measured from aircraft during the Studies of Emissions and Atmospheric Composition, Clouds, and Climate Coupling by Regional Surveys (SEAC4RS) and the Biomass Burning Observation Project (BBOP), both in summer 2013. This study reports an extensive set of emission factors (EFs) for over 80 gases and 5 components of submicron particulate matter (PM1) from these temperate wildfires. These include rarely, or never before, measured oxygenated volatile organic compounds and multifunctional organic nitrates. The observed EFs are compared with previous measurements of temperate wildfires, boreal forest fires, and temperate prescribed fires. The wildfires emitted high amounts of PM1 (with organic aerosol (OA) dominating the mass) with an average EF that is more than two times the EFs for prescribed fires. The measured EFs were used to estimate the annual wildfire emissions of carbon monoxide, nitrogen oxides, total nonmethane organic compounds, and PM1 from 11 western U.S. states. The estimated gas emissions are generally comparable with the 2011 National Emissions Inventory (NEI). However, our PM1 emission estimate (1530 ± 570 Gg yr-1) is over three times that of the NEI PM2.5 estimate and is also higher than the PM2.5 emitted from all other sources in these states in the NEI. This study indicates that the source of OA from BB in the western states is significantly underestimated. In addition, our results indicate prescribed burning may be an effective method to reduce fine particle emissions.

Trending analysis of incidents involving primary water stress corrosion cracking on Alloy 600 components at U.S. PWRs

International Nuclear Information System (INIS)

Takahara, Shogo; Watanabe, Norio

2006-01-01

Primary Water Stress Corrosion Cracking (PWSCC) which occurs on Nickel based alloy (Alloy 600) is a worldwide concern since early 1980's. Recently several significant degradations that originate from PWSCC in the reactor coolant pressure boundary (RCPB) components have been observed at U.S. PWR plants (e.g. Oconee-3, Davis Besse). The United States Nuclear Regulation Commission (NRC) has issued generic communications to address this problem and, in response to the Davis Besse event in 2002, gave the inspection order EA-03-009 for the PWR licensees to implement the inspection of the reactor vessel heads depending upon the effective degradation years. As well, in Japan, PWSCC is considered one of the safety issues, in particular, for aged nuclear power plants and actually, some plants have experienced PWSCC on RCPB components. In the present study, we analyzed the U.S. experience with Alloy 600 degradation by reviewing the licensee event reports from 1999 to 2005 and examined the trend of them mainly focusing on affected components, characteristics of cracking and inspection approaches for detecting the PWSCC. This study indicates that PWSCC is found to be occurred on the RCPB components exposed to the environment with high temperature such as the reactor vessel head, and has the tendency to happen for specific manufactures and material according to the RCPB components. As well, it is shown that for several components, the non-destructive examination is generally needed to detect and/or confirm the PWSCC after the visual inspection and different repair techniques are applied depending on the components affected. (author)

Dicty_cDB: Contig-U13254-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13254-1 no gap 575 5 203798 203233 MINUS 1 1 U13254 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U13254-1 Contig ID Contig-U13254-1 Contig update 2002.12.18 Contig sequence >Contig-U13254-1 (Contig...-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d AAATAATTTATTTAATTTTAAAATTAATAGATAAAAAGATGGAAATGATA A...CATTTTAACATTATTGGATAAT GTCAATGATTGGCCAANNNNNNNNN Gap no gap Contig length 575 Chromosome number (1..6, M) 5 ...2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13254-1 (Contig-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d

Dicty_cDB: Contig-U13891-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13891-1 no gap 1355 6 799802 798446 MINUS 4 4 U13891 0 0 0 0 1 1 1 0 0 0 1 0 0 0 Show Contig...-U13891-1 Contig ID Contig-U13891-1 Contig update 2002.12.18 Contig sequence >Contig-U13891-1 (Contig...-U13891-1Q) /CSM_Contig/Contig-U13891-1Q.Seq.d TTTTAAAATATTTCAAAATTAGCGAGCACGCATTCGCATATAAATATATT ...ACAAATAAAAAAAAAAAATAAAAAAAATA ATTTA Gap no gap Contig length 1355 Chromosome numb...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13891-1 (Contig-U13891-1Q) /CSM_Contig/Contig-U138

Dicty_cDB: Contig-U10823-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10823-1 gap included 1750 1 3559501 3561234 PLUS 85 124 U10823 0 5 0 30 1 0... 0 20 0 29 0 0 0 0 Show Contig-U10823-1 Contig ID Contig-U10823-1 Contig update 2002.12.18 Contig sequence >Contig-U10823-1 (Contig...-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d ACTGTTGGCCTACTGGTATTTTTGGTAGTGTGTTAAAA...CAACAAATAAAATTAAAATTA GTTATATTTTTTTTAAATTAAAAAAAAAAATAAAAAAAATAAATTATTTA TTAAATTTTT Gap gap included Contig ...4. 6.10 Homology vs CSM-cDNA Query= Contig-U10823-1 (Contig-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d (1

Dicty_cDB: Contig-U09694-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09694-1 gap included 1129 1 4027135 4026071 MINUS 3 4 U09694 2 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09694-1 Contig ID Contig-U09694-1 Contig update 2002. 9.13 Contig sequence >Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U0969...TTAAATTAAAACAACAACAATTTCATAATATAAATAAT Gap gap included Contig length 1129 Chromosome number (1..6, M) 1 Chr...iklkqqqfklkqqqfhninn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig...E Sequences producing significant alignments: (bits) Value Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig

Dicty_cDB: Contig-U12086-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

Dicty_cDB: Contig-U06829-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06829-1 no gap 449 5 4394444 4394893 PLUS 1 1 U06829 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06829-1 Contig ID Contig-U06829-1 Contig update 2001. 8.30 Contig sequence >Contig-U06829-1 (Contig...-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d GTAAAAGAATGTAATGAAAATGAAAAAATTAATTTTATAATAAAATTATT ...ATGATTTAGAATTGGTACAATTAGTTTA Gap no gap Contig length 449 Chromosome number (1..6, M) 5 Chromosome length 50...04. 6.10 Homology vs CSM-cDNA Query= Contig-U06829-1 (Contig-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d (

Dicty_cDB: Contig-U13065-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13065-1 no gap 718 1 3561021 3561729 PLUS 1 1 U13065 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U13065-1 Contig ID Contig-U13065-1 Contig update 2002.12.18 Contig sequence >Contig-U13065-1 (Contig...-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d NNNNNNNNNNCAATCAAAGCAATCAATGGTAAATTAACTTTGTTACCATT ...TGATTCAACTCTCTCTG TTTCAAATTTACAACTTGCTTTAGATGAATCCTTTGAAGTTGATTTTGTA TTATATTAAAAATTATCA Gap no gap Contig...kny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig

Dicty_cDB: Contig-U15541-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15541-1 gap included 2750 - - - - 634 1127 U15541 1 129 1 375 19 0 2 32 4 69 1 0 1 0 Show Contig...-U15541-1 Contig ID Contig-U15541-1 Contig update 2004. 6.11 Contig sequence >Contig-U15541-1 (Contig...-U15541-1Q) /CSM_Contig/Contig-U15541-1Q.Seq.d ATAATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTAG...AAAAAT AAAAATAAAAATAAATAAATAATCATTTCATATTAATATTTTTTTTTATT TTTAAAAAAA Gap gap included Contig...ffyf*k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15541-1 (Contig-U15541-1Q) /CSM_Contig/Contig

Effective internalization of U251-MG-secreted exosomes into cancer cells and characterization of their lipid components.

Science.gov (United States)

Toda, Yuki; Takata, Kazuyuki; Nakagawa, Yuko; Kawakami, Hikaru; Fujioka, Shusuke; Kobayashi, Kazuya; Hattori, Yasunao; Kitamura, Yoshihisa; Akaji, Kenichi; Ashihara, Eishi

2015-01-16

Exosomes, the natural vehicles of various biological molecules, have been examined in several research fields including drug delivery. Although understanding of the biological functions of exosomes has increased, how exosomes are transported between cells remains unclear. We hypothesized that cell tropism is important for effective exosomal intercellular communication and that parental cells regulate exosome movement by modulating constituent exosomal molecules. Herein, we demonstrated the strong translocation of glioblastoma-derived exosomes (U251exo) into their parental (U251) cells, breast cancer (MDA-MB-231) cells, and fibrosarcoma (HT-1080). Furthermore, disruption of proteins of U251exo by enzymatic treatment did not affect their uptake. Therefore, we focused on lipid molecules of U251exo with the expectation that they are crucial for effective incorporation of U251exo by cancer cells. Phosphatidylethanolamine was identified as a unique lipid component of U251-MG cell-derived extracellular vesicles. From these results, valuable insight is provided into the targeting of U251exo to cancer cells, which will help to develop a cancer-targeted drug delivery system. Copyright © 2014 Elsevier Inc. All rights reserved.

Dicty_cDB: Contig-U16093-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16093-1 gap included 1020 2 4899973 4899063 MINUS 29 31 U16093 7 0 0 0 0 2 ...18 0 0 0 0 0 2 0 Show Contig-U16093-1 Contig ID Contig-U16093-1 Contig update 2004. 6.11 Contig sequence >Contig-U16093-1 (Contig...-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d TTTTTTTTTTTTTTTTTAATTTTTTTTTTTCATAAAACTT...AAAATTAAATT Gap gap included Contig length 1020 Chromosome number (1..6, M) 2 Chr...pdate 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q

Dicty_cDB: Contig-U12545-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

Dicty_cDB: Contig-U09615-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1

Dicty_cDB: Contig-U03367-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U03367-1 no gap 323 - - - - 2 1 U03367 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig-U03367-1 Contig... ID Contig-U03367-1 Contig update 2001. 8.29 Contig sequence >Contig-U03367-1 (Contig-U03367-1Q) /CSM_Contig/Contig...TTGCGGGTTGGCAGGACTGTNGGNAGGCATGGNCATCGGTATNNTTGGAG ATGCTNGTGTGAGGGCGAATGCT Gap no gap Contig length 323 Chro...HLXXGLXCGLAGLXXGMXIGXXGDAXVRANA own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U03367-1 (Contig...-U03367-1Q) /CSM_Contig/Contig-U03367-1Q.Seq.d (323 letters) Database: CSM 6905 sequ

Dicty_cDB: Contig-U16086-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16086-1 gap included 1018 - - - - 3 4 U16086 0 0 0 0 0 1 1 0 0 0 1 0 0 0 Show Contig-U16086-1 Contig... ID Contig-U16086-1 Contig update 2004. 6.11 Contig sequence >Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig.../Contig-U16086-1Q.Seq.d AATTTGATGAAGTAGTAGTAGAGGTAAAACATGTATCAAAACATTATAAG ATTGCAGG...ACTTGGATATAAATGAAG GTAGCTCATCAAATTTTTCAAATAATGATAATTTTAAATCGGTAGATCAA ATTACCAATGACCTTAGCCGTATTTTAT Gap gap included Contig...KSVDQI TNDLSRIL own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U13737-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13737-1 no gap 672 6 1762420 1761754 MINUS 1 1 U13737 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13737-1 Contig ID Contig-U13737-1 Contig update 2002.12.18 Contig sequence >Contig-U13737-1 (Contig...-U13737-1Q) /CSM_Contig/Contig-U13737-1Q.Seq.d NNNNNNNNNNAAAATTAGAAAATGGTACAATTGTTTTTAGAGATATTTCA...AGAATAGAAGGAAAATAT AGATCAATGGGGTGGCACAACA Gap no gap Contig length 672 Chromosome...gwhn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13737-1 (Contig-U13737-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U06307-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06307-1 no gap 637 6 29174 29801 PLUS 4 5 U06307 4 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06307-1 Contig ID Contig-U06307-1 Contig update 2002. 9.13 Contig sequence >Contig-U06307-1 (Contig...-U06307-1Q) /CSM_Contig/Contig-U06307-1Q.Seq.d CCCGCGTCCGAATGCCTCGTATTTTACACACTATGCTCCGTGTGGGTAAT TTAG...ATAGTATTTTTATTTTATT CTTTTTCTTTTAAAAATTTTTTATATTGTCAACAATATAATCAAATAAAT GTATTTAATTATCGGGTATTAAAAAAAAAAAAAAAAA Gap no gap Contig...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06307-1 (Contig-U06307-1Q) /CSM_Contig/Contig-U063

Implications of U.S. electricity deregulation

International Nuclear Information System (INIS)

Gottfried, D.A.

1997-01-01

This article is a concise summary of the potential impacts of electric utility deregulation, including the resolution of stranded costs, impact on electricity rates, reformation of utilities, and reshuffling of the nation's fuel portfolio. The national and state implications of the deregulation of the electricity industry are monumental and overwhelming. The implications occur on many fronts, including monetary, quality, reliability, and environmental issues. Many significant changes will occur as a result--some will be positive and others may be more disturbing

Dicty_cDB: Contig-U15058-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15058-1 no gap 1987 4 4423139 4424727 PLUS 2 4 U15058 0 0 0 0 0 0 0 0 1 0 1 0 0 0 Show Contig...-U15058-1 Contig ID Contig-U15058-1 Contig update 2004. 6.11 Contig sequence >Contig-U15058-1 (Contig...-U15058-1Q) /CSM_Contig/Contig-U15058-1Q.Seq.d AAAAAAGGTTACTCACAAAGTTAAAGAAATCAATGAAAGATTTACCACCC...ACTCAAGGGGGTAGGAGAATAAAATCAACCGATTATCCAGGCNTTAAG CGACCTTTTTCCCAAAAAAAAAAGATGTTCAGAAAAT Gap no gap Contig len...srx*atffpkkkdvq k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15058-1 (Contig-U15058-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U09640-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09640-1 gap included 1368 2 219988 218635 MINUS 4 5 U09640 0 0 2 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U09640-1 Contig ID Contig-U09640-1 Contig update 2002. 9.13 Contig sequence >Contig-U09640-1 (Contig...-U09640-1Q) /CSM_Contig/Contig-U09640-1Q.Seq.d ACTGTTGGCCTACTGGNAAAAAATAGTGTAATAATAACCAACAAT...AACAACAACAACAAAAACAAAAACAAATTTTAATT AAATAAAATAATAATATAAAATATAATA Gap gap included Contig...ate 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U14745-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14745-1 no gap 1780 6 3063854 3065579 PLUS 2 4 U14745 1 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14745-1 Contig ID Contig-U14745-1 Contig update 2002.12.18 Contig sequence >Contig-U14745-1 (Contig...-U14745-1Q) /CSM_Contig/Contig-U14745-1Q.Seq.d GCGTCCGGACAATTTCAATAAAACAAATTTAAAAATAAATAATTTTTAAT...AATAAAATA ATTTAAATAAAAAAATATTTATTTTATTTTAAGATTAACAAAATAAAATA ATTTAAATAAAAAAATATTTATTTTAAAGA Gap no gap Contig...k*kniyfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14745-1 (Contig-U14745-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U01997-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l

Dicty_cDB: Contig-U06384-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06384-1 no gap 660 5 3008439 3007779 MINUS 2 2 U06384 2 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06384-1 Contig ID Contig-U06384-1 Contig update 2001. 8.30 Contig sequence >Contig-U06384-1 (Contig...-U06384-1Q) /CSM_Contig/Contig-U06384-1Q.Seq.d TGAAAAAATTAGAGACAACAAGTGGATCAGCACGTAAAGTATGGCGTTTA...AAATAAAAATTAATTTCC AAAAATAAAA Gap no gap Contig length 660 Chromosome number (1.....own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06384-1 (Contig-U06384-1Q) /CSM_Contig/Contig-U063

Policy implications of considering pre-commitments in U.S. aggregate energy demand system

International Nuclear Information System (INIS)

Rowland, Christopher S.; Mjelde, James W.; Dharmasena, Senarath

2017-01-01

Linear approximations of the Generalized Almost Ideal Demand System and Almost Ideal Demand System for U.S. energy are compared to contrast the explicit inclusion and exclusion of pre-committed consumption levels. Results indicate that pre-commitment levels, the quantity of a good that is consumed in the short run with little regard for price, helps to better explain energy demand in the U.S. compared to the system that does not explicitly consider pre-commitments. Policy implications are if pre-commitments are a legitimate assumption, larger price changes are necessary to achieve a given policy objective than if there are no pre-commitments. - Highlights: • Pre-commitments are the quantity that is consumed with little regard for price. • Demand systems with pre-commitment levels better explain energy demand. • Elasticities from assuming pre-commitments are more elastic. • Estimated elasticities apply to discretionary and not pre-commitment consumption. • Pre-commitments require larger price changes to achieve a given policy objective.

Dicty_cDB: Contig-U06822-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06822-1 no gap 468 3 438742 439211 PLUS 1 1 U06822 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06822-1 Contig ID Contig-U06822-1 Contig update 2001. 8.30 Contig sequence >Contig-U06822-1 (Contig...-U06822-1Q) /CSM_Contig/Contig-U06822-1Q.Seq.d ATATTATTCTATTCACTCGTAATAATACATATAAATTGATATCAATCAGA AA...TGCTATTAAGACTTTGGAGCAAAAAAC TAACAAATCAATTCAAAA Gap no gap Contig length 468 Chromosome number (1..6, M) 3 Ch...*mmlklkeikllvllrlwskkltnqfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06822-1 (Contig-U06822-1Q) /CSM_Contig/Contig

Predictions for the neutrino parameters in the minimal gauged U(1){sub L{sub μ-L{sub τ}}} model

Energy Technology Data Exchange (ETDEWEB)

Asai, Kento; Nagata, Natsumi [University of Tokyo, Department of Physics, Bunkyo-ku, Tokyo (Japan); Hamaguchi, Koichi [University of Tokyo, Department of Physics, Bunkyo-ku, Tokyo (Japan); University of Tokyo, Kavli Institute for the Physics and Mathematics of the Universe (Kavli IPMU), Kashiwa (Japan)

2017-11-15

We study the structure of the neutrino-mass matrix in the minimal gauged U(1){sub L{sub μ-L{sub τ}}} model, where three right-handed neutrinos are added to the Standard Model in order to obtain non-zero masses for the active neutrinos. Because of the U(1){sub L{sub μ-L{sub τ}}} gauge symmetry, the structure of both Dirac and Majorana mass terms of neutrinos is tightly restricted. In particular, the inverse of the neutrino-mass matrix has zeros in the (μ,μ) and (τ,τ) components, namely, this model offers a symmetric realization of the so-called two-zero-minor structure in the neutrino-mass matrix. Due to these constraints, all the CP phases - the Dirac CP phase δ and the Majorana CP phases α{sub 2} and α{sub 3} - as well as the mass eigenvalues of the light neutrinos m{sub i} are uniquely determined as functions of the neutrino mixing angles θ{sub 12}, θ{sub 23}, and θ{sub 13}, and the squared mass differences Δm{sub 21}{sup 2} and Δm{sub 31}{sup 2}. We find that this model predicts the Dirac CP phase δ to be δ ≅ 1.59π-1.70π (1.54π-1.78π), the sum of the neutrino masses to be sum {sub i}m{sub i} ≅ 0.14-0.22 eV (0.12-0.40 eV), and the effective mass for the neutrinoless double-beta decay to be left angle m{sub ββ} right angle ≅ 0.024-0.055 eV (0.017-0.12 eV) at 1σ (2σ) level, which are totally consistent with the current experimental limits. These predictions can soon be tested in future neutrino experiments. Implications for leptogenesis are also discussed. (orig.)

Dicty_cDB: Contig-U08861-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U08861-1 gap included 1295 5 2877914 2879217 PLUS 1 2 U08861 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Contig...-U08861-1 Contig ID Contig-U08861-1 Contig update 2002. 9.13 Contig sequence >Contig-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861...CACATTATAAAGTACCAAATAAGTTATTAATTTTAGAAAATA AATTCCAAAGAATGCAATGTCTAAAGTTAATAAAAAAGAATACTAAAATA TTTTC Gap gap included Contig...k**iwsryccnhcl*kkqkttnef*r i*nql*tkistl*stk*vinfrk*ipknamskvnkkey*nif own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861-1Q.Seq.d (1305 letters) Database: C

Dicty_cDB: Contig-U16008-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16008-1 gap included 1557 5 1711154 1712676 PLUS 5 8 U16008 0 0 0 0 1 1 1 0 1 0 0 0 1 0 Show Contig...-U16008-1 Contig ID Contig-U16008-1 Contig update 2004. 6.11 Contig sequence >Contig-U16008-1 (Contig-U16008-1Q) /CSM_Contig/Contig-U16008... TAAGGTTTATGATTTTTGATTTTAGATTTTATATTTTATTTATTTTAATA AAAAAAAAAAAAAAAAA Gap gap included Contig length 1557 Ch...F LIFVHGSSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLN...SSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLNIGRTFR L

Dicty_cDB: Contig-U15062-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15062-1 no gap 1282 3 4759691 4758480 MINUS 5 6 U15062 0 0 0 0 0 0 1 0 1 1 1 0 1 0 Show Contig...-U15062-1 Contig ID Contig-U15062-1 Contig update 2004. 6.11 Contig sequence >Contig-U15062-1 (Contig...-U15062-1Q) /CSM_Contig/Contig-U15062-1Q.Seq.d CAAATATTTAAATAAATTTAACATTATAAAAACAAAAATTAATAAAGTA...TTTTCAATAGATAATAATAAAAAAAAAAAAAAAAAAA AAAAAAAAATTATTTTAAAAATAAAAAAAAAA Gap no gap Contig length 1282 Chromos...KMSHNHNSNNNKTTTTTTNDSGSAIANGINLEKILADVKECN YNLVNSITATEAIQKEKESLENELSTKGTIGDGKRIKKLQYNISLQTETLMKTLMKLDSL SITG

Dicty_cDB: Contig-U03323-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U03323-1 no gap 533 2 4820223 4820756 PLUS 2 1 U03323 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U03323-1 Contig ID Contig-U03323-1 Contig update 2001. 8.29 Contig sequence >Contig-U03323-1 (Contig...-U03323-1Q) /CSM_Contig/Contig-U03323-1Q.Seq.d ACATGTGACATTACTATTGGTAAATGTCAATGTTTAAAAAATACATGGTC ...TCAATAATGGTGGTGGTGGTGGTTTAGGT GAAACCCCCAATAGTAATAGTAATAGTGGTGAACTAGTTATCCCACCAAA ATCAAATACTACATTAAATGAAGAAACAGGTGG Gap no gap Contig... Link to clone list U03323 List of clone(s) est1= FC-IC0176F ,1,534 Translated Amino Acid sequence TCDITIGKC

Dicty_cDB: Contig-U04432-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04432-1 no gap 600 1 1520578 1521098 PLUS 1 1 U04432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04432-1 Contig ID Contig-U04432-1 Contig update 2001. 8.29 Contig sequence >Contig-U04432-1 (Contig...-U04432-1Q) /CSM_Contig/Contig-U04432-1Q.Seq.d AATTATAATCAAAACAAATTAATAAAAAAAATGATTAATAGTTTTGTCTC ...TCAACAATATGAAATTGCAAGAT TAAATGGTTATGATAATGCCCATAATTTACCAAGAGATATTAGTCAAATA Gap no gap Contig length 600 Chro...ni**fkgrnsnknyfsrymgtiessti*n ckikwl**cp*ftkry*sn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U04432-1 (Contig

Dicty_cDB: Contig-U13894-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13894-1 no gap 1550 2 2081463 2079913 MINUS 30 31 U13894 1 0 15 0 9 1 1 0 1 1 1 0 0 0 Show Contig...-U13894-1 Contig ID Contig-U13894-1 Contig update 2002.12.18 Contig sequence >Contig-U13894-1 (Contig...-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d CTTTTTGATTGTATAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAA...TAAATTAAATAATTAAAAAAAACAAAAAAATTAAGTGAAAATCAAAAAA Gap no gap Contig length 1550 Chromosome number (1..6, M) ...V*kkkkikk*k*sk*fklnn*kkqkn*vkikk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13894-1 (Contig

Dicty_cDB: Contig-U12073-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U10291-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10291-1 no gap 932 4 3203354 3204286 PLUS 2 2 U10291 0 0 1 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10291-1 Contig ID Contig-U10291-1 Contig update 2002. 9.13 Contig sequence >Contig-U10291-1 (Contig...-U10291-1Q) /CSM_Contig/Contig-U10291-1Q.Seq.d GTAAAGGTTTTATGTGTATATTTTTTAATGACCTTTTCGAATTAGTTTCA ...CAAAATAGATTAAATCTTAGTTACTCTCATGC TAATCAATATGTTGAGAGTTTTCCATCACAAATGTTATCAACAATTGCAA AATTCATTAGTTTCTTATTTGGTT...SLMYSL FNYIFDENGIIKSEFQDPTQRKRLSRGLSRRFMTIGILGLFTTPFIFFFLLINFFFEYAE ELKNRPGSLFSREWSPLARWEFRELNELPHYFQNRLNLSY

Dicty_cDB: Contig-U01791-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01791-1 no gap 527 2 7629792 7630319 PLUS 1 1 U01791 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01791-1 Contig ID Contig-U01791-1 Contig update 2001. 8.29 Contig sequence >Contig-U01791-1 (Contig...-U01791-1Q) /CSM_Contig/Contig-U01791-1Q.Seq.d GTTTGATTATAATTTATATGAATGTGAAATTAGACAAGCATTATCAAATA ...TCGTTCCCTTATGATTTAAGAACAACTTT GAATAGTTACAGAAATGGTGAATTTAGTATTTATCAATAAATTTTTTTTT AAAGATTTATAATTAAAATAAAAAAAA Gap no gap Contig...SILWSIESIGSLIVSAQINDDRETMELLHRYQIPQKFLIPLF QILALIDQLEKDLSHQIELDKFTINRDYYFLKSFSNLIEPPLNCLGILKTSRPHFRIFKL VGKNMISQVLETIG

Dicty_cDB: Contig-U12357-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12357-1 gap included 1333 1 2827305 2828232 PLUS 5 6 U12357 0 1 1 2 0 0 1 0 0 0 0 0 0 0 Show Contig...-U12357-1 Contig ID Contig-U12357-1 Contig update 2002.12.18 Contig sequence >Contig-U12357-1 (Contig-U12357-1Q) /CSM_Contig/Contig-U12357...ATAAAATAAAATTTATTAATTTTCCAACT Gap gap included Contig length 1333 Chromosome numb...RYXEKKKXXXXDSXNXXXXXPXX XXLXXXXPXX--- ---QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTL...-QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTLYYSINLSYASLNPISKAIFNRGLNIKRTYYPVSNSNDVIY

Dicty_cDB: Contig-U12049-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12049-1 gap included 2563 4 3071598 3069091 MINUS 9 17 U12049 0 0 0 0 2 0 0... 1 4 1 1 0 0 0 Show Contig-U12049-1 Contig ID Contig-U12049-1 Contig update 2002.12.18 Contig sequence >Contig-U12049-1 (Contig...-U12049-1Q) /CSM_Contig/Contig-U12049-1Q.Seq.d TAATGAAGGTAGTAATAATAATATAGTTGAAGCATCAAAAGA...TATCATTTAAACTGAAAAAAGTC CAAAAGATTTATGCAATGATTGCTGCGAATATGCTGCAACTTGTTCTCAT TAAAAATAAACAAAAAAATAATA Gap gap included Contig...disngqcvyseiidcgsssienss nqesssdidittastlgstiastigstigltstttttttsqttgtpttppqtvseipisl astistspvsdegtiastiatt

Dicty_cDB: Contig-U14772-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14772-1 no gap 665 1 1988279 1987624 MINUS 1 1 U14772 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14772-1 Contig ID Contig-U14772-1 Contig update 2002.12.18 Contig sequence >Contig-U14772-1 (Contig...-U14772-1Q) /CSM_Contig/Contig-U14772-1Q.Seq.d AAAAACAATAACCATCGTTTTTTATTTTTATTTTCAAAATATGGATTTAA...AAATTAATGAAGAAAAAA AAGTAANNNNNNNNN Gap no gap Contig length 665 Chromosome number...DADTTISFLSSQNLSQLSIIKNLVNGKTIG DKKVIVDFYDFKKVIPTPTPIPTPTPPTKTQEESNKKIKLTNEKPKEKKP

