Analysis of the 235U neutron cross sections in the resolved resonance range

International Nuclear Information System (INIS)

Leal, L.C.; de Saussure, G.; Perez, R.B.

1989-01-01

Using recent high-resolution measurements of the neutron transmission of 235 U and the spin-separated fission cross-section data of Moore et al., a multilevel analysis of the 235 U neutron cross sections was performed up to 300 eV. The Dyson Metha Δ 3 statistics were used to help locate small levels above 100 eV where resonances are not clearly resolved even in the best resolution measurements available. The statistical properties of the resonance parameters are discussed. 13 refs., 8 figs., 1 tab

Adjustment of the 235U Fission Spectrum

International Nuclear Information System (INIS)

GRIFFIN, PATRICK J.; WILLIAMS, J.G.

1999-01-01

The latest nuclear data are used to examine the sensitivity of the least squares adjustment of the 235 U fission spectrum to the measured reaction rates, dosimetry cross sections, and prior spectrum covariance matrix. All of these parameters were found to be very important in the spectrum adjustment. The most significant deficiency in the nuclear data is the absence of a good prior covariance matrix. Covariance matrices generated from analytic models of the fission spectra have been used in the past. This analysis reveals some unusual features in the covariance matrix produced with this approach. Specific needs are identified for improved nuclear data to better determine the 235 U spectrum. An improved 235 U covariance matrix and adjusted spectrum are recommended for use in radiation transport sensitivity analyses

235U NMR study of the itinerant antiferromagnet USb2

International Nuclear Information System (INIS)

Kato, Harukazu; Sakai, Hironori; Ikushima, Kenji; Kambe, Shinsaku; Tokunaga, Yo; Aoki, Dai; Haga, Yoshinori; O-bar nuki, Yoshichika; Yasuoka, Hiroshi; Walstedt, Russell E.

2005-01-01

We have succeeded in resolving a 235 U antiferromagnetic nuclear magnetic resonance (AFNMR) signal using 235 U-enriched samples of USb 2 . The uranium hyperfine field and coupling constant estimated for this compound are consistent with those from other experiments. This is the first reported observation of 235 U NMR in conducting host material

Should we ignore U-235 series contribution to dose?

International Nuclear Information System (INIS)

Beaugelin-Seiller, Karine; Goulet, Richard; Mihok, Steve; Beresford, Nicholas A.

2016-01-01

Environmental Risk Assessment (ERA) methodology for radioactive substances is an important regulatory tool for assessing the safety of licensed nuclear facilities for wildlife, and the environment as a whole. ERAs are therefore expected to be both fit for purpose and conservative. When uranium isotopes are assessed, there are many radioactive decay products which could be considered. However, risk assessors usually assume 235 U and its daughters contribute negligibly to radiological dose. The validity of this assumption has not been tested: what might the 235 U family contribution be and how does the estimate depend on the assumptions applied? In this paper we address this question by considering aquatic wildlife in Canadian lakes exposed to historic uranium mining practices. A full theoretical approach was used, in parallel to a more realistic assessment based on measurements of several elements of the U decay chains. The 235 U family contribution varied between about 4% and 75% of the total dose rate depending on the assumptions of the equilibrium state of the decay chains. Hence, ignoring the 235 U series will not result in conservative dose assessments for wildlife. These arguments provide a strong case for more in situ measurements of the important members of the 235 U chain and for its consideration in dose assessments. - Highlights: • Realistic ecological risk assessment infers a complete inventory of radionuclides. • U-235 family may not be minor when assessing total dose rates experienced by biota. • There is a need to investigate the real state of equilibrium decay of U chains. • There is a need to improve the capacity to measure all elements of the U decay chains.

Resonance analysis and evaluation of the 235U neutron induced cross sections

International Nuclear Information System (INIS)

Leal, L.C.

1990-06-01

Neutron cross sections of fissile nuclei are of considerable interest for the understanding of parameters such as resonance absorption, resonance escape probability, resonance self-shielding,and the dependence of the reactivity on temperature. In the present study, new techniques for the evaluation of the 235 U neutron cross sections are described. The Reich-Moore formalism of the Bayesian computer code SAMMY was used to perform consistent R-matrix multilevel analyses of the selected neutron cross-section data. The Δ 3 -statistics of Dyson and Mehta, along with high-resolution data and the spin-separated fission cross-section data, have provided the possibility of developing a new methodology for the analysis and evaluation of neutron-nucleus cross sections. The results of the analysis consists of a set of resonance parameters which describe the 235 U neutron cross sections up to 500 eV. The set of resonance parameters obtained through a R-matrix analysis are expected to satisfy statistical properties which lead to information on the nuclear structure. The resonance parameters were tested and showed good agreement with the theory. It is expected that the parametrization of the 235 U neutron cross sections obtained in this dissertation represents the current state of art in data as well as in theory and, therefore, can be of direct use in reactor calculations. 44 refs., 21 figs., 8 tabs

Symmetry of neutron-induced 235U fission at individual resonances. III

Energy Technology Data Exchange (ETDEWEB)

Cowan, G A; Bayhurst, B P; Prestwood, R J; Gilmore, J S; Knobeloch, G W [Los Alamos Scientific Laboratory, University of California, Los Alamos, NM (United States)

1970-05-15

A number of experiments have been described in recent years which document variations in the yields of symmetric or near-symmetric fission products at resonances in 235-U and 239-Pu neutron-induced fission. In the case of 239-Pu fission it has been demonstrated in a statistically significant sample of s-wave neutron resonances (J{sup {pi}} = 0{sup +} or 1{sup +}) that the 0{sup +} levels have a characteristic 115Cd yield which is a factor of four higher than the yield at 1{sup +} levels. The fission widths of the J = 0 levels are larger than the J = 1 levels by a factor of ten. The populations of the two groups are in reasonable agreement with the expected (2J + 1) distributions. Previous efforts to obtain equally detailed data in 235-U fission and 233-U fission by the 'wheel' technique have not been entirely successful due in large part to the high level densities in the epithermal excitation functions of these nuclides and the consequent difficulty in characterizing fission yields in a sufficiently large and well-resolved sample of levels. In a recent 'wheel' experiment (late summer, 1969) vith a 235-U target the energy resolution was sufficiently improved in the region 20 eV-60 eV to allow characterization of a sample of 38 reasonably well-resolved levels by their relative symmetry of fission. (author)

Analysis of 235U enrichment by chemical exchange in U(IV) - U(VI) system on anionite

International Nuclear Information System (INIS)

Raica, Paula; Axente, Damian

2007-01-01

Full text: A theoretical study about the 235 U enrichment by chemical exchange method in U(IV)-U(VI) system on anion-exchange resins is presented. The 235 U isotope concentration profiles along the band were numerically calculated using an accurate mathematical model and simulations were carried out for the situation of product and waste withdrawal and feed supply. By means of numerical simulation, an estimation of the migration time, necessary for a desired enrichment degree, was obtained. The required migration distance, the production of uranium 3 at.% 235 U per year and the plant configuration are calculated for different operating conditions. An analysis of the process scale for various experimental conditions is also presented. (authors)

Isotopic separation of 235U and 238U in an atomic beam with selective two-step photo-ionisation

International Nuclear Information System (INIS)

Boehm, H.D.V.

1977-01-01

The present work gives a report on investigations on isotope separation of 235 U and 238 U by means of selective two-stage photo-ionization on atomic uranium. An atomic beam of sufficient particle density was produced by dissociation of URe 2 in an electron beam heated tungsten furnace at a temperature of 2.500 k. A continuously operated rhodamin-69 dye laser with a maximum output of 120 mW and about 50 mHz band width in one-made operation was used for selective excitation from the ground state. From this state of excitation, ionization resulted achieving a light power of 1.8 W below 3030 A in the reaction volume. The measured separation factors show that the laser method enables the enrichment of uranium to the required valve of three or more percent 235 U for light water reactors in a single separation step. The hyperfine structure could be considerably better resolved compared to earlier investigations, so that it was possible for the first time to identify and measure hitherto unobserved weak components. (orig.) [de

Application of the 226Ra-230Th-234U and 227Ac-231Pa-235U radiochronometers to uranium certified reference materials

International Nuclear Information System (INIS)

Rolison, J.M.; Treinen, K.C.; McHugh, K.C.; Gaffney, A.M.; Williams, R.W.

2017-01-01

Uranium certified reference materials (CRM) issued by New Brunswick Laboratory were subjected to dating using four independent uranium-series radiochronometers. In all cases, there was acceptable agreement between the model ages calculated using the 231 Pa- 235 U, 230 Th- 234 U, 227 Ac- 235 U or 226 Ra- 234 U radiochronometers and either the certified 230 Th- 234 U model date (CRM 125-A and CRM U630), or the known purification date (CRM U050 and CRM U100). The agreement between the four independent radiochronometers establishes these uranium certified reference materials as ideal informal standards for validating dating techniques utilized in nuclear forensic investigations in the absence of standards with certified model ages for multiple radiochronometers. (author)

235U and 238U (n,xn gamma) cross-sections

International Nuclear Information System (INIS)

Bacquias, A.; Dessagne, Ph.; Kerveno, M.; Rudolf, G.; Thiry, J.C.; Borcea, C.; Negret, A.L.; Drohe, J.C.; Nankov, N.; Nyman, M.; Plompen, A.; Rouki, C.; Stanoiu, M.

2014-01-01

The (n,n') and (n,2n) are important processes in the energy domain of fission neutrons, but the cross-sections suffer from large uncertainties, not compatible with the objectives fixed for future and advanced nuclear reactors. This paper presents our experimental effort to improve 235 U and 238 U (n,xnγ) cross-section data. The experiments were performed at the GELINA facility (Belgium), which provides a pulsed (800 Hz) neutron beam covering a wide energy spectrum (from a few eV to about 20 MeV). The GRAPhEME set-up is designed for prompt gamma spectroscopy and time-of-flight measurement. The analysis methods are presented. Already published results on 235 U are shown, as well as results on 238 U. The interpretation and discussion rely on the comparison with TALYS and EMPIRE predictions. (authors)

Dispersion of the Neutron Emission in U{sup 235} Fission

Science.gov (United States)

Feynman, R. P.; de Hoffmann, F.; Serber, R.

1955-01-01

Equations are developed which allow the calculation of the average number of neutrons per U{sup235} fission from experimental measurements. Experimental methods are described, the results of which give a value of (7.8 + 0.6){sup ½} neutrons per U{sup 235} thermal fission.

Determination of the axial 235U distribution in target fuel rods

International Nuclear Information System (INIS)

Huettig, G.; Bernhard, G.; Niese, U.

1989-01-01

The homogenity of the axial 235 U distribution in target fuel rods is an important quality criterion for the production of 99 Mo. The 235 U distribution has been analyzed automatically and nondestructively by measuring the 235 U gamma ray peak at 285.7 keV. For the quantitative assessment a calibration curve was prepared by the help of X-ray fluorescence analysis, colorimetry, and photometric titration. The accuracy of the method is ≤ 1.5% uranium per centimeter of the fuel rod

Phase relationship in AL-Cu-Sc alloys at 450-500 deg C

International Nuclear Information System (INIS)

Kharakterova, M.L.

1991-01-01

Al-Cu-Sc alloys containing up to 40% Cu and up to 6% Sc at 450 deg C and 500 deg C are studied using light microscopy, X-ray-spectral microanalysis, X-ray diffraction analysis, scanning electron microscopy, measurement of microhardness and electric resistance. It is determined, that in equilibrium with aluminium solid solution under the given temperature ther are Al 3 Sc, CuAl 2 phases of the respective binary systems and W (ScCu 6.6-4 Al 5.4-8 ) ternary phase. Isothermal cross sections of Al-Cu-Sc system at 450 and 500 deg C are plotted. Microhardness of equilibrium phases is measured. Combined solubility of copper and scandium in aluminium is determined

Estimation of uranium and cobalt-60 distribution coefficients and uranium-235 enrichment at the Combustion Engineering Company site in Windsor, Connecticut

International Nuclear Information System (INIS)

Wang, Y.; Orlandini, K.A.; Yu, C.

1996-05-01

Site-specific distribution coefficients for uranium isotopes and cobalt-60 (Co-60) and the fraction of uranium-235 (U-235) enrichment by mass were estimated for environmental samples collected from the Combustion Engineering Company site in Windsor, CT. This site has been identified for remedial action under the US Department of Energy's (DOE) Formerly Utilized Sites Remedial Action Program. The authority of DOE at the Combustion Engineering site is limited to (1) Building 3; (2) other activities or areas associated exclusively with Building 3 (such as sewer lines); or (3) contamination that is exclusively highly enriched uranium. In this study, 16 samples were collected from the Combustion Engineering site, including 8 soil, 4 sediment, 3 water, and 1 water plus sludge sample. These samples were analyzed for isotopic uranium by alpha spectrometry and for Co-60 by gamma spectrometry. The site-specific distribution coefficient for each isotope was estimated as the ratio of extractable radionuclide activity in the solid phase to the activity in the contact solution following a 19-day equilibration. The uranium activity measurements indicate that uranium-234 (U-234) and uranium-238 (U-238) were in secular equilibrium in two soil samples and that soil and sediment samples collected from other sampling locations had higher U-234 activity than U-238 activity in both the solid and solution phases. The site-specific distribution coefficient (Kd) ranged from 82 to 44,600 mL/g for U-238 and from 102 to 65,900 mL/g for U-234. Calculation of U-235 enrichment by mass indicated that four soil samples had values greater than 0.20; these values were 0.37, 0.38, 0.46, and 0.68. Cobalt-60 activity was detected in only three sediment samples. The measured Co-60 activity in the solid phase ranged from 0.15 to 0.45 pCi/g and that in the water phase of all three samples combined was 4 pCi/L. The Kd value for Co-60 in the site brook sediment was calculated to be 70 mL/g

29 CFR 500.100 - Vehicle safety obligations.

Science.gov (United States)

2010-07-01

... safety standards. Prima facie evidence that safety standards have been met will be shown by the presence... 29 Labor 3 2010-07-01 2010-07-01 false Vehicle safety obligations. 500.100 Section 500.100 Labor... § 500.100 Vehicle safety obligations. (a) General obligations. Each farm labor contractor, agricultural...

Neutron inelastic-scattering cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu

International Nuclear Information System (INIS)

Smith, A.B.; Guenther, P.T.

1982-01-01

Differential-neutron-emission cross sections of 232 Th, 233 U, 235 U, 238 U, 239 Pu and 240 Pu are measured between approx. = 1.0 and 3.5 MeV with the angle and magnitude detail needed to provide angle-integrated emission cross sections to approx. 232 Th, 233 U, 235 U and 238 U inelastic-scattering values, poor agreement is observed for 240 Pu, and a serious discrepancy exists in the case of 239 Pu

Proposal of new 235U nuclear data to improve keff biases on 235U enrichment and temperature for low enriched uranium fueled lattices moderated by light water

International Nuclear Information System (INIS)

Wu, Haicheng; Okumura, Keisuke; Shibata, Keiichi

2005-06-01

The under prediction of k eff depending on 235 U enrichment in low enriched uranium fueled systems, which had been a long-standing puzzle especially for slightly enriched ones, was studied in this report. Benchmark testing was carried out with several evaluated nuclear data files, including the new uranium evaluations from preliminary ENDF/B-VII and CENDL-3.1. Another problem reviewed here was k eff underestimation vs. temperature increase, which was observed in the sightly enriched system with recent JENDL and ENDF/B uranium evaluations. Through the substitute analysis of nuclear data of 235 U and 238 U, we propose a new evaluation of 235 U data to solve both of the problems. The new evaluation was tested for various uranium fueled systems including low or highly enriched metal and solution benchmarks in the ICSBEP handbook. As a result, it was found that the combination of the new evaluation of 235 U and the 238 U data from the preliminary ENDF/B-VII gives quite good results for most of benchmark problems. (author)

Determination of the isotopic ratio 234 U/238 U and 235 U/238 U in uranium commercial reagents by alpha spectroscopy

International Nuclear Information System (INIS)

Iturbe G, J.L.

1990-02-01

In this work the determination of the isotope ratio 234 U/ 238 U and 235 U/ 238 U obtained by means of the alpha spectroscopy technique in uranium reagents of commercial marks is presented. The analyzed uranium reagents were: UO 2 (*) nuclear purity, UO 3 (*) poly-science, metallic uranium, uranyl nitrate and uranyl acetate Merck, uranyl acetate and uranyl nitrate Baker, uranyl nitrate (*) of the Refinement and Conversion Department of the ININ, uranyl acetate (*) Medi-Lab Sigma of Mexico and uranyl nitrate Em Science. The obtained results show that the reagents that are suitable with asterisk (*) are in radioactive balance among the one 234 U/ 238 U, since the obtained value went near to the unit. In the case of the isotope ratio 235 U/ 238 U the near value was also obtained the one that marks the literature that is to say 0.04347, what indicates that these reagents contain the isotope of 235 U in the percentage found in the nature of 0.71%. The other reagents are in radioactive imbalance among the 234 U/ 238 U, the found values fluctuated between 0.4187 and 0.1677, and for the quotient of activities 235 U/ 238 U its were of 0.0226, and the lowest of 0.01084. Also in these reagents it was at the 236 U as impurity. The isotope of 236 U is an isotope produced artificially, for what is supposed that the reagents that are in radioactive imbalance were synthesized starting from irradiated fuel. (Author)

Theoretical studies aiming at the IEA-R1 reactor core conversion from high U-235 enrichment to low U-235 enrichment

International Nuclear Information System (INIS)

Frajndlich, R.