Dicty_cDB: Contig-U15005-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15005-1 no gap 2023 1 1509217 1507616 MINUS 2 4 U15005 0 0 0 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U15005-1 Contig ID Contig-U15005-1 Contig update 2004. 6.11 Contig sequence >Contig-U15005-1 (Contig...-U15005-1Q) /CSM_Contig/Contig-U15005-1Q.Seq.d AATTTTCTTTTCTTTTTAAAACTTAAGTACCATATGGCAGAATATACAC...ATAATAACGATATTAA Gap no gap Contig length 2023 Chromosome number (1..6, M) 1 Chro...HMAEYTHYFIQYNLTDIFYEDVNIEKYSCSICYESVYKKEIYQCKEIHWF CKTCWAESLFKKKECMICRCIVKSISELSRNRFIEQDFLNIKVNCPNSFKYIDENKNNNN KIKDLENGCKDIITIG

Dicty_cDB: Contig-U15036-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG

Dicty_cDB: Contig-U16108-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16108-1 gap included 1456 4 1889609 1888449 MINUS 4 6 U16108 0 0 2 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U16108-1 Contig ID Contig-U16108-1 Contig update 2004. 6.11 Contig sequence >Contig-U16108-1 (Contig-U16108-1Q) /CSM_Contig/Contig-U1610...AAAATCA TAAAATCAAAAATTGTATAATTAAAATAAAAATAAAAAAAAAAACAAAAA TAAAAAAAAAAAACAA Gap gap included Contig length 1...DFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIGDNFYTKTGYNEIAETNNIIILYPQALET...---NYVNNDNIKTMFDIQSEHAFITNSFGNNCTYLGPDYINNCNFNAPWDFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIG

Dicty_cDB: Contig-U13974-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13974-1 no gap 1782 1 1265322 1267105 PLUS 29 32 U13974 0 0 0 1 2 0 22 0 4 0 0 0 0 0 Show Contig...-U13974-1 Contig ID Contig-U13974-1 Contig update 2002.12.18 Contig sequence >Contig-U13974-1 (Contig...-U13974-1Q) /CSM_Contig/Contig-U13974-1Q.Seq.d AAGAGTTAAAACAAAAATAAAAAAATAAAATAAAAAAAAAAAATTAA...TAAAACAAATAA ACATTAAAATGATATTTAGGTTTTAAATTTAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig...TTRKIYVYDNQNFFPIDNQGFD VDPAKRIYLNEKKTYHNYHFCMKMNTVFTYKGYEVFNFRGDDDVWVFINNKLVIDLGGLH SPIGTSVDTMTLGLTIG

Dicty_cDB: Contig-U11342-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11342-1 gap included 2051 2 611517 609465 MINUS 4 7 U11342 0 2 1 1 0 0 0 0 0 0 0 0 0 0 Show Contig...-U11342-1 Contig ID Contig-U11342-1 Contig update 2002.12.18 Contig sequence >Contig-U11342-1 (Contig...-U11342-1Q) /CSM_Contig/Contig-U11342-1Q.Seq.d GTCAACATTAACATCATCATCATCATCATCACCATCTAGTAATAA...GAATTTGGTAATTTTAAAATCACTNATTAATATATTAAACAAAATTA TAAAAATAAAA Gap gap included Contig...EFFFIDRKSLLVNFP RGSICAQILKLIGNLYGSNDIIFKINTNNVSFFDGTIGANNSTNNSNSNQPMTPQQVVIK YLNPTARWKRREISNFEYLMTLNTIAGRTYN

Dicty_cDB: Contig-U09412-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09412-1 gap included 873 3 3953072 3953946 PLUS 1 2 U09412 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09412-1 Contig ID Contig-U09412-1 Contig update 2002. 9.13 Contig sequence >Contig-U09412-1 (Contig...-U09412-1Q) /CSM_Contig/Contig-U09412-1Q.Seq.d ATTATCACAACTATTTTATAATAAACCAATTTTAAAGATTAAAGT...TGGTTCAATAAAAGAAATTAAATATAATTATCAATAAT AATAATAAATTAATTAATAAATTTAAATCAAAA Gap gap included Contig length 873 ...DCQCGFVSVVENNNNNNNNSDNENNENNENNENNE NNEDLEDFIPRKLLKKSSSTLQSRTYLVIYLGRRGILEIWGLKHRSREYFKTIG

Dicty_cDB: Contig-U11404-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11404-1 gap included 1618 6 1729583 1727965 MINUS 11 19 U11404 0 6 1 1 0 2 ...0 1 0 0 0 0 0 0 Show Contig-U11404-1 Contig ID Contig-U11404-1 Contig update 2002.12.18 Contig sequence >Contig-U11404-1 (Contig...-U11404-1Q) /CSM_Contig/Contig-U11404-1Q.Seq.d ATTTTAAGAGTTTTAATTTTAATAACTATACTTTTAATAAA...TTTTTCTTTTGAACCAGAAAAAAAAA Gap gap included Contig length 1618 Chromosome number ...AGARMLASLATDKLSNVIYLDVSENDFGDEGVSVICDGFVGNSTIKKLILNGNFKQ SK--- ---YEKITIGLDSVFKDLILEESQAQNEASGATPIPDSPVPTRSP

Dicty_cDB: Contig-U10406-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10406-1 no gap 661 4 1621526 1620875 MINUS 1 1 U10406 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U10406-1 Contig ID Contig-U10406-1 Contig update 2002. 9.13 Contig sequence >Contig-U10406-1 (Contig...-U10406-1Q) /CSM_Contig/Contig-U10406-1Q.Seq.d NNNNNNNNNNATAAGTAAAAGAGTTATTGGTCCAAGATTAGATGATGACA...TACAAATAAGTAAAGTTG ATAAAGAACAT Gap no gap Contig length 661 Chromosome number (1....cid sequence XXXISKRVIGPRLDDDNNNNDNDKFNNNNKKAIGPSRIGPTIGPSIGPSRYNTNNNDSNH NSNNDDDDDSSEEDEEDTKSEWERVRNMIENNKN

Dicty_cDB: Contig-U16457-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16457-1 no gap 1065 3 996438 997502 PLUS 6 5 U16457 0 0 1 0 1 0 2 0 0 0 0 0 1 1 Show Contig...-U16457-1 Contig ID Contig-U16457-1 Contig update 2004. 6.11 Contig sequence >Contig-U16457-1 (Contig...-U16457-1Q) /CSM_Contig/Contig-U16457-1Q.Seq.d ACAATTGGTGTTGCTGCTCTATTCGGTCTTCCAGCTATGGCACGTTCCGC A...TTTAACAAGATTGGAAGAC CAAAAAGAAAAAAAA Gap no gap Contig length 1065 Chromosome numb... Translated Amino Acid sequence TIGVAALFGLPAMARSAAMSLVFLIPFMWIVFSVHYPINSVVADICMSYNNNTGSIEQQL ANYTNPIVSEIFGTC

Dicty_cDB: Contig-U14400-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14400-1 no gap 1939 4 4053811 4055750 PLUS 5 7 U14400 0 0 2 0 0 1 0 0 1 1 0 0 0 0 Show Contig...-U14400-1 Contig ID Contig-U14400-1 Contig update 2002.12.18 Contig sequence >Contig-U14400-1 (Contig...-U14400-1Q) /CSM_Contig/Contig-U14400-1Q.Seq.d CATTACCAATAAATTTATCTGCTTCAACACCTATACCAATGACATCACCA...AGGTTTATAAAATATATTGAATCAATTTTTGATTAAA Gap no gap Contig length 1939 Chromosome number (1..6, M) 4 Chromosome...HQQQQSKTVTSSTTSTETTTTVESSTTSTTITTSTSTPIPTTITTTPTTPI NSDNSWTFTSFSPKVFKEIRRYYGVDEEFLKSQENSSGIVKFLEVQTIGRSGSFFY

Dicty_cDB: Contig-U14236-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14236-1 no gap 660 2 5626866 5627517 PLUS 1 1 U14236 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U14236-1 Contig ID Contig-U14236-1 Contig update 2002.12.18 Contig sequence >Contig-U14236-1 (Contig...-U14236-1Q) /CSM_Contig/Contig-U14236-1Q.Seq.d NNNNNNNNNNGAAAATCAAAAATTAAAAAGTAACATTACTCTATTATATG ...CAATCACTCCAATTAAA CCATAGTTTT Gap no gap Contig length 660 Chromosome number (1..6...MGSEKSPFNLKQYPSLVKIDDVS QCPKYKCLKRKSLNEWTIGLNIPAFCRESRYDCSLCYKYIECSFSDEF*tnlsalfv

Dicty_cDB: Contig-U15573-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15573-1 gap included 2005 4 5020093 5018210 MINUS 13 13 U15573 0 5 0 1 1 0 ...0 0 0 1 1 0 2 2 Show Contig-U15573-1 Contig ID Contig-U15573-1 Contig update 2004. 6.11 Contig sequence >Contig-U15573-1 (Contig...-U15573-1Q) /CSM_Contig/Contig-U15573-1Q.Seq.d AGTCTTGAGCTTTTATTGGGTCAACCATTGGGTGAATATAC... AGCNTTAACNGGNAA Gap gap included Contig length 2005 Chromosome number (1..6, M) ...xxlfrsnxslxxxxxxsxnxx Frame C: s*afigstig*iyiylkrfhlfl*skryyqskw*fkifpilkqttiiyen

Dicty_cDB: Contig-U16467-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16467-1 no gap 1261 2 7818565 7817305 MINUS 17 18 U16467 0 0 5 0 1 2 1 0 6 0 0 1 1 0 Show Contig...-U16467-1 Contig ID Contig-U16467-1 Contig update 2004. 6.11 Contig sequence >Contig-U16467-1 (Contig...-U16467-1Q) /CSM_Contig/Contig-U16467-1Q.Seq.d CAACAATTAACATTACTTAAATATAATATTATTATATTTTTTTTTTT...TTCAAATAAATAATTGTTTAGAAATTTCTAGAAAAAAAA AAAAAAAAAAA Gap no gap Contig length 1261 Chromosome number (1..6, M...LK833Z ,1005,1249 Translated Amino Acid sequence qqltllkyniiiffffyllplhlyhy**LKKKTLTIIKYFFQKMNKIALLFTIFFALFAI SFACDEFNPNTSTIG

General U(1)xU(1) F-theory Compactifications and Beyond: Geometry of unHiggsings and novel Matter Structure

CERN Document Server

Cvetic, Mirjam; Piragua, Hernan; Taylor, Washington

2015-01-01

We construct the general form of an F-theory compactification with two U(1) factors based on a general elliptically fibered Calabi-Yau manifold with Mordell-Weil group of rank two. This construction produces broad classes of models with diverse matter spectra, including many that are not realized in earlier F-theory constructions with U(1)xU(1) gauge symmetry. Generic U(1)xU(1) models can be related to a Higgsed non-Abelian model with gauge group SU(2)xSU(2)xSU(3), SU(2)^3xSU(3), or a subgroup thereof. The nonlocal horizontal divisors of the Mordell-Weil group are replaced with local vertical divisors associated with the Cartan generators of non-Abelian gauge groups from Kodaira singularities. We give a global resolution of codimension two singularities of the Abelian model; we identify the full anomaly free matter content, and match it to the unHiggsed non-Abelian model. The non-Abelian Weierstrass model exhibits a new algebraic description of the singularities in the fibration that results in the first expl...

Dicty_cDB: Contig-U13326-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13326-1 no gap 240 6 1728259 1728019 MINUS 1 1 U13326 0 0 0 0 0 1 0 0 0 0 0 0 0 0 Show Contig...-U13326-1 Contig ID Contig-U13326-1 Contig update 2002.12.18 Contig sequence >Contig-U13326-1 (Contig...-U13326-1Q) /CSM_Contig/Contig-U13326-1Q.Seq.d AATGACTCAACAAATCTTGGAGAGTATGCAAAATACTTTCCAATCTATGG...CCTCGTTAAAGGTGCTGGTGC TGAATTAAGTTCTCGTGCTCATGAGTGTTTCATTAGTGCCTTGGATATTG CCTCTGATTATACCTACGAGAAAATTACCATTGGCTTGGA Gap no gap Contig...FQSMDGPTIKRLATTIQYGSKDVDEQQIHSTLVKGAGAELSSRAHECF ISALDIASDYTYEKITIGL Translated Amino Acid sequence (All Fra

Dicty_cDB: Contig-U13455-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13455-1 no gap 750 2 945431 946181 PLUS 2 2 U13455 0 0 0 0 0 0 1 0 0 1 0 0 0 0 Show Contig...-U13455-1 Contig ID Contig-U13455-1 Contig update 2002.12.18 Contig sequence >Contig-U13455-1 (Contig...-U13455-1Q) /CSM_Contig/Contig-U13455-1Q.Seq.d TAATTCCAACAACATCAACAAATTCAACAACAATTACAAATGCAACAACA TA...CAATAATAATAATAATAACAATAACAATAATAATAA Gap no gap Contig length 750 Chromosome number (1..6, M) 2 Chromosome l...KMLEYIQKNPSATRPSCIQVVQQPSSKVVWKNRRLDTPFKVKVDLKAASAMA GTNLTTASVITIGIVTDHKGKLQIDSVENFTEAFNGQGLAVFQGLKMTKGTWGKE

Dicty_cDB: Contig-U10709-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT

Dicty_cDB: Contig-U09720-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09720-1 gap included 1323 2 5906974 5908260 PLUS 1 2 U09720 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09720-1 Contig ID Contig-U09720-1 Contig update 2002. 9.13 Contig sequence >Contig-U09720-1 (Contig-U09720-1Q) /CSM_Contig/Contig-U09720...ATNATTATTATAAAAATTT Gap gap included Contig length 1323 Chromosome number (1..6, ...QLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLKNQREIIAQSLKIXKKL*linqxll*kf ...AEMFDIDSRNNHAIENDGRLDDA LVCSVGIALAPQSIFQSWKSMSEHKREKYFEQLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLK

Dicty_cDB: Contig-U09379-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09379-1 gap included 899 2 1392012 1392912 PLUS 1 2 U09379 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09379-1 Contig ID Contig-U09379-1 Contig update 2002. 9.13 Contig sequence >Contig-U09379-1 (Contig...-U09379-1Q) /CSM_Contig/Contig-U09379-1Q.Seq.d AAAAATTTTTTAAACTAAAAAATAAAAAAAATAAATAAAAAAAAA...TTTAAAAATAATAATAAAAGTGAATATTATAATATTAT AATCTTTTTGGTATAATTGAAAAAGATCAATAATATATTAAAATTTCCAA AAAAAAAAA Gap gap included Contig...VSVCRAYATETATIENKTQIMGKMSGAQGAGFVLGPGIGFLLNFCNFTIG--- ---INNK******sn*finykl***f*kikqphfknlkiiikvniiil*sfwyn

Dicty_cDB: Contig-U15566-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15566-1 gap included 1830 4 3730704 3729599 MINUS 4 8 U15566 0 0 1 0 1 0 0 0 2 0 0 0 0 0 Show Contig...-U15566-1 Contig ID Contig-U15566-1 Contig update 2004. 6.11 Contig sequence >Contig-U15566-1 (Contig-U15566-1Q) /CSM_Contig/Contig-U1556...CAAGATCCAA TGGAATTTTAATAATAAATAAGAATAATAAAAAAAAAAAA Gap gap included Contig length 1830 Chromosome number (1...ITLTPSEDIEKKLKEI QDENLSNSEIWFAVKSYLEDNNLKEHLYNLVFHYTMPRIDEPVTIGLDHLGNVLVSNR*c tflvvvvvytfgcriephni*qerivlqf*...asilnhirvelsqnqipilkrsfdqillphfekc iieeqqiftnekqrknflsllpisykrqdrkipltpsediekklkeiqdenlsnseiwfa vksylednnlkehlynlvfhytmpridepvtig

Dicty_cDB: Contig-U11141-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11141-1 gap included 2122 2 1113359 1111236 MINUS 6 12 U11141 0 1 0 2 0 0 0... 1 0 2 0 0 0 0 Show Contig-U11141-1 Contig ID Contig-U11141-1 Contig update 2002.12.18 Contig sequence >Contig-U11141-1 (Contig...-U11141-1Q) /CSM_Contig/Contig-U11141-1Q.Seq.d AAAAAACAATCTTAAAACACACACACACTCAACACACTATCA...AAATCAAAATCAAAATCAAA ATAATAATAATTATAATAATAGCTATAATAAT Gap gap included Contig length 2122 Chromosome number ...HNYFGKVSRGIVSLSDYKYYGYLRSVHLIGYE QHEEELIKTIKSLPVGVSTLELSGHLNKIIFKEGSL--- ---DDSTIGAILNSFSSSSSRETFPRSVESLHLNI

Dicty_cDB: Contig-U09432-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09432-1 gap included 993 5 741953 740957 MINUS 1 2 U09432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09432-1 Contig ID Contig-U09432-1 Contig update 2002. 9.13 Contig sequence >Contig-U09432-1 (Contig...-U09432-1Q) /CSM_Contig/Contig-U09432-1Q.Seq.d AGGAAATATTTTAATATTTTATTTTTTTTATTTTTTTTATTTATTA...TTTTGGTGGTAAATATAGATATGAAAATAAA CAAATCCAAATTTTAGTTGAATTAAATTTCACTGATACCACTCAAAAAAA AAA Gap gap included Contig...iy*sni*SVKFGICYNYAKYHLSICNHTIYPGSDNQSLYFKLSSIFDS PTILSGYAVIYNSLDQIITNGTYNLILDEDVPTIG

Dicty_cDB: Contig-U07545-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U07545-1 no gap 439 3 4955441 4955098 MINUS 1 1 U07545 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U07545-1 Contig ID Contig-U07545-1 Contig update 2002. 5. 9 Contig sequence >Contig-U07545-1 (Contig...-U07545-1Q) /CSM_Contig/Contig-U07545-1Q.Seq.d ATATGAAATACTTAATACTTTTAATTTTCCTTTTAATAAATTCAACTTTT...ATGTTTCAGAGTCTGGTTG Gap no gap Contig length 439 Chromosome number (1..6, M) 3 Chromosome length 6358359 Sta...e MKYLILLIFLLINSTFGNIQFSKYISNSGNDNNSCGSFTSPCKTIGYSIQQIKSYEYNQY SIEILLDSGNYYSQNPINLYGLNISISAQNSNDLVQFLVPNINGT

Dicty_cDB: Contig-U15359-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15359-1 no gap 1420 6 1334613 1333192 MINUS 3 3 U15359 0 1 0 0 1 0 0 0 0 1 0 0 0 0 Show Contig...-U15359-1 Contig ID Contig-U15359-1 Contig update 2004. 6.11 Contig sequence >Contig-U15359-1 (Contig...-U15359-1Q) /CSM_Contig/Contig-U15359-1Q.Seq.d TATAGCATCATTTGCAAAGTTTAGTTTAAAGAAAAAAGAGAAAGCGGAA...A AAAAAAACTGGAAAAATTAA Gap no gap Contig length 1420 Chromosome number (1..6, M) 6 Chromosome length 3595308...SSGF DEPSLAVMYVDRALKGASAVQTIGRLSRVSKGKNACYIVDFVNTRREISDAFGQYWRETC LKGETRKTVLELKLNRVLGKLSAIEPLANGRLEESVEYILRD

Dicty_cDB: Contig-U09581-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09581-1 gap included 1235 1 2575525 2576764 PLUS 1 2 U09581 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09581-1 Contig ID Contig-U09581-1 Contig update 2002. 9.13 Contig sequence >Contig-U09581-1 (Contig-U09581-1Q) /CSM_Contig/Contig-U09581...ATCAAAATAAATTTTTGTAACATTAATAATAAATAAN Gap gap included Contig length 1235 Chromosome number (1..6, M) 1 Chro... VFD420Z ,579,1237 Translated Amino Acid sequence KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVS...ames) Frame A: KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVSII CDTIQ

Dicty_cDB: Contig-U04729-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04729-1 no gap 251 5 1037629 1037880 PLUS 1 1 U04729 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04729-1 Contig ID Contig-U04729-1 Contig update 2001. 8.29 Contig sequence >Contig-U04729-1 (Contig...-U04729-1Q) /CSM_Contig/Contig-U04729-1Q.Seq.d TGGATTTATAACAGAGGTTATTGTAGGTGGTAAAACTTTTAGAGGAATCG ...CATTATCTAATGGG T Gap no gap Contig length 251 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...ITEVIVGGKTFRGIVFEDLKSSNQTNNHSQNFSPNQSGTNLNNSNSNIPSSKKIKDKN ISPSSFLPTIGSTTSTSNPLSNG Translated Amino Acid seq

Dicty_cDB: Contig-U06929-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06929-1 no gap 726 5 4252576 4251850 MINUS 1 1 U06929 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06929-1 Contig ID Contig-U06929-1 Contig update 2001. 8.30 Contig sequence >Contig-U06929-1 (Contig...-U06929-1Q) /CSM_Contig/Contig-U06929-1Q.Seq.d AGTTCATTCATTTAGTCGTATGATAGTATCACCATTTATAAATCCAAAAT...TAAATTAAATAAATA Gap no gap Contig length 726 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start p...PSAISNNSNNS NNNDDNRPPILGLPFLFDYKNRITRGSRFFETIHYKIVHVTSATEFGIRRISKLYGTKWQ LEIGLKHQITQSGALQCLFTHTIGQTTIFGLSFGF

Dicty_cDB: Contig-U11195-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN

Dicty_cDB: Contig-U10996-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG

Airborne measurements of western U.S. wildfire emissions: Comparison with prescribed burning and air quality implications: Western U.S. Wildfire Emissions

International Nuclear Information System (INIS)

Liu, Xiaoxi; University of Colorado, Boulder, CO; Huey, L. Gregory; Yokelson, Robert J.; Selimovic, Vanessa

2017-01-01

Wildfires emit significant amounts of pollutants that degrade air quality. Plumes from three wildfires in the western U.S. were measured from aircraft during the Studies of Emissions and Atmospheric Composition, Clouds and Climate Coupling by Regional Surveys (SEAC4RS) and the Biomass Burning Observation Project (BBOP), both in summer 2013. This study reports an extensive set of emission factors (EFs) for over 80 gases and 5 components of submicron particulate matter (PM 1 ) from these temperate wildfires. These include rarely, or never before, measured oxygenated volatile organic compounds and multifunctional organic nitrates. The observed EFs are compared with previous measurements of temperate wildfires, boreal forest fires, and temperate prescribed fires. Furthermore, the wildfires emitted high amounts of PM 1 (with organic aerosol (OA) dominating the mass) with an average EF that is more than 2 times the EFs for prescribed fires. The measured EFs were used to estimate the annual wildfire emissions of carbon monoxide, nitrogen oxides, total nonmethane organic compounds, and PM 1 from 11 western U.S. states. The estimated gas emissions are generally comparable with the 2011 National Emissions Inventory (NEI). However, our PM 1 emission estimate (1530 ± 570 Gg yr -1 ) is over 3 times that of the NEI PM2.5 estimate and is also higher than the PM2.5 emitted from all other sources in these states in the NEI. This study indicates that the source of OA from biomass burning in the western states is significantly underestimated. Additionally, our results indicate that prescribed burning may be an effective method to reduce fine particle emissions.

Implications of SNOMED CT versioning

NARCIS (Netherlands)

Lee, Dennis; Cornet, Ronald; Lau, Francis

2011-01-01

To determine the changes each Systematized Nomenclature of Medicine Clinical Terms (SNOMED CT) release undergoes and the implications of those changes. (1) We reviewed the SNOMED CT Component History documentation and analyzed the Component History table in detail. (2) We outlined a list of semantic

Dicty_cDB: Contig-U15718-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15718-1 gap included 3735 6 2645446 2642451 MINUS 153 276 U15718 0 0 0 118 ...1 0 0 20 3 10 1 0 0 0 Show Contig-U15718-1 Contig ID Contig-U15718-1 Contig update 2004. 6.11 Contig sequence >Contig...-U15718-1 (Contig-U15718-1Q) /CSM_Contig/Contig-U15718-1Q.Seq.d AAATTATTAAATTGTTTATTAATTTTTTTTTTTAC...CCTG Gap gap included Contig length 3735 Chromosome number (1..6, M) 6 Chromosome length 3595308 Start point...ptqtppptqtpt nhsigvnecdccpegqycllifghercfiandggdgipeetigcpgvttgtptstdggtg hytesgtgnphlcdrhhcrsgmechvingipecl

Dicty_cDB: Contig-U04768-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04768-1 no gap 762 6 2607190 2606476 MINUS 3 3 U04768 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U04768-1 Contig ID Contig-U04768-1 Contig update 2001. 8.29 Contig sequence >Contig-U04768-1 (Contig...-U04768-1Q) /CSM_Contig/Contig-U04768-1Q.Seq.d AAAGTCTTATTTGTTTAAAAAAAAAAAAAAAAAATAAAAAACTTTATTCT...AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Gap no gap Contig length 762 Chromosome number (1..6, M...lknf*KMVMMHDEYISPTKLQFGFMIAVAFLG TIGVMGFCQNVFDILLGVISILSIYIGMRGVWKRKKRWLFVFMWLMMGMGFLHLVSFAVV VILHHKNPTKNTVF

Dicty_cDB: Contig-U10837-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI

Dicty_cDB: Contig-U12765-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA

Dicty_cDB: Contig-U09480-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09480-1 gap included 705 5 4277527 4276817 MINUS 1 2 U09480 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09480-1 Contig ID Contig-U09480-1 Contig update 2002. 9.13 Contig sequence >Contig-U09480-1 (Contig-U09480-1Q) /CSM_Contig/Contig-U09480...AAAAAAAAAA Gap gap included Contig length 705 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...**********imaeinienpfhvntkidvntfvnqirgipngsrcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstig...srcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstigydvyiiargrkvtatnfgdggydn wasggh

Dicty_cDB: Contig-U09345-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09345-1 gap included 1216 4 3361857 3360637 MINUS 4 5 U09345 1 0 1 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U09345-1 Contig ID Contig-U09345-1 Contig update 2002. 9.13 Contig sequence >Contig-U09345-1 (Contig-U09345-1Q) /CSM_Contig/Contig-U0934...AATGGTATTTTAAAAATAA Gap gap included Contig length 1216 Chromosome number (1..6, M) 4 Chromosome length 5430...ALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPITQKGYAYTGFEQTSS QSISDFIYSHSKI...LLALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPI

Dicty_cDB: Contig-U10335-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG

Dicty_cDB: Contig-U12399-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL

Dicty_cDB: Contig-U15306-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15306-1 no gap 2452 3 3887051 3889342 PLUS 54 91 U15306 0 0 0 49 4 1 0 0 0 0 0 0 0 0 Show Contig...-U15306-1 Contig ID Contig-U15306-1 Contig update 2004. 6.11 Contig sequence >Contig-U15306-1 (Contig...-U15306-1Q) /CSM_Contig/Contig-U15306-1Q.Seq.d AAGCATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTA...TTTTAGAACTTCAAAAAATAGTAC AAATTTTTTCAAATTAAGATAAAAAAAATAAAACAAAAATTAATTTAAAA CA Gap no gap Contig length 2452...*naagtgkgeegrt*hkslpywlapqvkgsvmprggqghygasrggrkhmgidfssivg qdivapisgkvvnfkgartkypmlqlypskkftefdylqmlyvhppvginmgasyqvsvg dtig

Dicty_cDB: Contig-U08397-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 6 |pid:none) Polaromonas sp. JS666, complete... 43 1e-06 U40031_3( U40031 |pid:none) Reithrodontomys megalot...ogena... 53 1e-06 U83832_3( U83832 |pid:none) Reithrodontomys fulvescens NADH dehydr... 52 1e-06 U83822_3( U...83822 |pid:none) Sigmodon ochrognathus NADH dehydrogena... 51 1e-06 U83831_3( U83831 |pid:none) Reithrodon...tomys megalotis NADH dehydro... 52 1e-06 AP009385_2172( AP009385 |pid:none) Burkhol

Dicty_cDB: Contig-U01750-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U11883-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11883-1 gap included 599 2 1457179 1457762 PLUS 1 2 U11883 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U11883-1 Contig ID Contig-U11883-1 Contig update 2002.12.18 Contig sequence >Contig-U11883-1 (Contig...-U11883-1Q) /CSM_Contig/Contig-U11883-1Q.Seq.d TACAAAATTTATATATATATATAATATTTTTAAATAATTATATTT...ATTTAGATGTATTTGGTATTCAAACATTA ACCGAACAACAAGCCTCTACAAAATTATTAACTTTTGTCATTTCAAAATC AGGTGAAAA Gap gap included Contig...ffkixn*kikkgfhvkxksflwfkxxx--- ---xxxx******************yprkyiniti*rn*kdil*ii*rne*rergtksc* nifs*kestpl*fnsxfktniilfstvfnttnvstig

Dicty_cDB: Contig-U07021-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U12043-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12043-1 gap included 1898 6 2694437 2692539 MINUS 7 13 U12043 0 6 0 0 0 0 0... 1 0 0 0 0 0 0 Show Contig-U12043-1 Contig ID Contig-U12043-1 Contig update 2002.12.18 Contig sequence >Contig-U12043-1 (Contig...-U12043-1Q) /CSM_Contig/Contig-U12043-1Q.Seq.d GAAACCATTCGTTTAAAGAAATGAAATATTTATATATATTAA...ATAAA AATAAATT Gap gap included Contig length 1898 Chromosome number (1..6, M) 6 Chromosome length 3595308 S...VPDIVSGILASKYASITLLNSGEM DLTNGITIGLLENSTSDQLFQINPILNTSLTNILVGQRFSIPFEISIKDSTISNQL

Dicty_cDB: Contig-U15462-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15462-1 no gap 546 4 3384206 3383661 MINUS 2 2 U15462 0 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U15462-1 Contig ID Contig-U15462-1 Contig update 2004. 6.11 Contig sequence >Contig-U15462-1 (Contig...-U15462-1Q) /CSM_Contig/Contig-U15462-1Q.Seq.d CTTTAGATTGGGGNTCAAGAAAAATATTGAAGTATTTGGTGGTGATAAGA...ATTCGATTCACTATCTTATA Gap no gap Contig length 546 Chromosome number (1..6, M) 4 Chromosome length 5430582 St...VMKLGFEVKDLITNDPKCDLFDSLS Y own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15462-1 (Contig

Integrable reductions of many component magnetic systems in (1,1) dimensions

International Nuclear Information System (INIS)

Makhankov, V.G.; Pashaev, O.K.

1983-01-01

A generalized many component Heisenberg spin chain with phonon interaction is proposed. Some reductions of the proposed model leading to different real magnetic systems such as many chained magnetic crystals with nontrivial interchain couplings, a mixture of many chained ferro and antiferromagnets, a ''colour'' generalized Pierels-Hubbard model, etc., are studied. It has been shown that the dynamics of all the above real models are close to some integrable systems and coincide with them in certain limits. Such integrable systems are the coupled generalised system of Yajima and Oikawa and U(p,q) nonlinear Schrodinger equation, already well studied. (Auth.)

Dicty_cDB: Contig-U15323-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15323-1 no gap 1230 2 3760829 3759661 MINUS 76 108 U15323 2 0 21 0 9 4 0 0 22 4 13 0 1 0 Show Contig...-U15323-1 Contig ID Contig-U15323-1 Contig update 2004. 6.11 Contig sequence >Contig-U15323-1 (Contig-U15323-1Q) /CSM_Contig/Contig-U1532...TAAAATTTAAGCAATCATTCCAT Gap no gap Contig length 1230 Chromosome number (1..6, M) 2 Chromosome length 846757...VGLLVFFNILYCTPLYYILFFFKMNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADG...MNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQK

Flavor changing neutral currents, CP violation, and implications for some rare decays in a SU(4)L x U(1)X extension of the standard model

International Nuclear Information System (INIS)

Jaramillo, Alejandro; Sanchez, Luis A.

2011-01-01

Extensions of the standard model with gauge symmetry SU(3) c x SU(4) L x U(1) X (3-4-1 extensions) where anomaly cancellation takes place between the fermion families (three-family models) predict the existence of two new heavy neutral gauge bosons which transmit flavor changing neutral currents at tree level. In this work, in the context of a three-family 3-4-1 extension which does not contain particles with exotic electric charges, we study the constraints coming from neutral meson mixing on the parameters of the extension associated to tree-level flavor changing neutral current effects. Taking into account experimental measurements of observables related to K and B meson mixing and including new CP-violating phases, we study the resulting bounds for angles and phases in the mixing matrix for the down-quark sector, as well as the implications of these bounds for the modifications in the amplitudes of the clean rare decays K + →π + νν, K L →π 0 νν, K L →π 0 l + l - (l=e, μ) and B d/s →μ + μ - .

Dicty_cDB: Contig-U04334-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04334-1 no gap 399 4 3746420 3746021 MINUS 3 3 U04334 0 0 0 0 0 0 3 0 0 0 0 0 0 0 Show Contig...-U04334-1 Contig ID Contig-U04334-1 Contig update 2001. 8.29 Contig sequence >Contig-U04334-1 (Contig...-U04334-1Q) /CSM_Contig/Contig-U04334-1Q.Seq.d CAAAAAAAAAAAAGTAAAACAATAAATTATATAAAAAAAATAAAAAAAAT...CTAATTTCA AACAATATCAATAAAATGTTATATAATTACTATTAAAATGAAAAAAAAA Gap no gap Contig len...ce QKKKSKTINYIKKIKKMSIINTISKLSLSNSLKSNITIGNLNGTTVNNYTHNETSSKFTE FFYKII*qnkrwf*kvkelnkkkrkkdyiissfcklysiyfvfs

Dicty_cDB: Contig-U09569-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09569-1 gap included 1424 5 3658944 3660352 PLUS 8 14 U09569 0 0 8 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09569-1 Contig ID Contig-U09569-1 Contig update 2002. 9.13 Contig sequence >Contig-U09569-1 (Contig-U09569-1Q) /CSM_Contig/Contig-U0956...TTAAAAA TAAAATAAATATAAAATAAAATAAAAATTAACAA Gap gap included Contig length 1424 Chromosome number (1..6, M) 5...NQTFQQKYYVNDQYYNYKNGGPIILYINGEGPVSSPPYSSDDGVVIYAQA LNCMIVTLEHRFYGESSPFSELTIENLQYLSHQQALEDLATFVVDFQSKLVGAGHIVTIG...YLSHQQALEDLATFVVDFQSKLVGAGHIVTIG GSYSGALSAWFRIKYPHITVGSIASLGVVHSILDFTAFDAYVSYA---

Dicty_cDB: Contig-U13202-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13202-1 no gap 1083 4 1301578 1302630 PLUS 41 45 U13202 8 0 13 0 0 2 16 0 2 0 0 0 0 0 Show Contig...-U13202-1 Contig ID Contig-U13202-1 Contig update 2002.12.18 Contig sequence >Contig-U13202-1 (Contig...-U13202-1Q) /CSM_Contig/Contig-U13202-1Q.Seq.d ACTGTTGGCCTACTGGGATTTTCTGCAGTAATAATAAAATCAAATA...TTTGTAATTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig len...kvgqfirvprgaqpaqtskftlmih*gvkshffsmlqpnwpncttigpvq nqarcgsllgfwvlqnqlltvlcihnnekcsikfygygyl**nlitvvkvvmpslhg

Dicty_cDB: Contig-U15069-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15069-1 no gap 1241 1 2719927 2720886 PLUS 37 43 U15069 16 2 0 0 0 5 8 0 0 1 1 0 4 0 Show Contig...-U15069-1 Contig ID Contig-U15069-1 Contig update 2004. 6.11 Contig sequence >Contig-U15069-1 (Contig...-U15069-1Q) /CSM_Contig/Contig-U15069-1Q.Seq.d TTTCAAACCAAAACATAAAATAATTAAAAATGACAACTGTTAAACCA...AAAAATAAAATAAATAAAAATAGTTTTAAA Gap no gap Contig length 1241 Chromosome number (1..6, M) 1 Chromosome length...07Z ,263,623 est42= VSJ431Z ,390,646 est43= CHB363Z ,460,1187 Translated Amino Acid sequence snqnik*lkmttvkptspenprvffditig

Dicty_cDB: Contig-U15828-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15828-1 gap included 1593 1 4184040 4182448 MINUS 12 19 U15828 0 0 6 0 0 0 ...0 0 2 0 4 0 0 0 Show Contig-U15828-1 Contig ID Contig-U15828-1 Contig update 2004. 6.11 Contig sequence >Contig-U15828-1 (Contig...-U15828-1Q) /CSM_Contig/Contig-U15828-1Q.Seq.d ATAAAAAAAATTAAAAAATTAAAAAAGTTATCCACCCAAGT...ACA AATATTATAACTGGTACTGCTACTGTTTCAATCCCTCAAAAAAATTTAAT TTATATTTTACCAAATTCAAATACAATTAATCAATCAACAATTACAATTA CAA Gap gap included Contig...SFNPANSDFSFSYNINTTITQPTQIYLNQDIYYPNGFTTNIITGTATVSIPQ KNLIYILPNSNTINQSTITIT own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig

Regulating Gamete Donation in the U.S.: Ethical, Legal and Social Implications

Directory of Open Access Journals (Sweden)

Maya Sabatello

2015-07-01

Full Text Available This article explores the practice of gamete donation in the U.S. having in mind the larger question of what do we as a society owe children born as a result (donor-conceived children. Do recipient-parents have a duty to tell their donor-conceived child about his/her genetic origins? Should the identity of the donor be disclosed or remain anonymous? Does the child have a right to know her conception story and to receive information, including identifying information, about the donor? Furthermore, if a donor-conceived child has a right to know, who has the duty to tell her/him about it? The Article underscores the ethical, legal and social dilemmas that arise, comparing and contrasting with international developments in this arena. It highlights the market-based and more specific medical justifications for regulating this field, explores the emerging so-called right of the child to know his/her genetic origins (“the right to know”, and considers the challenges such a right evokes to existing legal culture and principles of medical ethics in the U.S. as well as other broader societal implications of such a right.

Regulating Gamete Donation in the U.S.: Ethical, Legal and Social Implications.

Science.gov (United States)

Sabatello, Maya

2015-09-01

This article explores the practice of gamete donation in the U.S. having in mind the larger question of what do we as a society owe children born as a result (donor-conceived children). Do recipient-parents have a duty to tell their donor-conceived child about his/her genetic origins? Should the identity of the donor be disclosed or remain anonymous? Does the child have a right to know her conception story and to receive information, including identifying information, about the donor? Furthermore, if a donor-conceived child has a right to know, who has the duty to tell her/him about it? The Article underscores the ethical, legal and social dilemmas that arise, comparing and contrasting with international developments in this arena. It highlights the market-based and more specific medical justifications for regulating this field, explores the emerging so-called right of the child to know his/her genetic origins ("the right to know"), and considers the challenges such a right evokes to existing legal culture and principles of medical ethics in the U.S. as well as other broader societal implications of such a right.

Implications of a PTC Extension on U.S. Wind Deployment

Energy Technology Data Exchange (ETDEWEB)

Lantz, E.; Steinberg, D.; Mendelsohn, M.; Zinaman, O.; James, T.; Porro, G.; Hand, M.; Mai, T.; Logan, J.; Heeter, J.; Bird, L.

2014-04-01

This analysis explores the potential effects of wind production tax credit expiration and various extension scenarios on future wind deployment with the Regional Energy Deployment System (ReEDS), a model of the U.S. electricity sector. The analysis does not estimate the potential implications on government tax revenue associated with the PTC. Key findings include: Under a scenario in which the PTC is not extended and all other policies remain unchanged, wind capacity additions are expected to be between 3 and 5 GW per year from 2013-2020; PTC extension options that ramp-down from the current level to zero-credit by year-end 2022 appear to be insufficient to support deployment at the recent historical average; Extending the PTC at its historical level may provide the best opportunity to support deployment consistent with recent levels across a range of potential market conditions; it therefore may also provide the best opportunity to sustain wind power installation and manufacturing sector at current levels.

Dicty_cDB: Contig-U15525-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15525-1 gap included 3361 6 202399 204109 PLUS 34 57 U15525 0 0 7 0 7 6 0 0 4 3 7 0 0 0 Show Contig...-U15525-1 Contig ID Contig-U15525-1 Contig update 2004. 6.11 Contig sequence >Contig-U15525-1 (Contig-U15525-1Q) /CSM_Contig/Contig-U15525...ATTTAATTAAATAATAATA Gap gap included Contig length 3361 Chromosome number (1..6, M) 6 Chromosome length 3595...TEATCLILSVD ETVQNNQAEQAQAGPQINNQTRQALSRVEVFKQ--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKVLCLNIELELK...lslnsiqslpqlkqlv*ssll mkpfkiiklnklklvhklitkhvklyhg*rcss--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKV

Dicty_cDB: Contig-U13680-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13680-1 no gap 822 5 2371965 2372786 PLUS 2 2 U13680 0 2 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13680-1 Contig ID Contig-U13680-1 Contig update 2002.12.18 Contig sequence >Contig-U13680-1 (Contig...-U13680-1Q) /CSM_Contig/Contig-U13680-1Q.Seq.d AAAAAGATTCTCAAGGAATTCACCGTGTTTATACTTCTTATGGTAGAACT ...GGGAATCAATGATTTAAATATCTACCAAATTCAAAAGG AAGGTGATGTCGAGTCACATTCATTACAATCACCATCGAAATTATTATTT CATGGTTCAAGAGCATCGAATT Gap no gap Contig...**sirtinkdig*kslc*snhsidk*ffsynh*twy*ntigclingt s*kw*tcfeknqylfewynqsiisrvgeikfrifhnyst*tw*rfrcclkeyh*kfgsie

Dicty_cDB: Contig-U01204-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN

U-series isotopes in arc magma

Energy Technology Data Exchange (ETDEWEB)

Hawkesworth, C.; Turner, S.; McDermott, F.; Peate, D.; Van Calsteren, P.

1997-12-31

Thorium is not readily mobilized in the fluid component along destructive plate margins. Uranium is mobilized, and the resultant fractionation in U/Th can be used to estimate the rates of transfer slab derived components through the mantle wedge. The variations in Th/Yb, and by implication in the fractionation-corrected Th abundances of arc magmas largely depend on the contributions from subducted sediments. It is inferred that the distinctive high Th/Ta ratios of subduction related magmas primarily reflect the Th/Ta ratios of the subducted sediments, and that such high Th/Ta ratios are generated by processes other than those associated with recent subduction-related magmatism. Uranium and thorium isotopes have also been used to evaluate magma residence times within the crust. Thus, separated minerals and groundmass from six rocks erupted in the last 4,000 years from Soufriere on St. Vincent in the Lesser Antilles, scatter about a 50,000 year errorchron on the U-Th equiline diagram (Heath et al., 1977). Models are currently being developed to investigate how such apparent ages may relate to calculated replenishment times in steady state systems. Bulk continental crust has a lower U/Th ratio (0.25) than at least some estimates for the bulk Earth (0.26) and the depleted upper mantle (0.39). However, the island arc rocks with low U/Th ratios appear to have inherited those from subducted sediments, and arc rocks with a low sediment contribution have significantly higher U/Th. Consequently, the U/Th ratios of new crustal material generated along destructive plate margins are significantly higher than those of bulk continental crust. The low average U/Th of bulk crust may be primarily due to different crust generation processes in the Archaean, when U would be less mobile because conditions were less oxidising, and when residual garnet may have had more of a role in crust generation processes. Extended abstract. 4 figs., 23 refs.

Characteristics of WWER-1000 fuel rod claddings and FA components from E635 alloy at burnups up to 72 MWd/kgU

International Nuclear Information System (INIS)

Nikulin, A.; Novikov, A.; Peregud, M.; Shishov, V.; Shevyakov, A.; Volkova, I.; Novoselov, A.; Kobylyansky, G.

2011-01-01

In this paper operation experience, results of investigated E365 alloy components of Balakovo NPP Unit 1 and Kalinin NPP unit 1 fuel assemblies are presented. Appearance, shape changes and geometric size, corrosion state of guide thimbles, angles and fuel rods, corrosion of fuel claddings are studied. At the end authors concluded that: I) E635 alloy corroborated its high operation reliability as fuel claddings and WWER-1000 FA components during 6 year service to the fuel burnup of 72MWd/kgU; II) Based on the results from the post-irradiation investigations of the fuel rods and other structural elements of WWER-1000 FAA, fabricated from E635 alloy, in terms of the basic operational characteristics, their resources after the 6 year operation cycle have not been exhausted; III) The geometrical parameters, corrosion states, tensile properties of items fabricated from fuel alloy did not attain the values that would prevent their further operation: 1) the elongations of the fuel rods at the mean burnups up to 66.2 MWd/kgU do not exceed 15 mm or 4.9%; 8) the amount of the oxide coat at surface of GT and CT does not exceed 45 μm, the hydrogen content is <0.03% mass; 9) the oxide coat at the surfaces of the frame angles does not exceed 50 μm, the hydrogen content is <0.04% mass

Spin Tests of 1/20-Scale Models of the Chance Vought Revised XF6U-1 and F6U-1 Airplanes, TED No. NACA 2390

Science.gov (United States)

Klinar, Walter J.; Berman, Theodore

1948-01-01

An investigation has been conducted in the Langley 20-foot free-spinning tunnel on the 1/20-scale model of the Chance Vought XF6U-1 airplane altered to represent the XF6U-1 airplane as it will be spin-tested in flight, and also altered to represent the F6U-1 airplane as it will be produced for service use. Spin tests were made to determine the effects of control settings and movements at the normal loading. The results show that the spins obtained on the revised XF6U-1 airplane will be oscillatory in roll and yaw and that recoveries by rudder reversal will be rapid. Model test results indicate that the F6U-1 airplane will probably not spin. Inasmuch as the results of this investigation show that the new designs are as good as or better than the original XF6U-1 design in regard to spin recovery, it is felt that the conclusions and recommendations reached for the original design can be applied to the new designs for all loading conditions.

Dicty_cDB: Contig-U09822-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

Dicty_cDB: Contig-U12316-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12316-1 gap included 1238 4 1925901 1927143 PLUS 5 6 U12316 0 4 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12316-1 Contig ID Contig-U12316-1 Contig update 2002.12.18 Contig sequence >Contig-U12316-1 (Contig-U12316-1Q) /CSM_Contig/Contig-U12316...GAGTTGAAGATTTAGTTTTATCAGNANGAANAAATAAGAT Gap gap included Contig length 1238 Chromosome number (1..6, M) 4 C...,915,1174 Translated Amino Acid sequence lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig...lip*r*rtrkttn*kiknny*itketkiqs*t*rvmmmi*vedlvls xxxnk Frame B: lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig

Dicty_cDB: Contig-U12682-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12682-1 no gap 1408 4 4961739 4963050 PLUS 47 48 U12682 0 0 0 5 0 0 2 30 0 10 0 0 0 0 Show Contig...-U12682-1 Contig ID Contig-U12682-1 Contig update 2002.12.18 Contig sequence >Contig-U12682-1 (Contig...-U12682-1Q) /CSM_Contig/Contig-U12682-1Q.Seq.d AAACACATCATCCCGTTCGATCTGATAAGTAAATCGACCTCAGGCC...ATGA AACTACTG Gap no gap Contig length 1408 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start po... kwniikwysyinwykswyn**fihsiklqwsy*qcke*si*yiir*ny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

Non(anti)commutative N = (1,1/2) supersymmetric U(1) gauge theory

International Nuclear Information System (INIS)

Araki, Takeo; Ito, Katsushi; Ohtsuka, Akihisa

2005-01-01

We study a reduction of deformation parameters in non(anti)commutative N = 2 harmonic superspace to those in non(anti)commutative N = 1 superspace. By this reduction we obtain the exact gauge and supersymmetry transformations in the Wess-Zumino gauge of non(anti)commutative N = 2 supersymmetric U(1) gauge theory defined in the deformed harmonic superspace. We also find that the action with the first order correction in the deformation parameter reduces to the one in the N = 1 superspace by some field redefinition. We construct deformed N = (1,1/2) supersymmetry in N = 2 supersymmetric U(1) gauge theory in non(anti)commutative N = 1 superspace

OpenU 1.0

NARCIS (Netherlands)

Alberts, Jules; Finders, Anton; Martens, Harrie; Obreza, Matija; Schaeps, Leon; Slootmaker, Aad; Slot, Wim; Storm, Jeroen; Ternier, Stefaan; Van der Vegt, Wim; Vogten, Hubert

2013-01-01

Alberts, J., Finders, A., Martens, H., Obreza, M., Schaeps, L., Slootmaker, A., Slot, W., Storm, J., Ternier, S., Van der Vegt, W., & Vogten, H. (2012). OpenU (Version 1.0) [Software]. Heerlen, The Netherlands: Open Universiteit. Available under the GNU Lesser General Public License (LGPL3).

Microwave measurement test results of circular waveguide components for electron cyclotron resonant heating (ECRH) of the Tandem Mirror Experiment-Upgrade (TMX-U)

International Nuclear Information System (INIS)

Williams, C.W.; Rubert, R.R.; Coffield, F.E.; Felker, B.; Stallard, B.W.; Taska, J.

1983-01-01

Development of high-power components for electron cyclotron resonant heating (ECRH) applications requires extensive testing. In this paper we describe the high-power testing of various circular waveguide components designed for application on the Tandem Mirror Experiment-Upgrade (TMX-U). These include a 2.5-in. vacuum valve, polarizing reflectors, directional couplers, mode converters, and flexible waveguides. All of these components were tested to 200 kW power level with 40-ms pulses. Cold tests were used to determine field distribution. The techniques used in these tests are illustrated. The new high-power test facility at Lawrence Livermore National Laboratory (LLNL) is described and test procedures are discussed. We discuss the following test results: efficiency at high power of mode converters, comparison of high power vs low power for waveguide components, and full power tests of the waveguide system. We also explain the reasons behind selection of these systems for use on TMX-U

Reusable Component Services

Data.gov (United States)

U.S. Environmental Protection Agency — The Reusable Component Services (RCS) is a super-catalog of components, services, solutions and technologies that facilitates search, discovery and collaboration in...

7 CFR 51.2833 - U.S. No. 1 Boilers.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 1 Boilers. 51.2833 Section 51.2833 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards...) Grades § 51.2833 U.S. No. 1 Boilers. U.S. No. 1 Boilers consists of onions which meet all the...

Component Commonality and Its Cost Implications - Increasing the Commonality of the Right Components

DEFF Research Database (Denmark)

Lyly-Yrjänäinen, Jouni; Suomala, Petri; Israelsen, Poul

Component commonality (Labro 2004, Zhou & Gruppström 2004) can be defined as the use of the same version of a component across multiple products. It is usually seen as a means to manage costs without sacrificing product variety. However, when managing costs with component commonality, the managers...... constructions was identified as the most important bottleneck for the delivery process causing many indirect costs, especially with respect to project-management-related activities. Interestingly, by eliminating the need for mechanical engineering, the context starts to approach assembly-to-order context, also...... should be able to identify rather rapidly which group of components would enable the most significant cost reductions. Unfortunately, the existing literature lacks profound discussion of how to identify the right components for increased component commonality. The objective of the paper is to discuss how...

The Proposed U.S.-South Korea Free Trade Agreement (KORUS FTA): Provisions and Implications

Science.gov (United States)

2009-06-17

U.S.-South Korea Merchandise Trade, Selected Years ......................................7 The Proposed U.S.-South Korea Free Trade Agreement (KORUS...Research Service 7 Table 1. Annual U.S.-South Korea Merchandise Trade, Selected Years (Billions of U.S. Dollars) Year U.S. Exports U.S. Imports...household meat purchases, particularly on reducing beef consumption in restaurants . 157

Climate uncertainty and implications for U.S. state-level risk assessment through 2050.

Energy Technology Data Exchange (ETDEWEB)

Loose, Verne W.; Lowry, Thomas Stephen; Malczynski, Leonard A.; Tidwell, Vincent Carroll; Stamber, Kevin Louis; Kelic, Andjelka; Backus, George A.; Warren, Drake E.; Zagonel, Aldo A.; Ehlen, Mark Andrew; Klise, Geoffrey T.; Vargas, Vanessa N.

2009-10-01

Decisions for climate policy will need to take place in advance of climate science resolving all relevant uncertainties. Further, if the concern of policy is to reduce risk, then the best-estimate of climate change impacts may not be so important as the currently understood uncertainty associated with realizable conditions having high consequence. This study focuses on one of the most uncertain aspects of future climate change - precipitation - to understand the implications of uncertainty on risk and the near-term justification for interventions to mitigate the course of climate change. We show that the mean risk of damage to the economy from climate change, at the national level, is on the order of one trillion dollars over the next 40 years, with employment impacts of nearly 7 million labor-years. At a 1% exceedance-probability, the impact is over twice the mean-risk value. Impacts at the level of individual U.S. states are then typically in the multiple tens of billions dollar range with employment losses exceeding hundreds of thousands of labor-years. We used results of the Intergovernmental Panel on Climate Change's (IPCC) Fourth Assessment Report 4 (AR4) climate-model ensemble as the referent for climate uncertainty over the next 40 years, mapped the simulated weather hydrologically to the county level for determining the physical consequence to economic activity at the state level, and then performed a detailed, seventy-industry, analysis of economic impact among the interacting lower-48 states. We determined industry GDP and employment impacts at the state level, as well as interstate population migration, effect on personal income, and the consequences for the U.S. trade balance.

Flipped SU(5) times U(1) in superconformal models

Energy Technology Data Exchange (ETDEWEB)

Bailin, D.; Katechou, E.K. (Sussex Univ., Brighton (United Kingdom). School of Mathematical and Physical Sciences); Love, A. (London Univ. (United Kingdom))

1992-01-10

This paper reports that flipped SU(5) {times} U(1) models are constructed in the framework of tensoring of N = 2 superconformal minimal models quotiented by discrete symmetries. Spontaneous breaking of flipped SU(5) {times} U(1) and extra U(1) factors in the gauge group along F-flat directions of the effective potential is studied.

7 CFR 51.2730 - U.S. No. 1 Spanish.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 1 Spanish. 51.2730 Section 51.2730... STANDARDS) United States Standards for Grades of Shelled Spanish Type Peanuts Grades § 51.2730 U.S. No. 1 Spanish. “U.S. No. 1 Spanish” consists of shelled Spanish type peanut kernels which are whole and free...

India’s Evolving Nuclear Force and Its Implications for U.S. Strategy in the Asia-Pacific

Science.gov (United States)

2016-06-01

development and the norms of restraint in the present nuclear doctrine. Conclusion. The growing diversity of India’s delivery vehicles generates questions...India has reportedly rejected such proposals due to reasoning that its nuclear force must also be built to deter China and cannot be capped sole- ly...security policy formulation. iii v Strategic Studies Institute and U.S. Army War College Press INDIA’S EVOLVING NUCLEAR FORCE AND ITS IMPLICATIONS FOR

Dicty_cDB: Contig-U11323-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF134321 |pid:none) Dissostichus mawsoni clone Dm7m ch... 84 3e-14 AM747721_702( ...S101... 81 2e-13 U58944_1( U58944 |pid:none) Dissostichus mawsoni AFGP antifreeze g... 81 2e-13 AM182501_1( ...017194_2467( AE017194 |pid:none) Bacillus cereus ATCC 10987, com... 75 1e-11 U43149_1( U43149 |pid:none) Dissostichus mawson

U.S. Solar Photovoltaic System Cost Benchmark: Q1 2017

Energy Technology Data Exchange (ETDEWEB)

Fu, Ran [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Feldman, David J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Woodhouse, Michael A. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Ardani, Kristen B. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2017-09-11

NREL has been modeling U.S. photovoltaic (PV) system costs since 2009. This year, our report benchmarks costs of U.S. solar PV for residential, commercial, and utility-scale systems built in the first quarter of 2017 (Q1 2017). Costs are represented from the perspective of the developer/installer, thus all hardware costs represent the price at which components are purchased by the developer/installer, not accounting for preexisting supply agreements or other contracts. Importantly, the benchmark this year (2017) also represents the sales price paid to the installer; therefore, it includes profit in the cost of the hardware, along with the profit the installer/developer receives, as a separate cost category. However, it does not include any additional net profit, such as a developer fee or price gross-up, which are common in the marketplace. We adopt this approach owing to the wide variation in developer profits in all three sectors, where project pricing is highly dependent on region and project specifics such as local retail electricity rate structures, local rebate and incentive structures, competitive environment, and overall project or deal structures.

Phenomenology of the hierarchical lepton mass spectrum in the flipped SU(5)xU(1) string model

Energy Technology Data Exchange (ETDEWEB)

Leontaris, G.K.; Nanopoulos, D.V.