1982-01-01

The research reactors, of which the fuel elements are of MTR type, functions presently, almost in their majority with high U-235 enrichment. The fear that those fuel elements might generate a considerabLe proliferation of nuclear weapons rendered almost mandatory the conversion of highly enriched fuel elements to a low U-235 enrichment. As the IEA-R1 reactor of IPEN is operating with highly enriched fuel elements a study aiming at this conversion was done. The problems related to the conversion and the results obtained, demonstrated the technical viabilty for its realization. (E.G.) [pt

Performance evaluation of indigenous thermal ionization mass spectrometer for determination of 235U/238U atom ratios

International Nuclear Information System (INIS)

Alamelu, D.; Parab, A.R.; Sasi Bhushan, K.; Shah, Raju V.; Jagdish Kumar, S.; Rao, Radhika M.; Aggarwal, S.K.; Bhatia, R.K.; Yadav, V.K.; Sharma, Madhavi P.; Tulsyan, Puneet; Chavda, Pradip; Sriniwasan, P.

2014-07-01

A magnetic sector based Thermal Ionization Mass Spectrometer (TIMS) designed and developed at Technical Physics Division, B.A.R.C., was evaluated for its performance for the determination of 235 U/ 238 U atom ratios in uranium samples. This consisted of evaluating the precision and accuracy on the 235 U/ 238 U atom ratios in various isotopic reference materials as well as indigenously generated uranium samples. The results obtained by the indigenous TIMS were also compared with those obtained using a commercially available TIMS system. The internal and external precision were found to be around 0.1% for determining 235 U/ 238 U atom ratios close to those of natural uranium ( i.e. 0.00730). (author)

Fission cross sections of {sup 235,238}U and {sup 209}Bi at incident proton energies above 70 MeV

Energy Technology Data Exchange (ETDEWEB)

Obukhov, A I; Rimskij-Korsakov, A A; Eismont, V P [V.G. Khlopin Radium Inst., St. Petersburg (Russian Federation)

1997-06-01

The proton fission cross-section data of {sup 235,238}U and Bi were measured in the V.G. Khlopin Radium Institute over a wide proton energy range. The experimental and calculated data were also compared with experimental neutron values. The proton cross-section of {sup 235,238}U increased up to 60-70 MeV and then decreased. The bismuth proton fission cross-section increased in line with the rise in proton energy up to 1 GeV. (author). 21 refs, 6 figs.

Measurement of 235U enrichment with a LaBr3 scintillation detector

International Nuclear Information System (INIS)

Mortreau, P.; Berndt, R.

2010-01-01

This paper describes the performance of a 1.5 in.x1.5 in. LaBr 3 gamma radiation detector for determining 235 U enrichment by non-destructive analysis. The spectrometric properties of the detector, brought to market under the trade name BrillanCe-380 , were first evaluated. Enrichment measurements were subsequently carried out in different experimental conditions on certified uranium samples with enrichment ranging from 0.31% to 60% and on UF 6 containers of the type 30B and 48Y.

Effect of cycloheximide and actinomycin D on radionuclide 235U-induced apoptosis

International Nuclear Information System (INIS)

Fu Qiang; Zhang Lansheng; Zhu Shoupeng

1999-01-01

Objective: The mechanism of apoptosis induced by radionuclide 235 U was studied. Methods: MTT and JAM assay were used to analyse the cell viability and quantification of fragmented DNA. Results: The inhibitor of protein cycloheximide (CHX), and the inhibitor of RNA synthesis, actinomycin D. cannot inhibit the apoptosis induced by 235 U, but CHX can partly inhibit apoptotic cells DNA fragmentation. Conclusion: The pathway of apoptosis induced by radionuclide 235 U is different from X-and γ-ray external irradiation, protein synthesis is not essential for it, but synthetic endonuclease is necessary for DNA fragmentation of apoptotic cells

Computer program FPIP-REV calculates fission product inventory for U-235 fission

Science.gov (United States)

Brown, W. S.; Call, D. W.

1967-01-01

Computer program calculates fission product inventories and source strengths associated with the operation of U-235 fueled nuclear power reactor. It utilizes a fission-product nuclide library of 254 nuclides, and calculates the time dependent behavior of the fission product nuclides formed by fissioning of U-235.

Determination of the isotopic ratio {sup 234} U/{sup 238} U and {sup 235} U/{sup 238} U in uranium commercial reagents by alpha spectroscopy; Determinacion de la relacion isotopica {sup 234} U/{sup 238} U y {sup 235} U/{sup 238} U en reactivos comerciales de uranio por espectrometria alfa

Energy Technology Data Exchange (ETDEWEB)

Iturbe G, J L

1990-02-15

In this work the determination of the isotope ratio {sup 234} U/{sup 238} U and {sup 235} U/{sup 238} U obtained by means of the alpha spectroscopy technique in uranium reagents of commercial marks is presented. The analyzed uranium reagents were: UO{sub 2} (*) nuclear purity, UO{sub 3} (*) poly-science, metallic uranium, uranyl nitrate and uranyl acetate Merck, uranyl acetate and uranyl nitrate Baker, uranyl nitrate (*) of the Refinement and Conversion Department of the ININ, uranyl acetate (*) Medi-Lab Sigma of Mexico and uranyl nitrate Em Science. The obtained results show that the reagents that are suitable with asterisk (*) are in radioactive balance among the one {sup 234} U/{sup 238} U, since the obtained value went near to the unit. In the case of the isotope ratio {sup 235} U/{sup 238} U the near value was also obtained the one that marks the literature that is to say 0.04347, what indicates that these reagents contain the isotope of {sup 235} U in the percentage found in the nature of 0.71%. The other reagents are in radioactive imbalance among the {sup 234} U/{sup 238} U, the found values fluctuated between 0.4187 and 0.1677, and for the quotient of activities {sup 235} U/{sup 238} U its were of 0.0226, and the lowest of 0.01084. Also in these reagents it was at the {sup 236} U as impurity. The isotope of {sup 236} U is an isotope produced artificially, for what is supposed that the reagents that are in radioactive imbalance were synthesized starting from irradiated fuel. (Author)

Use of integral experiments for the assessment of a new 235U IRSN-CEA evaluation

Directory of Open Access Journals (Sweden)

Ichou Raphaëlle

2017-01-01

Full Text Available The Working Party on International Nuclear Data Evaluation Co-operation (WPEC subgroup 29 (SG 29 was established to investigate an issue with the 235U capture cross-section in the energy range from 0.1 to 2.25 keV, due to a possible overestimation of 10% or more. To improve the 235U capture crosssection, a new 235U evaluation has been proposed by the Institut de Radioprotection et de Sûreté Nucléaire (IRSN and the CEA, mainly based on new time-of-flight 235U capture cross-section measurements and recent fission cross-section measurements performed at the n_TOF facility from CERN. IRSN and CEA Cadarache were in charge of the thermal to 2.25 keV energy range, whereas the CEA DIF was responsible of the high energy region. Integral experiments showing a strong 235U sensitivity are used to assess the new evaluation, using Monte-Carlo methods. The keff calculations were performed with the 5.D.1 beta version of the MORET 5 code, using the JEFF-3.2 library and the new 235U evaluation, as well as the JEFF-3.3T1 library in which the new 235U has been included. The benchmark selection allowed highlighting a significant improvement on keff due to the new 235U evaluation. The results of this data testing are presented here.

48 CFR 252.235-7001 - Indemnification under 10 U.S.C. 2354-cost reimbursement.

Science.gov (United States)

2010-10-01

....S.C. 2354-cost reimbursement. 252.235-7001 Section 252.235-7001 Federal Acquisition Regulations.... 2354—cost reimbursement. As prescribed in 235.070-3, use the following clause: Indemnification Under 10 U.S.C. 2354—Cost Reimbursement (DEC 1991) (a) This clause provides for indemnification under 10 U.S...

Activation Doppler Measurements on U 238 and U 235 in Some Fast Reactor Spectra

Energy Technology Data Exchange (ETDEWEB)

Tiren, L I; Gustafsson, I

1968-03-15

Measurements of the Doppler effect in U-238 capture and U-235 fission have been made by means of the activation technique in three different neutron spectra in the fast critical assembly FR0. The experiments involved the irradiation of thin uranium metal foils or oxide disks, which were heated in a small oven located at the core centre. The measurements on U-238 were extended to 1780 deg K and on U-235 to 1470 deg K. A core region surrounding the oven was homogenized in order to facilitate the interpretation of results. The reaction rates in the uranium samples were detected by gamma counting. The experimental method was checked with regard to systematic errors by irradiations in a thermal spectrum. The data obtained for U-238 capture were corrected for the effect of neutron collisions in the oven wall, and were extrapolated to zero sample thickness. In the softest spectrum (core 5) a Doppler effect (relative increase in capture rate) of 0.260 {+-} 0.018 was obtained on heating from 343 to 1780 deg K, and in the hardest spectrum (core 3) the corresponding value was 0.030 {+-} 0.003. An appreciable Doppler effect in U-235 fission was obtained only in the softest spectrum, in which the measured increase in fission rate on heating from 320 to 1470 deg K was 0.007 {+-} 0.003.

Decay heat of 235U fission products by beta- and gamma-ray spectrometry

International Nuclear Information System (INIS)

Dickens, J.K.; Love, T.A.; McConnell, J.W.; Peelle, R.W.

1976-09-01

The fast-rabbit facilities of the ORRR were used to irradiate 1- to 10-μg samples of 235 U for 1, 10, and 100 s. Released power is observed using nuclear spectroscopy to permit separate observations of emitted β and γ spectra in successive time intervals. The spectra were integrated over energy to obtain total decay heat and the β- and γ-ray results are summed together. 10 fig, 2 tables

Measurement of the 235 U absolute activity

International Nuclear Information System (INIS)

Bueno, C.C.; Santos, M.D.S.

1993-01-01

The absolute activity of 235 U contained in a sample was measured utilizing a sum-coincidence circuit which selects only the alpha particles emitted simultaneously with the 143 KeV gamma radiations from the 231 Th (product nucleus). The alpha particles were detected by means of a new type of a gas scintillating chamber, in which the light emitted by excitation of the gas atoms, due to the passage of a charged incoming particle, has its intensity increased by the action of an applied electric field. The gamma radiations were detected by means of a 1'x 1 1/2 Nal (TI) scintillation detector. The value obtained for the half-life of 235 U, (7.04+-0.01)10 8 y, was compared with the data available from various observers with used different experimental techniques. It is shown that our results are in excellent agreement with the best data available on the subject. (author) 15 refs, 5 figs, 1 tab

13 CFR 500.100 - Purpose and scope.

Science.gov (United States)

2010-01-01

... Board's authorities and organizational structure, the means and rules by which the Board takes actions... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Purpose and scope. 500.100 Section 500.100 Business Credit and Assistance EMERGENCY OIL AND GAS GUARANTEED LOAN BOARD EMERGENCY OIL AND...

Non-electric-dipole photofission of 235U

International Nuclear Information System (INIS)

Arruda Neto, J.D.T.; Herdade, S.B.; Carvalheiro, Z.; Simionatto, S.

1984-01-01

The electrofission cross section for 235 U has been measured from 5.8 to 22 MeV. From a combined analysis of it and the previously measured photofission cross section, using the virtual-photon formalism, the photofission cross section for excitations other than E1 has been determined. (Author) [pt

Calculated critical parameters in simple geometries for oxide and nitrate water mixtures of U-233, U-235 and Pu-239 with thorium. Final report

International Nuclear Information System (INIS)

Converse, W.E.; Bierman, S.R.

1979-11-01

Calculations have been performed on water mixtures of oxides and nitrates of 233 U, 235 U, and 239 Pu with chemically similar thorium compounds to determine critical dimensions for simple geometries (sphere, cylinder, and slab). Uranium enrichments calculated were 100%, 20%, 10%, and 5%; plutonium calculations assumed 100% 239 Pu. Thorium to uranium or plutonium weight ratios (Th: U or Pu) calculated were 0, 1, 4, and 8. Both bare and full water reflection conditions were calculated. The results of the calculations are plotted showing a critical dimension versus the uranium or plutonium concentration. Plots of K-infinity and material buckling for each material type are also shown

Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV

International Nuclear Information System (INIS)

Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

1991-01-01

Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233, 234, 236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for 235 U(n,f). 6 refs., 1 fig

Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV

International Nuclear Information System (INIS)

Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

1992-01-01

Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233,234,236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most of the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n, f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n, f) at 14.1 MeV which will allow us to obtain cross section values from the ratio data and our values for 235 U(n, f). (orig.)

Determination of U235 enrichment from nuclear fuel by neutronic activation

International Nuclear Information System (INIS)

Almeida, M.C.M. de.

1988-01-01

The enrichment of 235 U in UO 2 pellets samples through the instrumental neutron activation analysis method (I.N.A.A.) was determined. By high resolution gamma-ray spectrometry (H.R.G.S.), from analysis of isotopic ratios between fission products peaks from 235 U and 239 Np different energies peaks from 238 U, the enrichment was achieved. The 'Boatstrap' statistics technique for the analytical results, which is based in shaping results of an unknown distribution to the Gaussian distribution by B replications in interested statistics such as: the mean and its standard error, was introduced. (M.J.C.) [pt

Uranium isotopic ratio measurements ({sup 235}U/{sup 238}U) by laser ablation high resolution inductively coupled plasma mass spectrometry for environmental radioactivity monitoring - {sup 235}U/{sup 238}U isotope ratio analysis by LA-ICP-MS-HR for environmental radioactivity monitoring

Energy Technology Data Exchange (ETDEWEB)

David, K.; Mokili, M.B.; Rousseau, G.; Deniau, I.; Landesman, C. [SUBATECH, Ecole des Mines de Nantes, Universite de Nantes, CNRS/IN2P3, 4 rue Alfred Kastler, 44307 Nantes cedex 3 (France)

2014-07-01

standard control during the analysis session. Sample surfaces were cleaned by raster line scan using spot size of 90 micrometers, laser frequency of 10 Hz at low energy (10%) and then analyzed using the ablation line mode with spot sizes of 90-100 micrometers, laser frequency of 10 Hz at energies 50-80% (0.5-2.3 mJ). One analysis including measurement of background and sample signals allowed the acquisition of one thousand {sup 235}U/{sup 238}U isotope ratios in one minute. The reliability and comparability of measurement results of isotope ratios of uranium were guaranteed and monitored via the correct use of reference materials. Preliminary results on six coral samples display a natural uranium signature with an average {sup 235}U/{sup 238}U of 0.0072±0.0002 (2-sigma). The analysis of the NIST612 standard without mass fractionation correction gives an average {sup 235}U/{sup 238}U equal to 0.00238±0.00002 (2-sigma). (authors)

Identification of high-spin states in 235U

International Nuclear Information System (INIS)

Lorenz, A.; Makarenko, V.E.; Chukreev, F.E.

1994-02-01

The results of a 235 U high spin states study are analysed. A new way to assign newly observed gamma ray transitions is proposed. Such assignments deals with low spin parts of the level scheme without introducing high spin level states. (author)

Fission product yields from 6 to 9 MeV neutron induced fission of 235U and 238U

International Nuclear Information System (INIS)

Chapman, T.C.

1978-01-01

The yields of 28 mass chains have been measured for fission of 235 U and 238 U induced by neutrons at four different energies from 6.0 to 9.1 MeV. This is the first experimental measurement where sufficient energy resolution was obtained to observe the effect of the onset of second-chance fission in the case of symmetric fission. The 111 Ag results are compared with measurements at other neutron energies and with previous theoretical predictions. Several of the nuclide results are presented in graphical form, and all nuclide results are presented in tabular form, as a function of neutron energy. The mass chains measured range from 84 to 156, and their half-lives range from 18 minutes to 30 years

Neutron induced fission cross sections for 232Th, 235,238U, 237Np, and 239Pu

International Nuclear Information System (INIS)

Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Hill, N.W.; Carlson, A.D.; Wasson, O.A.

1989-01-01

Neutron-induced fission cross section ratios for samples of 232 Th, 235,238 U, 237 Np and 239 Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence from 3 to 30 MeV. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.178 MeV. From 30 to 400 MeV cross section values were determined using the neutron fluence measured with a plastic scintillator. Cross section values of 232 Th, 235,238 U, 237 Np and 239 Pu were computed from the ratio data using the authors' values for 235 U(n,f). In addition to providing new results at high neutron energies, these data highlight several areas of deficiency in the evaluated nuclear data files and provide new information for the 235 U(n,f) standard

The Effect of Early Diagenesis on the 238U/235U Ratio of Platform Carbonates.

Science.gov (United States)

Tissot, F.; Chen, C.; Go, B. M.; Naziemiec, M.; Healy, G.; Swart, P. K.; Dauphas, N.

2017-12-01

In the past 15 years, the so-called non-traditional stable isotopes systems (e.g., Mg, Fe, Mo, U) have emerged as powerful tracers of both high-T and low-T geochemical processes (e.g., [1]). Of particular interest for paleoredox studies is the ratio of "stable" isotopes of U (238U/235U), which has the potential to track the global extent of oceanic anoxia (e.g., [2, 3]). Indeed, in the modern ocean, U exists in two main oxidation states, soluble U6+ and insoluble U4+, and has a mean residence time of 400 kyr ([4]), much longer than the global ocean mixing time (1-2 kyr). As such the salinity-normalized ocean is homogeneous with regards to both U concentrations and isotopes (δ238USW = -0.392±0.005 ‰, [2]). The value of δ238USW at any given time is therefore the balance between U input to the ocean, mainly from rivers, and U removal, mostly into biogenic carbonates, anoxic/euxinic sediments and suboxic/hypoxic sediments (e.g., [2, 5]). Because the 238U/235U ratio of the past ocean cannot be measured directly, it has to be estimated from the measurement of the 238U/235U ratio of a sedimentary rock and assuming a constant fractionation factor. Carbonates appear as a promising record since they span most of Earth's history, and the δ238U values of modern primary carbonate precipitates and well-preserved fossil aragonitic coral up to 600 ka are indistinguishable from that of seawater (e.g., [2, 6, 7]). Yet, the effect of secondary processes on the δ238U values of non-coral carbonates, which represent the bulk of the rock record, has only been studied in a handful of shallow samples (down to 40cm, [6]) and remains poorly understood. To investigate the effect of early diagenesis on the 238U/235U ratio of carbonates on the 30kyr to 1Myr timescale, we measured δ13C, δ18O, and δ238U in samples from a 220m long drill core from the Bahamas carbonate platform. In order to separate lattice bound U from secondary U we developed a leaching protocol applicable to carbonate

Resonance Region Covariance Analysis Method and New Covariance Data for Th-232, U-233, U-235, U-238, and Pu-239

International Nuclear Information System (INIS)

Leal, Luiz C.; Arbanas, Goran; Derrien, Herve; Wiarda, Dorothea

2008-01-01

Resonance-parameter covariance matrix (RPCM) evaluations in the resolved resonance region were done for 232Th, 233U, 235U, 238U, and 239Pu using the computer code SAMMY. The retroactive approach of the code SAMMY was used to generate the RPCMs for 233U, 235U. RPCMs for 232Th, 238U and 239Pu were generated together with the resonance parameter evaluations. The RPCMs were then converted in the ENDF format using the FILE32 representation. Alternatively, for computer storage reasons, the FILE32 was converted in the FILE33 cross section covariance matrix (CSCM). Both representations were processed using the computer code PUFF-IV. This paper describes the procedures used to generate the RPCM with SAMMY.