1988-09-29

A detailed phenomenological analysis of the lepton mass matrices and their implications in the low energy theory are discussed, within the recently proposed SU(5)xU(1) string model. The unification scale is highly constrained while the Yukawa couplings lie in a natural region. The flavour changing decays ..mu.. -> e..gamma.., ..mu.. -> 3e, ..mu.. -> e are highly suppressed while the depletion in the flux of muon neutrinos reported by the Kamiokande is explained through ..nu../sub ..mu../ reversible ..nu../sub tau/ oscillations.

Component Fragility Research Program: Phase 1 component prioritization

International Nuclear Information System (INIS)

Holman, G.S.; Chou, C.K.

1987-06-01

Current probabilistic risk assessment (PRA) methods for nuclear power plants utilize seismic ''fragilities'' - probabilities of failure conditioned on the severity of seismic input motion - that are based largely on limited test data and on engineering judgment. Under the NRC Component Fragility Research Program (CFRP), the Lawrence Livermore National Laboratory (LLNL) has developed and demonstrated procedures for using test data to derive probabilistic fragility descriptions for mechanical and electrical components. As part of its CFRP activities, LLNL systematically identified and categorized components influencing plant safety in order to identify ''candidate'' components for future NRC testing. Plant systems relevant to safety were first identified; within each system components were then ranked according to their importance to overall system function and their anticipated seismic capacity. Highest priority for future testing was assigned to those ''very important'' components having ''low'' seismic capacity. This report describes the LLNL prioritization effort, which also included application of ''high-level'' qualification data as an alternate means of developing probabilistic fragility descriptions for PRA applications

U(1) mediation of flux supersymmetry breaking

Science.gov (United States)

Grimm, Thomas W.; Klemm, Albrecht

2008-10-01

We study the mediation of supersymmetry breaking triggered by background fluxes in Type II string compactifications with Script N = 1 supersymmetry. The mediation arises due to an U(1) vector multiplet coupling to both a hidden supersymmetry breaking flux sector and a visible D-brane sector. The required internal manifolds can be constructed by non-Kähler resolutions of singular Calabi-Yau manifolds. The effective action encoding the U(1) coupling is then determined in terms of the global topological properties of the internal space. We investigate suitable local geometries for the hidden and visible sector in detail. This includes a systematic study of orientifold symmetries of del Pezzo surfaces realized in compact geometries after geometric transition. We construct compact examples admitting the key properties to realize flux supersymmetry breaking and U(1) mediation. Their toric realization allows us to analyze the geometry of curve classes and confirm the topological connection between the hidden and visible sector.

U(1) mediation of flux supersymmetry breaking

International Nuclear Information System (INIS)

Grimm, Thomas W.; Klemm, Albrecht

2008-01-01

We study the mediation of supersymmetry breaking triggered by background fluxes in Type II string compactifications with N = 1 supersymmetry. The mediation arises due to an U(1) vector multiplet coupling to both a hidden supersymmetry breaking flux sector and a visible D-brane sector. The required internal manifolds can be constructed by non-Kaehler resolutions of singular Calabi-Yau manifolds. The effective action encoding the U(1) coupling is then determined in terms of the global topological properties of the internal space. We investigate suitable local geometries for the hidden and visible sector in detail. This includes a systematic study of orientifold symmetries of del Pezzo surfaces realized in compact geometries after geometric transition. We construct compact examples admitting the key properties to realize flux supersymmetry breaking and U(1) mediation. Their toric realization allows us to analyze the geometry of curve classes and confirm the topological connection between the hidden and visible sector.

Study of infrared emission spectroscopy for the B1Δg–A1Πu and B′1Σg+–A1Πu systems of C2

International Nuclear Information System (INIS)

Chen, Wang; Kawaguchi, Kentarou; Tang, Jian; Bernath, Peter F.

2016-01-01

Thirteen bands for the B 1 Δ g –A 1 Π u system and eleven bands for the B ′1 Σ g + –A 1 Π u system of C 2 were identified in the Fourier transform infrared emission spectra of hydrocarbon discharges. The B ′1 Σ g + v = 4 and the B 1 Δ g v = 6, 7, and 8 vibrational levels involved in nine bands were studied for the first time. A direct global analysis with Dunham parameters was carried out satisfactorily for the B 1 Δ g –A 1 Π u system except for a small perturbation in the B 1 Δ g v = 6 level. The calculated rovibrational term energies up to B 1 Δ g v = 12 showed that the level crossing between the B 1 Δ g and d 3 Π g states is responsible for many of the prominent perturbations in the Swan system observed previously. Nineteen forbidden transitions of the B 1 Δ g –a 3 Π u transition were identified and the off-diagonal spin-orbit interaction constant A dB between d 3 Π g and B 1 Δ g was derived as 8.3(1) cm −1 . For the B ′1 Σ g + –A 1 Π u system, only individual band analyses for each vibrational level in the B′ 1 Σ g + state could be done satisfactorily and Dunham parameters obtained from these effective parameters showed that the anharmonic vibrational constant ω e x e is anomalously small (nearly zero). Inspection of the RKR (Rydberg-Klein-Rees) potential curves for the B ′1 Σ g + and X 1 Σ g + states revealed that an avoided crossing or nearly avoided crossing may occur around 30 000 cm −1 , which is responsible for the anomalous molecular constants in these two states

Gulf of Mexico Coastal Ocean Observing System: The Gulf Component of the U.S. Integrated Ocean Observing System

Science.gov (United States)

Bernard, L. J.; Moersdorf, P. F.

2005-05-01

The United States is developing an Integrated Ocean Observing System (IOOS) as the U.S. component of the international Global Ocean Observing System (GOOS). IOOS consists of: (1) a coastal observing system for the U.S. EEZ, estuaries, and Great Lakes; and (2) a contribution to the global component of GOOS focused on climate and maritime services. The coastal component will consist of: (1) a National Backbone of observations and products from our coastal ocean supported by federal agencies; and (2) contributions of Regional Coastal Ocean Observing Systems (RCOOS). The Gulf of Mexico Coastal Ocean Observing System (GCOOS) is one of eleven RCOOS. This paper describes how GCOOS is progressing as a system of systems to carry out data collection, analysis, product generation, dissemination of information, and data archival. These elements are provided by federal, state, and local government agencies, academic institutions, non-government organization, and the private sector. This end-to-end system supports the seven societal goals of the IOOS, as provided by the U.S. Commission on Ocean Policy: detect and forecast oceanic components of climate variability, facilitate safe and efficient marine operations, ensure national security, manage marine resources, preserve and restore healthy marine ecosystems, mitigate natural hazards, and ensure public health. The initial building blocks for GCOOS include continuing in situ observations, satellite products, models, and other information supported by federal and state government, private industry, and academia. GCOOS has compiled an inventory of such activities, together with descriptions, costs, sources of support, and possible out-year budgets. These activities provide information that will have broader use as they are integrated and enhanced. GCOOS has begun that process by several approaches. First, GCOOS has established a web site (www.gcoos.org) which is a portal to such activities and contains pertinent information

7 CFR 51.3050 - U.S. No. 1.

Science.gov (United States)

2010-01-01

... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... Standards for Florida Avocados Grades § 51.3050 U.S. No. 1. “U.S. No. 1” consists of avocados of similar...

Topological excitations in U(1) -invariant theories

International Nuclear Information System (INIS)

Savit, R.

1977-01-01

A class of U(1) -invariant theories in d dimensions is introduced on a lattice. These theories are labeled by a simplex number s, with 1 < or = s < d. The case with s = 1 is the X-Y model; and s = 2 gives compact photodynamics. An exact duality transformation is applied to show that the U(1) -invariant theory in d dimensions with simplex number s is the same as a similar theory in d dimensions but which is Z /sub infinity/-invariant and has simplex number s = d-s. This dual theory describes the topological excitations of the original theory. These excitations are of dimension s - 1

Rotational and Translational Components of Motion Parallax: Observers' Sensitivity and Implications for Three-Dimensional Computer Graphics

Science.gov (United States)

Kaiser, Mary K.; Montegut, Michael J.; Proffitt, Dennis R.

1995-01-01

The motion of objects during motion parallax can be decomposed into 2 observer-relative components: translation and rotation. The depth ratio of objects in the visual field is specified by the inverse ratio of their angular displacement (from translation) or equivalently by the inverse ratio of their rotations. Despite the equal mathematical status of these 2 information sources, it was predicted that observers would be far more sensitive to the translational than rotational component. Such a differential sensitivity is implicitly assumed by the computer graphics technique billboarding, in which 3-dimensional (3-D) objects are drawn as planar forms (i.e., billboards) maintained normal to the line of sight. In 3 experiments, observers were found to be consistently less sensitive to rotational anomalies. The implications of these findings for kinetic depth effect displays and billboarding techniques are discussed.

Implications of the effective one-component analysis of pair correlations in colloidal fluids with polydispersity

Science.gov (United States)

Pond, Mark J.; Errington, Jeffrey R.; Truskett, Thomas M.

2011-09-01

Partial pair-correlation functions of colloidal suspensions with continuous polydispersity can be challenging to characterize from optical microscopy or computer simulation data due to inadequate sampling. As a result, it is common to adopt an effective one-component description of the structure that ignores the differences between particle types. Unfortunately, whether this kind of simplified description preserves or averages out information important for understanding the behavior of the fluid depends on the degree of polydispersity and can be difficult to assess, especially when the corresponding multicomponent description of the pair correlations is unavailable for comparison. Here, we present a computer simulation study that examines the implications of adopting an effective one-component structural description of a polydisperse fluid. The square-well model that we investigate mimics key aspects of the experimental behavior of suspended colloids with short-range, polymer-mediated attractions. To characterize the partial pair-correlation functions and thermodynamic excess entropy of this system, we introduce a Monte Carlo sampling strategy appropriate for fluids with a large number of pseudo-components. The data from our simulations at high particle concentrations, as well as exact theoretical results for dilute systems, show how qualitatively different trends between structural order and particle attractions emerge from the multicomponent and effective one-component treatments, even with systems characterized by moderate polydispersity. We examine consequences of these differences for excess-entropy based scalings of shear viscosity, and we discuss how use of the multicomponent treatment reveals similarities between the corresponding dynamic scaling behaviors of attractive colloids and liquid water that the effective one-component analysis does not capture.

F-GUTs with Mordell-Weil U(1)'s

CERN Document Server

Antoniadis, I

2014-01-01

In this note we study the constraints on F-theory GUTs with extra $U(1)$'s in the context of elliptic fibrations with rational sections. We consider the simplest case of one abelian factor (Mordell-Weil rank one) and investigate the conditions that are induced on the coefficients of its Tate form. Converting the equation representing the generic hypersurface $P_{112}$ to this Tate's form we find that the presence of a U(1), already in this local description, is consistent with the exceptional ${\\cal E}_6$ and ${\\cal E}_7$ non-abelian singularities. We briefly comment on a viable ${\\cal E}_6\\times U(1)$ effective F-theory model.

7 CFR 51.302 - U.S. No. 1.

Science.gov (United States)

2010-01-01

... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946... Standards for Grades of Apples Grades § 51.302 U.S. No. 1. “U.S. No. 1” consists of apples which meet the...

On the U(1) problem

International Nuclear Information System (INIS)

McDougall, N.A.

1984-01-01

The resolution of the U(1) problem requires the quark condensates to have a specific THETA dependence. We show that the required THETA dependence arises naturally upon application of the index theorem during the calculation of the dynamically generated quark mass. (orig.)

Policy implications of the GRI baseline projection of U.S. energy supply and demand to 2010, 1992

International Nuclear Information System (INIS)

1992-01-01

The 1992 Edition of the GRI Baseline Projection of U.S. Energy Supply and Demand is summarized. Three broad implications concerning the future of the natural gas industry are highlighted: the residual impact of the August 1990 Gulf War on crude oil prices and the factors influencing the long-term price path, the impact of the growing number of environmental constraints on future energy use, and the effect of recent developments in gas production on future gas supply and price

Kinetics of the U-1% Mo alloy transformation during continual cooling; Kinetika transformacije legura U-1% Mo pri kontinuiranom hladjenju

Energy Technology Data Exchange (ETDEWEB)

Mihajlovic, A; Djuric, B; Tepavac, P [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Yugoslavia)

1965-11-15

Study of continuous cooling of the U-1% Mo alloy is significant if it could be used as fuel in the nuclear reactor. Previous studies were dealing with relatively low cooling rate up to 3 deg C/s{sup 1}, which produced alpha + gamma structure. This task was devoted to testing the U-1% Mo alloy properties at higher cooling rates in order to discover whether bainite reaction and favourable alpha grain could be achieved under certain conditions.

O(5) x U(1) electroweak theory

International Nuclear Information System (INIS)

Mukku, C.; Sayed, W.A.

1981-01-01

An anomaly-free O(5) x U(1) theory of electroweak interactions is described which provides a unified description of electroweak phenomena for two families of standard leptons and quarks. No ''new'' nonsequential-type fermions are introduced, unlike the case for all past studies based on this group. The present scheme requires the introduction of two further charged and three more neutral gauge fields over and above those of SU(2) x U(1) giving rise to new neutral and charged currents

3D nuclear organization of telomeres in the Hodgkin cell lines U-HO1 and U-HO1-PTPN1: PTPN1 expression prevents the formation of very short telomeres including "t-stumps"

Directory of Open Access Journals (Sweden)

Lemieux Bruno

2010-12-01

Full Text Available Abstract Background In cancer cells the three-dimensional (3D telomere organization of interphase nuclei into a telomeric disk is heavily distorted and aggregates are found. In Hodgkin's lymphoma quantitative FISH (3D Q-FISH reveals a major impact of nuclear telomere dynamics during the transition form mononuclear Hodgkin (H to diagnostic multinuclear Reed-Sternberg (RS cells. In vitro and in vivo formation of RS-cells is associated with the increase of very short telomeres including "t-stumps", telomere loss, telomeric aggregate formation and the generation of "ghost nuclei". Results Here we analyze the 3D telomere dynamics by Q-FISH in the novel Hodgkin cell line U-HO1 and its non-receptor protein-tyrosine phosphatase N1 (PTPN1 stable transfectant U-HO1-PTPN1, derived from a primary refractory Hodgkin's lymphoma. Both cell lines show equally high telomerase activity but U-HO1-PTPN differs from U-HO1 by a three times longer doubling time, low STAT5A expression, accumulation of RS-cells (p As expected, multinuclear U-HO1-RS-cells and multinuclear U-HO1-PTPN1-RS-cells differ from their mononuclear H-precursors by their nuclear volume (p Conclusion Abundant RS-cells without additional very short telomeres including "t-stumps", high rate of apoptosis, but low STAT5A expression, are hallmarks of the U-HO1-PTPN1 cell line. These characteristics are independent of telomerase activity. Thus, PTPN1 induced dephosphorylation of STAT5 with consecutive lack of Akt/PKB activation and cellular arrest in G2, promoting induction of apoptosis, appears as a possible pathogenetic mechanism deserving further experimental investigation.

Involvement of reversible binding to alpha 2u-globulin in 1,4-dichlorobenzene-induced nephrotoxicity.

Science.gov (United States)

Charbonneau, M; Strasser, J; Lock, E A; Turner, M J; Swenberg, J A

1989-06-01

Similarly to unleaded gasoline, 1,4-dichlorobenzene (1,4-DCB) administered for 2 years caused a dose-related increase in the incidence of renal tumors in male but not in female rats or in either sex of mice. Unleaded gasoline and 2,2,4-trimethylpentane (TMP), a component of unleaded gasoline, increased protein droplet formation and cell proliferation in male but not in female rat kidneys. These protein droplets contained, alpha 2u-globulin, a male rat-specific low-molecular-weight protein and 2,4,4-trimethyl-2-pentanol, a metabolite of TMP that was reversibly bound to this protein. Studies were undertaken to determine if 1,4-DCB produced similar effects; 1,2-DCB was used for comparison since it did not produce renal carcinogenesis in male rats. Gel filtration chromatography of a 116,000g supernatant prepared from kidneys of 1,4-[14C]DCB-treated rats showed that radiolabel coeluted with alpha 2u-globulin as one sharp peak as opposed to a multipeak pattern observed for 1,2-[14C]DCB; the maximal quantity of radiolabel for 1,4-DCB was twice that for 1,2-DCB. Equilibrium dialysis of kidney cytosol in the presence or absence of sodium dodecyl sulfate demonstrated that the radiolabel was reversibly bound to alpha 2u-globulin; the amount for 1,4-[14C]DCB-treated rats was almost twice as much as that for 1,2-[14C]DCB-treated rats. 1,2-DCB was also shown to be covalently bound to renal alpha 2u-globulin, and covalently bound to liver and plasma high-molecular-weight proteins. 1,4-DCB and, to a minor extent, 2,5-dichlorophenol, the major metabolite of 1,4-DCB, were reversibly bound to renal alpha 2u-globulin from 1,4-DCB-treated rats. 1,4-DCB increased protein droplet formation in male but not in female rat kidneys, whereas equimolar doses of 1,2-DCB showed no effect in either sex. Renal cell proliferation, measured by [3H]thymidine incorporation into renal DNA, was increased after 1,4-DCB but not after 1,2-DCB treatment. Nephrotoxicity and biochemical alterations induced by

U.S. GLOBEC Georges Bank Long-Term Moored Program. Part 1. Mooring Configuration

National Research Council Canada - National Science Library

Irish, J. D; Kerry, S; Fucile, P; Beardsley, R. C; Lord, J; Brink, K. H

2005-01-01

As part of the U.S. GLOBEC Northwest Atlantic/Georges Bank program, moorings were deployed on Georges Bank as part of the broad-scale survey component to help measure the temporal variability of both physical...

Preparation of D-[U-14C]galactose and α-D-[U-14C]galactose-1-phosphate

International Nuclear Information System (INIS)

Kolina, J.; Hromadkova, B.

1989-01-01

Optically pure D-[U- 14 C]galactose was prepared on a preparatory scale using the galactokinase enzyme. The suggested procedure allows to also prepare a α-D-[U- 14 C]galactose-1-phosphate and L-[U- 14 ]galactose giving good yield. The experiments proved that the raw fraction isolated from yeast of the Kluyveromyces fragilis strain or the Kluyveromyces lactis strain shows sufficient activity. Phosphorylation of D-[U- 14 C]galactose practically terminates after 30 mins of incubation. DL-[U- 14 C]galactose isolated using preparatory paper chromatography from the acid hydrolyzate of [U- 14 C] polysaccharide is a satisfactory radioactive precursor. The developed preparation procedure theoretically contributed towards the further elucidation of the problem of the proportional representation of galactose stereo-isomers in extracellular polysaccharide isolated from red algae. In this respect data in the literature differ and some sources state a significantly higher propertion of L-galactose. The experiments showed that [U- 14 C] polysaccharide isolated from the red algae Porphyridium cruentum prevalently contains D-[U- 14 C]galactose, which confirms the process of enzyme reaction. (author). 1 tab., 4 refs

O(5) x U(1) electroweak theory

International Nuclear Information System (INIS)

Mukku, C.; Sayed, W.A.

1980-12-01

An anomaly free O(5) x U(1) theory of electroweak interactions is described which provides a unified description of electroweak phenomena for two families of standard leptons and quarks. No ''new'' non-sequential type fermions of the standard model are introduced as has been the case for all past studies based on this group. The present scheme requires the introduction of two further charged and three more neutral gauge fields over and above the Wsup(+-), Z and photon fields of SU(2) x U(1) giving rise to new neutral and charged currents. In this note we outline our reasons for proposing the present electroweak scheme, give the basic structure of the model, discuss the symmetry breaking pattern which ensures that SU(2)sub(L) x U(1) is the low energy symmetry, point out the new interactions present in the extended framework and obtain limits on the masses of all the gauge fields. (author)

Re-editing the paradigm of Cytidine (C) to Uridine (U) RNA editing.

Science.gov (United States)

Fossat, Nicolas; Tam, Patrick P L

2014-01-01

Cytidine (C) to Uridine (U) RNA editing is a post-trancriptional modification that until recently was known to only affect Apolipoprotein b (Apob) RNA and minimally require 2 components of the C to U editosome, the deaminase APOBEC1 and the RNA-binding protein A1CF. Our latest work has identified a novel RNA-binding protein, RBM47, as a core component of the editosome, which can substitute A1CF for the editing of ApoB mRNA. In addition, new RNA species that are subjected to C to U editing have been identified. Here, we highlight these recent discoveries and discuss how they change our view of the composition of the C to U editing machinery and expand our knowledge of the functional attributes of C to U RNA editing.

U.V.-enhanced reactivation of u.v.-irradiated herpes virus by primary cultures of rat hepatocytes

International Nuclear Information System (INIS)

Zurlo, J.; Yager, J.D.

1984-01-01

Carcinogen treatment of cultured mammalian cells prior to infection with u.v.-irradiated virus results in enhanced virus survival and mutagenesis suggesting the induction of SOS-type processes. In this paper, we report the development of a primary rat hepatocyte culture system to investigate cellular responses to DNA damage which may be relevant to hepatocarcinogenesis in vivo. We have obtained data demonstrating that enhanced reactivation of u.v.-irradiated Herpes simplex virus type 1 (HSV-1) occurs in hepatocytes irradiated with u.v. Cultured hepatocytes were pretreated with u.v. at the time of enhanced DNA synthesis. These treatments caused an inhibition followed by a recovery of DNA synthesis. At various times after pretreatment, the hepatocytes were infected with control or u.v.-irradiated HSV-1 at low multiplicity, and virus survival was measured by direct plaque assay. U.v.-irradiated HSV-1 exhibited the expected two-component survival curve in control or u.v. pretreated hepatocytes. The magnitude of enhanced reactivation of HSV-1 was dependent on the u.v. dose to the hepatocytes, the time of infection following u.v. pretreatment, and the level of DNA synthesis at the time of pretreatment. These results suggest that u.v. treatment of rat hepatocytes causes the induction of SOS-type functions that may have a role in the initiation of hepatocarcinogenesis

Airborne measurements of western U.S. wildfire emissions: Comparison with prescribed burning and air quality implications

Science.gov (United States)

Liu, Xiaoxi; Huey, L. Gregory; Yokelson, Robert J.; Selimovic, Vanessa; Simpson, Isobel J.; Müller, Markus; Jimenez, Jose L.; Campuzano-Jost, Pedro; Beyersdorf, Andreas J.; Blake, Donald R.; Butterfield, Zachary; Choi, Yonghoon; Crounse, John D.; Day, Douglas A.; Diskin, Glenn S.; Dubey, Manvendra K.; Fortner, Edward; Hanisco, Thomas F.; Hu, Weiwei; King, Laura E.; Kleinman, Lawrence; Meinardi, Simone; Mikoviny, Tomas; Onasch, Timothy B.; Palm, Brett B.; Peischl, Jeff; Pollack, Ilana B.; Ryerson, Thomas B.; Sachse, Glen W.; Sedlacek, Arthur J.; Shilling, John E.; Springston, Stephen; St. Clair, Jason M.; Tanner, David J.; Teng, Alexander P.; Wennberg, Paul O.; Wisthaler, Armin; Wolfe, Glenn M.

2017-06-01

Wildfires emit significant amounts of pollutants that degrade air quality. Plumes from three wildfires in the western U.S. were measured from aircraft during the Studies of Emissions and Atmospheric Composition, Clouds and Climate Coupling by Regional Surveys (SEAC4RS) and the Biomass Burning Observation Project (BBOP), both in summer 2013. This study reports an extensive set of emission factors (EFs) for over 80 gases and 5 components of submicron particulate matter (PM1) from these temperate wildfires. These include rarely, or never before, measured oxygenated volatile organic compounds and multifunctional organic nitrates. The observed EFs are compared with previous measurements of temperate wildfires, boreal forest fires, and temperate prescribed fires. The wildfires emitted high amounts of PM1 (with organic aerosol (OA) dominating the mass) with an average EF that is more than 2 times the EFs for prescribed fires. The measured EFs were used to estimate the annual wildfire emissions of carbon monoxide, nitrogen oxides, total nonmethane organic compounds, and PM1 from 11 western U.S. states. The estimated gas emissions are generally comparable with the 2011 National Emissions Inventory (NEI). However, our PM1 emission estimate (1530 ± 570 Gg yr-1) is over 3 times that of the NEI PM2.5 estimate and is also higher than the PM2.5 emitted from all other sources in these states in the NEI. This study indicates that the source of OA from biomass burning in the western states is significantly underestimated. In addition, our results indicate that prescribed burning may be an effective method to reduce fine particle emissions.

Distinct 238U/235U ratios and REE patterns in plutonic and volcanic angrites: Geochronologic implications and evidence for U isotope fractionation during magmatic processes

Science.gov (United States)

Tissot, François L. H.; Dauphas, Nicolas; Grove, Timothy L.

2017-09-01

Angrites are differentiated meteorites that formed between 4 and 11 Myr after Solar System formation, when several short-lived nuclides (e.g., 26Al-26Mg, 53Mn-53Cr, 182Hf-182W) were still alive. As such, angrites are prime anchors to tie the relative chronology inferred from these short-lived radionuclides to the absolute Pb-Pb clock. The discovery of variable U isotopic composition (at the sub-permil level) calls for a revision of Pb-Pb ages calculated using an ;assumed; constant 238U/235U ratio (i.e., Pb-Pb ages published before 2009-2010). In this paper, we report high-precision U isotope measurement for six angrite samples (NWA 4590, NWA 4801, NWA 6291, Angra dos Reis, D'Orbigny, and Sahara 99555) using multi-collector inductively coupled plasma mass-spectrometry and the IRMM-3636 U double-spike. The age corrections range from -0.17 to -1.20 Myr depending on the samples. After correction, concordance between the revised Pb-Pb and Hf-W and Mn-Cr ages of plutonic and quenched angrites is good, and the initial (53Mn/55Mn)0 ratio in the Early Solar System (ESS) is recalculated as being (7 ± 1) × 10-6 at the formation of the Solar System (the error bar incorporates uncertainty in the absolute age of Calcium, Aluminum-rich inclusions - CAIs). An uncertainty remains as to whether the Al-Mg and Pb-Pb systems agree in large part due to uncertainties in the Pb-Pb age of CAIs. A systematic difference is found in the U isotopic compositions of quenched and plutonic angrites of +0.17‰. A difference is also found between the rare earth element (REE) patterns of these two angrite subgroups. The δ238U values are consistent with fractionation during magmatic evolution of the angrite parent melt. Stable U isotope fractionation due to a change in the coordination environment of U during incorporation into pyroxene could be responsible for such a fractionation. In this context, Pb-Pb ages derived from pyroxenes fraction should be corrected using the U isotope composition

Phenomenology of U(1){sub F} extension of inert-doublet model with exotic scalars and leptons

Energy Technology Data Exchange (ETDEWEB)

Dhargyal, Lobsang [Harish-Chandra Research Institute, HBNI, Allahabad (India)

2018-02-15

In this work we will extend the inert-doublet model (IDM) by adding a new U(1){sub F} gauge symmetry to it, under which, a Z{sub 2} even scalar (φ{sub 2}) and Z{sub 2} odd right handed component of two exotic charged leptons (F{sub eR}, F{sub μR}), are charged. We also add one Z{sub 2} even real scalar (φ{sub 1}) and one complex scalar (φ), three neutral Majorana right handed fermions (N{sub 1}, N{sub 2}, N{sub 3}), two left handed components of the exotic charged leptons (F{sub eL}, F{sub μL}) as well as F{sub τ} are all odd under the Z{sub 2}, all of which are not charged under the U(1){sub F}. With these new particles added to the IDM, we have a model which can give two scalar DM candidates, together they can explain the present DM relic density as well as the muon (g-2) anomaly simultaneously. Also in this model the neutrino masses are generated at one loop level. One of the most peculiar feature of this model is that non-trivial solution to the axial gauge anomaly free conditions lead to the prediction of a stable very heavy partner to the electron (F{sub e}), whose present collider limit (13 TeV LHC) on its mass should be around m{sub F{sub e}} ≥ few TeV. (orig.)

Supersymmetric U(1)' model with multiple dark matters

International Nuclear Information System (INIS)

Hur, Taeil; Lee, Hye-Sung; Nasri, Salah

2008-01-01

We consider a scenario where a supersymmetric model has multiple dark matter particles. Adding a U(1) ' gauge symmetry is a well-motivated extension of the minimal supersymmetric standard model (MSSM). It can cure the problems of the MSSM such as the μ problem or the proton decay problem with high-dimensional lepton number and baryon number violating operators which R parity allows. An extra parity (U parity) may arise as a residual discrete symmetry after U(1) ' gauge symmetry is spontaneously broken. The lightest U-parity particle (LUP) is stable under the new parity becoming a new dark matter candidate. Up to three massive particles can be stable in the presence of the R parity and the U parity. We numerically illustrate that multiple stable particles in our model can satisfy both constraints from the relic density and the direct detection, thus providing a specific scenario where a supersymmetric model has well-motivated multiple dark matters consistent with experimental constraints. The scenario provides new possibilities in the present and upcoming dark matter searches in the direct detection and collider experiments

Military Implications of Global Warming.

Science.gov (United States)

1999-05-20

U.S. environmental issues also have important global implications. This paper analyzes current U.S. Policy as it pertains to global warming and climate...for military involvement to reduce global warming . Global warming and other environmental issues are important to the U.S. military. As the United

Tuned and non-Higgsable U(1)s in F-theory

Energy Technology Data Exchange (ETDEWEB)

Wang, Yi-Nan [Center for Theoretical Physics, Department of Physics, Massachusetts Institute of Technology,77 Massachusetts Avenue, Cambridge, MA 02139 (United States)

2017-03-27

We study the tuning of U(1) gauge fields in F-theory models on a base of general dimension. We construct a formula that computes the change in Weierstrass moduli when such a U(1) is tuned, based on the Morrison-Park form of a Weierstrass model with an additional rational section. Using this formula, we propose the form of “minimal tuning” on any base, which corresponds to the case where the decrease in the number of Weierstrass moduli is minimal. Applying this result, we discover some universal features of bases with non-Higgsable U(1)s. Mathematically, a generic elliptic fibration over such a base has additional rational sections. Physically, this condition implies the existence of U(1) gauge group in the low-energy supergravity theory after compactification that cannot be Higgsed away. In particular, we show that the elliptic Calabi-Yau manifold over such a base has a small number of complex structure moduli. We also suggest that non-Higgsable U(1)s can never appear on any toric bases. Finally, we construct the first example of a threefold base with non-Higgsable U(1)s.

Projected Growth in Small-Scale, Fossil-Fueled Distributed Generation: Potential Implications for the U.S. Greenhouse Gas Inventory

Energy Technology Data Exchange (ETDEWEB)

Eberle, Annika [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Heath, Garvin A [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2018-03-29

The generation capacity of small-scale (less than one megawatt) fossil-fueled electricity in the United States is anticipated to grow by threefold to twenty-fold from 2015 to 2040. However, in adherence with internationally agreed upon carbon accounting methods, the Environmental Protection Agency's (EPA's) U.S. Greenhouse Inventory (GHGI) does not currently attribute greenhouse gases (GHGs) from these small-scale distributed generation sources to the electric power sector and instead accounts for these emissions in the sector that uses the distributed generation (e.g., the commercial sector). In addition, no other federal electric-sector GHG emission data product produced by the EPA or the U.S. Energy Information Administration (EIA) can attribute these emissions to electricity. We reviewed the technical documentation for eight federal electric-sector GHG emission data products, interviewed the data product owners, collected their GHG emission estimates, and analyzed projections for growth in fossil-fueled distributed generation. We show that, by 2040, these small-scale generators could account for at least about 1%- 5% of total CO2 emissions from the U.S. electric power sector. If these emissions fall outside the electric power sector, the United States may not be able to completely and accurately track changes in electricity-related CO2 emissions, which could impact how the country sets GHG reduction targets and allocates mitigation resources. Because small-scale, fossil-fueled distributed generation is expected to grow in other countries as well, the results of this work also have implications for global carbon accounting.

The Value of Wind Technology Innovation: Implications for the U.S. Power System, Wind Industry, Electricity Consumers, and Environment

Energy Technology Data Exchange (ETDEWEB)

Mai, Trieu T [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Lantz, Eric J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Mowers, Matthew [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Wiser, Ryan [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-21

Improvements to wind technologies have, in part, led to substantial deployment of U.S. wind power in recent years. The degree to which technology innovation will continue is highly uncertain adding to uncertainties in future wind deployment. We apply electric sector modeling to estimate the potential wind deployment opportunities across a range of technology advancement projections. The suite of projections considered span a wide range of possible cost and technology innovation trajectories, including those from a recent expert elicitation of wind energy experts, a projection based on the broader literature, and one reflecting estimates based on a U.S. DOE research initiative. In addition, we explore how these deployment pathways may impact the electricity system, electricity consumers, the environment, and the wind-related workforce. Overall, our analysis finds that wind technology innovation can have consequential implications for future wind power development throughout the United States, impact the broader electricity system, lower electric system and consumer costs, provide potential environmental benefits, and grow the U.S. wind workforce.

SU(3)_C× SU(2)_L× U(1)_Y( × U(1)_X ) as a symmetry of division algebraic ladder operators

Science.gov (United States)

Furey, C.

2018-05-01

We demonstrate a model which captures certain attractive features of SU(5) theory, while providing a possible escape from proton decay. In this paper we show how ladder operators arise from the division algebras R, C, H, and O. From the SU( n) symmetry of these ladder operators, we then demonstrate a model which has much structural similarity to Georgi and Glashow's SU(5) grand unified theory. However, in this case, the transitions leading to proton decay are expected to be blocked, given that they coincide with presumably forbidden transformations which would incorrectly mix distinct algebraic actions. As a result, we find that we are left with G_{sm} = SU(3)_C× SU(2)_L× U(1)_Y / Z_6. Finally, we point out that if U( n) ladder symmetries are used in place of SU( n), it may then be possible to find this same G_{sm}=SU(3)_C× SU(2)_L× U(1)_Y / Z_6, together with an extra U(1)_X symmetry, related to B-L.

Relativistic four-component potential energy curves for the lowest 23 covalent states of molecular bromine (Br2).

Science.gov (United States)

Gomes, José da Silva; Gargano, Ricardo; Martins, João B L; M de Macedo, Luiz Guilherme

2014-08-07

The covalent excited states and ground state of the Br2 molecule has been investigated by using four-component relativistic COSCI and MRCISD methods. These methods were performed for all covalent states in the representation Ω((±)). Calculated potential energy curves (PECs) were obtained at the four-component COSCI level, and spectroscopic constants (R(e), D(e), D0, ω(e), ω(e)x(e), ω(e)y(e), B(e), α(e), γ(e), Te, Dv) for bounded states are reported. The vertical excitations for all covalent states are reported at COSCI, MRCISD, and MRCISD+Q levels. We also present spectroscopic constants for two weakly bounded states (A':(1)2u and B':(1)0(-)u) not yet reported in the literature, as well as accurate analytical curves for all five relativistic molecular bounded sates [the ground state X:0 g(+) and the excited states A:(1)1(u), B:(1)0(u)(+), C:(2)1(u), and B':(1)0(u)(-)] found in this work.

VG2 URA TRAJECTORY DERIVED SUMM U1 COORDS 48SEC V1.0

Data.gov (United States)

National Aeronautics and Space Administration — This dataset contains Voyager 2 spacecraft position vectors relative to Uranus in minus U1 coordinates. The U1 or Uranus West Longitude System coordinate system is a...

The application of the Harwell neutron absorptiometer to the analysis of U-235 in nuclear fuel components

International Nuclear Information System (INIS)

Jones, T.L.; Watson, J.; Taylor, T.A.H.

1979-05-01

This paper describes the application of the Harwell Neutron Absorptiometer to routine analysis of the U-235 content of fuel element inserts manufactured at the Dounreay Nuclear Power Development Establishment for the use in Materials Testing Reactors. The instrument response, which is principally dependent on the 235 U closely follows a logarithmic relationship. Neutron attenuation due to the aluminium matrix and the presence of 238 U is less than 2% of the total attenuation. The absorptiometer can be used to estimate the weight of 235 U in a single insert with a total error in the range 1 to 1.6%. (author)

Alteration of RNA splicing by small molecule inhibitors of the interaction between NHP2L1 and U4

Science.gov (United States)

Diouf, Barthelemy; Lin, Wenwei; Goktug, Asli; Grace, Christy R. R.; Waddell, Michael Brett; Bao, Ju; Shao, Youming; Heath, Richard J.; Zheng, Jie J.; Shelat, Anang A.; Relling, Mary V.; Chen, Taosheng; Evans, William E.

2018-01-01

Splicing is an important eukaryotic mechanism for expanding the transcriptome and proteome, influencing a number of biological processes. Understanding its regulation and identifying small molecules that modulate this process remains a challenge. We developed an assay based on time-resolved FRET (TR-FRET) to detect the interaction between the protein NHP2L1 and U4 RNA, which are two key components of the spliceosome. We used this assay to identify small molecules that interfere with this interaction in a high-throughput screening (HTS) campaign. Topotecan and other camptothecin derivatives were among the top hits. We confirmed that topotecan disrupts the interaction between NHP2L1 and U4 by binding to U4 and inhibits RNA splicing. Our data reveal new functions of known drugs which could facilitate the development of therapeutic strategies to modify splicing and alter gene function. PMID:28985478

IMPACT OF CFTA/NAFTA ON U.S. AND CANADIAN AGRICULTURE

OpenAIRE

Tweeten, Luther G.; Sharples, Jerry A.; Evers-Smith, Linda

1997-01-01

CFTA/NAFTA is estimated annually to add $1,430 million of U.S. agricultural exports to Canada and $1,884 million of Canadian agricultural exports to the United States. Thus CFTA/NAFTA contributed an estimated 25 percent of the $5.8 billion of U.S. agricultural exports to Canada in 1995. Classical welfare analysis was used to estimate the implications of free trade in the dairy, poultry, sugar, and other industries that continue to be protected. In aggregate, consumers benefit from liberalizat...

Maintenance implications of critical components in ITER CXRS upper port plug design

International Nuclear Information System (INIS)

Koning, Jarich; Jaspers, Roger; Doornink, Jan; Ouwehand, Bernard; Klinkhamer, Friso; Snijders, Bart; Sadakov, Sergey; Heemskerk, Cock

2009-01-01

Already in the early phase of a design for ITER, the maintenance aspects should be taken into account, since they might have serious implications. This paper presents the arguments in support of the case for the maintainability of the design, notably if this maintenance is to be performed by advanced remote methods. This structure is compliant to the evolving maintenance strategy of ITER. Initial results of a Failure Mode Effects and Criticality Analysis (FMECA) and a development risk analysis for the ITER upper port plug no. 3, housing the Charge Exchange Recombination Spectroscopy (CXRS) diagnostic, are employed for the definition of the maintenance strategy. The CXRS upper port plug is essentially an optical system which transfers visible light from the plasma into a fiber bundle. The most critical component in this path is the first mirror (M1) whose reflectivity degrades during operation due to deposition and/or erosion dominated effects. Amongst other measures to mitigate these effects, the strategy is to allow for a replacement of this mirror. Therefore it is mounted on a retractable central tube. The main purpose of this tube is to make frequent replacements possible without hindering operation. The maintenance method in terms of time, geometry and spare part policy has a large impact on cost of the system and time usage in the hot cell. Replacement of the tube under vacuum and magnetic field seems infeasible due to the operational risk involved. The preferred solution is to have a spare tube available which is replaced in parallel with other maintenance operations on the vessel, as to avoid any interference in the hot cell with the shutdown scheduling. This avoids having to refurbish a full port plug and also allows for a more frequent replacement of M1, as we can replace the mirror anytime the vacuum vessel is vented, estimated to be once a year.

RA reactor operation and maintenance in 1992, Part 1; Deo 1 - Pogon i odrzavanje nuklearnog reaktoro RA u 1992. Godini

Energy Technology Data Exchange (ETDEWEB)

Sotic, O; Cupac, S; Sulem, B; Zivotic, Z; Majstorovic, D; Tanaskovic, M [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1992-12-01

During 1992 Ra reactor was not in operation. All the activities were fulfilled according to the previously adopted plan. Basic activities were concerned with revitalisation of the RA reactor and maintenance of reactor components. All the reactor personnel was busy with reconstruction and renewal of the existing reactor systems and building of the new systems, maintenance of the reactor devices. Part of the staff was trained for relevant tasks and maintenance of reactor systems. [Serbo-Croat] U toku 1992 godine poslovi u okviru projekta 'Istrazivacki nuklearni reaktor RA' obavljani su u skladu sa programom i planom rada. Osnovne aktivnosti na kojima je radjeno odnosile su se na revitalizaciju reaktora RA, kao i na odrzavanje opreme. U ovom periodu reaktor nije bio u pogonu. Svo osoblje je bilo angazovano na poslovima rekonstrukcije i modernizacije postojecih i dogradnje novih reaktorskih sistema, na odrzavanju opreme a deo tehnickog osoblja je bio obucavan za vrsenje odgovarajucih poslova u pogonu i odrzavanju opreme.

'L=R' -- $U(1)_R$ Lepton Number at the LHC

Energy Technology Data Exchange (ETDEWEB)

Frugiuele, Claudia [Fermilab; Gregoire, Thomas [Ottawa Carleton Inst. Phys.; Kumar, Piyush [Yale U.; Ponton, Eduardo [ISCAP, New York

2013-05-03

We perform a detailed study of a variety of LHC signals in supersymmetric models where lepton number is promoted to an (approximate) U(1)( )R( ) symmetry. Such a symmetry has interesting implications for naturalness, as well as flavor- and CP-violation, among others. Interestingly, it makes large sneutrino vacuum expectation values phenomenologically viable, so that a slepton doublet can play the role of the down-type Higgs. As a result, (some of) the leptons and neutrinos are incorporated into the chargino and neutralino sectors. This leads to characteristic decay patterns that can be experimentally tested at the LHC. The corresponding collider phenomenology is largely determined by the new approximately conserved quantum number, which is itself closely tied to the presence of “leptonic R-parity violation”. We find rather loose bounds on the first and second generation squarks, arising from a combination of suppressed production rates together with relatively small signal efficiencies of the current searches. Naturalness would indicate that such a framework should be discovered in the near future, perhaps through spectacular signals exhibiting the lepto-quark nature of the third generation squarks. The presence of fully visible decays, in addition to decay chains involving large missing energy (in the form of neutrinos) could give handles to access the details of the spectrum of new particles, if excesses over SM background were to be observed. The scale of neutrino masses is intimately tied to the source of U(1)( )R( ) breaking, thus opening a window into the R-breaking sector through neutrino physics. Further theoretical aspects of the model have been presented in the companion paper [1].

7 CFR 51.1142 - U.S. No. 1 Bright.

Science.gov (United States)

2010-01-01

...) Internal quality: Lots meeting the internal requirements for “U.S. Grade AA Juice (Double A)” or “U.S... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 1 Bright. 51.1142 Section 51.1142 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...

7 CFR 51.1145 - U.S. No. 1 Bronze.

Science.gov (United States)

2010-01-01

...) Internal quality: Lots meeting the internal requirements for “U.S. Grade AA Juice (Double A)” or “U.S... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 1 Bronze. 51.1145 Section 51.1145 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...

Light hidden-sector U(1)s in string compactifications

Energy Technology Data Exchange (ETDEWEB)

Goodsell, Mark; Ringwald, Andreas

2010-02-15

We review the case for light U(1) gauge bosons in the hidden-sector of heterotic and type II string compactifications, present estimates of the size of their kinetic mixing with the visible-sector hypercharge U(1), and discuss their possibly very interesting phenomenological consequences in particle physics and cosmology. (orig.)

Light hidden-sector U(1)s in string compactifications

International Nuclear Information System (INIS)

Goodsell, Mark; Ringwald, Andreas

2010-02-01

We review the case for light U(1) gauge bosons in the hidden-sector of heterotic and type II string compactifications, present estimates of the size of their kinetic mixing with the visible-sector hypercharge U(1), and discuss their possibly very interesting phenomenological consequences in particle physics and cosmology. (orig.)

Dicty_cDB: Contig-U11897-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e-17 AY155346_1( AY155346 |pid:none) Bactrocera cucurbitae white eye pr... 93 2e-...816 |pid:none) Bactrocera cucurbitae ABC membrane... 67 1e-09 U73828_1( U73828 |pid:none) Aedes albopictus w

Dicty_cDB: Contig-U03010-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ransient A gene cod... 50 0.13 1 ( U51084 ) Drosophila paulistorum Orinocan period protein (per... 50 0.13 1... ( U51081 ) Drosophila paulistorum Andean-Brazilian period prot... 50 0.13 1 ( M33496 ) D.melanogaster no-on

Production physiology and morphology of Populus species and their hybrids grown under short rotation. II. Biomass components and harvest index of hybrid and parental species clones

Energy Technology Data Exchange (ETDEWEB)

Scarascia-Mugnozza, G. E. [Univ. of Tuscia, Viterbo, (Italy); Ceulemans, R. [Antwerp Univ., Wilrijk (Belgium); Heilman, P. E. [Washington State Univ., Olympia, WA (United States); Isebrands, J. G.; Stettler, R. F.; Hinckley, T. M. [Forest Service, Rhinelander, WI (United States). North Central Forest Experiment Station

1997-03-01

Growth and biomass components of four poplar clones were studied during four consecutive years of short-rotation culture in western Washington, U.S.A. Results confirmed previous observations indicating the high productive potential of hybrid clones. In two of the hybrid clones tested, large differences in biomass distribution among tree components and in the pattern of growth were evident, as indicated by harvest index and root/shoot ratios. Results suggest that the clonal differences shown in total biomass, in allocation to different tree components, and in harvest index, have important implications for future poplar breeding programs. 39 refs., 4 tabs., 4 figs.

Duality invariance of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory

International Nuclear Information System (INIS)

Dayi, Oemer F.; Kelleyane, Lara T.; Uelker, Kayhan

2005-01-01

A parent action is introduced to formulate (S-) dual of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory. Partition function for parent action in phase space is utilized to establish the equivalence of partition functions of the theories which this parent action produces. Thus, duality invariance of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory follows. The results which we obtained are valid at tree level or equivalently at the first order in the nonanticommutativity parameter C μν

The role of hnRPUL1 involved in DNA damage response is related to PARP1.

Directory of Open Access Journals (Sweden)

Zehui Hong

Full Text Available Heterogeneous nuclear ribonucleoprotein U-like 1 (hnRPUL1 -also known as adenovirus early region 1B-associated proteins 5 (E1B-AP5 - plays a role in RNA metabolism. Recently, hnRPUL1 has also been shown to be involved in DNA damage response, but the function of hnRPUL1 in response to DNA damage remains unclear. Here, we have demonstrated that hnRPUL1 is associated with PARP1 and recruited to DNA double-strand breaks (DSBs sites in a PARP1-mediated poly (ADP-ribosyl ation dependent manner. In turn, hnRPUL1 knockdown enhances the recruitment of PARP1 to DSBs sites. Specifically, we showed that hnRPUL1 is also implicated in the transcriptional regulation of PARP1 gene. Thus, we propose hnRPUL1 as a new component related to PARP1 in DNA damage response and repair.

Armenia, Azerbaijan, and Georgia: Security Issues and Implications for U.S. Interests

Science.gov (United States)

2010-03-11

reaction border forces. The Georgian Border Police responded that there were no terrorists in the Gorge and retorted that “the Russian side has never...106 N.Bogdanova, “Azerbaijan, U.S. Develop Package of Proposals During Security Dialogue,” Trend News, November 5, 2009...Georgia since the August [2008] conflict. No part of the $1 billion U.S. assistance package went to the Ministry of Defense.”129 In addition, no FMF

Prime implicants in dynamic reliability analysis

International Nuclear Information System (INIS)

Tyrväinen, Tero

2016-01-01

This paper develops an improved definition of a prime implicant for the needs of dynamic reliability analysis. Reliability analyses often aim to identify minimal cut sets or prime implicants, which are minimal conditions that cause an undesired top event, such as a system's failure. Dynamic reliability analysis methods take the time-dependent behaviour of a system into account. This means that the state of a component can change in the analysed time frame and prime implicants can include the failure of a component at different time points. There can also be dynamic constraints on a component's behaviour. For example, a component can be non-repairable in the given time frame. If a non-repairable component needs to be failed at a certain time point to cause the top event, we consider that the condition that it is failed at the latest possible time point is minimal, and the condition in which it fails earlier non-minimal. The traditional definition of a prime implicant does not account for this type of time-related minimality. In this paper, a new definition is introduced and illustrated using a dynamic flowgraph methodology model. - Highlights: • A new definition of a prime implicant is developed for dynamic reliability analysis. • The new definition takes time-related minimality into account. • The new definition is needed in dynamic flowgraph methodology. • Results can be represented by a smaller number of prime implicants.

A fast-fission component with small mass drift in the reaction 84Kr + 27Al at ELab = 5.9 MeV/u

International Nuclear Information System (INIS)

Heusch, B.; Freiesleben, H.; Schneider, W.F.W.; Kohlmeyer, B.; Stege, H.; Puehlhofer, F.

1985-01-01

All reaction products in the range from target- and projectile-like to fission-like fragments were measured for the system 84 Kr + 27 Al at 5.9 MeV/u beam energy. They are assigned to the various reaction mechanisms on the basis of experimental signatures (energy dissipation, mass and angular distribution). The sum of the measured partial cross sections, including the evaporation residue yield obtained previously, agrees with the total reaction cross section derived from elastic scattering. A small fast-fission component was found, discernible from deep-inelastic reactions by its 1/sinθ angular distribution, and distinguished from compound-nucleus fission by an incomplete mass asymmetry relaxation

Minimal anomalous U(1) theories and collider phenomenology

Science.gov (United States)

Ekstedt, Andreas; Enberg, Rikard; Ingelman, Gunnar; Löfgren, Johan; Mandal, Tanumoy

2018-02-01

We study the collider phenomenology of a neutral gauge boson Z ' arising in minimal but anomalous U(1) extensions of the Standard Model (SM). To retain gauge invariance of physical observables, we consider cancellation of gauge anomalies through the Green-Schwarz mechanism. We categorize a wide class of U(1) extensions in terms of the new U(1) charges of the left-handed quarks and leptons and the Higgs doublet. We derive constraints on some benchmark models using electroweak precision constraints and the latest 13 TeV LHC dilepton and dijet resonance search data. We calculate the decay rates of the exotic and rare one-loop Z ' decays to ZZ and Z-photon modes, which are the unique signatures of our framework. If observed, these decays could hint at anomaly cancellation through the Green-Schwarz mechanism. We also discuss the possible observation of such signatures at the LHC and at future ILC colliders.

Assembly and dynamics of the U4/U6 di-snRNP by single-molecule FRET

Science.gov (United States)

Hardin, John W.; Warnasooriya, Chandani; Kondo, Yasushi; Nagai, Kiyoshi; Rueda, David

2015-01-01

In large ribonucleoprotein machines, such as ribosomes and spliceosomes, RNA functions as an assembly scaffold as well as a critical catalytic component. Protein binding to the RNA scaffold can induce structural changes, which in turn modulate subsequent binding of other components. The spliceosomal U4/U6 di-snRNP contains extensively base paired U4 and U6 snRNAs, Snu13, Prp31, Prp3 and Prp4, seven Sm and seven LSm proteins. We have studied successive binding of all protein components to the snRNA duplex during di-snRNP assembly by electrophoretic mobility shift assay and accompanying conformational changes in the U4/U6 RNA 3-way junction by single-molecule FRET. Stems I and II of the duplex were found to co-axially stack in free RNA and function as a rigid scaffold during the entire assembly, but the U4 snRNA 5′ stem-loop adopts alternative orientations each stabilized by Prp31 and Prp3/4 binding accounting for altered Prp3/4 binding affinities in presence of Prp31. PMID:26503251

Tank 241-U-102, Grab Samples 2U-99-1, 2U-99-2 and 2U-99-3 Analytical Results for the Final Report

International Nuclear Information System (INIS)

STEEN, F.H.

1999-01-01

This document is the final report for tank 241-U-102 grab samples. Five grab samples were collected from riser 13 on May 26, 1999 and received by the 222-S laboratory on May 26 and May 27, 1999. Samples 2U-99-3 and 2U-99-4 were submitted to the Process Chemistry Laboratory for special studies. Samples 2U-99-1, 2U-99-2 and 2U-99-5 were submitted to the laboratory for analyses. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler 1995, Mulkey and Miller 1998). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP

U.S. International Trade: Trends and Forecasts

Science.gov (United States)

2008-11-26

Agreements: Impact on U.S. Trade and Implications for U.S. Trade Policy, by William H. Cooper;CRS Report RL32371, Trade Remedies: A Primer, by Vivian C...initial public offering of the Blackstone Group, a U.S. private equity group. Morgan Stanley research estimates that such sovereign wealth funds could

The small molecule Mek1/2 inhibitor U0126 disrupts the chordamesoderm to notochord transition in zebrafish

Directory of Open Access Journals (Sweden)

Szabó Gábor

2008-04-01

Full Text Available Abstract Background Key molecules involved in notochord differentiation and function have been identified through genetic analysis in zebrafish and mice, but MEK1 and 2 have so far not been implicated in this process due to early lethality (Mek1-/- and functional redundancy (Mek2-/- in the knockout animals. Results Here, we reveal a potential role for Mek1/2 during notochord development by using the small molecule Mek1/2 inhibitor U0126 which blocks phosphorylation of the Mek1/2 target gene Erk1/2 in vivo. Applying the inhibitor from early gastrulation until the 18-somite stage produces a specific and consistent phenotype with lack of dark pigmentation, shorter tail and an abnormal, undulated notochord. Using morphological analysis, in situ hybridization, immunhistochemistry, TUNEL staining and electron microscopy, we demonstrate that in treated embryos the chordamesoderm to notochord transition is disrupted and identify disorganization in the medial layer of the perinotochordal basement mebrane as the probable cause of the undulations and bulges in the notochord. We also examined and excluded FGF as the upstream signal during this process. Conclusion Using the small chemical U0126, we have established a novel link between MAPK-signaling and notochord differentiation. Our phenotypic analysis suggests a potential connection between the MAPK-pathway, the COPI-mediated intracellular transport and/or the copper-dependent posttranslational regulatory processes during notochord differentiation.

Dicty_cDB: Contig-U15057-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( U58944 |pid:none) Dissostichus mawsoni AFGP antifreeze g... 44 0.012 C81265( C81265 )probable lipoprotein ...U43149_1( U43149 |pid:none) Dissostichus mawsoni antifreeze glycop... 36 3.2 ( P24856 ) RecName: Full=Ice-st

More modular invariant anomalous U(1) breaking

International Nuclear Information System (INIS)

Gaillard, Mary K.; Giedt, Joel

2002-01-01

We consider the case of several scalar fields, charged under a number of U(1) factors, acquiring vacuum expectation values due to an anomalous U(1). We demonstrate how to make redefinitions at the superfield level in order to account for tree-level exchange of vector supermultiplets in the effective supergravity theory of the light fields in the supersymmetric vacuum phase. Our approach builds upon previous results that we obtained in a more elementary case. We find that the modular weights of light fields are typically shifted from their original values, allowing an interpretation in terms of the preservation of modular invariance in the effective theory. We address various subtleties in defining unitary gauge that are associated with the noncanonical Kaehler potential of modular invariant supergravity, the vacuum degeneracy, and the role of the dilaton field. We discuss the effective superpotential for the light fields and note how proton decay operators may be obtained when the heavy fields are integrated out of the theory at the tree-level. We also address how our formalism may be extended to describe the generalized Green-Schwarz mechanism for multiple anomalous U(1)'s that occur in four-dimensional Type I and Type IIB string constructions

Exploring a new S U (4 ) symmetry of meson interpolators

Science.gov (United States)

Glozman, L. Ya.; Pak, M.

2015-07-01

In recent lattice calculations it has been discovered that mesons upon truncation of the quasizero modes of the Dirac operator obey a symmetry larger than the S U (2 )L×S U (2 )R×U (1 )A symmetry of the QCD Lagrangian. This symmetry has been suggested to be S U (4 )⊃S U (2 )L×S U (2 )R×U (1 )A that mixes not only the u- and d-quarks of a given chirality, but also the left- and right-handed components. Here it is demonstrated that bilinear q ¯q interpolating fields of a given spin J ≥1 transform into each other according to irreducible representations of S U (4 ) or, in general, S U (2 NF). This fact together with the coincidence of the correlation functions establishes S U (4 ) as a symmetry of the J ≥1 mesons upon quasizero mode reduction. It is shown that this symmetry is a symmetry of the confining instantaneous charge-charge interaction in QCD. Different subgroups of S U (4 ) as well as the S U (4 ) algebra are explored.