R-matrix analyses of the 235U and 239Pu neutron cross sections

International Nuclear Information System (INIS)

Derrien, H.; de Saussure, G.; Larson, N.M.; Leal, L.C.; Perez, R.B.

1988-01-01

The resonance parameter analysis code SAMMY was used to perform consistent resonance analyses of several 235 U and 239 Pu fission and capture cross section and transmission measurements up to 110 eV for 235 U and up to 1 keV for 239 Pu. The method of analysis, the measurement selection and the results are briefly outlined in this paper

DEVELOPMENT OF ENRICHMENT VERIFICATION ASSAY BASED ON THE AGE AND 235U AND 238U ACTIVITIES OF THE SAMPLES

International Nuclear Information System (INIS)

AL-YAMAHI, H.; EL-MONGY, S.A.

2008-01-01

Development of the enrichment verification methods is the backbone of the nuclear materials safeguards skeleton. In this study, the 235U percentage of depleted , natural and very slightly enriched uranium samples were estimated based on the sample age and the measured activity of 235U and 238U. The HpGe and NaI spectrometry were used for samples assay. A developed equation was derived to correlate the sample age and 235U and 238U activities with the enrichment percentage (E%). The results of the calculated E% by the deduced equation and the target E% values were found to be similar and within 0.58 -1.75% bias in the case of HpGe measurements. The correlation between them was found to be very sharp. The activity was also calculated based on the measured sample count rate and the efficiency at the gamma energies of interest. The correlation between the E% and the 235U activity was estimated and found to be linearly sharp. The results obtained by NaI was found to be less accurate than these obtained by HpGe. The bias in the case of NaI assay was in the range from 6.398% to 22.8% for E% verification

Using 238U/235U ratios to understand the formation and oxidation of reduced uranium solids in naturally reduced zones

Science.gov (United States)

Jemison, N.; Johnson, T. M.; Druhan, J. L.; Davis, J. A.

2016-12-01

Uranium occurs in groundwater primarily as soluble and mobile U(VI), which can be reduced to immobile U(IV), often observed in sediments as uraninite. Numerous U(VI)-contaminated sites, such as the DOE field site in Rifle, CO, contain naturally reduced zones (NRZ's) that have relatively high concentrations of organic matter. Reduction of heavy metals occurs within NRZ's, producing elevated concentrations of iron sulfides and U(IV). Slow, natural oxidation of U(IV) from NRZ's may prolong U(VI) contamination of groundwater. The reduction of U(VI) produces U(IV) with a higher 238U/235U ratio. Samples from two NRZ sediment cores recovered from the Rifle site revealed that the outer fringes of the NRZ contain U(IV) with a high 238U/235U ratio, while lower values are observed in the center . We suggest that as aqueous U(VI) was reduced in the NRZ, it was driven to lower 238U/235U values, such that U(IV) formed in the core of the NRZ reflects a lower 238U/235U. Two oxidation experiments were conducted by injecting groundwater containing between 14.9 and 21.2 mg/L dissolved O2 as an oxidant into the NRZ. The oxidation of U(IV) from this NRZ increased aqueous U(VI) concentrations and caused a shift to higher 238U/235U in groundwater as U(IV) was oxidized primarily on the outer fringes of the NRZ. In total these observations suggest that the stability of solid phase uranium is governed by coupled reaction and transport processes. To better understand various reactive transport scenarios we developed a model for the formation and oxidation of NRZ's utilizing the reactive transport software CrunchTope. These simulations suggest that the development of isotopically heterogeneous U(IV) within NRZ's is largely controlled by permeability of the NRZ and the U(VI) reduction rate. Oxidation of U(IV) from the NRZ's is constrained by the oxidation rate of U(IV) as well as iron sulfides, which can prevent oxidation of U(IV) by scavenging dissolved oxygen.

Exploratory study of fission product yields of neutron-induced fission of 235U , 238U , and 239Pu at 8.9 MeV

Science.gov (United States)

Bhatia, C.; Fallin, B. F.; Gooden, M. E.; Howell, C. R.; Kelley, J. H.; Tornow, W.; Arnold, C. W.; Bond, E.; Bredeweg, T. A.; Fowler, M. M.; Moody, W.; Rundberg, R. S.; Rusev, G. Y.; Vieira, D. J.; Wilhelmy, J. B.; Becker, J. A.; Macri, R.; Ryan, C.; Sheets, S. A.; Stoyer, M. A.; Tonchev, A. P.

2015-06-01

Using dual-fission chambers each loaded with a thick (200 -400 -mg /c m2) actinide target of 235 ,238U or 239Pu and two thin (˜10 -100 -μ g /c m2) reference foils of the same actinide, the cumulative yields of fission products ranging from 92Sr to 147Nd have been measured at En= 8.9 MeV . The 2H(d ,n ) 3He reaction provided the quasimonoenergetic neutron beam. The experimental setup and methods used to determine the fission product yield (FPY) are described, and results for typically eight high-yield fission products are presented. Our FPYs for 235U(n ,f ) , 238U(n ,f ) , and 239Pu(n ,f ) at 8.9 MeV are compared with the existing data below 8 MeV from Glendenin et al. [Phys. Rev. C 24, 2600 (1981), 10.1103/PhysRevC.24.2600], Nagy et al. [Phys. Rev. C 17, 163 (1978), 10.1103/PhysRevC.17.163], Gindler et al. [Phys. Rev. C 27, 2058 (1983), 10.1103/PhysRevC.27.2058], and those of Mac Innes et al. [Nucl. Data Sheets 112, 3135 (2011), 10.1016/j.nds.2011.11.009] and Laurec et al. [Nucl. Data Sheets 111, 2965 (2010), 10.1016/j.nds.2010.11.004] at 14.5 and 14.7 MeV, respectively. This comparison indicates a negative slope for the energy dependence of most fission product yields obtained from 235U and 239Pu , whereas for 238U the slope issue remains unsettled.

Fission Product Yields of 233U, 235U, 238U and 239Pu in Fields of Thermal Neutrons, Fission Neutrons and 14.7-MeV Neutrons

Science.gov (United States)

Laurec, J.; Adam, A.; de Bruyne, T.; Bauge, E.; Granier, T.; Aupiais, J.; Bersillon, O.; Le Petit, G.; Authier, N.; Casoli, P.

2010-12-01

The yields of more than fifteen fission products have been carefully measured using radiochemical techniques, for 235U(n,f), 239Pu(n,f) in a thermal spectrum, for 233U(n,f), 235U(n,f), and 239Pu(n,f) reactions in a fission neutron spectrum, and for 233U(n,f), 235U(n,f), 238U(n,f), and 239Pu(n,f) for 14.7 MeV monoenergetic neutrons. Irradiations were performed at the EL3 reactor, at the Caliban and Prospero critical assemblies, and at the Lancelot electrostatic accelerator in CEA-Valduc. Fissions were counted in thin deposits using fission ionization chambers. The number of fission products of each species were measured by gamma spectrometry of co-located thick deposits.

Impact of the 235U Covariance Data in Benchmark Calculations

International Nuclear Information System (INIS)

Leal, Luiz C.; Mueller, D.; Arbanas, G.; Wiarda, D.; Derrien, H.

2008-01-01

The error estimation for calculated quantities relies on nuclear data uncertainty information available in the basic nuclear data libraries such as the U.S. Evaluated Nuclear Data File (ENDF/B). The uncertainty files (covariance matrices) in the ENDF/B library are generally obtained from analysis of experimental data. In the resonance region, the computer code SAMMY is used for analyses of experimental data and generation of resonance parameters. In addition to resonance parameters evaluation, SAMMY also generates resonance parameter covariance matrices (RPCM). SAMMY uses the generalized least-squares formalism (Bayes method) together with the resonance formalism (R-matrix theory) for analysis of experimental data. Two approaches are available for creation of resonance-parameter covariance data. (1) During the data-evaluation process, SAMMY generates both a set of resonance parameters that fit the experimental data and the associated resonance-parameter covariance matrix. (2) For existing resonance-parameter evaluations for which no resonance-parameter covariance data are available, SAMMY can retroactively create a resonance-parameter covariance matrix. The retroactive method was used to generate covariance data for 235U. The resulting 235U covariance matrix was then used as input to the PUFF-IV code, which processed the covariance data into multigroup form, and to the TSUNAMI code, which calculated the uncertainty in the multiplication factor due to uncertainty in the experimental cross sections. The objective of this work is to demonstrate the use of the 235U covariance data in calculations of critical benchmark systems

Impact of the 235U covariance data in benchmark calculations

International Nuclear Information System (INIS)

Leal, Luiz; Mueller, Don; Arbanas, Goran; Wiarda, Dorothea; Derrien, Herve

2008-01-01

The error estimation for calculated quantities relies on nuclear data uncertainty information available in the basic nuclear data libraries such as the U.S. Evaluated Nuclear Data File (ENDF/B). The uncertainty files (covariance matrices) in the ENDF/B library are generally obtained from analysis of experimental data. In the resonance region, the computer code SAMMY is used for analyses of experimental data and generation of resonance parameters. In addition to resonance parameters evaluation, SAMMY also generates resonance parameter covariance matrices (RPCM). SAMMY uses the generalized least-squares formalism (Bayes' method) together with the resonance formalism (R-matrix theory) for analysis of experimental data. Two approaches are available for creation of resonance-parameter covariance data. (1) During the data-evaluation process, SAMMY generates both a set of resonance parameters that fit the experimental data and the associated resonance-parameter covariance matrix. (2) For existing resonance-parameter evaluations for which no resonance-parameter covariance data are available, SAMMY can retroactively create a resonance-parameter covariance matrix. The retroactive method was used to generate covariance data for 235 U. The resulting 235 U covariance matrix was then used as input to the PUFF-IV code, which processed the covariance data into multigroup form, and to the TSUNAMI code, which calculated the uncertainty in the multiplication factor due to uncertainty in the experimental cross sections. The objective of this work is to demonstrate the use of the 235 U covariance data in calculations of critical benchmark systems. (authors)

Fission cross section ratios for sup 233,234,236 U relative to sup 235 U from 0. 5 to 400 MeV

Energy Technology Data Exchange (ETDEWEB)

Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J. (Los Alamos National Lab., NM (USA)); Carlson, A.D.; Wasson, O.A. (National Inst. of Standards and Technology, Gaithersburg, MD (USA)); Hill, N.W. (Oak Ridge National Lab., TN (USA))

1991-01-01

Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of {sup 233, 234, 236}U relative to {sup 235}U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the {sup 235}U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for {sup 235}U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for {sup 235}U(n,f). 6 refs., 1 fig.

Development and evaluation of a collection apparatus for recoil products for study of the deexcitation process of "2"3"5"mU

International Nuclear Information System (INIS)

Shigekawa, Y.; Kasamatsu, Y.; Shinohara, A.

2016-01-01

The nucleus "2"3"5"mU is an isomer with extremely low excitation energy (76.8 eV) and decays dominantly through the internal conversion (IC) process. Because outer-shell electrons are involved in the IC process, the decay constant of "2"3"5"mU depends on its chemical environment. We plan to study the deexcitation process of "2"3"5"mU by measuring the energy spectra of IC electrons in addition to the decay constants for various chemical forms. In this paper, the preparation method of "2"3"5"mU samples from "2"3"9Pu by using alpha-recoil energy is reported. A Collection Apparatus for Recoil Products was fabricated, and then collection efficiencies under various conditions were determined by collecting "2"2"4Ra recoiling out of "2"2"8Th electrodeposited and precipitated sources. The pressure in the apparatus (vacuum or 1 atm of N_2 gas) affected the variations of the collection efficiencies depending on the negative voltage applied to the collector. The maximum values of the collection efficiencies were mainly affected by the thickness of the "2"2"8Th sources. From these results, the suitable conditions of the "2"3"9Pu sources for preparation of "2"3"5"mU were determined. In addition, dissolution efficiencies were determined by washing collected "2"2"4Ra with solutions. When "2"2"4Ra was collected in 1 atm of N_2 gas and dissolved with polar solutions such as water, the dissolution efficiencies were nearly 100%. The method of rapid dissolution of recoil products would be applicable to rapid preparation of short-lived "2"3"5"mU samples for various chemical forms.

Theoretical Model for Volume Fraction of UC, 235U Enrichment, and Effective Density of Final U 10Mo Alloy

Energy Technology Data Exchange (ETDEWEB)

Devaraj, Arun [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Prabhakaran, Ramprashad [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Joshi, Vineet V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Hu, Shenyang Y. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); McGarrah, Eric J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Lavender, Curt A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL)

2016-04-12

The purpose of this document is to provide a theoretical framework for (1) estimating uranium carbide (UC) volume fraction in a final alloy of uranium with 10 weight percent molybdenum (U-10Mo) as a function of final alloy carbon concentration, and (2) estimating effective ²³⁵U enrichment in the U-10Mo matrix after accounting for loss of ²³⁵U in forming UC. This report will also serve as a theoretical baseline for effective density of as-cast low-enriched U-10Mo alloy. Therefore, this report will serve as the baseline for quality control of final alloy carbon content

Decay heat measurement of U-235

International Nuclear Information System (INIS)

Baumung, K.

1976-01-01

The calorimeter and the transport mechanism for the fuel samples was designed and is under construction now. Calculations of the heat-source distributions for different 235U-contents led to an optimal enrichment of the UO 2 -samples which minimizes the effects of the bad heat conductivity of the oxide on temperature measurement. Monte-Carlo-calculations of the γ-leakage-spectra yielded data which allow, from the γ-energy-flow measurements, to calculate the total γ-energy loss as well as the portions of the β- and γ-heating. (orig.) [de

Use of integral experiments for the assessment of the 235U capture cross section within the CIELO Project

Directory of Open Access Journals (Sweden)

Ichou Raphaelle

2016-01-01

Full Text Available A new 235U capture cross-section evaluation, evaluated by ORNL and the CEA Bruyères-le-Châtel (BRC has been proposed within the CIELO project. IRSN, who participates in the CIELO project, contributes with data testing and has carried out benchmark calculations using few benchmarks, extracted from the ICSBEP database, for testing the new 235U evaluation. The benchmarks have been selected by privileging the experiments showing small experimental uncertainties and a significant sensitivity to 235U capture cross-section. The keff calculations were performed with both the MCNP 6 code and the 5.C.1 release of the MORET 5 code, using the ENDF/B-VII.1 library for all isotopes except 235U, for which both the ENDF/B-VII.1 and the new 235U evaluation was used. The benchmark selection allowed highlighting a significant effect on keff of the new 235U capture cross-section. The results of this data testing, provided as input for the evaluators, are presented here.

Study of correcting the effect of daughter age on determining 235U enrichment of fuel rods

International Nuclear Information System (INIS)

Deng Jingshan; Zhou Chengfang; Luo Minxuan; Liu Yun

1997-01-01

Gamma-ray passive technique is a very effective method to assay and determine 235 U enrichment of nuclear power plant fuel rods. There is a weakness in this passive method, i.e. only after the uranium isotope daughters of UO 2 pellets have reached to equilibrium with uranium parent, then the 235 U enrichment can be determined. This weakness greatly restricts the application of the method. A new two-peak and two-window technique is developed that can overcome the interference of uranium daughter decay in determining 235 U enrichment of nuclear fuel rods, and the results are very satisfactory. The new technique will play an important role in the gamma-ray passive technique for determining 235 U enrichment of fuel rods. This new technique also makes the gamma-ray passive method perfectly. (11 figs., 6 tabs.)

Determination of the isotope U-235 in uranium hexafluoride by gas mass spectrometry: results of an interlaboratory experiment performed in 1975

International Nuclear Information System (INIS)

Duerr, W.; Grossgut, W.; Beyrich, W.

1977-02-01

Samples of UF 6 with a 235 U content of about 0.4, 0.7 and 3% were measured with 10 gas mass spectrometers in 8 European laboratories. Identical reference materials were used with 235 U abundances deviating less than 6% from those of the samples and known with an accuracy better than +- 0.15%. By statistical evaluation of the data, errors of about 0.1% were calculated for the determination of the ratio of ratios 235 U: 238 U (sample)/ 235 U: 238 U (reference) with increasing tendency for 235 U abundances below the natural range. (orig./HP) [de

Quantification of 235U and 238U activity concentrations for undeclared nuclear materials by a digital gamma-gamma coincidence spectroscopy.

Science.gov (United States)

Zhang, Weihua; Yi, Jing; Mekarski, Pawel; Ungar, Kurt; Hauck, Barry; Kramer, Gary H

2011-06-01

The purpose of this study is to investigate the possibility of verifying depleted uranium (DU), natural uranium (NU), low enriched uranium (LEU) and high enriched uranium (HEU) by a developed digital gamma-gamma coincidence spectroscopy. The spectroscopy consists of two NaI(Tl) scintillators and XIA LLC Digital Gamma Finder (DGF)/Pixie-4 software and card package. The results demonstrate that the spectroscopy provides an effective method of (235)U and (238)U quantification based on the count rate of their gamma-gamma coincidence counting signatures. The main advantages of this approach over the conventional gamma spectrometry include the facts of low background continuum near coincident signatures of (235)U and (238)U, less interference from other radionuclides by the gamma-gamma coincidence counting, and region-of-interest (ROI) imagine analysis for uranium enrichment determination. Compared to conventional gamma spectrometry, the method offers additional advantage of requiring minimal calibrations for (235)U and (238)U quantification at different sample geometries. Crown Copyright © 2011. Published by Elsevier Ltd. All rights reserved.