The structure of an E. coli tRNAfMet A1-U72 variant shows an unusual conformation of the A1-U72 base pair.

Science.gov (United States)

Monestier, Auriane; Aleksandrov, Alexey; Coureux, Pierre-Damien; Panvert, Michel; Mechulam, Yves; Schmitt, Emmanuelle

2017-05-01

Translation initiation in eukaryotes and archaea involves a methionylated initiator tRNA delivered to the ribosome in a ternary complex with e/aIF2 and GTP. Eukaryotic and archaeal initiator tRNAs contain a highly conserved A 1 -U 72 base pair at the top of the acceptor stem. The importance of this base pair to discriminate initiator tRNAs from elongator tRNAs has been established previously using genetics and biochemistry. However, no structural data illustrating how the A 1 -U 72 base pair participates in the accurate selection of the initiator tRNAs by the translation initiation systems are available. Here, we describe the crystal structure of a mutant E. coli initiator tRNA f Met A 1 -U 72 , aminoacylated with methionine, in which the C 1 :A 72 mismatch at the end of the tRNA acceptor stem has been changed to an A 1 -U 72 base pair. Sequence alignments show that the mutant E. coli tRNA is a good mimic of archaeal initiator tRNAs. The crystal structure, determined at 2.8 Å resolution, shows that the A 1 -U 72 pair adopts an unusual arrangement. A 1 is in a syn conformation and forms a single H-bond interaction with U 72 This interaction requires protonation of the N1 atom of A 1 Moreover, the 5' phosphoryl group folds back into the major groove of the acceptor stem and interacts with the N7 atom of G 2 A possible role of this unusual geometry of the A 1 -U 72 pair in the recognition of the initiator tRNA by its partners during eukaryotic and archaeal translation initiation is discussed. © 2017 Monestier et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.

238U series isotopes and 232Th in carbonates and black shales from the Lesser Himalaya: implications to dissolved uranium abundances in Ganga-Indus source waters

International Nuclear Information System (INIS)

Singh, S.K.; Dalai, Tarun K.; Krishnaswami, S.

2003-01-01

238 U and 232 Th concentrations and the extent of 238 U- 234 U- 230 Th radioactive equilibrium have been measured in a suite of Precambrian carbonates and black shales from the Lesser Himalaya. These measurements were made to determine their abundances in these deposits, their contributions to dissolved uranium budget of the headwaters of the Ganga and the Indus in the Himalaya and to assess the impact of weathering on 238 U- 234 U- 230 Th radioactive equilibrium in them. 238 U concentrations in Precambrian carbonates range from 0.06 to 2.07 μg g -1 . The 'mean' U/Ca in these carbonates is 2.9 ng U mg -1 Ca. This ratio, coupled with the assumption that all Ca in the Ganga-Indus headwaters is of carbonate origin and that U and Ca behave conservatively in rivers after their release from carbonates, provides an upper limit on the U contribution from these carbonates, to be a few percent of dissolved uranium in rivers. There are, however, a few streams with low uranium concentrations, for which the carbonate contribution could be much higher. These results suggest that Precambrian carbonates make only minor contributions to the uranium budget of the Ganga-Indus headwaters in the Himalaya on a basin wide scale, however, they could be important for particular streams. Similar estimates of silicate contribution to uranium budget of these rivers using U/Na in silicates and Na* (Na corrected for cyclic and halite contributions) in river waters show that silicates can contribute significantly (∼40% on average) to their U balance. If, however, much of the uranium in these silicates is associated with weathering resistant minerals, then the estimated silicate uranium component would be upper limits. Uranium concentration in black shales averages about 37 μg g -1 . Based on this concentration, supply of U from at least ∼50 mg of black shales per liter of river water is needed to balance the average river water U concentration, 1.7 μg L -1 in the Ganga-Indus headwaters

Central region component1, a novel synaptonemal complex component, is essential for meiotic recombination initiation in rice.

Science.gov (United States)

Miao, Chunbo; Tang, Ding; Zhang, Honggen; Wang, Mo; Li, Yafei; Tang, Shuzhu; Yu, Hengxiu; Gu, Minghong; Cheng, Zhukuan

2013-08-01

In meiosis, homologous recombination entails programmed DNA double-strand break (DSB) formation and synaptonemal complex (SC) assembly coupled with the DSB repair. Although SCs display extensive structural conservation among species, their components identified are poorly conserved at the sequence level. Here, we identified a novel SC component, designated central region component1 (CRC1), in rice (Oryza sativa). CRC1 colocalizes with ZEP1, the rice SC transverse filament protein, to the central region of SCs in a mutually dependent fashion. Consistent with this colocalization, CRC1 interacts with ZEP1 in yeast two-hybrid assays. CRC1 is orthologous to Saccharomyces cerevisiae pachytene checkpoint2 (Pch2) and Mus musculus THYROID receptor-interacting protein13 (TRIP13) and may be a conserved SC component. Additionally, we provide evidence that CRC1 is essential for meiotic DSB formation. CRC1 interacts with homologous pairing aberration in rice meiosis1 (PAIR1) in vitro, suggesting that these proteins act as a complex to promote DSB formation. PAIR2, the rice ortholog of budding yeast homolog pairing1, is required for homologous chromosome pairing. We found that CRC1 is also essential for the recruitment of PAIR2 onto meiotic chromosomes. The roles of CRC1 identified here have not been reported for Pch2 or TRIP13.

Dicty_cDB: Contig-U15201-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 2e-04 2 ( EX698640 ) GF_AW109651c08 AW1 Schistosoma mansoni cDNA clone... 44 2e-04 2 ( CD147...-0107T-L395-E12-U.B MG1-0107 Schistosoma manso... 44 2e-04 2 ( CD147233 ) ML1-0002T-M131-E11-U.G ML1-0002 Sc

APS beamline standard components handbook, Version 1.3

International Nuclear Information System (INIS)

Hahn, U.; Shu, D.; Kuzay, T.M.

1993-02-01

This Handbook in its current version (1.3) contains descriptions, specifications, and preliminary engineering design drawings for many of the standard components. The design status and schedules have been provided wherever possible. In the near future, the APS plans to update engineering drawings of identified standard beamline components and complete the Handbook. The completed version of this Handbook will become available to both the CATs and potential vendors. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction

SUZAKU MONITORING OF THE SEYFERT 1 GALAXY NGC 5548: WARM ABSORBER LOCATION AND ITS IMPLICATION FOR COSMIC FEEDBACK

International Nuclear Information System (INIS)

Krongold, Y.; Andrade-Velazquez, M.; Binette, L.; Jimenez-Bailon, E.; Elvis, M.; Nicastro, F.; Brickhouse, N. S.; Liu, Y.; Wilkes, B.; Mathur, S.; Reeves, J. N.; Grupe, D.; McHardy, I. M.; Minezaki, T.; Yoshii, Y.

2010-01-01

We present a 2 month Suzaku X-ray monitoring of the Seyfert 1 galaxy NGC 5548. The campaign consists of seven observations (with exposure time of ∼30 ks each), separated by ∼1 week. This paper focus on the X-ray Imaging Spectrometer data of NGC 5548. We analyze the response in the opacity of the gas that forms the well-known ionized absorber in this source for ionizing flux variations. Despite variations by a factor of ∼4 in the impinging continuum, the soft X-ray spectra of the source show little spectral variations, suggesting no response from the ionized absorber. A detailed time modeling of the spectra confirms the lack of opacity variations for an absorbing component with high ionization (U X ∼ -0.85), and high outflow velocity (v out ∼ 1040 km s -1 ), as the ionization parameter was found to be consistent with a constant value during the whole campaign. Instead, the models suggest that the ionization parameter of a low ionization (U X ∼ -2.8), low velocity (v out ∼ 590 km s -1 ) absorbing component might be changing linearly with the ionizing flux, as expected for gas in photoionization equilibrium. However, given the lack of spectral variations among observations, we consider the variations in this component as tentative. Using the lack of variations, we set an upper limit of n e 7 cm -3 for the electron density of the gas forming the high ionization, high velocity component. This implies a large distance from the continuum source (R>0.033 pc; R>5000R S ). If the variations in the low ionization, low velocity component are real, they imply n e >9.8 x 10 4 cm -3 and R 1.2 x 10 56 erg) can be enough to disrupt the interstellar medium, possibly quenching or regulating large-scale star formation. However, the total mass and energy ejected by the wind may still be lower than the one required for cosmic feedback, even when extrapolated to quasar luminosities. Such feedback would require that we are observing the wind before it is fully accelerated.

The Proposed U.S.-South Korea Free Trade Agreement (KORUS FTA): Provisions and Implications

Science.gov (United States)

2008-10-17

imports, see Appendix A.) About 20% of the export increase would benefit U.S. producers and exporters of pork, poultry and other meat products.20 In...more than $1.5 billion (45%) higher under the KORUS FTA than would be the case otherwise. Sales of beef, poultry , and pork would account for $644...U.S. beef primarily to regional markets and neighborhood butcher shops. However, U.S. exporters are watching for changes in consumer sentiment that

Declining average daily census. Part 1: Implications and options.

Science.gov (United States)

Weil, T P

1985-12-01

A national trend toward declining average daily (inpatient) census (ADC) started in late 1982 even before the Medicare prospective payment system began. The decrease in total days will continue despite an increasing number of aged persons in the U.S. population. This decline could have been predicted from trends during 1978 to 1983, such as increasing available beds but decreasing occupancy, 100 percent increases in hospital expenses, and declining lengths of stay. Assuming that health care costs will remain as a relatively fixed part of the gross national product and no major medical advances will occur in the next five years, certain implications and options exist for facilities experiencing a declining ADC. This article discusses several considerations: Attempts to improve market share; Reduction of full-time equivalent employees; Impact of greater acuity of illness among remaining inpatients; Implications of increasing the number of physicians on medical staffs; Option of a closed medical staff by clinical specialty; Unbundling with not-for-profit and profit-making corporations; Review of mergers, consolidations, and multihospital systems to decide when this option is most appropriate; Sale of a not-for-profit hospital to an investor-owned chain, with implications facing Catholic hospitals choosing this option; Impact and difficulty of developing meaningful alternative health care systems with the hospital's medical staff; Special problems of teaching hospitals; The social issue of the hospital shifting from the community's health center to a cost center; Increased turnover of hospital CEOs; With these in mind, institutions can then focus on solutions that can sometimes be used in tandem to resolve this problem's impact. The second part of this article will discuss some of them.

Anomalous U(1) as a mediator of Supersymmetry Breaking

CERN Document Server

Dvali, Gia; Dvali, Gia; Pomarol, Alex

1996-01-01

We point out that an anomalous gauge U(1) symmetry is a natural candida= te for being the mediator and messenger of supersymmetry breaking. It facilitate= s dynamical supersymmetry breaking even in the flat limit. Soft masses are induced by both gravity and the U(1) gauge interactions giving an unusual= mass hierarchy in the sparticle spectrum which suppresses flavor violations. T= his scenario does not suffer from the Polonyi problem.

Development of the TRSSS-1 Satellite as the Major Component of the Space Based Information System(SBIS) for Effective Decision Support System for Thailand's Natural Resources and Environmental Management

OpenAIRE

Musigasam, Weerapant; Ditsariyakue, Praneet; Aphicholati, Navanit; Vibulsresth, Suvit

1997-01-01

The paper describes development of the first Thailand Remote Sensing Satellite System (TRSSS-1) by the National Research Council of Thailand (NRCT), Ministry of Science Technology and Environment (MOSTE). The TRSSS-1 project has primarily been developed as a major component of the Space Base Information System (SBIS) for effective decision support system for Thailand's natural resources and environmental management. The Space Based Information System consists of three components namely, the u...

U1 snDNA clusters in grasshoppers: chromosomal dynamics and genomic organization

Science.gov (United States)

Anjos, A; Ruiz-Ruano, F J; Camacho, J P M; Loreto, V; Cabrero, J; de Souza, M J; Cabral-de-Mello, D C

2015-01-01

The spliceosome, constituted by a protein set associated with small nuclear RNA (snRNA), is responsible for mRNA maturation through intron removal. Among snRNA genes, U1 is generally a conserved repetitive sequence. To unveil the chromosomal/genomic dynamics of this multigene family in grasshoppers, we mapped U1 genes by fluorescence in situ hybridization in 70 species belonging to the families Proscopiidae, Pyrgomorphidae, Ommexechidae, Romaleidae and Acrididae. Evident clusters were observed in all species, indicating that, at least, some U1 repeats are tandemly arrayed. High conservation was observed in the first four families, with most species carrying a single U1 cluster, frequently located in the third or fourth longest autosome. By contrast, extensive variation was observed among Acrididae, from a single chromosome pair carrying U1 to all chromosome pairs carrying it, with occasional occurrence of two or more clusters in the same chromosome. DNA sequence analysis in Eyprepocnemis plorans (species carrying U1 clusters on seven different chromosome pairs) and Locusta migratoria (carrying U1 in a single chromosome pair) supported the coexistence of functional and pseudogenic lineages. One of these pseudogenic lineages was truncated in the same nucleotide position in both species, suggesting that it was present in a common ancestor to both species. At least in E. plorans, this U1 snDNA pseudogenic lineage was associated with 5S rDNA and short interspersed elements (SINE)-like mobile elements. Given that we conclude in grasshoppers that the U1 snDNA had evolved under the birth-and-death model and that its intragenomic spread might be related with mobile elements. PMID:25248465

Dicty_cDB: Contig-U11847-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 00512_699( AE000512 |pid:none) Thermotoga maritima MSB8, comple... 42 0.065 JC2551( JC2551 ) tropomyosin alpha chain - axolotl...AltName: Full=Myosin heavy chai... 42 0.11 JC6199( JC6199 ) alpha-tropomyosin S-1 - axolotl &U33450_1(U33450

Evaluation Study of the Monitoring Result for River Water Environment Component Around U Mining Research Area at, Kalan West Kalimantan from 1997/1998 up to 2002

International Nuclear Information System (INIS)

Achmad-Sorot-Soediro

2004-01-01

The Uranium research which have been carrying out since 1980/1981 up to now and uranium processing activities which was carried out since 1981/1982 to 1996/1997 have probably decreased environment quality. Therefore the environment component would be monitored through Kalan river water every year. From 1997/1998 up to 2002 the environment quality decreased. So, the environment quality is necessarily to be evaluated doing those period. Aim of study is to recover development information of environmental quality at river water component up to 5 years. Evaluation has been done by comparing research the yearly data obtained and construct the correlation with U mining and processing activities on that year. BOD, COD, As, Ca, Mg, Fe, Ni, Zn, Cu, Pb, Mn, Mo and radioactivity of U, Th and Ra content with in Kalan water river tends to become lower in accordance with the decreasing of U mining and processing research activities. (author)

China-U.S. Relations: Current Issues and Implications for U.S. Policy

National Research Council Canada - National Science Library

Dumbaugh, Kerry

2007-01-01

.... policy makers have adopted tougher stances on issues involving China and U.S.-China relations, concerned about the impact of the PRC's strong economic growth and a more assertive international diplomacy...

Indonesias New Maritime Ambitions: Implications for U.S.Indonesian Engagement

Science.gov (United States)

2015-06-26

for U.S.–Indonesian Engagement Bronson Percival, Senior Advisor, CNA Strategic Studies Summary and Introduction1 Indonesia lies at the heart of...the Indo-Pacific region. Its new president, Joko Widodo, wants to transform Indonesia into a “global maritime fulcrum” between the Indian and Pacific...Oceans. He will struggle to overcome entrenched elites, a sluggish bureaucracy, endemic corruption , limited resources, and the army’s traditional

RA reactor operation in 1991, Part 1; Deo 1 - Pogon i odrzavanje nuklearnog reaktora RA u 1991. godini

Energy Technology Data Exchange (ETDEWEB)

Sotic, O; Cupac, S; Sulem, B; Zivotic, Z; Majstorovic, D; Sanovic, V [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1992-01-01

During the previous period RA reactor was not operated because the Committee of Serbian ministry for health and social care has cancelled the operation licence in August 1984. The reason was the non existing emergency cooling system and lack of appropriate filters in the special ventilation system. Control and maintenance of the reactor instrumentation and tools was done regularly but dependent on the availability of the spare parts. In order to enable future reliable operation of the RA reactor, according to new licensing regulations, during 1991, three major tasks were fulfilled: building of the new emergency cooling system, reconstruction of the existing ventilation system, and renewal of the reactor power supply system. Renewal of the reactor instrumentation was started but but it is behind the schedule in 1991 because the delivery of components from USSR is late. Production of this instruments is financed by the IAEA according to the contract signed in December 1988 with Russian Atomenergoexport. According to this contract, it has been planned that the RA reactor instrumentation should be delivered to the Vinca Institute by the end of 1990. Since then any delivery of components to Yugoslavia was stopped because of the temporary embargo imposed by the IAEA for political reasons. In 1991 most of the existing RA reactor instrumentation was dismantled, only the part needed for basic measurements when reactor is not operated, was maintained. Training of the existing personnel was done regularly, but lack of financial support prevented employment of new workers that would be needed for operation in shifts and regular maintenance. [Serbo-Croat] U proteklom periodu reaktor RA nije bio u pogonu zato sto je 30. jula Republicki komitet za zdravlje i socijalnu politiku republike Srbije, zabranio njegov rad zbog toga sto reaktor ne poseduje sistem za udesno hladjenje i ne poseduje odgovarajuce filtere u sistemu specijalne ventilacije. Kako bi se ubuduce mogao obezbediti

Determination of 234U and 238U activity concentrations in groundwaters from three deep wells drilled in Itu Intrusive Suite (SP)

International Nuclear Information System (INIS)

Souza, Francisca de

2006-01-01

Activity concentrations of ( 234 U) and ( 238 U) were determined in groundwaters drawn from three deep wells drilled in rocks from Itu Intrusive Suite (SP), two located in Salto town (S and SY wells) and the other one in Itu (I well). Sampling was done from September, 2004 to December, 2005, and twelve samples of each well were collected monthly. For those determinations alpha spectrometry technique was used, providing high precision results, as shown by the very good agreement of the data obtained in the analyses of 23 duplicates. The waters from the three wells presented a considerable enrichment of 234 U in relation to 238 U, indicating an important radioactive disequilibrium of these isotopes. In well I, the activity concentrations of ( 238 U) varied from (1,06 +- 0,03) to (2,1+- 0,2) mBq/L and those of ( 234 U) spanned from (3,1 +- 0,2) to (6,0 +- 0,4) mBq/L, whereas ( 234 U/ 238 U) activity ratios did not present significant variation, during the sampling time interval, presenting an average of 2,8 +- 0,1. The S waters showed the lowest uranium concentrations and the largest diversity of ( 238 U) and ( 234 U) activity concentrations, which varied from (0,26 +- 0,02) to (1,07+- 0,08) mBq/L and from (1,8 +- 0,1) to (7,0 +- 0,5) mBq/L, respectively, and also presented variable ( 234 U/ 238 U) activity ratios, spanning from (2,79 +- 0,07) to (8,1+- 0,3). In SY well, ( 238 U) activities varied between (0,8 +- 0,1) and (4,2 +- 0,3) mBq/L and those ones of ( 234 U) from (14 +- 1) to (53 +- 4) mBq/L, whereas ( 234 U/ 238 U) ratios fell in the interval from 12,6 +- 0,3 to 18,3 +- 0,4, with the highest activities of both radioisotopes registered during the dry season and the lowest ones in the rainy time period. The ( 234 U/ 238 U) activity ratios, which were invariable during sampling period of well I, indicated the contribution of rainfall to recharge the aquifer. The observed correlation between those ratios and uranium concentrations, for S and SY wells, showed

Analytical approach to (2+1)-dimensional Boussinesq equation and (3+1)-dimensional Kadomtsev-Petviashvili equation

Energy Technology Data Exchange (ETDEWEB)

Sariaydin, Selin; Yildirim, Ahmet [Ege Univ., Dept. of Mathematics, Bornova-Izmir (Turkey)

2010-05-15

In this paper, we studied the solitary wave solutions of the (2+1)-dimensional Boussinesq equation u{sub tt} - u{sub xx} - u{sub yy} - (u{sup 2}){sub xx} - u{sub xxxx} = 0 and the (3+1)-dimensional Kadomtsev-Petviashvili (KP) equation u{sub xt} - 6u{sub x}{sup 2} + 6uu{sub xx} - u{sub xxxx} - u{sub yy} - u{sub zz} = 0. By using this method, an explicit numerical solution is calculated in the form of a convergent power series with easily computable components. To illustrate the application of this method numerical results are derived by using the calculated components of the homotopy perturbation series. The numerical solutions are compared with the known analytical solutions. Results derived from our method are shown graphically. (orig.)

Dicty_cDB: Contig-U16215-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 90 |pid:none) Maxillaria adendrobium voucher JBL... 34 9.8 EU123651_1( EU123651 |... |pid:none) Dichaea poicillantha voucher M. Bl... 34 9.8 EU214391_1( EU214391 |pid:none) Maxillaria adendrobium...87 |pid:none) Maxillaria adendrobium voucher JBL... 34 9.8 EU214423_1( EU214423 |pid:none) Pescatoria cerina... 34 9.8 EU214389_1( EU214389 |pid:none) Maxillaria adendrobium voucher JBL... 34 9.8 >U77053_1( U77053 |pid:

7 CFR 51.1146 - U.S. No. 1 Russet.

Science.gov (United States)

2010-01-01

.... (a) For tolerances see § 51.1151. (b) Internal quality: Lots meeting the internal requirements for “U... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 1 Russet. 51.1146 Section 51.1146 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...

7 CFR 51.1144 - U.S. No. 1 Golden.

Science.gov (United States)

2010-01-01

...) For tolerances see § 51.1151. (b) Internal quality: Lots meeting the internal requirements for “U.S... 7 Agriculture 2 2010-01-01 2010-01-01 false U.S. No. 1 Golden. 51.1144 Section 51.1144 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing...

Fragmented Production in East Asia: What are Their Implications for the Sino-U.S. Trade

Directory of Open Access Journals (Sweden)

Lin Feiting

2017-01-01

Full Text Available Fragmented production means organization of production in which different stages of production are divided among different suppliers that are located in different countries. East Asia is one of the most important manufacturing centers in the world, China imports components from other East Asian economies for processing and then exports to the United States. The volume of export from China to the United States increase in traditional international trade statistics. Therefore, the solution of Sino-U.S. trade imbalance should pay attention to the relationship between the United States, China, and other East Asian economies.

Kinetics and mechanism of photoaccelerated isotope exchange between U(VI) and U(IV) in oxalate solutions

International Nuclear Information System (INIS)

Shaban, I.S.; Owreit, M.F.; Nikitenko, S.I.

1992-01-01

A kinetic study of thermal and photoaccelerated U(IV)-U(VI) isotope exchange has been carried out in oxalate solutions at 11-40 deg C. The rate and quantum yield were determined as a function of U(IV), U(VI) and oxalate concentration, wavelength of incident light, temperature and absorbed dose of γ-radiation. The kinetic equations for thermal and photoaccelerated exchange have been obtained. It was assumed that the mechanism of exchange involves formation of U(V) as an intermediate, followed by slow exchange between U(V) and U(IV). The isokinetic dependence confirms the identity of limiting stages for thermal and photostimulated exchange. The upper component of photoexcited T 1 level of uranyl is supposed to be the most reactive in the process of U(V) generation. It was observed that the small doses of γ-radiation evoke the acceleration of isotope exchange, however, at D>100 krad the rate of exchange is reduced to the level of thermal exchange. (author) 8 refs.; 4 figs.; 2 tabs

Interdiffusion between U-Pu-Zr fuel and HT9 cladding

International Nuclear Information System (INIS)

Keiser, D.D. Jr.; Petri, M.C.

1994-01-01

As part of systematic interdiffusion studies of fuel-cladding compatibility in the integral Fast Reactor, a solid-solid diffusion couple was assembled with U-22Pu-23 1 Zr fuel and HT9 2 cladding and annealed at 650 degrees C for 100 hours. The couple was examined for diffusion structure development using a scanning electron microscope equipped with an energy dispersive x-ray analyzer (SEM-EDX). Point-by-point and linescan analysis was used to generate composition profiles and diffusion paths. From the composition profiles, average effective interdiffusion coefficients were calculated for individual components on both sides of the Matano plane. Results from this investigation indicate that the same types of phases as would be expected from binary U-Fe, Pu-Fe, and Zr-Fe phase diagrams develop in this couple; and U and Pu are the fastest diffusing fuel components and Fe is the fastest diffusing cladding component. Compared with diffusion couples with binary (U-Zr) fuel, the addition of Pu greatly enhanced the extent of diffusion and affected the types of phases observed

Bose-Fermi U(6/2j+1) supersymmetries and high-spin anomalies

International Nuclear Information System (INIS)

Morrison, I.; Jarvis, P.D.

1985-01-01

A supersymmetric extension of the interacting boson model (IBM) is constructed to describe high-spin anomalies in both even- and odd-mass spectra of the Hg, Pt region (190<=A<=200). Supergroup chains such as U(6/2j+1)containsOsp(6/2j+1)containsO(6)xSp(2j+1)... or U(6/2j+1)containsU(5/2j+1)xU(1)containsOsp(5/2j+1)... incorporate a single j-shell fermion in addition to the usual 's' and 'd' bosons (L=0 and L=2). The orthosympletic supergroup reflects the strong pairing force in the subspace of the fermion intruder level. The model agrees favourably with experiment and microscopic calculation. (orig.)

Multipole components of 235U photofission

International Nuclear Information System (INIS)

Carvalheiro, Z.

1985-01-01

The absolute electrofission cross section for 235 U has been experimentally obtained in the energy range 5.8 - 18.0 MeV, using the electron beam of the Linear Accelerator of Institute of Physics of the University of Sao Paulo. From a combined analysis of this cross section and a previously measured photofission cross section, using virtual photon spectra calculated in the Distorted Wave Born Approximation (DWBA), the '' non electric dipole photofission'' cross section σ NDE γ,f (ω) has been obtained, which contains all multipolarities allowed by the reaction Kinematics, except El. This cross section presents a resonant shape, probably associated with the Giant Quadrupole Resonance (GQR). Once the fission channel exhausts a great amount of the Energy Weighted Sum Rule (EWSR), it is therefore the major decay mode of the GQR. All these aspects agree with the ones verified for the other Uranium isotopes previously analysed in this Laboratory. (author) [pt

A novel homozygous truncating GNAT1 mutation implicated in retinal degeneration.

LENUS (Irish Health Repository)

Carrigan, Matthew

2016-04-01

The GNAT1 gene encodes the α subunit of the rod transducin protein, a key element in the rod phototransduction cascade. Variants in GNAT1 have been implicated in stationary night-blindness in the past, but unlike other proteins in the same pathway, it has not previously been implicated in retinitis pigmentosa.

39 CFR 211.1 - Disposition of former title 39, U.S.C.

Science.gov (United States)

2010-07-01

... 39 Postal Service 1 2010-07-01 2010-07-01 false Disposition of former title 39, U.S.C. 211.1... REGULATIONS § 211.1 Disposition of former title 39, U.S.C. Except as otherwise continued in effect as postal regulations, all provisions of former title 39, U.S.C., which were continued in effect as regulations of the...

New hierarchy in GUTs based on SU(n,1)/SU(n)U(1) SUGRA

International Nuclear Information System (INIS)

Hayashi, M.J.; Murayama, Akihiro

1985-01-01

Grand unified theories (GUTs) in the framework of SU(n, 1)/SU(n) x U(1) supergravity are discussed which naturally generate a new hierarchy, Msub(P) (Planck mass): Msub(X) (GUT scale):msub(3/2) (gravitino mass):m (explicit supersymmetry breaking scale)=1:epsilon:epsilon 3 :epsilon 5 α(Msub(X)) with Msub(P) as the only input mass scale. The SUSY breaking scale m is expected to be fixed radiatively as mproportionalMsub(W), i.e., epsilonproportional10 -3 . Our method would be applicable to any GUT based on SU(n, 1)/SU(n) x U(1) supergravity. (orig.)