Beta decay heat following U-235, U-238 and Pu-239 neutron fission

Science.gov (United States)

Li, Shengjie

1997-09-01

This is an experimental study of beta-particle decay heat from 235U, 239Pu and 238U aggregate fission products over delay times 0.4-40,000 seconds. The experimental results below 2s for 235U and 239Pu, and below 20s for 238U, are the first such results reported. The experiments were conducted at the UMASS Lowell 5.5-MV Van de Graaff accelerator and 1-MW swimming-pool research reactor. Thermalized neutrons from the 7Li(p,n)7Be reaction induced fission in 238U and 239Pu, and fast neutrons produced in the reactor initiated fission in 238U. A helium-jet/tape-transport system rapidly transferred fission fragments from a fission chamber to a low background counting area. Delay times after fission were selected by varying the tape speed or the position of the spray point relative to the beta spectrometer that employed a thin-scintillator-disk gating technique to separate beta-particles from accompanying gamma-rays. Beta and gamma sources were both used in energy calibration. Based on low-energy(energies 0-10 MeV. Measured beta spectra were unfolded for their energy distributions by the program FERD, and then compared to other measurements and summation calculations based on ENDF/B-VI fission-product data performed on the LANL Cray computer. Measurements of the beta activity as a function of decay time furnished a relative normalization. Results for the beta decay heat are presented and compared with other experimental data and the summation calculations.

The application of the Harwell neutron absorptiometer to the analysis of U-235 in nuclear fuel components

International Nuclear Information System (INIS)

Jones, T.L.; Watson, J.; Taylor, T.A.H.

1979-05-01

This paper describes the application of the Harwell Neutron Absorptiometer to routine analysis of the U-235 content of fuel element inserts manufactured at the Dounreay Nuclear Power Development Establishment for the use in Materials Testing Reactors. The instrument response, which is principally dependent on the 235 U closely follows a logarithmic relationship. Neutron attenuation due to the aluminium matrix and the presence of 238 U is less than 2% of the total attenuation. The absorptiometer can be used to estimate the weight of 235 U in a single insert with a total error in the range 1 to 1.6%. (author)

Ground water contamination with (238)U, (234)U, (235)U, (226)Ra and (210)Pb from past uranium mining: cove wash, Arizona.

Science.gov (United States)

Dias da Cunha, Kenya Moore; Henderson, Helenes; Thomson, Bruce M; Hecht, Adam A

2014-06-01

The objectives of the study are to present a critical review of the (238)U, (234)U, (235)U, (226)Ra and (210)Pb levels in water samples from the EPA studies (U.S. EPA in Abandoned uranium mines and the Navajo Nation: Red Valley chapter screening assessment report. Region 9 Superfund Program, San Francisco, 2004, Abandoned uranium mines and the Navajo Nation: Northern aum region screening assessment report. Region 9 Superfund Program, San Francisco, 2006, Health and environmental impacts of uranium contamination, 5-year plan. Region 9 Superfund Program, San Franciso, 2008) and the dose assessment for the population due to ingestion of water containing (238)U and (234)U. The water quality data were taken from Sect. "Data analysis" of the published report, titled Abandoned Uranium Mines Project Arizona, New Mexico, Utah-Navajo Lands 1994-2000, Project Atlas. Total uranium concentration was above the maximum concentration level for drinking water (7.410-1 Bq/L) in 19 % of the water samples, while (238)U and (234)U concentrations were above in 14 and 17 % of the water samples, respectively. (226)Ra and (210)Pb concentrations in water samples were in the range of 3.7 × 10(-1) to 5.55 × 102 Bq/L and 1.11 to 4.33 × 102 Bq/L, respectively. For only two samples, the (226)Ra concentrations exceeded the MCL for total Ra for drinking water (0.185 Bq/L). However, the (210)Pb/(226)Ra ratios varied from 0.11 to 47.00, and ratios above 1.00 were observed in 71 % of the samples. Secular equilibrium of the natural uranium series was not observed in the data record for most of the water samples. Moreover, the (235)U/(total)U mass ratios ranged from 0.06 to 5.9 %, and the natural mass ratio of (235)U to (total)U (0.72 %) was observed in only 16 % of the water samples, ratios above or below the natural ratio could not be explained based on data reported by U.S. EPA. In addition, statistical evaluations showed no correlations among the distribution of the radionuclide concentrations

Assay of Uranium Isotopic Ratios 234U/238U, 235U/238U in Bottom Sediment Samples Using Destructive and Non Destructive Techniques (Nasser Lake)

International Nuclear Information System (INIS)

Agha, A.R.; El-Mongy, S.A.; Kandel, A.E.

2011-01-01

Nasser Lake is the greatest man-made lake in the World. It is considered as the main source of water where the Nile water is impounded behind the Aswan high dam.. Uranium has three naturally occurring isotopes 234 U, 235 U and 238 U with isotopic abundance 0.00548, 0.7200 and 99.2745 atom percent. Dissolved uranium in the lake is primary due to weathering process. Monitoring of the isotopic ratios of uranium is used as a good indicator to trace and evaluate the origin and activities associated with any variation of uranium in the lake environment. The main objective of the present study is to clarify any potential variation of natural uranium 234 U/ 238 U, 235 U/ 238 U ratios in sediment samples of Nasser Lake by using destructive alpha and non destructive gamma- techniques. The results show that the uranium isotopic activity ratios are very close to the natural values. This study can also be used for radiological protection and safety evaluation purposes.

Photon-induced Fission Product Yield Measurements on 235U, 238U, and 239Pu

Science.gov (United States)

Krishichayan, Fnu; Bhike, M.; Tonchev, A. P.; Tornow, W.

2015-10-01

During the past three years, a TUNL-LANL-LLNL collaboration has provided data on the fission product yields (FPYs) from quasi-monoenergetic neutron-induced fission of 235U, 238U, and 239Pu at TUNL in the 0.5 to 15 MeV energy range. Recently, we have extended these experiments to photo-fission. We measured the yields of fission fragments ranging from 85Kr to 147Nd from the photo-fission of 235U, 238U, and 239Pu using 13-MeV mono-energetic photon beams at the HIGS facility at TUNL. First of its kind, this measurement will provide a unique platform to explore the effect of the incoming probe on the FPYs, i.e., photons vs. neutrons. A dual-fission ionization chamber was used to determine the number of fissions in the targets and these samples (along with Au monitor foils) were gamma-ray counted in the low-background counting facility at TUNL. Details of the experimental set-up and results will be presented and compared to the FPYs obtained from neutron-induced fission at the same excitation energy of the compound nucleus. Work supported in part by the NNSA-SSAA Grant No. DE-NA0001838.

Behavior of uranium along Jucar River (Eastern Spain). Determination of 234U/238U and 235U/238U ratios

International Nuclear Information System (INIS)

Rodriguez-Alvarez, M.J.; Sanchez, F.

1995-01-01

The uranium concentration and the 234 U/ 238 U, 235 U/ 238 U activity ratios were studied in water samples from Jucar River, using low-level α-spectrometry. The effects of pH, temperature and salinity were considered and more detailed sampling was done in the neighbourhood of Cofrentes Nuclear Plant (Valencia, Spain). Changes were observed in the uranium concentration with the salinity and the 234 U/ 238 U activity ratio was found to vary with pH. Leaching and dilution, which depend on pH and salinity, are the probable mechanisms for these changes in the concentration of uranium and the activity ratios. (author) 25 refs.; 4 figs.; 1 tab

235U isotope enrichment in the metastable levels of UI

International Nuclear Information System (INIS)

Gagne, J.M.; Demers, Y.; Dreze, C.; Pianarosa, P.

1983-01-01

We have used optical pumping to produce a substantial 235 U enrichment in the metastable levels of UI in the discharge afterglow of a hollow-cathode vapor generator. The measured isotope-enrichment factor for the level at 3800 cm -1 is approximately 20

Computer simulation of the natural U 238 and U 235 radioactive series decay

International Nuclear Information System (INIS)

Barna, A.; Oncescu, M.

1980-01-01

The principles of the computer simulation of a radionuclide decay - its decay scheme adoption and codification -, and the adoption principle of a radionuclide chain in a series are applied to the natural U 238 and U 235 series radionuclide decay computer simulation. Using the computer simulation data of these two series adopted chains, the decay characteristic quantities of the series radionuclides, the gamma spectra and the basic characteristics of each of these series are determined and compared with the experimental values given in the literature. (author)

Measurement of 235U fission spectrum-averaged cross sections and neutron spectrum adjusted with the activation data

International Nuclear Information System (INIS)

Kobayashi, Katsuhei; Kobayashi, Tooru

1992-01-01

The 235 U fission spectrum-averaged cross sections for 13 threshold reactions were measured with the fission plate (27 cm in diameter and 1.1 cm thick) at the heavy water thermal neutron facility of the Kyoto University Reactor. The Monte Carlo code MCNP was applied to check the deviation from the 235 U fission neutron spectrum due to the room-scattered neutrons, and it was found that the resultant spectrum was close to that of 235 U fission neutrons. Supplementally, the relations to derive the absorbed dose rates with the fission plate were also given using the calculated neutron spectra and the neutron Kerma factors. Finally, the present values of the fission spectrum-averaged cross sections were employed to adjust the 235 U fission neutron spectrum with the NEUPAC code. The adjusted spectrum showed a good agreement with the Watt-type fission neutron spectrum. (author)

Pulsed reactivity measurements of large 235U--Al castings in H2O

International Nuclear Information System (INIS)

Pellarin, D.J.; Jarriel, J.L.

1977-01-01

The safe storage and handling of large 235 U-Al castings at the Savannah River Plant are assured by limiting the number of fuel pieces and their spacing such that the k/sub eff/ calculated by KENO-IV with Hansen-Roach cross sections does not exceed some conservative limit with complete, accidental water immersion. For economic reasons, the conservative limit on the calculated k/sub eff/ is generally chosen as high as possible consistent with an accurate knowledge of the margin of error in the k/sub eff/ calculation. The margin of error for arrays of large, hollow cylinders of highly enriched 235 U-Al alloy fuel in H 2 O is presented. The subcritical reactivities were derived from pulsed neutron measurements. The measurements are extended to castings with 17.39 kg 235 U/m, the pulsed experiments are more accurately analyzed by the αv -1 method, and measurements for both 7-assembly hexagonal and 2 x 3 square pitch lattices are compared with KENO-IV calculations

Comparison of 235U fission cross sections in JENDL-3.3 and ENDF/B-VI

International Nuclear Information System (INIS)

Kawano, Toshihiko; Carlson, Allan D.; Matsunobu, Hiroyuki; Nakagawa, Tsuneo; Shibata, Keiichi

2002-01-01

Comparisons of evaluated fission cross sections for 235 U in JENDL-3.3 and ENDF/B-VI are carried out. The comparisons are made for both the differential and integral data. The fission cross sections as well as the fission ratios are compared with the experimental data in detail. Spectrum averaged cross sections are calculated and compared with the measurements. The employed spectra are the 235 U prompt fission neutron spectrum, the 252 Cf spontaneous fission neutron spectrum, and the neutron spectrum produced by a 9 Be(d, xn) reaction. For 235 U prompt fission neutron spectrum, the ENDF/B-VI evaluation reproduces experimental averaged cross sections. For 252 Cf and 9 Be(d, xn) neutron spectra, the JENDL-3.3 evaluation gives better results than ENDF/B-VI. (author)

R-matrix analysis of the 235U neutron cross sections

International Nuclear Information System (INIS)

Leal, L.C.; de Saussure, G.; Perez, R.B.

1988-01-01

The ENDFB-V representation of the 235 U neutron cross sections in the resolved resonance region is unsatisfactory: below 1 eV the cross sections are given by ''smooth files'' (file 3) rather than by resonance parameters; above 1 eV the single-level formalism used by ENDFB-V necessitates a structured file 3 contribution consisting of more than 1300 energy points; furthermore, information on level-spins has not been included. Indeed the ENDFB-V 235 U resonance region is based on an analysis done in 1970 for ENDFB-III and therefore does not include the results of high quality measurements done in the past 18 years. The present paper presents the result of an R-matrix multilevel analysis of recent measurements as well as older data. The analysis also extends the resolved resonance region from its ENDFB-V upper limit of 81 eV to 110 eV. 13 refs., 2 figs., 1 tab

Resonance structure in the fission of ( sup 235 U+n)

Energy Technology Data Exchange (ETDEWEB)

Moore, M.S. (Los Alamos National Lab. (LANL), NM (USA). Physics Div.); Leal, L.C.; De Saussure, G.; Perez, R.B.; Larson, N.M. (Oak Ridge National Lab., TN (USA))

1989-10-09

A new multilevel reduced R-matrix analysis of the neutron-induced resonance cross sections of {sup 235}U has been carried out. We used as a constraint in the analysis the angular anisotropy measurements of Pattenden and Postma, obtaining a Bohr-channel (or J, K channel) representation of the resonances in a two-fission vector space for each spin state. Hambsch et al., have reported definitive measurements of the mass- and kinetic-energy distributions of fission fragments of ({sup 235}U+n) in the resonance region and analyzed their results according to the fission-channel representation of Brosa et al., extracting relative contributions of the two asymmetric and one symmetric Brosa fission channels. We have explored the connection between Bohr-channel and asymmetric Brosa-channel representations. The results suggest that a simple rotation of coordinates in channel space may be the only transformation required; the multilevel fit to the total and partial cross sections is invariant to such a transformation. (orig.).

Improvement of voltage holding capability in the 500 keV negative ion source for JT-60SA.

Science.gov (United States)

Tanaka, Y; Hanada, M; Kojima, A; Akino, N; Shimizu, T; Ohshima, K; Inoue, T; Watanabe, K; Taniguchi, M; Kashiwagi, M; Umeda, N; Tobari, H; Grisham, L R

2010-02-01

Voltage holding capability of JT-60 negative ion source that has a large electrostatic negative ion accelerator with 45 cm x 1.1 m acceleration grids was experimentally examined and improved to realize 500 keV, 22 A, and 100 s D- ion beams for JT-60 Super Advanced. The gap lengths in the acceleration stages were extended to reduce electric fields in a gap between the large grids and at the corner of the support flanges from the original 4-5 to 3-4 kV/mm. As a result, the voltage holding capability without beam acceleration has been successfully improved from 400 to 500 kV. The pulse duration to hold 500 kV reached 40 s of the power supply limitation.

Distribution of nanomole quantities of 235U in young and adult Japanese quail and in the F1 generation. Comparison with 153Gd

International Nuclear Information System (INIS)

Robinson, G.A.

1988-01-01

Enriched uranium, 93.16% for 235 U, served as a tracer of uranium deposition in an avian species, the Japanese quail. A second label, 153 Gd, provided for monitoring of procedures and for estimation of the 235 U content of live eggs. Depositions of 235 U were greater than for 153 Gd in all tissues except the yolk sac and the liver. Skeletal levels for 235 U were age- and sex-dependent. Feathers contained only 0.11% of the 235 U tracer in contrast to 50% of the endogenous uranium. The results show that 235 U provides for tracing uranium metabolism in small animals, since in quail the tracer increased the uranium burden of the body by only 1-8%. (author)

Delayed β ray spectrum of 235U fission fragments

International Nuclear Information System (INIS)

Pascholati, P.R.