The flipped SU(5)xU(1) string model revamped

Energy Technology Data Exchange (ETDEWEB)

Antoniadis, I.; Ellis, J.; Hagelin, J.S.; Nanopoulos, D.V. (European Organization for Nuclear Research, Geneva (Switzerland))

1989-11-02

We present a refined version of our three-generation flipped SU(5)xU(1) string model with the following properties. The complete massless spectrum is derived and shown to be free of all gauge and mixed anomalies apart from a single anomalous U(1). The imaginary part of the dilaton supermultiplet is eaten by the anomalous U(1) gauge boson, and the corresponding D-term is cancelled by large VEVs for singlet fields that break surplus U(1) gauge factors, leaving a supersymmetric vacuum with an SU(5)xU(1) visible gauge group and an SO(10)xSO(6) hidden gauge group. There are sufficient Higgs multiplets to break the visible gauge symmetry down to the standard model in an essentially unique way. All trilinear superpotential couplings have been calculated and there are in particular some giving m{sub t}, m{sub b}, m{sub tau}ne0. A renormalization group analysis shows that m{sub t}<190 GeV and m{sub b}{approx equal}3m{sub tau}. Light Higgs doublets are split automatically from heavy Higgs triplets, leaving no residual dimension-five operators for baryon decay, and the baryon lifetime tau{sub B} {approx equal} 2x10{sup 34{plus minus}2} yr. There are no tree-level flavour-changing neutral currents, but muyieldsegamma may occur at a detectable level: B(muyieldsegamma){proportional to} 10{sup -11}-10{sup -14}. (orig.).

Baryon number generation in a flipped SU(5) x U(1) model

International Nuclear Information System (INIS)

Campbell, B.; Hagelin, J.; Nanopoulos, D.V.; Olive, K.A.

1988-01-01

We consider the possibilities for generating a baryon asymmetry in the early universe in a flipped SU(5) x U(1) model inspired by the superstring. Depending on the temperature of the radiation background after inflation we can distinguish between two scenarios for baryogenesis: (1) After reheating the original SU(5) x U(1) symmetry is restored, or there was no inflation at all; (2) reheating after inflation is rather weak and SU(5) x U(1) is broken. In either case the asymmetry is generated by the out-of-equilibrium decays of a massive SU(3) x SU(2) x U(1) singlet field φ m . In the flipped SU(5) x U(1) model, gauge symmetry breaking is triggered by strong coupling phenomena, and is in general accompanied by the production of entropy. We examine constraints on the reheating temperature and the strong coupling scale in each of the scenarios. (orig.)

U.S. Offshore Wind Manufacturing and Supply Chain Development

Energy Technology Data Exchange (ETDEWEB)

Hamilton, Bruce Duncan [Navigant Consulting, Inc.

2013-02-22

The objective of the report is to provide an assessment of the domestic supply chain and manufacturing infrastructure supporting the U.S. offshore wind market. The report provides baseline information and develops a strategy for future development of the supply chain required to support projected offshore wind deployment levels. A brief description of each of the key chapters includes: » Chapter 1: Offshore Wind Plant Costs and Anticipated Technology Advancements. Determines the cost breakdown of offshore wind plants and identifies technical trends and anticipated advancements in offshore wind manufacturing and construction. » Chapter 2: Potential Supply Chain Requirements and Opportunities. Provides an organized, analytical approach to identifying and bounding the uncertainties associated with a future U.S. offshore wind market. It projects potential component-level supply chain needs under three demand scenarios and identifies key supply chain challenges and opportunities facing the future U.S. market as well as current suppliers of the nation’s land-based wind market. » Chapter 3: Strategy for Future Development. Evaluates the gap or competitive advantage of adding manufacturing capacity in the U.S. vs. overseas, and evaluates examples of policies that have been successful . » Chapter 4: Pathways for Market Entry. Identifies technical and business pathways for market entry by potential suppliers of large-scale offshore turbine components and technical services. The report is intended for use by the following industry stakeholder groups: (a) Industry participants who seek baseline cost and supplier information for key component segments and the overall U.S. offshore wind market (Chapters 1 and 2). The component-level requirements and opportunities presented in Section 2.3 will be particularly useful in identifying market sizes, competition, and risks for the various component segments. (b) Federal, state, and local policymakers and economic development

Nonminimal quartic inflation in classically conformal U(1 ) X extended standard model

Science.gov (United States)

Oda, Satsuki; Okada, Nobuchika; Raut, Digesh; Takahashi, Dai-suke

2018-03-01

We propose quartic inflation with nonminimal gravitational coupling in the context of the classically conformal U(1 ) X extension of the standard model (SM). In this model, the U(1 ) X gauge symmetry is radiatively broken through the Coleman-Weinberg mechanism, by which the U(1 ) X gauge boson (Z' boson) and the right-handed Majorana neutrinos acquire their masses. We consider their masses in the range of O (10 GeV )-O (10 TeV ) , which are accessible to high-energy collider experiments. The radiative U(1 ) X gauge symmetry breaking also generates a negative mass squared for the SM Higgs doublet, and the electroweak symmetry breaking occurs subsequently. We identify the U(1 ) X Higgs field with inflaton and calculate the inflationary predictions. Because of the Coleman-Weinberg mechanism, the inflaton quartic coupling during inflation, which determines the inflationary predictions, is correlated to the U(1 ) X gauge coupling. With this correlation, we investigate complementarities between the inflationary predictions and the current constraint from the Z' boson resonance search at the LHC Run 2 as well as the prospect of the search for the Z' boson and the right-handed neutrinos at the future collider experiments.

Underground storage tank 431-D1U1, Closure Plan

Energy Technology Data Exchange (ETDEWEB)

Mancieri, S.

1993-09-01

This document contains information about the decommissioning of Tank 431-D1U1. This tank was installed in 1965 for diesel fuel storage. This tank will remain in active usage until closure procedures begin. Soils and ground water around the tank will be sampled to check for leakage. Appendices include; proof of proper training for workers, health and safety briefing record, task hazard analysis summary, and emergency plans.

Dicty_cDB: Contig-U16279-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AB254080 |pid:none) Streptomyces kanamyceticus kanam... 47 0.002 CP000964_3229( CP000964 |pid:none) Klebsiella pneumoni...nkkmtkpvasyeldekrfltllgkligetenlqnrppalipiednag rhviealtpylkanggvleleqvhcdpvnypkrgniiie... letters Score E Sequences producing significant alignments: (bits) Value Contig-U16279-1 (Contig-U16279-1Q....................................................done Score E Sequences producing significant alignments: (bits) Val....................................done Score E Sequences producing significant alignments: (bits) Val

A model with isospin doublet U(1)D gauge symmetry

Science.gov (United States)

Nomura, Takaaki; Okada, Hiroshi

2018-05-01

We propose a model with an extra isospin doublet U(1)D gauge symmetry, in which we introduce several extra fermions with odd parity under a discrete Z2 symmetry in order to cancel the gauge anomalies out. A remarkable issue is that we impose nonzero U(1)D charge to the Standard Model Higgs, and it gives the most stringent constraint to the vacuum expectation value of a scalar field breaking the U(1)D symmetry that is severer than the LEP bound. We then explore relic density of a Majorana dark matter candidate without conflict of constraints from lepton flavor violating processes. A global analysis is carried out to search for parameters which can accommodate with the observed data.

Relationship between kidney burden and radiation dose from chronic ingestion of U: Implications for radiation standards for the public

International Nuclear Information System (INIS)

Kocher, D.C.

1989-01-01

Metabolic models for U in adults recommended by Wrenn et al. (1985) and the International Commission on Radiological Protection (ICRP 1979a) were used to study the relationship between kidney burden and radiation dose from chronic ingestion of soluble 238U or natural U and whether current radiation standards for the public provide adequate protection against chemical toxicity from U in the kidney. We assumed that the threshold concentration for chemical toxicity is 1 microgram of U g-1 of kidney and that a safety factor of 10 should be applied in limiting kidney burdens for maximally exposed individuals in the general public. We found that a limit on annual effective dose equivalent of 1 mSv (0.1 rem) for chronic exposures of the public from all sources, as recommended by the ICRP (1985) and the National Council on Radiation Protection and Measurements (NCRP 1987), corresponds to concentrations of U in the kidney from chronic ingestion that exceed the assumed threshold for chemical toxicity of 1 microgram g-1 only for 238U using the metabolic model of the ICRP (1979a). However, using either metabolic model (ICRP 1979a; Wrenn et al. 1985), the predicted concentrations of U in the kidney exceeded the limit of 0.1 microgram g-1, based on the assumed safety factor for protection of the public, for both 238U and natural U. From these results, we concluded that chemical toxicity should be considered in developing health protection standards for the public for ingestion of soluble 238U or natural U. Environmental radiation standards for certain practices established by the U.S. Environmental Protection Agency and Nuclear Regulatory Commission (EPA 1987a, 1987b, 1987c, 1987d; NRC 1988a) are consistent with a limit on annual effective dose equivalent of 0.25 mSv (25 mrem) per practice. If the metabolic model of Wrenn et al. 27 references

The Role of Progesterone and a Novel Progesterone Receptor, Progesterone Receptor Membrane Component 1, in the Inflammatory Response of Fetal Membranes to Ureaplasma parvum Infection.

Directory of Open Access Journals (Sweden)

Liping Feng

Full Text Available Ureaplasma parvum (U. parvum is gaining recognition as an important pathogen for chorioamnionitis and preterm premature rupture of membranes. We aimed to investigate the roles of progesterone (P4 and a novel progesterone receptor, progesterone receptor membrane component 1 (PGRMC1, in the response of fetal membranes to U. parvum. Fetal membrane cells (amnion, chorion and decidua were isolated and confirmed to be free of Mycoplasmataceae. Cells were treated with U. parvum (5x106 CFU, and adherence was quantified by qPCR. Amnion and chorion cells were transfected with scrambled siRNA or validated PGRMC1 siRNA for 72h. Cells were then treated with U. parvum for 4h with or without pretreatment with P4 (10-7 M or ethanol for 1h. Interleukin-8 (IL-8, matrix metalloproteinase 9 (MMP9 and cyclooxygenase (COX-2 mRNA expression were quantified by qRT-PCR. Culture medium was harvested and analyzed for IL-8 and prostaglandin (PGE2 secretion by ELISA and MMP9 activity by zymography. U. parvum had a mean adherence of 15.0±0.6%, 16.9± 3.7% and 4.7±0.3% in cultured amnion, chorion and decidua cells, respectively. Exposure to U. parvum elicited significant inflammatory responses including induction of IL-8, COX-2, PGE2 and MMP9. A possible role of PGRMC1 was identified in the inhibition of U. parvum-stimulated COX-2 and MMP9 mRNA expression in chorion cells and MMP9 activity in amnion cells. On the other hand, it might enhance the U. parvum-stimulated IL-8 protein secretion in amnion cells. P4, mediated through PGRMC1, significantly inhibited U. Parvum-induced MMP9 mRNA and COX-2 mRNA expression in chorion cells. P4 appeared to attenuate U. parvum induced IL-8 mRNA expression in chorion cells, but this P4 effect might not mediated through PGRMC1. In summary, U. parvum preferentially adheres to and induces inflammatory responses in chorion and amnion cells. P4 and PGRMC1 appear to differentially modulate the inflammatory responses induced by U. parvum among

A reduction of the globalization and U(1)-covering

International Nuclear Information System (INIS)

Tran Dao Dong.

1993-03-01

We suggest a reduction of the globalization and multidimensional quantization to the case of reductive Lie groups by lifting to U(1)-covering. our construction is connected with M. Duflo's third method for algebraic groups. From a reductive datum of the given real algebraic Lie group we firstly construct geometric complexes with respect to U(1)-covering by using the unipotent positive distributions. Then we describe in terms of local cohomology the maximal globalization of Harish-Chandra modules which correspond to the geometric complexes. (author). 9 refs

The Equation Δ u + ∇φ· ∇u = 8πc(1-heu) on a Riemann Surface

International Nuclear Information System (INIS)

Wang Meng

2009-12-01

Let M be a compact Riemann surface, h(x) a positive smooth function on M, and φ(x) a smooth function on M which satisfies that ∫ M e φ dV g = 1. In this paper, we consider the functional J(u) = 2 1 ∫ M |∇u| 2 e φ dV g +8πc ∫ M ue φ dV g -8πclog ∫ M he u+φ dV g . We give a sufficient condition under which J achieves its minimum for c ≤ inf xelement ofM Φ(x). (author)

National Lesbian Health Care Survey: Implications for U Mental Health Care.

Science.gov (United States)

Bradford, Judith; And Others

1994-01-01

Findings from national survey of approximately 1,925 U lesbians revealed that over 50% had considered suicide and 18% had attempted suicide; 37% had been physically abused; 32% had been raped/sexually attacked; and 19% had been in incestuous relationships. Almost one-third used tobacco daily, and about 30% drank alcohol more than once a week.…

Dicty_cDB: Contig-U03802-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available T-2KB Trichosurus... 48 3e-11 4 ( DY894715 ) CeleSEQ14351 Cunninghamella elegans pBluescript (... 58 4e-11 3... letters Score E Sequences producing significant alignments: (bits) Value Contig-U03802-1 (Contig-U... letters Searching..................................................done Score E Sequences producing significant al...1... 62 4e-05 1 ( EJ306703 ) 1095390099376 Global-Ocean-Sampling_GS-27-01-01-1... 62 4e-05 1 ( CP000238 ) Baumannia cicadellinicola... AY241394 |pid:none) Melopsittacus undulatus Mn superox... 244 2e-63 AF329270_1( AF329270 |pid:none) Gallus gallus manganes

Non-aqueous removal of sodium from reactor components

Energy Technology Data Exchange (ETDEWEB)

Welch, F H; Steele, O P [Rockwell International, Atomics International Division, Canoga Park (United States)

1978-08-01

Reactor components from sodium-cooled systems. whether radioactive or not, must have the sodium removed before they can be safely handled for 1) disposal, 2) examination and test, or 3) decontamination, repair, and requalification. In the latter two cases, the sodium must be removed in a manner which will not harm the component. and prevent future use. Two methods for sodium removal using non-aqueous techniques have been studied extensively in the U.S.A. in the past few years: the Alcohol Process, which uses a fully denatured ethanol to react away the sodium; and the Evaporative Process, which uses heat and vacuum to evaporate the sodium from the component.

Non-aqueous removal of sodium from reactor components

International Nuclear Information System (INIS)

Welch, F.H.; Steele, O.P.

1978-01-01

Reactor components from sodium-cooled systems. whether radioactive or not, must have the sodium removed before they can be safely handled for 1) disposal, 2) examination and test, or 3) decontamination, repair, and requalification. In the latter two cases, the sodium must be removed in a manner which will not harm the component. and prevent future use. Two methods for sodium removal using non-aqueous techniques have been studied extensively in the U.S.A. in the past few years: the Alcohol Process, which uses a fully denatured ethanol to react away the sodium; and the Evaporative Process, which uses heat and vacuum to evaporate the sodium from the component

Sunburn among active component service members, U.S. Armed Forces, 2002-2013.

Science.gov (United States)

2014-07-01

Sunburn is caused by acute overexposure to ultraviolet (UV) radiation directly from the sun or from artificial UV sources. Service members are at risk of excessive exposure to sunlight due to the nature of their military duties, which often involve working and training outdoors, and deployment to environments where UV radiation is more intense. From January 2002 through December 2013, a total of 19,172 incident cases of clinically significant sunburn were diagnosed among active component service members. Most of the cases (80.2%) were first degree sunburn. The incidence rates of sunburn diagnoses were higher among females, white non-Hispanics, younger age groups, individuals in the Marine Corps or Army, and among enlisted service members. Additionally, the rate among recruits was more than 3.5 times the rate for non-recruits. Sixty-one percent of all diagnosed cases occurred from May through July. Sunburn cases occurred in all areas of the U.S., particularly near major recruit and combat training locations. Service members are strongly advised to practice sun safety as a part of heat illness prevention, including properly using broad-spectrum sunscreen, finding or constructing shade during work and rest, wearing protective clothing and military combat eye protection items, and avoiding tanning booths and sun lamps.

SU(5) x U(1) phenomenology: Theorems on neutral-current analysis

International Nuclear Information System (INIS)

Zee, A.; Kim, J.E.

1980-01-01

We embed the SU(5) unified theory of Georgi and Glashow in a U(5) theory. This may result from the breaking of an SU(N), N>5, theory or of a GL(5,c) theory. At low energy this leads to an SU(2) x U(1) x U(1) electroweak theory. We show that, with a suitable choice of Higgs representations, the predictions of this theory for neutral-current experiments are characterized by three parameters. For appropriate values of these parameters, the predictions are practically indistinguishable from the standard SU(2) x U(1) theory. Certain theorems on the analysis of neutral-current interactions are proved. (Section V is independent for readers who are interested only in the theorems.) More accurate neutral-current measurement might answer the question of whether SU(5) x U(1) is relevant. Possible verification of the present electroweak theory can result from (roughly) an order suppression relative to the standard prediction on the asymmetries in e + e - → μ + μ - and discovery of two Z bosons around 90 --100 GeV. GL(n,c) gauge theories are formulated in the Appendix

Symmetry breaking of u(6/2j+1) supersymmetric models

International Nuclear Information System (INIS)

Baake, M.; Reinicke, P.

1985-09-01

In this paper, we present the group theory of models with broken u(6/2j+1) supersymmetry described by the chain u(6/2j+1) contains usub(B)(6) x usub(F)(2j+1) contains usub(B)(6) x spsub(F)(2j+1) contains ... contains sosub(B)(3) x susub(F)(2) contains susub(B+F)(2) which has recently been suggested for application to nuclear physics. We present all invariants that are needed for the construction of the general Hamiltonian for this model. (orig.)

Library thermohydraulic components for training simulators

International Nuclear Information System (INIS)

Castelao Caruana, M. J.; Di Benedetto, A.; Pierini, J.P.

2013-01-01

The thermohydraulic components Library was modeled in MatLab/Simulink®. This library owns Pipe type components (pump, control valve and / or heaters), storage tanks (Open, Closed and Equilibrium Water Vapor-Air) and Heat Exchangers (Co-Current, Counter-Current and U-tubes). Each component can be attached to other components through the component library Header, in order to create a more complex thermal-hydraulic system which in turn can interact with other thermal-hydraulic systems. (author)

Footprinting analysis of interactions between the largest eukaryotic RNase P/MRP protein Pop1 and RNase P/MRP RNA components.

Science.gov (United States)

Fagerlund, Robert D; Perederina, Anna; Berezin, Igor; Krasilnikov, Andrey S

2015-09-01

Ribonuclease (RNase) P and RNase MRP are closely related catalytic ribonucleoproteins involved in the metabolism of a wide range of RNA molecules, including tRNA, rRNA, and some mRNAs. The catalytic RNA component of eukaryotic RNase P retains the core elements of the bacterial RNase P ribozyme; however, the peripheral RNA elements responsible for the stabilization of the global architecture are largely absent in the eukaryotic enzyme. At the same time, the protein makeup of eukaryotic RNase P is considerably more complex than that of the bacterial RNase P. RNase MRP, an essential and ubiquitous eukaryotic enzyme, has a structural organization resembling that of eukaryotic RNase P, and the two enzymes share most of their protein components. Here, we present the results of the analysis of interactions between the largest protein component of yeast RNases P/MRP, Pop1, and the RNA moieties of the enzymes, discuss structural implications of the results, and suggest that Pop1 plays the role of a scaffold for the stabilization of the global architecture of eukaryotic RNase P RNA, substituting for the network of RNA-RNA tertiary interactions that maintain the global RNA structure in bacterial RNase P. © 2015 Fagerlund et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.

Fundamental U-Theory of Time. Part 1

Directory of Open Access Journals (Sweden)

Yuvraj J. Gopaul

2016-02-01

Full Text Available The Fundamental U-Theory of Time (Part 1 is an original theory that aims to unravel the mystery of what exactly is ‘time’. To date very few explanations, from the branches of physics or cosmology, have succeeded to provide an accurate and comprehensive depiction of time. Most explanations have only managed to provide partial understanding or at best, glimpses of its true nature. The U-Theory uses ‘Thought Experiments’ to uncover the determining characteristics of time. In part 1 of this theory, the focus is not on the mathematics as it is on the accuracy of the depiction of time. Moreover, it challenges current views on theoretical physics, particularly on the idea of ‘time travel’. Notably, it is a theory seeking to present a fresh approach for reviewing Einstein’s Theory of Relativity, while unlocking new pathways for upcoming research in the field of physics and cosmology.

Role of National Academies in radioactive waste disposal projects. Implications from the comparison of the science council of Japan with the U.S. National Academies

International Nuclear Information System (INIS)

Yamashita, Yuji; Tanaka, Satoru

2012-01-01

We made a descriptive inference about the role of the U.S. National Academies in the U.S. radioactive waste disposal projects on the basis of literature-based information and compared the U.S. National Academies with the Science Council of Japan to determine their implications on the progress of social acceptability of radioactive waste disposal projects in Japan. The descriptive inference was made as follows. We described the organizational characteristics of the U.S. National Academies and the U.S. federal governments related to the projects. We outlined the related bills and demonstrated chronologically the activities related to the projects by the U.S. National Academies and the U.S. Government. As a consequence, we identified some specific roles that the U.S. National Academies played in the U.S. radioactive waste disposal projects. The U.S. National Academies have acted not only as a scientific and engineering adviser for the governments but also as an anchor for some political decision making or judicial actions. Furthermore, we analyzed the credibility of the Science Council of Japan and the U.S. National Academies from the viewpoint that a reliable third party must exhibit fairness, expertise and continuity. From the results of the comparison, it was found that the Science Council of Japan has the possibility to become a reliable third party that can help the radioactive waste disposal projects in Japan. (author)

CENTRAL REGION COMPONENT1, a Novel Synaptonemal Complex Component, Is Essential for Meiotic Recombination Initiation in Rice[C][W

Science.gov (United States)

Miao, Chunbo; Tang, Ding; Zhang, Honggen; Wang, Mo; Li, Yafei; Tang, Shuzhu; Yu, Hengxiu; Gu, Minghong; Cheng, Zhukuan

2013-01-01

In meiosis, homologous recombination entails programmed DNA double-strand break (DSB) formation and synaptonemal complex (SC) assembly coupled with the DSB repair. Although SCs display extensive structural conservation among species, their components identified are poorly conserved at the sequence level. Here, we identified a novel SC component, designated CENTRAL REGION COMPONENT1 (CRC1), in rice (Oryza sativa). CRC1 colocalizes with ZEP1, the rice SC transverse filament protein, to the central region of SCs in a mutually dependent fashion. Consistent with this colocalization, CRC1 interacts with ZEP1 in yeast two-hybrid assays. CRC1 is orthologous to Saccharomyces cerevisiae pachytene checkpoint2 (Pch2) and Mus musculus THYROID RECEPTOR-INTERACTING PROTEIN13 (TRIP13) and may be a conserved SC component. Additionally, we provide evidence that CRC1 is essential for meiotic DSB formation. CRC1 interacts with HOMOLOGOUS PAIRING ABERRATION IN RICE MEIOSIS1 (PAIR1) in vitro, suggesting that these proteins act as a complex to promote DSB formation. PAIR2, the rice ortholog of budding yeast homolog pairing1, is required for homologous chromosome pairing. We found that CRC1 is also essential for the recruitment of PAIR2 onto meiotic chromosomes. The roles of CRC1 identified here have not been reported for Pch2 or TRIP13. PMID:23943860

Climate Change: Implications for South African Building Systems and Components

CSIR Research Space (South Africa)

Gibberd, Jeremy T

2017-12-01

Full Text Available to determine the implications of these changes for buildings. Proposals are made on how buildings may be adapted to climate change and recommendations on further research and development are outlined....

Regularity for 3D Navier-Stokes equations in terms of two components of the vorticity

Directory of Open Access Journals (Sweden)

Sadek Gala

2010-10-01

Full Text Available We establish regularity conditions for the 3D Navier-Stokes equation via two components of the vorticity vector. It is known that if a Leray-Hopf weak solution $u$ satisfies $$ ilde{omega}in L^{2/(2-r}(0,T;L^{3/r}(mathbb{R}^3quad hbox{with }01, $$ where $ilde{omega}$ form the two components of the vorticity, $omega =operatorname{curl}u$, then $u$ becomes the classical solution on $(0,T]$ (see [5]. We prove the regularity of Leray-Hopf weak solution $u$ under each of the following two (weaker conditions: $$displaylines{ ilde{omega}in L^{2/(2-r}(0,T;dot {mathcal{M}}_{2, 3/r}(mathbb{R}^3quad hbox{for }01,cr abla ilde{u}in L^{2/(2-r}(0,T;dot {mathcal{M}}_{2, 3/r}(mathbb{R}^3quad hbox{for }0leq r<1, }$$ where $dot {mathcal{M}}_{2,3/r}(mathbb{R}^3$ is the Morrey-Campanato space. Since $L^{3/r}(mathbb{R}^3$ is a proper subspace of $dot {mathcal{M}}_{2,3/r}(mathbb{R}^3$, our regularity criterion improves the results in Chae-Choe [5].

U1 snRNP Alteration and Neuronal Cell Cycle Reentry in Alzheimer Disease

Directory of Open Access Journals (Sweden)

Bing Bai

2018-03-01

Full Text Available The aberrancy of U1 small nuclear ribonucleoprotein (snRNP complex and RNA splicing has been demonstrated in Alzheimer’s disease (AD. Importantly, the U1 proteopathy is AD-specific, widespread and early-occurring, thus providing a very unique clue to the AD pathogenesis. The prominent feature of U1 histopathology is its nuclear depletion and redistribution in the neuronal cytoplasm. According to the preliminary data, the initial U1 cytoplasmic distribution pattern is similar to the subcellular translocation of the spliceosome in cells undergoing mitosis. This implies that the U1 mislocalization might reflect the neuronal cell cycle-reentry (CCR which has been extensively evidenced in AD brains. The CCR phenomenon explains the major molecular and cellular events in AD brains, such as Tau and amyloid precursor protein (APP phosphorylation, and the possible neuronal death through mitotic catastrophe (MC. Furthermore, the CCR might be mechanistically linked to inflammation, a critical factor in the AD etiology according to the genetic evidence. Therefore, the discovery of U1 aberrancy might strengthen the involvement of CCR in the AD neuronal degeneration.

Usb1 controls U6 snRNP assembly through evolutionarily divergent cyclic phosphodiesterase activities.

Science.gov (United States)

Didychuk, Allison L; Montemayor, Eric J; Carrocci, Tucker J; DeLaitsch, Andrew T; Lucarelli, Stefani E; Westler, William M; Brow, David A; Hoskins, Aaron A; Butcher, Samuel E

2017-09-08

U6 small nuclear ribonucleoprotein (snRNP) biogenesis is essential for spliceosome assembly, but not well understood. Here, we report structures of the U6 RNA processing enzyme Usb1 from yeast and a substrate analog bound complex from humans. Unlike the human ortholog, we show that yeast Usb1 has cyclic phosphodiesterase activity that leaves a terminal 3' phosphate which prevents overprocessing. Usb1 processing of U6 RNA dramatically alters its affinity for cognate RNA-binding proteins. We reconstitute the post-transcriptional assembly of yeast U6 snRNP in vitro, which occurs through a complex series of handoffs involving 10 proteins (Lhp1, Prp24, Usb1 and Lsm2-8) and anti-cooperative interactions between Prp24 and Lhp1. We propose a model for U6 snRNP assembly that explains how evolutionarily divergent and seemingly antagonistic proteins cooperate to protect and chaperone the nascent snRNA during its journey to the spliceosome.The mechanism of U6 small nuclear ribonucleoprotein (snRNP) biogenesis is not well understood. Here the authors characterize the enzymatic activities and structures of yeast and human U6 RNA processing enzyme Usb1, reconstitute post-transcriptional assembly of yeast U6 snRNP in vitro, and propose a model for U6 snRNP assembly.

Separating movement and gravity components in an acceleration signal and implications for the assessment of human daily physical activity.