1973-01-01

The time-dependent electron spectra of fission fragments from the thermal-neutron-induced fission of 235 U are calculated. The Gross theory of nuclear beta decay is used to obtain the decay constant and individual electron spectra. The mean energy per fission carried by the electrons and the number of electrons per fission are also calculated. Comparison of these calculated spectra to experimental ones shows good agreements. (Author) [pt

Evaluation of Total Daily Dose and Glycemic Control for Patients Taking U-500 Insulin Admitted to the Hospital

Science.gov (United States)

2016-04-27

mail:jack.e.lewi.mil@mail.mil Key Words: U-500 regular insulin , inpatient diabetes mellitus, insulin resistance Conflict of Interest Statements...500 regular insulin are severely insulin resistant requiring high doses of insulin . It has been observed that a patient’s insulin requirements may...concentrated than U-100 regular insulin and is generally used in patients with severe insulin resistance requiring greater than 200 units of insulin

Measurement of the fission cross-section of {sup 235}U and {sup 239}Pu for thermal neutrons; Mesures des sections de fission de {sup 235}U et de {sup 239}Pu en neutrons thermiques

Energy Technology Data Exchange (ETDEWEB)

Fraysse, G; Prosdocimi, A; Netter, F; Samour, C [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1965-07-01

Improved techniques of fast detection have been applied for determining the fission cross-sections of {sup 235}U and {sup 239}Pu with reference to the absorption cross-section of Boron. Monochromatic neutron beams of 0.0322 eV, 0.0626 eV and 0.275 eV have been employed. Use has been made of a Xe-filled gaseous scintillator and of a low-geometry solid state ion chamber. Both measured alpha and fission rates. The results at the reference energy of 0.0253 eV are: ({sigma}{sub F}){sub 0} {sup 235}U = 588 {+-} 10 barns ({sigma}{sub F}){sub 0} {sup 239}Pu = 738 {+-} 7 barns. (authors) [French] Des techniques avancees de comptage rapide ont ete mise en oeuvre pour determiner la section efficace de fission de {sup 235}U et de {sup 239}Pu par rapport a celle d'absorption du bore. Des faisceaux de neutrons monochromatiques de 0,0322 eV, 0,0626 eV et 0,275 eV ont ete employes. Les detecteurs utilises sont un scintillateur gazeux rempli de xenon et une chambre d'ionisation a etat solide a basse geometrie. Les deux ont mesure les taux des desintegrations alpha et des fissions. Les resultats a l'energie de reference de 0,0253 eV sont: ({sigma}{sub F}){sub 0} {sup 235}U = 588 {+-} 10 barns ({sigma}{sub F}){sub 0} {sup 239}Pu = 738 {+-} 7 barns. (auteurs)

Comparison of {sup 235}U fission cross sections in JENDL-3.3 and ENDF/B-VI

Energy Technology Data Exchange (ETDEWEB)

Kawano, Toshihiko [Kyushu Univ., Fukuoka (Japan); Carlson, Allan D. [National Institute of Standards and Technology (United States); Matsunobu, Hiroyuki [Data Engineering, Inc., Fujisawa, Kanagawa (Japan); Nakagawa, Tsuneo; Shibata, Keiichi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Talou, Patrick; Young, Philip G.; Chadwick, Mark B. [Los Alamos National Laboratory, Los Alamos, NM (United States)

2002-01-01

Comparisons of evaluated fission cross sections for {sup 235}U in JENDL-3.3 and ENDF/B-VI are carried out. The comparisons are made for both the differential and integral data. The fission cross sections as well as the fission ratios are compared with the experimental data in detail. Spectrum averaged cross sections are calculated and compared with the measurements. The employed spectra are the {sup 235}U prompt fission neutron spectrum, the {sup 252}Cf spontaneous fission neutron spectrum, and the neutron spectrum produced by a {sup 9}Be(d, xn) reaction. For {sup 235}U prompt fission neutron spectrum, the ENDF/B-VI evaluation reproduces experimental averaged cross sections. For {sup 252}Cf and {sup 9}Be(d, xn) neutron spectra, the JENDL-3.3 evaluation gives better results than ENDF/B-VI. (author)

Preparation of 235U target by electrodeposition

International Nuclear Information System (INIS)

Chen Qiping; Zhong Wenbin; Li Yougen

2004-12-01

A target for the production of fission 99 Mo in a nuclear reactor is composed of an enclosed, cylindrical vessel. Preferable vessel is comprised of stainless steel, having a thin, continuous, uniform layer of 235 U integrally bonded to its inner walls. Two processes are introduced for electrodepositing uranium on to the inner walls of the vessel. One processes is electrodepositing UO 2 from UO 2 (NO 3 ) 2 -(NH 4 ) 2 CO 4 ·H 2 O solution; the other is electrodepositing pure uranium metal from molten salt. Its plating efficiency and plating quantity from a molten bath is higher than UO 2 from the aqueous system. (authors)

Consistent Data Assimilation of Actinide Isotopes: 235U and 239Pu

International Nuclear Information System (INIS)

Palmiottti, G.; Hiruta, H.; Salvatores, M.

2011-01-01

In this annual report we illustrate the methodology of the consistent data assimilation that allows to use the information coming from integral experiments for improving the basic nuclear parameters used in cross section evaluation. A series of integral experiments were analyzed using the EMPIRE evaluated files for 235 U, 238 U, and 239 Pu. Inmost cases the results have shown quite large worse results with respect to the corresponding existing evaluations available for ENDF/B-VII. The observed discrepancies between calculated and experimental results were used in conjunction with the computed sensitivity coefficients and covariance matrix for nuclear parameters in a consistent data assimilation. Only the GODIVA and JEZEBEL experimental results were used, in order to exploit information relative to the isotope of interest that are, in this particular case: 235 U and 239 Pu. The results obtained by the consistent data assimilation indicate that with reasonable modifications (mostly within the initial standard deviation) it is possible to eliminate the original large discrepancies on the K eff of the two critical configurations. However, some residual discrepancy remains for a few fission spectral indices that are, most likely, to be attributed to the detector cross sections.

Cross sections and neutron yields for U233, U235 and Pu239 at 2200 m/sec

International Nuclear Information System (INIS)

Sjoestrand, N.G.; Story, J.S.

1960-04-01

The experimental information on the 2200 m/sec values for σ abs , σ f , α, ν and η for 233 U , 235 U and 23 been collected and discussed. The values will later be used in an evaluation of a 'best' set of data. In appendix the isotopic abundances of the uranium isotopes are discussed and also the alpha activities of the uranium isotopes and Pu-239

Ternary Fission of U{sup 235} by Resonance Neutrons; Fission Ternaire de {sup 235}U par des Neutrons de Resonance; 0422 0420 041e 0419 041d 041e 0415 0414 0415 041b 0415 041d 0418 0415 0423 0420 0410 041d 0410 -235 041d 0410 0420 0415 0417 041e 041d 0410 041d 0421 041d 042b 0425 041d 0415 0419 0422 0420 041e 041d 0410 0425 ; Fision Ternaria del {sup 235}U por Neutrones de Resonancia

Energy Technology Data Exchange (ETDEWEB)

Kvitek, I.; Popov, Ju. P.; Rjabov, Ju. V. [Ob' edinennyj Institut Jadernyh Issledovanij, Dubna, SSSR (Russian Federation)

1965-07-15

Recently a number of papers have appeared indicating considerable variations in the ratio of the ternary-fission cross-section to the binary-fission cross-section of U{sup 235} on transition from one neutron resonance to another. However, such variations have not been discovered in U{sup 233} and Pu{sup 239}. The paper reports investigations of the ternary fission of U{sup 235} by neutrons with an energy of 0.1 to 30 eV. Unlike other investigators of the ternary fission of U{sup 235} , we identified the ternary-fission event by the coincidence of one of the fission fragments with a light long-range particle. This made it passible to separate ternary fissions from the possible contribution of the (n, {alpha})reaction. The measurements were performed at the fast pulsed reactor of the Joint Institute for Nuclear Research by the time-of-flight method. A flight length of 100 m was used, giving a resolution of 0.6 {mu}s/m. Gas scintillation counters filled with xenon at a pressure of 2 atm were used to record the fission fragments and the light long-range particle. A layer of enriched U{sup 235} {approx}2 mg/cm{sup 2} thick and {approx}300 cm{sup 2} in area was applied to an aluminium foil 20-fim thick. The scintillations from the fission fragments were recorded in the gas volume on one side of the foil and those from the light long-range particles in that on the other. In order to assess the background (e.g . coincidences of the pulse from a fragment with that from a fission gamma quantum or a proton from the (n, p) reaction in the aluminium foil), a measurement was carried out in which the volume recording the long-range particle was shielded with a supplementary aluminium filter 1-mm thick. The results obtained indicate the absence of the considerable variations in the ratio between the ternary-and binary- fission cross-sections for U{sup 235} that have been noted by other authors. Measurements showed no irregularity in the ratio of the cross-sections in the energy

New ETR 450/ETR 500 electric railcars for the FS

Energy Technology Data Exchange (ETDEWEB)

Messerschmidt, W

1986-04-01

Also in Italy research and development projects are of eminent importance in present transport policies. The Italian State Railways (FS) and the industry are intensifying their development programmes especially in respect of high- speed travel, but the planners emphasize that priority must be given not only to propulsion technology but now more than ever to overall styling and design. Whereas the eleven-unit electric railcar ETR 450 now being built clearly shows its common ancestry with the smaller four-unit prototype ETR 401 (with coach-body tilt control), the ETR 500 super-train now taking shape in the design offices of the FS and the industry will have radically new aesthetics that show the influence of the automobile designer. At the FS the view is that there is a need to 'sell' not only technology but also the design creativity that can bring big returns in terms of public favour.

Prolonged 500 C Operation of 100+ Transistor Silicon Carbide Integrated Circuits

Science.gov (United States)

Spry, David J.; Neudeck, Philip G.; Lukco, Dorothy; Chen, Liangyu; Krasowski, Michael J.; Prokop, Norman F.; Chang, Carl W.; Beheim, Glenn M.

2017-01-01

This report describes more than 5000 hours of successful 500 C operation of semiconductor integrated circuits (ICs) with more than 100 transistors. Multiple packaged chips with two different 4H-SiC junction field effect transistor (JFET) technology demonstrator circuits have surpassed thousands of hours of oven-testing at 500 C. After 100 hours of 500 C burn-in, the circuits (except for 2 failures) exhibit less than 10 change in output characteristics for the remainder of 500C testing. We also describe the observation of important differences in IC materials durability when subjected to the first nine constituents of Venus-surface atmosphere at 9.4 MPa and 460C in comparison to what is observed for Earth-atmosphere oven testing at 500 C.

Thermal-Neutron-Induced Fission of U235, U233 and Pu239

International Nuclear Information System (INIS)

Thomas, T.D.; Gibson, W.M.; Safford, G.J.

1965-01-01

We have used solid-state detectors to measure the kinetic energies of the coincident fission fragments in the thermal-neutron-induced fission of U 235 , U 233 and Pu 239 . Special care has been taken to eliminate spurious-events near symmetry to give an accurate measure of such quantities as the average total kinetic energy at symmetry. For each fissioning system over 10 6 events were recorded. As a result the statistics are good enough to see definite evidence for fine structure over a wide range of masses and energies. The data have been analysed to give mass yield curves, average kinetic energies as a function of mass, and other quantities of interest. For each fissioning system the average total kinetic energy goes through a maximum for a heavy fragment mass of about 132 and for the corresponding light fragment mass. There is a pronounced minimum at symmetry, although not as deep as that found in time-of-flight experiments. The difference between the maximum average kinetic energy and that at symmetry is about 32 MeV for U 235 , 18 MeV for U 233 and 20 MeV for Pu 239 . The dispersion of kinetic energies at symmetry is also smaller than that found in time-of-flight experiments. Fine structure is apparent in two different representations of the data. The energy spectrum of heavy fragments in coincidence with light fragment energies is greater than the most probable value. This structure becomes more pronounced as the light fragment energy increases. The mass yield curves for a given total kinetic energy show a structure suggesting a preference for fission fragments with masses ∼134, ∼140 and ∼145 (and their light fragment partners). Much of the structure observed can be understood by considering a semi-empirical mass surface and a simple model for the nuclear configuration at the saddle point. (author) [fr

Evaluation of Uranium-235 Measurement Techniques

Energy Technology Data Exchange (ETDEWEB)

Kaspar, Tiffany C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lavender, Curt A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Dibert, Mark W. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2017-05-23

Monolithic U-Mo fuel plates are rolled to final fuel element form from the original cast ingot, and thus any inhomogeneities in ²³⁵U distribution present in the cast ingot are maintained, and potentially exaggerated, in the final fuel foil. The tolerance for inhomogeneities in the ²³⁵U concentration in the final fuel element foil is very low. A near-real-time, nondestructive technique to evaluate the ²³⁵U distribution in the cast ingot is required in order to provide feedback to the casting process. Based on the technical analysis herein, gamma spectroscopy has been recommended to provide a near-real-time measure of the ²³⁵U distribution in U-Mo cast plates.

Neutron methods for measuring 235U content in UF6 gas

International Nuclear Information System (INIS)

Stromswold, D.C.; Peurrung, A.J.; Reeder, P.L.; Pappas, R.A.; Sunberg, D.S.

1996-10-01

In the United States and Russia, UF 6 gas streams of highly enriched uranium and lower enrichment uranium am being blended to reduce the stockpile of the highly enriched material. The resultant uranium is no longer useful for weapons, but is suitable as fuel for nuclear reactors. A method to verify the blending of high- and low-enrichment uranium was developed at Pacific Northwest National Laboratory (PNNL) for the U.S. Department of Energy, Office of Research and Development (NN-20). In the United States, blending occurs at the U.S. Department of Energy's Portsmouth Gaseous Diffusion Plant located near Portsmouth, Ohio. In Russia, the blending takes place at Novouralsk. The United States is purchasing the blended product produced in Russia in a program to reduce the availability of enriched uranium that can be used for weapons production. Monitoring the 235 U mass flux of the input stream having the highly enriched uranium will provide confidence that high-enrichment uranium is being consumed in the blending process, and monitoring the output stream will provide an on-line measure of the 235 U in the mixed product. The Portsmouth plant is a potential test facility for non-destructive technology to monitor blending. In addition, monitoring the blending at Portsmouth can support International Atomic Energy Agency activities on controlling and reducing enriched uranium stockpiles

14.2 MeV neutron induced U-235 fission cross section measurement

International Nuclear Information System (INIS)

Li Jingwen; Shen Guanren; Ye Zongyuan; Li Anli; Zhou Shuhua; Sun Zhongfan; Wu Jingxia; Huang Tanzi

1986-01-01

The cross section of U-235 fission induced by 14.2 MeV neutrons was measured by the time correlated associated particle method. The result obtained is (2.078+-0.040) barn. Comparison with other author's is also given. (author)

The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

International Nuclear Information System (INIS)

Meadows, J.W.

1986-12-01

The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

Nuclear data and measurements series: Ratio of the prompt-fission-neutron spectrum of plutonium 239 to that of uranium 235

International Nuclear Information System (INIS)

Sugimoto, M.; Smith, A.B.; Guenther, P.T.

1986-09-01

The prompt-fission-neutron spectrum resulting from 239 Pu fission induced by 0.55 MeV incident neutrons is measured from 1.0 to 10.0 MeV relative to that of 235 U fission induced by the same incident-energy neutrons. The measurements employ the time-of-flight technique. Energy-dependent ratios of the two spectra are deduced from the measured values over the energy range 1.0 to 10.0 MeV. The experimentally-derived ratio results are compared with those calculated from ENDF/B-V, revision-2, and with results of recent microscopic measurements. Using the ENDF/B-V 235 U Watt parameters for the 235 U spectrum, the experimental measurements imply a ratio of average fission-spectrum energies of 239 Pu/ 235 U = 1.045 +- 0.003, compared to the value 1.046 calculated from ENDF/B-V, revision 2. 12 refs., 2 figs., 2 tabs

On uncertainties and fluctuations of averaged neutron cross sections in unresolved resonance energy region for 235U, 238U, 239Pu

International Nuclear Information System (INIS)

Van'kov, A.A.; Blokhin, A.I.; Manokhin, V.N.; Kravchenko, I.V.

1985-01-01

This paper analyses the reasons for the differences which exist between group-averaged evaluated cross-section data from different evaluated data files for U235, U238 and Pu239 in the unresolved resonance energy region. (author)

Neutron widths for 236U from high resolution transmission measurements at a 100M flightpath

International Nuclear Information System (INIS)

Carraro, G.; Brusegan, A.

1975-01-01

A series of neutron transmission measurements has been performed on 236 U aiming at a determination of the resonance parameters and their statistical properties. The analysis range covered neutron energies from 40eV to 4.1 keV. The experiments were carried out at about 100 m flightpath of the 80 MeV electron linear accelerator of CBNM using a 10 B slab-NaI detector and 2 236 U-oxyde samples on loan from the USAEC. A table displays the details of 6 experimental runs, 3 of which were arranged in such a way that the effect of the 235 U and 238 U impurities in the sample on the transmission was automatically compensated

Fission Product Yields for 14 MeV Neutrons on 235U, 238U and 239Pu

International Nuclear Information System (INIS)

Mac Innes, M.; Chadwick, M.B.; Kawano, T.

2011-01-01

We report cumulative fission product yields (FPY) measured at Los Alamos for 14 MeV neutrons on 235 U, 238 U and 239 Pu. The results are from historical measurements made in the 1950s–1970s, not previously available in the peer reviewed literature, although an early version of the data was reported in the Ford and Norris review. The results are compared with other measurements and with the ENDF/B-VI England and Rider evaluation. Compared to the Laurec (CEA) data and to ENDF/B-VI evaluation, good agreement is seen for 235 U and 238 U, but our FPYs are generally higher for 239 Pu. The reason for the higher plutonium FPYs compared to earlier Los Alamos assessments reported by Ford and Norris is that we update the measured values to use modern nuclear data, and in particular the 14 MeV 239 Pu fission cross section is now known to be 15–20% lower than the value assumed in the 1950s, and therefore our assessed number of fissions in the plutonium sample is correspondingly lower. Our results are in excellent agreement with absolute FPY measurements by Nethaway (1971), although Nethaway later renormalized his data down by 9% having hypothesized that he had a normalization error. The new ENDF/B-VII.1 14 MeV FPY evaluation is in good agreement with our data.

²³⁵U Determination using In-Beam Delayed Neutron Counting Technique at the NRU Reactor

Energy Technology Data Exchange (ETDEWEB)

Andrews, M. T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Bentoumi, G. [Canadian Nuclear Labs., Chalk River, ON (Canada); Corcoran, E. C. [Royal Military College of Canada, Kingston, ON (United States); Dimayuga, I. [Canadian Nuclear Labs., Chalk River, ON (Canada); Kelly, D. G. [Royal Military College of Canada, Kingston, ON (United States); Li, L. [Canadian Nuclear Labs., Chalk River, ON (Canada); Sur, B. [Canadian Nuclear Labs., Chalk River, ON (Canada); Rogge, R. B. [Canadian Nuclear Labs., Chalk River, ON (Canada)

2015-11-17

This paper describes a collaborative effort that saw the Royal Military College of Canada (RMC)’s delayed neutron and gamma counting apparatus transported to Canadian Nuclear Laboratories (CNL) for use in the neutron beamline at the National Research Universal (NRU) reactor. Samples containing mg quantities of fissile material were re-interrogated, and their delayed neutron emissions measured. This collaboration offers significant advantages to previous delayed neutron research at both CNL and RMC. This paper details the determination of ²³⁵U content in enriched uranium via the assay of in-beam delayed neutron magnitudes and temporal behavior. ²³⁵U mass was determined with an average absolute error of ± 2.7 %. This error is lower than that obtained at RMCC for the assay of ²³⁵U content in aqueous solutions (3.6 %) using delayed neutron counting. Delayed neutron counting has been demonstrated to be a rapid, accurate, and precise method for special nuclear material detection and identification.

Reimiep 87. An interlaboratory U-235 enrichment determination by gamma measurement on solid UF6 sample

International Nuclear Information System (INIS)

Aparo, M.; Cresti, P.

1988-01-01

Gamma spectroscopy technique, based on the measurement of U 235 186 KeV flux, is now currently used for the determination of Uranium enrichment in different material of nuclear fuel cycle, namely: Uranium metallic, UO 2 pellets, UF 6 liquid or solid. The present paper describes the use of such a technique and the obtained results in determining the U 235 /U atomic isotopic abundance on a certified UF 6 solid sample. The measurements have been carried out in the frame work of the partecipation to the ''UF 6 Interlaboratory Measurements Evaluation Programme'' organized by CBNM/Geel with the support of the ESARDA (European Safeguards Research and Development Association)

Fuel cycle cost comparison of choices in U-235 recycle in the HTGR

International Nuclear Information System (INIS)

Rothstein, M.P.

1976-07-01

An analysis of alternative options for the recycle of discharged makeup U-235 (''residual'' makeup) in HTGRs shows that the three-particle system which has been the reference plan remains optimal. This result considers both the resource utilization and the handling costs attendant to the alternative strategies (primarily in the recycle facility and in waste disposal). Furthermore, this result appears to be true under all forseeable economic conditions. A simple risk assessment indicates that recycle cost (including reprocessing, refabrication, and related waste disposal) would have to double or triple in order for the alternative U-235 recycle schemes to become attractive. This induces some degree of confidence in the choice of staying with the reference cycle in spite of the large degree of uncertainty over recycle and its costs

Measurement of mass distribution of U-235 fission products in the intermediate neutron region

International Nuclear Information System (INIS)

Nakagomi, Yoshihiro; Kobayashi, Shohei; Yamamoto, Shuji; Kanno, Ikuo; Wakabayashi, Hiroaki.

1982-01-01

The mass distribution and the momentum distribution of U-235 fission products in the intermediate neutron region were measured by using a combination system of the Yayoi intermediate neutron column and an electron linear accelerator. The double energy measurement method was applied. A fission chamber, which consists of an enriched uranium target and two Si surface barrier detectors, was used for the measurement of the neutrons with energy above 1.3 eV. The linear accelerator was operated at the repetition rate of 100 Hz and the pulse width of 10 ns. The data obtained by the two-dimensional pulse height analysis were analyzed by the Schmitt's method. The preliminary results of the mass distribution and the momentum distribution of fission fragments were obtained. (Kato, T.)

Neutron Energy Spectra from Neutron Induced Fission of 235U at 0.95 MeV and of 238U at 1.35 and 2.02 MeV

Energy Technology Data Exchange (ETDEWEB)

Almen, E; Holmqvist, B; Wiedling, T

1971-09-15

The shapes of fission neutron spectra are of interest for power reactor calculations. Recently it has been suggested that the neutron induced fission spectrum of 235U may be harder than was earlier assumed. For this reason measurements of the neutron spectra of some fissile isotopes are in progress at our laboratory. This report will present results from studies of the energy spectra of the neutrons emitted in the neutron induced fission of 235U and 238U. The measurements were performed at an incident neutron energy of 0.95 MeV for 235U and at energies of 1.35 and 2.02 MeV for 238U using time-of-flight techniques. The time-of-flight spectra were only analysed at energies higher than those of the incident neutrons and up to about 10 MeV. Corrections for neutron attenuation in the uranium samples were calculated using a Monte Carlo program. The corrected fission neutron spectra were fitted to Maxwellian temperature distributions. For 235U a temperature of 1.27 +- 0.01 MeV gives the best fit to the experimental data and for 238U the corresponding values are 1.29 +- 0.03 MeV at 1.35 MeV and 1.29 +- 0.02 MeV at 2.02 MeV

Cross sections and neutron yields for U-233, U-235 and Pu-239 at 2200 m/sec

Energy Technology Data Exchange (ETDEWEB)

Sjoestrand, N G; Story, J S

1960-04-15

The experimental information on the 2200 m/sec values for {sigma}{sub abs}, {sigma}{sub f}, {alpha}, {nu} and {eta} for {sup 233}U , {sup 235}U and {sup 23} been collected and discussed. The values will later be used in an evaluation of a 'best' set of data. In appendix the isotopic abundances of the uranium isotopes are discussed and also the alpha activities of the uranium isotopes and Pu-239.

Development a recovery method of 13I from the 23'5U fission products

International Nuclear Information System (INIS)

Bignardi, Aline M.T.; Osso Junior, Joao Alberto

2013-01-01

13I is a iodine radioisotope widely used in nuclear medicine that can be used either for diagnostic or for treatment due to its physical decay by β- and its high emission of rays-γ. It is produced at IPEN through the irradiation of TeO 2 targets in the IEA-R1 nuclear reactor. There is also the possibility produced it by the fission of 235 U. The aim of this work is to develop a recovery method of 13I in the production process of 99 Mo through the route of acid dissolution of 235 U targets, with the quality to be used in Nuclear Medicine. 13I finds itself in two stages of the process, either in the gaseous produced in the acid dissolution of metallic U targets and the smallest part in solution. In this work was studied the recovery of 131 in these two stages. Several materials were used for the capture and recovery of 13I at the two phases of the process. Anionic cartridges, Ag cartridges, anion exchange resin, activated charcoal columns and AgI precipitation were tested. Solutions with 13 '1I in 0.1 mol.L -1 NaOH were percolated through the materials and the eluted solutions were analyzed in a dose calibrator. Among all the tests that were executed, at first, the anion exchange resin and AgI precipitation have showed the best retention result (100%). The results of elution have varied according to the material, the activated charcoal presented a elution yield between 70% and 82% At first, it is possible to conclude that anion exchange resin and AgI precipitation show better results for 13I retention and the column and activated charcoal have a great potential for the elution of 131 in the right chemical state. (author)

Benchmark experiments at ASTRA facility on definition of space distribution of 235U fission reaction rate

International Nuclear Information System (INIS)

Bobrov, A. A.; Boyarinov, V. F.; Glushkov, A. E.; Glushkov, E. S.; Kompaniets, G. V.; Moroz, N. P.; Nevinitsa, V. A.; Nosov, V. I.; Smirnov, O. N.; Fomichenko, P. A.; Zimin, A. A.

2012-01-01

Results of critical experiments performed at five ASTRA facility configurations modeling the high-temperature helium-cooled graphite-moderated reactors are presented. Results of experiments on definition of space distribution of 235 U fission reaction rate performed at four from these five configurations are presented more detail. Analysis of available information showed that all experiments on criticality at these five configurations are acceptable for use them as critical benchmark experiments. All experiments on definition of space distribution of 235 U fission reaction rate are acceptable for use them as physical benchmark experiments. (authors)

Uranium contents and {sup 235}U/{sup 238}U atom ratios in soil and earthworms in western Kosovo after the 1999 war

Energy Technology Data Exchange (ETDEWEB)

Di Lella, L.A.; Nannoni, F.; Protano, G.; Riccobono, F. [Dipartimento di Scienze Ambientali ' G. Sarfatti' -Sezione di Geochimica Ambientale, University of Siena, Via del Laterino 8, I-53100, Siena (Italy)

2005-01-20

The uranium content and {sup 235}U/{sup 238}U atom ratio were determined in soils and earthworms of an area of Kosovo (Djakovica garrison), heavily shelled with depleted uranium (DU) ammunition during the 1999 war. The aim of the study was to reconstruct the small-scale distribution of uranium and assess the influence of the DU added to the surface environment. The total uranium concentration and the {sup 235}U/{sup 238}U ratio of topsoils showed great variability and were inversely correlated. The highest uranium levels (up to 31.47 mg kg{sup -1}) and lowest {sup 235}U/{sup 238}U ratios (minimum 0.002147) were measured in topsoils collected inside, or very close to, the clusters of DU penetrator holes. Regarding the fractionation of uranium in the surface soils, the uranium concentrations in the soluble and exchangeable fractions increased as the total uranium concentration of the topsoils increased. High and rather uniform percentage contents of uranium (24-36%) were associated with the poorly crystalline iron oxide phases of soils. In the U-enriched soils the elevated levels of the element were probably due to the presence of very small, unevenly distributed oxidized DU particles. The total uranium concentration in earthworms was in the range 0.142-0.656 mg kg{sup -1}, with the highest concentrations in Lumbricus terrestris. The juveniles of all three studied species seemed to accumulate uranium more than adults, probably due to age-related differences in metabolism. The {sup 235}U/{sup 238}U ratio in the earthworms was variable (0.005241-0.007266) and independent of both the total uranium contents in soils and the absolute uranium levels in the animals. Bioconcentration was greater at lower U concentrations in soil, probably due to an increasing rate of elimination of uranium by the earthworms as the soil contents of the element increase. The results of this study clearly indicate that DU was added to the soil of the study area. Nevertheless, the phenomenon was

Evaluation of fission cross sections and covariances for 233U, 235U, 238U, 239Pu, 240Pu, and 241Pu

International Nuclear Information System (INIS)

Kawano, Toshihiko; Matsunobu, Hiroyuki; Murata, Toru

2000-02-01

A simultaneous evaluation code SOK (Simultaneous evaluation on KALMAN) has been developed, which is a least-squares fitting program to absolute and relative measurements. The SOK code was employed to evaluate the fission cross sections of 233 U, 235 U, 238 U, 239 Pu, 240 Pu, and 241 Pu for the evaluated nuclear data library JENDL-3.3. Procedures of the simultaneous evaluation and the experimental database of the fission cross sections are described. The fission cross sections obtained were compared with evaluated values given in JENDL-3.2 and ENDF/B-VI. (author)

Investigating Uranium Mobility Using Stable Isotope Partitioning of 238U/235U and a Reactive Transport Model

Science.gov (United States)

Bizjack, M.; Johnson, T. M.; Druhan, J. L.; Shiel, A. E.

2015-12-01

We report a numerical reactive transport model which explicitly incorporates the effectively stable isotopes of uranium (U) and the factors that influence their partitioning in bioactive systems. The model reproduces trends observed in U isotope ratios and concentration measurements from a field experiment, thereby improving interpretations of U isotope ratios as a tracer for U reactive transport. A major factor contributing to U storage and transport is its redox state, which is commonly influenced by the availability of organic carbon to support metal-reducing microbial communities. Both laboratory and field experiments have demonstrated that biogenic reduction of U(VI) fractionates the stable isotope ratio 238U/235U, producing an isotopically heavy solid U(IV) product. It has also been shown that other common reactive transport processes involving U do not fractionate isotopes to a consistently measurable level, which suggests the capacity to quantify the extent of bioreduction occurring in groundwater containing U using 238U/235U ratios. A recent study of a U bioremediation experiment at the Rifle IFRC site (Colorado, USA) applied Rayleigh distillation models to quantify U stable isotope fractionation observed during acetate amendment. The application of these simplified models were fit to the observations only by invoking a "memory-effect," or a constant source of low-concentration, unfractionated U(VI). In order to more accurately interpret the measured U isotope ratios, we present a multi-component reactive transport model using the CrunchTope software. This approach is capable of quantifying the cycling and partitioning of individual U isotopes through a realistic network of transport and reaction pathways including reduction, oxidation, and microbial growth. The model incorporates physical heterogeneity of the aquifer sediments through zones of decreased permeability, which replicate the observed bromide tracer, major ion chemistry, U concentration, and U

Measurement of the ^235mU Production Cross Section Using a Critical Assembly*

Science.gov (United States)

Macri, Robert; Authier, Nicolas; Becker, John; Belier, Gilbert; Bond, Evelyn; Bredeweg, Todd; Glover, S.; Meot, Vincent; Rundberg, Robert; Vieira, David; Wilhelmy, Jerry

2006-10-01

Measurements of the creation and destruction cross sections for actinide nuclei constitute an important experimental effort in support of Stockpile Stewardship. In this talk I will give a progress report on the effort to measure the production cross section of the ^235mU isomer integrated over a fission neutron spectrum. This ongoing experiment is fielded at CEA in Valduc, France, taking advantage of the CALIBAN critical assembly. This effort is performed in collaboration with LANL, LLNL, Bruyeres le Chatel, and Valduc staff. This experiment utilizes a technique to measure internal conversion electrons from the ^235mU isomer with the French BIII detector (Bruyeres le Chatel), and involves a substantial chemistry effort (LANL) to prepare targets for irradiation and counting, as well as to remove fission fragments after irradiation. Experimental techniques will be discussed and preliminary data presented. *Work performed under the auspices of the U.S. Department of Energy by Los Alamos National Laboratory (W-7405-ENG-36) and Lawrence Livermore National Laboratory (W-7405-ENG-48), and CEA-DAM under CEA-DAM NNSA-DOE agreement.

Bimodality in binary Au + Au collisions from 60 to 100 MeV/u

International Nuclear Information System (INIS)

Pichon, M.; Tamain, B.; Bougault, R.

2003-03-01

The deexcitation of quasi-projectiles (QP) released in binary Au on Au collisions as been studied from 60 to 100 MeV/u. Bimodality between two different decay patterns has been observed for intermediate violence collisions. The main experimental result is that the system jumps from one mode to the other on a narrow range of energy deposit and/or impact parameter. The sorting of the events (according to the violence of the collision) has been provided by the perpendicular energy of the light charged particles emitted on the quasi-target side. Such a sorting prevents spurious autocorrelation effects between the sorting variable and the observed mechanism. The two modes of the QP decay correspond on the one side to residue or fission fragments production, and on the other side to the multifragmentation channel. A detailed study has been performed in order to try to establish the origin of the observed bimodality in disentangling dynamical or geometrical effects from bulk matter properties linked with a liquid-gas type phase transition. The whole set of data is coherent with a dominant role of the deposited excitation energy as it is expected from theoretical arguments.(lattice gas model) in the framework of a liquid-gas phase transition picture. (authors)

Quantities of uranium-235 buried in disposal boxes, 1985--1991

International Nuclear Information System (INIS)

Cook, J.R.

1991-01-01

IWT was asked by J. R. Schornhorst of NPSR to determine the distribution of the quantity of enriched uranium per disposal box (B-25) of the years 1985--1991 to provide input to an uptake of the E Area Safety Analysis. This information was considered important since the issue of criticality is an important concern in safety analyses. Information found in the COBRA data base shows no disposal containers exceeded 100 grams of U-235. The COBRA data base was queried in a two-step process. First a short program in the NATURAL language was used to retrieve all records beginning with January 1983 having a Burial Code of less than 4, indicating low-level waste disposed in trenches. These records were then passed to a temporary storage file and read into a program written in Statistical Analysis System (SAS) language. SAS was used to eliminate waste from the Naval Fuel Facility, which will not operate in the future, and to sort the records in order of increasing amounts of U-235. The SAS procedure FREQ was then used to produce a cumulative frequency distribution of grams of U-235. A total of 53,198 packages were disposed of during this time period, 277 of which contained U-235. The programs used and resulting output are attached as Appendix I

Multipole components of 235U photofission

International Nuclear Information System (INIS)

Carvalheiro, Z.

1985-01-01

The absolute electrofission cross section for 235 U has been experimentally obtained in the energy range 5.8 - 18.0 MeV, using the electron beam of the Linear Accelerator of Institute of Physics of the University of Sao Paulo. From a combined analysis of this cross section and a previously measured photofission cross section, using virtual photon spectra calculated in the Distorted Wave Born Approximation (DWBA), the '' non electric dipole photofission'' cross section σ NDE γ,f (ω) has been obtained, which contains all multipolarities allowed by the reaction Kinematics, except El. This cross section presents a resonant shape, probably associated with the Giant Quadrupole Resonance (GQR). Once the fission channel exhausts a great amount of the Energy Weighted Sum Rule (EWSR), it is therefore the major decay mode of the GQR. All these aspects agree with the ones verified for the other Uranium isotopes previously analysed in this Laboratory. (author) [pt

A new method to measure the U-235 content in fresh LWR fuel assemblies via fast-neutron passive self-interrogation

Science.gov (United States)

Menlove, Howard; Belian, Anthony; Geist, William; Rael, Carlos

2018-01-01

The purpose of this paper is to provide a solution to a decades old safeguards problem in the verification of the fissile concentration in fresh light water reactor (LWR) fuel assemblies. The problem is that the burnable poison (e.g. Gd2O3) addition to the fuel rods decreases the active neutron assay for the fuel assemblies. This paper presents a new innovative method for the verification of the 235U linear mass density in fresh LEU fuel assemblies that is insensitive to the burnable poison content. The technique makes use of the 238U atoms in the fuel rods to self-interrogate the 235U mass. The innovation for the new approach is that the 238U spontaneous fission (SF) neutrons from the rods induces fission reactions (IF) in the 235U that are time correlated with the SF source neutrons. Thus, the coincidence gate counting rate benefits from both the nu-bar of the 238U SF (2.07) and the 235U IF (2.44) for a fraction of the IF reactions. Whereas, the 238U SF background has no time-correlation boost. The higher the detection efficiency, the higher the correlated boost because background neutron counts from the SF are being converted to signal doubles. This time-correlation in the IF signal increases signal/background ratio that provides a good precision for the net signal from the 235U mass. The hard neutron energy spectrum makes the technique insensitive to the burnable poison loading where a Cd or Gd liner on the detector walls is used to prevent thermal-neutron reflection back into the fuel assembly from the detector. We have named the system the fast-neutron passive collar (FNPC).

Coulomb effects in isobaric cold fission from reactions 233U(nth,f), 235U(nth,f),239Pu(nth,f) and 252Cf(sf)

International Nuclear Information System (INIS)

Montoya, Modesto

2013-01-01

The Coulomb effect hypothesis, formerly used to interpret fluctuations in the curve of maximal total kinetic energy as a function of light fragment mass in reactions 233 U(n th ,f), 235 U(n th ,f) and 239 Pu(n th ,f), is confirmed in high kinetic energy as well as in low excitation energy windows, respectively. Data from reactions 233 U(n th ,f), 235 U(n th ,f), 239 Pu(n th ,f) and 252 Cf(sf) show that, between two isobaric fragmentations with similar Q-values, the more asymmetric charge split reaches the higher value of total kinetic energy. Moreover, in isobaric charge splits with different Q-values, similar preference for asymmetrical fragmentations is observed in low excitation energy windows. (author).