Science.gov (United States)

van Hees, Vincent T; Gorzelniak, Lukas; Dean León, Emmanuel Carlos; Eder, Martin; Pias, Marcelo; Taherian, Salman; Ekelund, Ulf; Renström, Frida; Franks, Paul W; Horsch, Alexander; Brage, Søren

2013-01-01

Human body acceleration is often used as an indicator of daily physical activity in epidemiological research. Raw acceleration signals contain three basic components: movement, gravity, and noise. Separation of these becomes increasingly difficult during rotational movements. We aimed to evaluate five different methods (metrics) of processing acceleration signals on their ability to remove the gravitational component of acceleration during standardised mechanical movements and the implications for human daily physical activity assessment. An industrial robot rotated accelerometers in the vertical plane. Radius, frequency, and angular range of motion were systematically varied. Three metrics (Euclidian norm minus one [ENMO], Euclidian norm of the high-pass filtered signals [HFEN], and HFEN plus Euclidean norm of low-pass filtered signals minus 1 g [HFEN+]) were derived for each experimental condition and compared against the reference acceleration (forward kinematics) of the robot arm. We then compared metrics derived from human acceleration signals from the wrist and hip in 97 adults (22-65 yr), and wrist in 63 women (20-35 yr) in whom daily activity-related energy expenditure (PAEE) was available. In the robot experiment, HFEN+ had lowest error during (vertical plane) rotations at an oscillating frequency higher than the filter cut-off frequency while for lower frequencies ENMO performed better. In the human experiments, metrics HFEN and ENMO on hip were most discrepant (within- and between-individual explained variance of 0.90 and 0.46, respectively). ENMO, HFEN and HFEN+ explained 34%, 30% and 36% of the variance in daily PAEE, respectively, compared to 26% for a metric which did not attempt to remove the gravitational component (metric EN). In conclusion, none of the metrics as evaluated systematically outperformed all other metrics across a wide range of standardised kinematic conditions. However, choice of metric explains different degrees of variance in

Separating movement and gravity components in an acceleration signal and implications for the assessment of human daily physical activity.

Directory of Open Access Journals (Sweden)

Vincent T van Hees

Full Text Available INTRODUCTION: Human body acceleration is often used as an indicator of daily physical activity in epidemiological research. Raw acceleration signals contain three basic components: movement, gravity, and noise. Separation of these becomes increasingly difficult during rotational movements. We aimed to evaluate five different methods (metrics of processing acceleration signals on their ability to remove the gravitational component of acceleration during standardised mechanical movements and the implications for human daily physical activity assessment. METHODS: An industrial robot rotated accelerometers in the vertical plane. Radius, frequency, and angular range of motion were systematically varied. Three metrics (Euclidian norm minus one [ENMO], Euclidian norm of the high-pass filtered signals [HFEN], and HFEN plus Euclidean norm of low-pass filtered signals minus 1 g [HFEN+] were derived for each experimental condition and compared against the reference acceleration (forward kinematics of the robot arm. We then compared metrics derived from human acceleration signals from the wrist and hip in 97 adults (22-65 yr, and wrist in 63 women (20-35 yr in whom daily activity-related energy expenditure (PAEE was available. RESULTS: In the robot experiment, HFEN+ had lowest error during (vertical plane rotations at an oscillating frequency higher than the filter cut-off frequency while for lower frequencies ENMO performed better. In the human experiments, metrics HFEN and ENMO on hip were most discrepant (within- and between-individual explained variance of 0.90 and 0.46, respectively. ENMO, HFEN and HFEN+ explained 34%, 30% and 36% of the variance in daily PAEE, respectively, compared to 26% for a metric which did not attempt to remove the gravitational component (metric EN. CONCLUSION: In conclusion, none of the metrics as evaluated systematically outperformed all other metrics across a wide range of standardised kinematic conditions. However, choice

The SPF27 homologue Num1 connects splicing and kinesin 1-dependent cytoplasmic trafficking in Ustilago maydis.

Directory of Open Access Journals (Sweden)

Nikola Kellner

2014-01-01

Full Text Available The conserved NineTeen protein complex (NTC is an integral subunit of the spliceosome and required for intron removal during pre-mRNA splicing. The complex associates with the spliceosome and participates in the regulation of conformational changes of core spliceosomal components, stabilizing RNA-RNA- as well as RNA-protein interactions. In addition, the NTC is involved in cell cycle checkpoint control, response to DNA damage, as well as formation and export of mRNP-particles. We have identified the Num1 protein as the homologue of SPF27, one of NTC core components, in the basidiomycetous fungus Ustilago maydis. Num1 is required for polarized growth of the fungal hyphae, and, in line with the described NTC functions, the num1 mutation affects the cell cycle and cell division. The num1 deletion influences splicing in U. maydis on a global scale, as RNA-Seq analysis revealed increased intron retention rates. Surprisingly, we identified in a screen for Num1 interacting proteins not only NTC core components as Prp19 and Cef1, but several proteins with putative functions during vesicle-mediated transport processes. Among others, Num1 interacts with the motor protein Kin1 in the cytoplasm. Similar phenotypes with respect to filamentous and polar growth, vacuolar morphology, as well as the motility of early endosomes corroborate the genetic interaction between Num1 and Kin1. Our data implicate a previously unidentified connection between a component of the splicing machinery and cytoplasmic transport processes. As the num1 deletion also affects cytoplasmic mRNA transport, the protein may constitute a novel functional interconnection between the two disparate processes of splicing and trafficking.

İki uçlu bozukluk 1 ve iki uçlu bozukluk 2 depresyon tedavisi arasındaki farklar

OpenAIRE

Sayar, Kemal

2013-01-01

İki uçlu bozukluk 1 ve 2 depresyonları, klinik açıdan farklılıklar gösterebilmektedir. İki uçlu bozukluk 2 ve iki uçlu bozukluk 1 depresyonların tedavisi arasındaki farklar ise tartışmalı bir alandır. Henüz İki uçlu bozukluk 2 depresyon tedavisi konusunda yeterince kanıt birikmemişse de ilk veriler her iki durumun tedavisinde farklar olması gerektiğini düşündürmektedir. Özellikle antidepresan kullanımı konusunda dikkatli olmak gerekmektedir.

The recruitment of the U5 snRNP to nascent transcripts requires internal loop 1 of U5 snRNA.

Science.gov (United States)

Kim, Rebecca; Paschedag, Joshua; Novikova, Natalya; Bellini, Michel

2012-12-01

In this study, we take advantage of the high spatial resolution offered by the nucleus and lampbrush chromosomes of the amphibian oocyte to investigate the mechanisms that regulate the intranuclear trafficking of the U5 snRNP and its recruitment to nascent transcripts. We monitor the fate of newly assembled fluorescent U5 snRNP in Xenopus oocytes depleted of U4 and/or U6 snRNAs and demonstrate that the U4/U6.U5 tri-snRNP is not required for the association of U5 snRNP with Cajal bodies, splicing speckles, and nascent transcripts. In addition, using a mutational analysis, we show that a non-functional U5 snRNP can associate with nascent transcripts, and we further characterize internal loop structure 1 of U5 snRNA as a critical element for licensing U5 snRNP to target both nascent transcripts and splicing speckles. Collectively, our data support the model where the recruitment of snRNPs onto pre-mRNAs is independent of spliceosome assembly and suggest that U5 snRNP may promote the association of the U4/U6.U5 tri-snRNP with nascent transcripts.

11 CFR 101.1 - Candidate designations (2 U.S.C. 432(e)(1)).

Science.gov (United States)

2010-01-01

... 11 Federal Elections 1 2010-01-01 2010-01-01 false Candidate designations (2 U.S.C. 432(e)(1)). 101.1 Section 101.1 Federal Elections FEDERAL ELECTION COMMISSION GENERAL CANDIDATE STATUS AND... and address, party affiliation, and office sought, the District and State in which Federal office is...

Nonsyndromic cleft lip with or without cleft palate: Increased burden of rare variants within Gremlin-1, a component of the bone morphogenetic protein 4 pathway.

Science.gov (United States)

Al Chawa, Taofik; Ludwig, Kerstin U; Fier, Heide; Pötzsch, Bernd; Reich, Rudolf H; Schmidt, Gül; Braumann, Bert; Daratsianos, Nikolaos; Böhmer, Anne C; Schuencke, Hannah; Alblas, Margrieta; Fricker, Nadine; Hoffmann, Per; Knapp, Michael; Lange, Christoph; Nöthen, Markus M; Mangold, Elisabeth

2014-06-01

The genes Gremlin-1 (GREM1) and Noggin (NOG) are components of the bone morphogenetic protein 4 pathway, which has been implicated in craniofacial development. Both genes map to recently identified susceptibility loci (chromosomal region 15q13, 17q22) for nonsyndromic cleft lip with or without cleft palate (nsCL/P). The aim of the present study was to determine whether rare variants in either gene are implicated in nsCL/P etiology. The complete coding regions, untranslated regions, and splice sites of GREM1 and NOG were sequenced in 96 nsCL/P patients and 96 controls of Central European ethnicity. Three burden and four nonburden tests were performed. Statistically significant results were followed up in a second case-control sample (n = 96, respectively). For rare variants observed in cases, segregation analyses were performed. In NOG, four rare sequence variants (minor allele frequency elements. © 2014 Wiley Periodicals, Inc.

F-theory GUTs with U(1) symmetries: Generalities and survey

International Nuclear Information System (INIS)

Dolan, Matthew J.; Marsano, Joseph; Saulina, Natalia; Schaefer-Nameki, Sakura

2011-01-01

We study the structure of SU(5) F-theory grand unified theory (GUT) models that engineer additional U(1) symmetries. These are highly constrained by a set of relations observed by Dudas and Palti (DP) that originate from the physics of four-dimensional anomaly cancellation. Using the DP relations, we describe a general tension between unification and the suppression of dimension 5 proton decay when one or more U(1)'s are Peccei-Quinn (PQ) symmetries and hypercharge flux is used to break the SU(5) GUT group. We then specialize to spectral cover models, whose global completions in F theory we know how to construct. In that setting, we provide a technical derivation of the DP relations, construct spectral covers that yield all possible solutions to them, and provide a complete survey of spectral cover models for SU(5) GUTs that exhibit two U(1) symmetries.

Microstructure of the irradiated U 3Si 2/Al silicide dispersion fuel

Science.gov (United States)

Gan, J.; Keiser, D. D.; Miller, B. D.; Jue, J.-F.; Robinson, A. B.; Madden, J. W.; Medvedev, P. G.; Wachs, D. M.

2011-12-01

The silicide dispersion fuel of U 3Si 2/Al is recognized as the best performance fuel for many nuclear research and test reactors with up to 4.8 gU/cm 3 fuel loading. An irradiated U 3Si 2/Al dispersion fuel ( 235U ˜ 75%) from the high-flux side of a fuel plate (U0R040) from the Reduced Enrichment for Research and Test Reactors (RERTR)-8 test was characterized using transmission electron microscopy (TEM). The fuel was irradiated in the Advanced Test Reactor (ATR) for 105 days. The average irradiation temperature and fission density of the U 3Si 2 fuel particles for the TEM sample are estimated to be approximately 110 °C and 5.4 × 10 27 f/m 3. The characterization was performed using a 200-kV TEM. The U/Si ratio for the fuel particle and (Si + Al)/U for the fuel-matrix-interaction layer are approximately 1.1 and 4-10, respectively. The estimated average diameter, number density and volume fraction for small bubbles (<1 μm) in the fuel particle are ˜94 nm, 1.05 × 10 20 m -3 and ˜11%, respectively. The results and their implication on the performance of the U 3Si 2/Al silicide dispersion fuel are discussed.

The Proterozoic of NW Mexico revisited: U-Pb geochronology and Hf isotopes of Sonoran rocks and their tectonic implications

Science.gov (United States)

Solari, L. A.; González-León, C. M.; Ortega-Obregón, C.; Valencia-Moreno, M.; Rascón-Heimpel, M. A.

2018-04-01

Several Proterozoic basement units crop out in the Sonora State of NW Mexico, and the same can be correlated with crustal provinces of southern Laurentia in the neighboring southwestern USA. Zircon U-Pb and Hf isotopic determinations in more than 300 grains separated from igneous and metaigneous rocks from these units indicate that the crystalline basement in Sonora is made up of different components, which are from west to east: (1) The Caborca-Mojave province to the west, characterized by the so-called Bámori Complex, have U-Pb ages between 1696 and 1772 Ma, with moderately juvenile to slightly evolved ɛHf values, yielding T DM ages of ca. 2.1-2.4 Ga; (2) in the intermediate area, east of Hermosillo, the Palofierral and La Ramada orthogneiss units yield an age of 1640 and 1703 Ma, respectively, both having juvenile ɛHf with the Palofierral overlapping the depleted mantle curve at ca. 1.65 Ga; and (3) in the northeastern Sonora, samples from the southern extension of the Mazatzal province, represented by the Pinal Schist, yielded ages between 1674 and 1694 Ma, with moderately juvenile to juvenile ɛHf values and a T DM age of ca. 1.9 Ga. In addition, a suite of post-tectonic granites was also studied in Caborca (San Luis granite) as well as in northeastern Sonora (Cananea granite), both yielding ages of ca. 1.44 Ga with moderately juvenile ɛHf values ranging from -1 to +8 and T DM dates of ca. 1.8-1.9 Ga and 1.6-1.7 Ga, respectively. These two isotopically contrasting provinces may imply the existence of a Proterozoic paleo-suture. However, if the Palofierral gneiss, of which the Hf signature straddles the depleted mantle array, is taken as the source for the 1.44 Ga Cananea granite, then the location of such a suture zone should lay farther south than the proposed trace of the Mojave-Sonora megashear.

Lead exposures in U.S. Children, 2008: implications for prevention.

Science.gov (United States)

Levin, Ronnie; Brown, Mary Jean; Kashtock, Michael E; Jacobs, David E; Whelan, Elizabeth A; Rodman, Joanne; Schock, Michael R; Padilla, Alma; Sinks, Thomas

2008-10-01

We reviewed the sources of lead in the environments of U.S. children, contributions to children's blood lead levels, source elimination and control efforts, and existing federal authorities. Our context is the U.S. public health goal to eliminate pediatric elevated blood lead levels (EBLs) by 2010. National, state, and local exposure assessments over the past half century have identified risk factors for EBLs among U.S. children, including age, race, income, age and location of housing, parental occupation, and season. Recent national policies have greatly reduced lead exposure among U.S. children, but even very low exposure levels compromise children's later intellectual development and lifetime achievement. No threshold for these effects has been demonstrated. Although lead paint and dust may still account for up to 70% of EBLs in U.S. children, the U.S. Centers for Disease Control and Prevention estimates that >or=30% of current EBLs do not have an immediate lead paint source, and numerous studies indicate that lead exposures result from multiple sources. EBLs and even deaths have been associated with inadequately controlled sources including ethnic remedies and goods, consumer products, and food-related items such as ceramics. Lead in public drinking water and in older urban centers remain exposure sources in many areas. Achieving the 2010 goal requires maintaining current efforts, especially programs addressing lead paint, while developing interventions that prevent exposure before children are poisoned. It also requires active collaboration across all levels of government to identify and control all potential sources of lead exposure, as well as primary prevention.

Dimensional Reduction of N=1, E_8 SYM over SU(3)/U(1) x U(1) x Z_3 and its four-dimensional effective action

CERN Document Server

Irges, Nikos; Zoupanos, George

2011-01-01

We present an extension of the Standard Model inspired by the E_8 x E_8 Heterotic String. In order that a reasonable effective Lagrangian is presented we neglect everything else other than the ten-dimensional N=1 supersymmetric Yang-Mills sector associated with one of the gauge factors and certain couplings necessary for anomaly cancellation. We consider a compactified space-time M_4 x B_0 / Z_3, where B_0 is the nearly-Kaehler manifold SU(3)/U(1) x U(1) and Z_3 is a freely acting discrete group on B_0. Then we reduce dimensionally the E_8 on this manifold and we employ the Wilson flux mechanism leading in four dimensions to an SU(3)^3 gauge theory with the spectrum of a N=1 supersymmetric theory. We compute the effective four-dimensional Lagrangian and demonstrate that an extension of the Standard Model is obtained with interesting features including a conserved baryon number and fixed tree level Yukawa couplings and scalar potential. The spectrum contains new states such as right handed neutrinos and heavy ...

DENSITY-FUNCTIONAL STUDY OF U-Mo AND U-Zr ALLOYS

Energy Technology Data Exchange (ETDEWEB)

Landa, A; Soderlind, P; Turchi, P A

2010-11-01

Density-functional theory previously used to describe phase equilibria in U-Zr alloys [A. Landa, P. Soederlind, P.E.A. Turchi, J. Alloys Comp. 478 (2009) 103-110] is extended to investigate the ground-state properties of U-Mo solid solutions. We discuss how the heat of formation in both alloys correlates with the charge transfer between the alloy components, and how the specific behavior of the density of states in the vicinity of the Fermi level promotes the stabilization of the U{sub 2}Mo compound. Our calculations prove that, due to the existence of a single {gamma}-phase over the typical fuel operation temperatures, {gamma}-U-Mo alloys should indeed have much lower constituent redistribution than {gamma}-U-Zr alloys for which binodal decomposition causes a high degree of constituent redistribution.

Dark Matter candidate in Inert Doublet Model with additional local gauge symmetry U (1)

International Nuclear Information System (INIS)

Gaitán, R.; De Oca, J.H. Montes; Garcés, E. A.; Cabral-Rosetti, L. G.

2016-01-01

We consider the Inert Doublet Model (IDM) with an additional local gauge symmetry U (1) and a complex singlet scalar to break the symmetry U (1). The continuous symmetry U (1) is introduced to control the CP-conserving interaction instead of some discrete symmetries as usually. We present the mass spectrum for neutral scalar and gauge bosons and the values of the charges under U (1) for which the model could have a candidate to dark matter. (paper)

LDC nuclear power prospects, 1975--1990: commercial, economic, and security implications

International Nuclear Information System (INIS)

1975-01-01

The potential market for products of the U. S. nuclear industry in the lesser developed countries is evaluated. The political, economic, and security implications of U. S. nuclear technology exports to these countries are analyzed. Information is presented under the following headings: energy projections and economic change in less developed countries; comparative costs of nuclear and conventional power; the general policy environment and its effect on the nuclear power market potential; assessment of U. S. and foreign capabilities in the international competitive environment for production and sale of nuclear power plant products and services; and assessment of international and domestic implications of expanding exports of U. S. nuclear products to less developed countries. (U.S.)

Structure and Mechanism of the S Component of a Bacterial ECF Transporter

Energy Technology Data Exchange (ETDEWEB)

P Zhang; J Wang; Y Shi

2011-12-31

The energy-coupling factor (ECF) transporters, responsible for vitamin uptake in prokaryotes, are a unique family of membrane transporters. Each ECF transporter contains a membrane-embedded, substrate-binding protein (known as the S component), an energy-coupling module that comprises two ATP-binding proteins (known as the A and A' components) and a transmembrane protein (known as the T component). The structure and transport mechanism of the ECF family remain unknown. Here we report the crystal structure of RibU, the S component of the ECF-type riboflavin transporter from Staphylococcus aureus at 3.6-{angstrom} resolution. RibU contains six transmembrane segments, adopts a previously unreported transporter fold and contains a riboflavin molecule bound to the L1 loop and the periplasmic portion of transmembrane segments 4-6. Structural analysis reveals the essential ligand-binding residues, identifies the putative transport path and, with sequence alignment, uncovers conserved structural features and suggests potential mechanisms of action among the ECF transporters.

Implications of high renewable electricity penetration in the U.S. for water use, greenhouse gas emissions, land-use, and materials supply

International Nuclear Information System (INIS)

Arent, Doug; Pless, Jacquelyn; Mai, Trieu; Wiser, Ryan; Hand, Maureen; Baldwin, Sam; Heath, Garvin; Macknick, Jordan; Bazilian, Morgan; Schlosser, Adam; Denholm, Paul

2014-01-01

Highlights: • Renewable electricity generation could supply 80% of U.S. generation in 2050. • GHGs are reduced proportionally and water use is reduced by 50%. • Gross land-use impacts total less than 3% of land area of the contiguous U.S. • Some clean energy technologies rely on materials that face short-term risks. • No insurmountable long-term constraints to materials supply were identified. - Abstract: Recent work found that renewable energy could supply 80% of electricity demand in the contiguous United States in 2050 at the hourly level. This paper explores some of the implications of achieving such high levels of renewable electricity for supply chains and the environment in scenarios with renewable supply up to such levels. Expanding the renewable electricity supply at this scale by 2050 implies annual capacity additions of roughly 20 gigawatts per year (GW/year) over the next decade, rising to roughly 40 GW/year from 2040 to 2050. Given total 2012 renewable electricity capacity additions of slightly more than 16 GW, this suggests moderate growth of the related supply chains, averaging overall roughly 4% annual growth to 2040. Transitioning to high renewable electricity supply would lead to significant reductions in greenhouse gas emissions and water use, with only modest land-use implications. While renewable energy expansion implies moderate growth of the renewable electricity supply chains, no insurmountable long-term constraints to renewable electricity technology manufacturing capacity or materials supply are identified

Coenzyme O*U1*UO, Alpha-Tocopherol and Free Cholesterol in HDL and LDL Fractions

DEFF Research Database (Denmark)

Johansen, Kurt; Theorell, Henning; Karlsson, Jan

1991-01-01

Farmakologi, Alpha-tocopherol, Coenzyme Q*U1*U0, free cholesterol, LDL, Antioxidants, Lipoproteins, HDL......Farmakologi, Alpha-tocopherol, Coenzyme Q*U1*U0, free cholesterol, LDL, Antioxidants, Lipoproteins, HDL...

Photometric study of the eclipsing binary U Sagittae

International Nuclear Information System (INIS)

McNamara, D.H.; Feltz, K.A. Jr.

1976-01-01

The geometric and photometric elements of the eclipsing star U Sge have been derived from uvby observations secured in 1973-74. The ''best'' elements are r 1 = 0.296, r 2 = 0.225, i = 90 0 ; and L 1 = 0.130, L 2 = 0.870 in yellow light where the subscript 1 refers to the G2 IV-III component and the subscript 2 refers to the B8 V component. Radii and masses of the two stars can be derived by assuming that the larger star fills its Roche lobe. This assumption yields r 1 = 3.32 R/sub solar mass/, r 2 = 2.52 R/sub solar mass/, M 1 = 1.4 solar mass, and M 2 = 3.5 solar mass. The absolute magnitudes are found by two different methods and yield M/sub v/ = -0/sup m/4 for the B star and M/sub v/ = + 1.8/sup m/ for the G star. If corrections for radiative interactions are made, the absolute magnitude of the G star is M/sub v/ is approximately equal + 2.2/sup m/. Observational data secured in the u filter suggest that Balmer continuum emission can be detected from an emitting gas stream or disk. The gas must be concentrated near the following hemisphere of the B Star. The m 1 measurements of the secondary component suggest a metal deficiency of [Fe/H] = -0.6

77 FR 34063 - Certain Electronic Devices, Including Mobile Phones and Tablet Computers, and Components Thereof...

Science.gov (United States)

2012-06-08

... Phones and Tablet Computers, and Components Thereof Institution of Investigation AGENCY: U.S... the United States after importation of certain electronic devices, including mobile phones and tablet... mobile phones and tablet computers, and components thereof that infringe one or more of claims 1-3 and 5...

The herpes simplex virus 1 U{sub S}3 regulates phospholipid synthesis

Energy Technology Data Exchange (ETDEWEB)

Wild, Peter, E-mail: pewild@access.uzh.ch [Institute of Veterinary Anatomy, University of Zuerich (Switzerland); Institute of Virology, University of Zuerich (Switzerland); Oliveira, Anna Paula de [Institute of Virology, University of Zuerich (Switzerland); Sonda, Sabrina [Institute for Parasitology, University of Zuerich (Switzerland); Schraner, Elisabeth M. [Institute of Veterinary Anatomy, University of Zuerich (Switzerland); Institute of Virology, University of Zuerich (Switzerland); Ackermann, Mathias; Tobler, Kurt [Institute of Virology, University of Zuerich (Switzerland)

2012-10-25

Herpes simplex virus type 1 capsids bud at nuclear and Golgi membranes for envelopment by phospholipid bilayers. In the absence of U{sub S}3, nuclear membranes form multiple folds harboring virions that suggests disturbance in membrane turnover. Therefore, we investigated phospholipid metabolism in cells infected with the U{sub S}3 deletion mutant R7041({Delta}U{sub S}3), and quantified membranes involved in viral envelopment. We report that (i) [{sup 3}H]-choline incorporation into nuclear membranes and cytoplasmic membranes was enhanced peaking at 12 or 20 h post inoculation with wild type HSV-1 and R7041({Delta}U{sub S}3), respectively, (ii) the surface area of nuclear membranes increased until 24 h of R7041({Delta}U{sub S}3) infection forming folds that equaled {approx}45% of the nuclear surface, (iii) the surface area of viral envelopes between nuclear membranes equaled {approx}2400 R7041({Delta}U{sub S}3) virions per cell, and (iv) during R7041({Delta}U{sub S}3) infection, the Golgi complex expanded dramatically. The data indicate that U{sub S}3 plays a significant role in regulation of membrane biosynthesis.

U(1) textures and Lepton Flavor Violation

CERN Document Server

Gómez, M E; Lola, S; Vergados, J D

1999-01-01

U(1) family symmetries have led to successful predictions of the fermion mass spectrum and the mixing angles of the hadronic sector. In the context of the supersymmetric unified theories, they further imply a non-trivial mass structure for the scalar partners, giving rise to new sources of flavour violation. In the present work, lepton flavour non-conserving processes are examined in the context of the MSSM augmented by a U(1) family symmetry. We calculate the mixing effects on the mu -> e gamma and tau-> mu gamma rare decays. All supersymmetric scalar masses involved in the processes are determined at low energies using two loop renormalisation group analysis and threshold corrections. Further, various novel effects are considered and found to have important impact on the branching ratios. Thus, a rather interesting result is that when the see-saw mechanism is applied in the (12X12)-sneutrino mass matrix, the mixing effects of the Dirac matrix in the effective light sneutrino sector are canceled at first ord...

The major histocompatibility complex genes impact pain response in DA and DA.1U rats.

Science.gov (United States)

Guo, Yuan; Yao, Fan-Rong; Cao, Dong-Yuan; Li, Li; Wang, Hui-Sheng; Xie, Wen; Zhao, Yan

2015-08-01

Our recent studies have shown that the difference in basal pain sensitivity to mechanical and thermal stimulation between Dark-Agouti (DA) rats and a novel congenic DA.1U rats is major histocompatibility complex (MHC) genes dependent. In the present study, we further used DA and DA.1U rats to investigate the role of MHC genes in formalin-induced pain model by behavioral, electrophysiological and immunohistochemical methods. Behavioral results showed biphasic nociceptive behaviors increased significantly following the intraplantar injection of formalin in the hindpaw of DA and DA.1U rats. The main nociceptive behaviors were lifting and licking, especially in DA rats (PDA rats were significantly higher than those in DA.1U rats in both phases of the formalin test (PDA rats was significantly higher than that of DA.1U rats (PDA was greater than that in DA.1U rats (PDA rats was significantly higher than that in DA.1U rats in the respective experimental group (PDA and DA.1U rats exhibited nociceptive responses in formalin-induced pain model and DA rats were more sensitive to noxious chemical stimulus than DA.1U rats, indicating that MHC genes might contribute to the difference in pain sensitivity. Copyright © 2015 Elsevier Inc. All rights reserved.

Zero Action on Perfect Crystals for U_q(G_2^{(1}

Directory of Open Access Journals (Sweden)

Kailash C. Misra

2010-03-01

Full Text Available The actions of 0-Kashiwara operators on the U_q(G_2^{(1}-crystal B_l in [Yamane S., J. Algebra 210 (1998, 440-486] are made explicit by using a similarity technique from that of a U_q'(D_4^{(3}-crystal. It is shown that {B_l}_{l ≥ 1} forms a coherent family of perfect crystals.

A novel homozygous truncating GNAT1 mutation implicated in retinal degeneration

OpenAIRE

Carrigan, Matthew; Duignan, Emma; Humphries, Pete; Palfi, Arpad; Kenna, Paul F; Farrar, G Jane

2015-01-01

Background The GNAT1 gene encodes the ? subunit of the rod transducin protein, a key element in the rod phototransduction cascade. Variants in GNAT1 have been implicated in stationary night-blindness in the past, but unlike other proteins in the same pathway, it has not previously been implicated in retinitis pigmentosa. Methods A panel of 182 retinopathy-associated genes was sequenced to locate disease-causing mutations in patients with inherited retinopathies. Results Sequencing revealed a ...