Reactive transport of uranium in a groundwater bioreduction study: Insights from high-temporal resolution 238U/235U data

Science.gov (United States)

Shiel, A. E.; Johnson, T. M.; Lundstrom, C. C.; Laubach, P. G.; Long, P. E.; Williams, K. H.

2016-08-01

We conducted a detailed investigation of U isotopes in conjunction with a broad geochemical investigation during field-scale biostimulation and desorption experiments. This investigation was carried out in the uranium-contaminated alluvial aquifer of the Rifle field research site. In this well-characterized setting, a more comprehensive understanding of U isotope geochemistry is possible. Our results indicate that U isotope fractionation is consistently observed across multiple experiments at the Rifle site. Microbially-mediated reduction is suggested to account for most or all of the observed fractionation as abiotic reduction has been demonstrated to impart much smaller, often near-zero, isotopic fractionation or isotopic fractionation in the opposite direction. Data from some time intervals are consistent with a simple model for transport and U(VI) reduction, where the fractionation factor (ε = +0.65‰ to +0.85‰) is consistent with experimental studies. However, during other time intervals the observed patterns in our data indicate the importance of other processes in governing U concentrations and 238U/235U ratios. For instance, we demonstrate that departures from Rayleigh behavior in groundwater systems arise from the presence of adsorbed species. We also show that isotope data are sensitive to the onset of oxidation after biostimulation ends, even in the case where reduction continues to remove contaminant uranium downstream. Our study and the described conceptual model support the use of 238U/235U ratios as a tool for evaluating the efficacy of biostimulation and potentially other remedial strategies employed at Rifle and other uranium-contaminated sites.

Calculation of 235U(n,n') cross sections for ENDF/B-VI

International Nuclear Information System (INIS)

Young, P.G.; Arthur, E.D.

1988-01-01

Cross sections for neutron-induced reactions on 235 U between 0.01 and 20 MeV have been calculated in a preliminary analysis for the ENDF/B-VI evaluation with particular emphasis on neutron inelastic scattering. A deformed optical model potential that fits total, elastic, inelastic, and low-energy average resonance data is used to calculate direct (n,n') cross sections and transmission coefficients for a Hauser-Feshbach statistical theory analysis using a multiple fission barrier representation. Direct cross sections for higher-lying vibrational states are provided from DWBA calculations, normalized using B(E/ital l/) values determined from (d,d') and Coulomb excitation data. Initial fission barrier parameters and transition state density enhancements appropriate to the compound systems involved were obtained from previous analyses, especially fits to charged-particle fission probability data. Further modifications to fit 235 U(n,f) data were small, and the final fission parameters are generally consistent with published values. The results from this preliminary analysis are compared with the ENDF/B-V evaluation as well as with experimental data. 26 refs., 5 figs., 3 tabs

Fission cross section measurements at the LLL 100-MeV linac

International Nuclear Information System (INIS)

Browne, J.C.

1975-01-01

The fission cross section for 235 U was measured from thermal energy to 20 MeV in several steps. First, the cross section was measured from 8 MeV to 20 MeV relative to the n,p scattering cross section and then from thermal to one MeV relative to 6 Li(n,α). In addition, a measurement of the ratio of the fission cross sections of 235 U and 238 U relative to 235 U has been completed in the range 1 keV to 30 MeV for 233 U and 100 keV to 30 MeV for 238 U. Statistical uncertainties are less than 4 percent. (U.S.)

Recommended reactor coolant water chemistry requirements for WWER-1000 units with 235U higher enriched fuel

International Nuclear Information System (INIS)

Dobrevski, I.; Zaharieva, N.

2011-01-01

The last decade worldwide experience of PWRs and WWERs confirms the trends for the improvement of the nuclear power industry electricity production through the implementation of high burn-up or high fuel duty, which are usually accompanied with the usage of UO 2 fuel with higher content of 235 U - 4.0% - 4.5% (5.0%). It was concluded that the onset of sub-cooled nucleate boiling (SNB) on the fuel cladding surfaces and the initial excess reactivity of the core are the primary and basic factors accompanying the implementation of uranium fuel with higher 235 U content, aiming extended fuel cycles and higher burn-up of the fuel in Pressurized Water Reactors. As main consequences of the presence of these factors the modifications of chemical / electrochemical environments of nuclear fuel cladding- and reactor coolant system- surfaces are evaluated. These conclusions are the reason for: 1) The determination of the choices of the type of fuel cladding materials in respect with their enough corrosion resistance to the specific fuel cladding environment, created by the presence of SNB; 2) The development and implementation of primary circuit water chemistry guidelines ensuring the necessary low corrosion rates of primary circuit materials and limitation of cladding deposition and out-of-core radioactivity buildup; 3) Implementation of additional neutron absorbers which allow enough decrease of the initial concentration of H 3 BO 3 in coolant, so that its neutralization will be possible with the permitted alkalising agent concentrations. In this paper the specific features of WWER-1000 units in Bulgarian Nuclear Power Plant; use of 235 U higher enriched fuel in the WWER-1000 reactors in the Kozloduy NPP; coolant water chemistry and radiochemistry plant data during the power operation period of the Kozloduy NPP Unit 5, 15 th fuel cycle; evaluation of the approaches and results by the conversion of the WWER-1000 Units at the Kozloduy NPP to the uranium fuel with 4.3% 235 U as

Isotopic analysis of uranium hexafluoride highly enriched in U-235; Analyse isotopique de l'hexafluorure d'uranium fortement enrichi en U 235

Energy Technology Data Exchange (ETDEWEB)

Chaussy, L; Boyer, R [Commissariat a l' Energie Atomique, Pierrelatte (France). Centre d' Etudes Nucleaires

1968-07-01

Isotopic analysis of uranium in the form of the hexafluoride by mass-spectrometry gives gross results which are not very accurate. Using a linear interpolation method applied to two standards it is possible to correct for this inaccuracy as long as the isotopic concentrations are less than about 10 per cent in U-235. Above this level, the interpolations formula overestimates the results, especially if the enrichment of the analyzed samples is higher than 1.3 with respect to the standards. A formula is proposed for correcting the interpolation equation and for the extending its field of application to high values of the enrichment ({approx_equal}2) and of the concentration. It is shown that by using this correction the results obtained have an accuracy which depends practically only on that of the standards, taking into account the dispersion in the measurements. (authors) [French] L'analyse isotopique de l'uranium sous forme d'hexafluorure, par spectrometrie de masse, fournit des resultats bruts entaches d'inexactitude. Une methode d'interpolation lineaire entre deux etalons permet de corriger cette inexactitude, tant que les concentrations isotopiques sont inferieures a 10 pour cent en U-235 environ. Au-dessus de cette valeur, la formule d'interpolation surestime les resultats, notamment si l'enrichissement des echantillons analyses par rapport aux etalons est superieur a 1,3. On propose une formule de correction de l'equation d'interpolation qui etend son domaine d'application jusqu'a des valeurs elevees d'enrichissement ({approx_equal}2) et de concentration. On montre experimentalement que par cette correction, les resultats atteignent, a la precision des mesures, une exactitude qui ne depend pratiquement plus que de celles des etalons. (auteurs)

Trace element distribution and 235U/238U ratios in Euphrates waters and in soils and tree barks of Dhi Qar province (southern Iraq)

International Nuclear Information System (INIS)

Riccobono, Francesco; Perra, Guido; Pisani, Anastasia; Protano, Giuseppe

2011-01-01

To assess the quality of the environment in southern Iraq after the Gulf War II, a geochemical survey was carried out. The survey provided data on the chemistry of Euphrates waters, as well as the trace element contents, U and Pb isotopic composition, and PAH levels in soil and tree bark samples. The trace element concentrations and the 235 U/ 238 U ratio values in the Euphrates waters were within the usual natural range, except for the high contents of Sr due to a widespread presence of gypsum in soils of this area. The trace element contents in soils agreed with the common geochemistry of soils from floodplain sediments. Some exceptions were the high contents of Co, Cr and Ni, which had a natural origin related to ophiolitic outcrops in the upper sector of the Euphrates basin. The high concentrations of S and Sr were linked to the abundance of gypsum in soils. A marked geochemical homogeneity of soil samples was suggested by the similar distribution pattern of rare earth elements, while the 235 U/ 238 U ratio was also fairly homogeneous and within the natural range. The chemistry of the tree bark samples closely reflected that of the soils, with some notable exceptions. Unlike the soils, some tree bark samples had anomalous values of the 235 U/ 238 U ratio due to mixing of depleted uranium (DU) with the natural uranium pool. Moreover, the distribution of some trace elements (such as REEs, Th and Zr) and the isotopic composition of Pb in barks clearly differed from those of the nearby soils. The overall results suggested that significant external inputs occurred implying that once formed the DU-enriched particles could travel over long distances. The polycyclic aromatic hydrocarbon concentrations in tree bark samples showed that phenanthrene, fluoranthene and pyrene were the most abundant components, indicating an important role of automotive traffic. - Highlights: → This is a contribution to the knowledge of the Iraqi environment after Gulf War II. → In

Measurements of the neutron-induced fission cross sections of 240Pu and 242Pu relative to 235U

International Nuclear Information System (INIS)

Behrens, J.W.; Browne, J.C.; Carlson, G.W.

1976-01-01

A continuation is given of the fission-cross-section ratio measurements in progress at the Lawrence Livermore Laboratory. Preliminary results are provided for the 240 Pu/ 235 U and 242 Pu/ 235 U ratios from 0.02 to 30 MeV and 0.1 to 30 MeV, respectively. Using the threshold-cross-section method, the ratios were normalized to the values 1.368 +- 0.030 and 1.116 +- 0.025, respectively, from 1.75 to 4.00 MeV

Determination of U-235 quantity in fresh fuel elements by neutron coincidence collar technique

International Nuclear Information System (INIS)

Almeida, M.C.M. de; Almeida, S.G. de; Marzo, M.A.S.; Moita, L.P.M.

1990-01-01

The U-235 quantity per lenght of fresh fuel assemblies of the Angra-I first recharge was determined by Neutron Coincidence Collar technique (N.C.C.). This technique is well-founded in fresh fuel assemblies activation by thermal neutrons from AmLi source to generate U-235 fission neutrons. These neutrons are detected by coincidence method in polyethylene structure where 18 He-3 detectors were placed. The coincidence counting results, in active mode (AmLi), showed 0,7% to standard deviation and equal to 1,49% to mass in 1000s of counting. The accuracies of different calibration methods were evaluated and compared. The results showed that the operator declared values are consistent. This evaluation was part of technical-exchange program between Safeguards Laboratory from C.N.E.N. and Los Alamos National Lab., United States. (author)

An alternative route for the preparation of the medical isotope 99Mo from the 238U(γ, f) and 100Mo(γ, n) reactions

International Nuclear Information System (INIS)

Naik, H.; Goswami, A.; Suryanarayana, S.V.; Jagadeesan, K.C.; Thakare, S.V.; Joshi, P.V.; Nimje, V.T.; Mittal, K.C.; Venugopal, V.; Kailas, S.

2013-01-01

The radionuclide 99 Mo, which has a half-life of 65.94 h was produced from 238 U(γ, f) and 100 Mo(γ, n) reactions using a 10 MeV electron linac at EBC, Kharghar Navi-Mumbai, India. This has been investigated since the daughter product 99m Tc is very important from a medical point of view and can be produced in a generator from the parent 99 Mo. The activity of 99 Mo was analyzed by a γ-ray spectrometric technique using a HPGe detector. From the detected γ-rays activity of 140.5 and 739.8 keV, the amount of 99 Mo produced was determined. For comparison, the amount of 99 Mo from 238 U(γ, f) and 100 Mo(γ, n) reactions was also estimated using the experimental photon flux from 197 Au(γ, n) 196 Au reaction. The amount of 99 Mo from the detected γ-lines is in agreement with the estimated value for 238 U(γ, f) and 100 Mo(γ, n) reactions. The production of 99 Mo activity from 238 U(γ, f) and 100 Mo(γ, n) reactions is a relevant and novel approach, which provides alternative routes to 235,238 U(n, f) and 98 Mo(n, γ) reactions, circumventing the need for a reactor. The viability and practicality of the 99 Mo production from the 238 U(γ, f) and 100 Mo(γ, n) reactions alternative to 235,238 U(n, f) and 98 Mo(n, γ) reactions has been emphasize. An estimate has been also arrived based on the experimental data of present work to fulfill the requirement of DOE. (author)

Measurement of the neutron-induced fission cross section of 232Th relative to 235U from 0.7 to 30 MeV

International Nuclear Information System (INIS)

Behzens, T.W.; Ables, E.; Browne, T.C.

1982-01-01

The authors have measured the fission cross-section ratio 232 Th: 235 U as a function of neutron energy from 0.7 to 30 MeV using ionization fission chambers, the threshold cross-section method, and the time-of-flight technique at the Lawrence Livermore National Laboratory 100-MeV electron linear accelerator. The measured cross-section ratio, averaged over the neutron energy interval from 1.75 to 4.00 MeV, was 0.1086 + 0.0024

Reich-Moore and Adler-Adler representations of the 235U cross sections in the resolved resonance region

International Nuclear Information System (INIS)

Saussure, G. de; Leal, L.C.; Perez, R.B.

1990-01-01

In the first part of this paper, a reevaluation of the low-energy neutron cross sections of 235 U is described. This reevaluation was motivated by the discrepancy between the measured and computed temperature coefficients of reactivity and is based on recent measurements of the fission cross section and of η in the thermal and subthermal neutron energy regions. In the second part of the paper, we discuss the conversion of the Reich-Moore resonance parameters, describing the neutron cross sections of 235 U in the resolved resonance region, into equivalent Adler-Adler resonance parameters and into equivalent momentum space multipole resonance parameters

Neutron-fragment angular correlations in /sup 235/U(n/sub th/,f)

International Nuclear Information System (INIS)

Franklyn, C.B.

1985-01-01

Neutron-fragment angular correlations in /sup 235/U(n/sub th/,f) as a function of neutron energy and fragment mass are presented. The results obtained in this experiment, together with data for neutron-neutron angular correlations, are compared with a Monte Carlo simulation of the fission process incorporating both a scission neutron component and an anisotropic neutron emission component

Quantum Zeno paradox and decay of the 235m U isomer in matter

International Nuclear Information System (INIS)

Panov, A.D.

1995-01-01

The known quantum Zeno paradox is considered from microscopic viewpoint as applied to observation of nuclear decay. It is shown that some phenomena, related with this paradox can produce sufficient effect on the constant of 235m U isomer decay during its implantation in metallic matrices. 43 refs., 3 figs

Candidate processes for diluting the 235U isotope in weapons-capable highly enriched uranium

International Nuclear Information System (INIS)

Snider, J.D.

1996-02-01

The United States Department of Energy (DOE) is evaluating options for rendering its surplus inventories of highly enriched uranium (HEU) incapable of being used to produce nuclear weapons. Weapons-capable HEU was earlier produced by enriching uranium in the fissile 235 U isotope from its natural occurring 0.71 percent isotopic concentration to at least 20 percent isotopic concentration. Now, by diluting its concentration of the fissile 235 U isotope in a uranium blending process, the weapons capability of HEU can be eliminated in a manner that is reversible only through isotope enrichment, and therefore, highly resistant to proliferation. To the extent that can be economically and technically justified, the down-blended uranium product will be made suitable for use as commercial reactor fuel. Such down-blended uranium product can also be disposed of as waste if chemical or isotopic impurities preclude its use as reactor fuel

Multilevel fitting of 235U resonance data sensitive to Bohr-and Brosa-fission channels

International Nuclear Information System (INIS)

Moore, M.S.

1995-01-01

The recent determination of the K, J dependence of the neutron induced fission cross section of 235 U by the Dubna group has led to a renewed interest in the mechanism of fission from saddle to scission. The K quantum numbers designate the so-called Bohr fission channels, which describe the fission properties at the saddle point. Certain other fission properties, e.g., the fragment mass and kinetic-energy distribution, are related to the properties of the scission point. The neutron energy dependence of the fragment kinetic energies has been measured by Hambsch et al., who analyzed their data according to a channel description of Brosa et al. How these two channel descriptions, the saddle-point Bohr channels and the scission-point Brosa channels, relate to one another is an open question, and is the subject matter of the present paper. We use the correlation coefficient between various data sets, in which variations are reported from resonance to resonance, as a measure of both-the statistical reliability of the data and of the degree to which different scission variables relate to different Bohr channels. We have carried out an adjustment of the ENDF/B-VI multilevel evaluation of the fission cross section of 235 U, one that provides a reasonably good fit to the energy dependence of the fission, capture, and total cross sections below 100 eV, and to the Bohr-channel structure deduced from an earlier measurement by Pattenden and Postma. We have also further explored the possibility of describing the data of Hambsch et al. in the Brosa-channel framework with the same set of fission-width vectors, only in a different reference system. While this approach shows promise, it is clear that better data are also needed for the neutron energy variation of the scission-point variables

The 235U Prompt Fission Neutron Spectrum in the BR1 Reactor at SCK•CEN

Science.gov (United States)

Wagemans, Jan; Malambu, Edouard; Borms, Luc; Fiorito, Luca

2016-02-01

The BR1 research reactor at SCK•CEN has a spherical cavity in the graphite above the reactor core. In this cavity an accurately characterised Maxwellian thermal neutron field is present. Different converters can be loaded in the cavity in order to obtain other types of neutron (and gamma) irradiation fields. Inside the so-called MARK III converter a fast 235U(n,f) prompt fission neutron field can be obtained. With the support of MCNP calculations, irradiations in MARK III can be directly related to the pure 235U(n,f) prompt fission neutron spectrum. For this purpose MARK III spectrum averaged cross sections for the most relevant fluence dosimetry reactions have been determined. A calibration factor for absolute measurements has been determined applying activation dosimetry following ISO/IEC 17025 standards.

The 235U Prompt Fission Neutron Spectrum in the BR1 Reactor at SCK•CEN

Directory of Open Access Journals (Sweden)

Wagemans Jan

2016-01-01

Full Text Available The BR1 research reactor at SCK•CEN has a spherical cavity in the graphite above the reactor core. In this cavity an accurately characterised Maxwellian thermal neutron field is present. Different converters can be loaded in the cavity in order to obtain other types of neutron (and gamma irradiation fields. Inside the so-called MARK III converter a fast 235U(n,f prompt fission neutron field can be obtained. With the support of MCNP calculations, irradiations in MARK III can be directly related to the pure 235U(n,f prompt fission neutron spectrum. For this purpose MARK III spectrum averaged cross sections for the most relevant fluence dosimetry reactions have been determined. A calibration factor for absolute measurements has been determined applying activation dosimetry following ISO/IEC 17025 standards.

Prompt Gamma Radiation from Fragments in the Thermal Fission of 235U

International Nuclear Information System (INIS)

Albinsson, H.; Lindow, L.

1970-06-01

Measurements were made on the gamma radiation emitted from fission fragments in slow neutron induced fission of 235 U. The fragments were detected with solid state detectors of the surface barrier type and the gamma radiation with a Nal(Tl) scintillator. Mass selection was used so that the gamma radiation could be measured as a function of fragment mass. Time discrimination between the fission gammas and the prompt neutrons released in the fission process was employed to reduce the background. The gamma radiation emitted during different time intervals after the fission event was studied with the help of a collimator, the position of which was changed along the path of the fission fragments. In this way a decay curve was obtained from which the life-time of one of the gamma-emitting states could be estimated. The relative yield of the gamma-rays was determined as a function of mass for different gamma-ray energy portions and two specific time intervals after the fission events. Comparisons were made with data obtained from 252 Cf-fission. Attention is drawn to some features which seem to be the same in 235 U and 252 Cf-fission

Critical mass experiment using U-235 foils and lucite plates

International Nuclear Information System (INIS)

Sanchez, R.; Butterfield, K.; Kimpland, R.; Jaegers, P.

1998-01-01

The main objective of this experiment was to show how the multiplication of the system increases as moderated material is placed between highly enriched uranium foils. In addition, this experiment served to demonstrate the hand-stacking techniques, and approach to criticality by remote operation. This experiment was designed by Tom McLaughlin in the mid seventies as part of the criticality safety course that is taught at Los Alamos Critical Experiment Facility (LACEF). The W-U-235 ratio for this experiment was 215 which is where the minimum critical mass for this configuration occurs

Critical mass experiment using 235U foils and lucite plates

International Nuclear Information System (INIS)

Sanchez, R.; Butterfield, K.; Kimpland, R.; Jaegers, P.

1998-01-01

This experiment demonstrated how the neutron multiplication of a system increases as moderated material is placed between highly enriched uranium foils. In addition, this experiment served to demonstrate the hand-stacking technique and approach to criticality be remote operation. This experiment was designed by McLaughlin in the mid-seventies as part of the criticality safety course that is taught at the Los Alamos Critical Experiments Facility. The H/ 235 U ratio for this experiment was 215, which is the ratio at which the minimum critical mass for this configuration occurs

Analysis of the angular distributions of elastically scattered neutrons for 235U

International Nuclear Information System (INIS)

Sukhovitskij, E.Sh.; Benderskij, A.R.; Konshin, V.A.

1976-01-01

Experimental data on the angular distributions of 0.5-15 MeV neutrons elastically scattered by 235 U nuclei are analysed on the basis of Bessel functions and Legendre polynomial expansions. The advantages of the method are that there are no negative cross-sections and relatively few expansion coefficients and that experimental data on scattering at 0 0 and 180 0 are not needed. (author)

Use of delayed gamma rays for active non-destructive assay of {sup 235}U irradiated by pulsed neutron source (plasma focus)

Energy Technology Data Exchange (ETDEWEB)

Andola, Sanjay; Niranjan, Ram [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Kaushik, T.C., E-mail: tckk@barc.gov.in [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Rout, R.K. [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Kumar, Ashwani; Paranjape, D.B.; Kumar, Pradeep; Tomar, B.S.; Ramakumar, K.L. [Radioanalytical Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Gupta, S.C. [Applied Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)

2014-07-01

A pulsed neutron source based on plasma focus device has been used for active interrogation and assay of {sup 235}U by monitoring its delayed high energy γ-rays. The method involves irradiation of fissile material by thermal neutrons obtained after moderation of a burst of neutrons emitted upon fusion of deuterium in plasma focus (PF) device. The delayed gamma rays emitted from the fissile material as a consequence of induced fission were detected by a large volume sodium iodide (NaI(Tl)) detector. The detector is coupled to a data acquisition system of 2k input size with 2k ADC conversion gain. Counting was carried out in pulse height analysis mode for time integrated counts up to 100 s while the temporal profile of delayed gamma has been obtained by counting in multichannel scaling mode with dwell time of 50 ms. To avoid the effect of passive (natural) and active (from surrounding materials) backgrounds, counts have been acquired for gamma energy between 3 and 10 MeV. The lower limit of detection of {sup 235}U in the oxide samples with this set-up is estimated to be 14 mg.

Reich-Moore and Adler-Adler representations of the 235U cross sections in the resolved resonance region

International Nuclear Information System (INIS)

de Saussure, G.; Leal, L.C.; Perez, R.B.

1990-01-01

In the first part of this paper, a reevaluation of the low-energy neutron cross sections of 235 U is described. This reevaluation was motivated by the discrepancy between the measured and computed temperature coefficients of reactivity and is based on recent measurements of the fission cross section and of η in the thermal and subthermal neutron energy regions. In the second part of the paper, we discuss the conversion of the Reich-Moore resonance parameters, describing the neutron cross sections of 235 U in the resolved resonance region, into equivalent Adler-Adler resonance parameters and into equivalent momentum space multipole resonance parameters. 25 refs., 4 figs., 5 tabs

Prompt neutron decay constant for the Oak Ridge Research Reactor with 20 wt % 235U enriched fuel

International Nuclear Information System (INIS)

Ragan, G.E.; Mihalczo, J.T.

1986-01-01

This paper describes measurements of the prompt neutron decay constant at delayed criticality for the Oak Ridge Research Reactor (ORR) using 20 wt % 235 U enriched fuel and compares these measurements with similar measurements using 93.2 wt % 235 U enriched fuel. This reactor parameter is of interest because it affects the transient behavior of the reactor in prompt criticality accident situations. This experiment is part of a program to investigate the differences in the performance of research reactors fueled with highly enriched and low enriched uranium. The prompt neutron decay constants were obtained using noise analysis measurement techniques for a core with newly fabricated, unirradiated fuel elements

Standard practice for the determination of 237Np, 232Th, 235U and 238U in urine by inductively coupled plasma-Mass spectrometry (ICP-MS) and gamma ray spectrometry.

CERN Document Server

American Society for Testing and Materials. Philadelphia

2005-01-01

1.1 This practice covers the separation and preconcentration of neptunium-237 (237Np), thorium-232 (232Th), uranium-235 (235U) and uranium-238 (238U) from urine followed by quantitation using ICP-MS. 1.2 This practice can be used to support routine bioassay programs. The minimum detectable concentrations (MDC) for this method, taking the preconcentration factor into account, are approximately 1E-2Bq for 237Np (0.38ng), 2E-6Bq for 232Th (0.50ng), 4E-5Bq for 235U (0.50ng) and 6E-6Bq for 238U (0.48ng). 1.3 This standard does not purport to address all of the safety problems, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

Beta and gamma decay heat evaluation for the thermal fission of 235U

International Nuclear Information System (INIS)

Schenter, G.K.; Schmittroth, F.

1979-01-01

Beta and gamma fission product decay heat curves are evaluated for the thermal fission of 235 U. Experimental data that include beta, gamma, and total measurements are combined with summation calculations based on ENDF/B in a consistent evaluation. Least-squares methods are used that take proper account of data uncertainties and correlations. 4 figures, 2 tables

Method of fault diagnosis in nozzle cascades for U-235 enrichment

International Nuclear Information System (INIS)

Schuette, R.; Steinhaus, H.

1978-09-01

In a separation nozzle cascade for enrichment of the light uranium isotope U-235 some 450 stages are connected in series. For optimum separation performance of such a plant the design values of the nozzle inlet pressure, of the UF 6 concentration of the UF 6 -cut and the cut of the light additional gas must be matched in all separation stages. Also the feed stream, the product stream, and the tails stream have to be controlled according to the cascade design values. Since it is not possible to measure the cuts directly, these values are calculated on the basis of the material flow balances of the cascade using the pressure values and the UF 6 concentration measurements in each stage, these data being supplemented by concentration measurements in the light and heavy fractions of selected stages. This approach requires the use of a digital computer for processing some 1500 readings to calculate the 2500 plant parameters defining the plant state. This study describes a method of diagnosing the major faults to be expected in a separation nozzle cascade. It is based on the fact that the fault profiles are characterized sufficiently well by maximum values and values to identify the cause of a fault and localize the point where it occurs by means of simple relations between these six values and of their relative positions. The performance of the method has been tested in experiments in the ten-stage pilot plant. For use in commercial separation nozzle cascades the range of performance and the special mode of implementation can be derived from the characteristics of the plant components (separation nozzles, compressors, control valves). The methodological approach in this fault diagnosis also provides the basis for computer aided control procedures to raise a separation cascade from any steady plant condition to its set point operation. (orig./HP) 891 HP [de

Criticality study of the storage of radioactive waste containing 235U

International Nuclear Information System (INIS)

Couasnon, O.

1999-01-01

The purpose of this study is to define the conditions of storage of nuclear waste drums containing 350 g of 235 U (per drum). This study is valid for a square pitch stacking of cylindrical drums whose height/diameter ratio does not exceed 3. The reflector effect of concrete is taken into account. This study defines a conservative case that can be used under any hypothesis of moderation, of radiation coupling between drums and of fissile material density. (A.C.)

Fission Product Yield Study of 235U, 238U and 239Pu Using Dual-Fission Ionization Chambers

Science.gov (United States)

Bhatia, C.; Fallin, B.; Howell, C.; Tornow, W.; Gooden, M.; Kelley, J.; Arnold, C.; Bond, E.; Bredeweg, T.; Fowler, M.; Moody, W.; Rundberg, R.; Rusev, G.; Vieira, D.; Wilhelmy, J.; Becker, J.; Macri, R.; Ryan, C.; Sheets, S.; Stoyer, M.; Tonchev, A.

2014-05-01

To resolve long-standing differences between LANL and LLNL regarding the correct fission basis for analysis of nuclear test data [M.B. Chadwick et al., Nucl. Data Sheets 111, 2891 (2010); H. Selby et al., Nucl. Data Sheets 111, 2891 (2010)], a collaboration between TUNL/LANL/LLNL has been established to perform high-precision measurements of neutron induced fission product yields. The main goal is to make a definitive statement about the energy dependence of the fission yields to an accuracy better than 2-3% between 1 and 15 MeV, where experimental data are very scarce. At TUNL, we have completed the design, fabrication and testing of three dual-fission chambers dedicated to 235U, 238U, and 239Pu. The dual-fission chambers were used to make measurements of the fission product activity relative to the total fission rate, as well as for high-precision absolute fission yield measurements. The activation method was employed, utilizing the mono-energetic neutron beams available at TUNL. Neutrons of 4.6, 9.0, and 14.5 MeV were produced via the 2H(d,n)3He reaction, and for neutrons at 14.8 MeV, the 3H(d,n)4He reaction was used. After activation, the induced γ-ray activity of the fission products was measured for two months using high-resolution HPGe detectors in a low-background environment. Results for the yield of seven fission fragments of 235U, 238U, and 239Pu and a comparison to available data at other energies are reported. For the first time results are available for neutron energies between 2 and 14 MeV.

Effective K quantum numbers in fission of oriented 235U

International Nuclear Information System (INIS)

Dabbs, J.W.T.; Eggerman, C.; Cauvin, B.; Michaudon, A.; Sanche, M.

1969-01-01

The angular anisotropy of fission fragments produced in neutron-induced fission of aligned 235 U nuclei has been measured for neutron energies between 0.3 eV and 175 eV, using time-of-flight techniques at the pulsed 45 MeV electron linear accelerator at Saclay. The low-temperature nuclear-alignment apparatus used was a modified version of the apparatus described at the Salzburg conference, and gave an average temperature of 0.61 K for the four UO 2 Rb(NO 3 ) 3 single crystal samples during a measurement period of approximately 220 h. The flight path was 5 m and the election pulse length was 100 ns. Multilevel fits to the observed 0 deg and 90 deg fission cross-sections have been made using the Adler and Adler formalism with the aid of a program developed by G. de Saussure. The most striking result obtained in the analysis of some 16 of 100 levels or groups of levels is a strong correlation between small fission width and an effective value of K ≅ J. All 5 resonances in the group of 16 for which results are final, for which K ≅ J is deduced, have exceptionally small widths. This result suggests that the small widths are associated with a large rotational energy and consequent diminution in available deformation energy, so that these 5 resonances are effectively sub-threshold resonances; such a suggestion is quite in accord with the ideas of Bohr. The preponderance of other resonances so far analysed have effective K values of 1 or 2. An analysis of all resolvable resonances is presented. (author)

(e,e'f) coincidence experiments for fission decay of giant resonances in 235,238U

International Nuclear Information System (INIS)

Weber, T.; Heil, R.D.; Kneissl, U.; Pecho, W.; Wilke, W.; Emrich, H.J.; Kihm, T.; Knoepfle, K.T.

1988-01-01

Extending previous work on 238 U, 235 U(e,e'f) coincidence data were taken at 4 momentum transfers yielding both E1, E2/E0 and E3 form factors and the respective multipole strength distributions in the giant resonance region of 238 U (4 x x /Γ a is obtained as a function of excitation energy for separated multipoles. The giant E2 resonance exhibits an increased symmetric fission contribution compared to E1 and E3 resonances. (orig.)

Effect of U-238 and U-235 cross sections on nuclear characteristics of fast and thermal reactors

Energy Technology Data Exchange (ETDEWEB)

Akie, Hiroshi; Takano, Hideki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kaneko, Kunio

1997-03-01

Benchmark calculation has been made for fast and thermal reactors by using ENDF/B-VI release 2(ENDF/B-VI.2) and JENDL-3.2 nuclear data. Effective multiplication factors (k{sub eff}s) calculated for fast reactors calculated with ENDF/B-VI.2 becomes about 1% larger than the results with JENDL-3.2. The difference in k{sub eff} is caused mainly from the difference in inelastic scattering cross section of U-238. In all thermal benchmark cores, ENDF/B-VI.2 gives smaller multiplication factors than JENDL-3.2. In U-235 cores, the difference is about 0.3%dk and it becomes about 0.6% in TCA U cores. The difference in U-238 data is also important in thermal reactors, while there are found 0.1-0.3% different v values of U isotopes in thermal energy between ENDF/B-VI.2 and JENDL-3.2. (author)

Thallium, uranium, and 235U/238U ratios in the digestive gland of American lobster (Homarus americanus) from an industrialized harbor

International Nuclear Information System (INIS)

Chou, C.L.; Uthe, J.F.

1995-01-01

Only a few studies have concentrated on elements such as thallium (TI). Uranium (U) has been studied as a radionuclide of concern in food and the environment. Foodstuffs contain 10-100 ng U· -1 with vegetables and cereals contributing most heavily to the daily intake of ca 1.5 ug U. Between 10-30% of ingested U is absorbed, with most being stored in bone. Rainbow trout (onchorynchus mykiss) and longnose sucker (Catostomus catostomus) from a lake with naturally high radioactivity contained -1 in the flesh. Trout bone contained 40 ng U·g -1 . Higher tissue U concentrations occurred in fish from areas receiving U mining wastes. Bioconcentration factors for bone and flesh were estimated to be low, 118 and 14.7, respectively. This paper describes the Inductively coupled plasma-mass spectrometry (ICP-MS) determination of Tl and U in digestive gland tissue from lobsters captured in the vicinity of Belledune Harbor, New Brunswick, Canada. The harbor is the site of a lead smelter, a fertilizer plant, and a coal-fired power station (the latter due to enter production in late 1993) and thus has the potential of adding significant amounts of Tl to the local marine environment. The accumulation of Tl from water by marine shellfish is low, at least for bivalves, and the accumulated Tl is eliminated in a number of days when the animals are transferred to clean water. Bioconcentration factors for U in finfish ranged from 0.4-17 for larger species. However, because of the high concentrations of various trace elements in lobster digestive gland, its desirability as a foodstuff, and its relatively large size (approximately 20% of the edible tissue yield), we have investigated Tl and U concentrations and 235U / 238U ratios in it. 15 refs., 1 fig., 3 tabs

Contribution to the study of the interaction of slow neutrons with {sup 235}U using the time-of-flight method; Contribution a l'etude par la methode du temps de vol de l'interaction de neutrons lents avec l'U{sup 235}

Energy Technology Data Exchange (ETDEWEB)

Michaudon, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1964-05-15

This study concerns the properties of the excited levels of uranium 236 obtained by interaction of slow neutron with uranium 235. The experiments have been carried out at the Saclay linear electron accelerator by use of the time of flight method. In the first part of this paper, we examine the technical and physical conditions which rule the experiments: compromise between resolution and counting rate, time dispersion due to the slowing down of the neutrons and crystalline binding effects. In a second part the experimental results i.e. total, fission and ternary fission cross sections are given. The third part deals with the analysis of these results: the resonance parameters determination ({tau}{sub n}, {tau}{sub {gamma}}, {tau}{sub f}), the study of their statistical distribution and of their correlations. We tried some classifications of the resonances according to their parameters and compared these classifications to each other and to other results. At least the evidence of a cross section correlation with a range smaller than 100 eV seems to be confirmed. (author) [French] Cette etude porte sur les proprietes des niveaux excites de l'Uranium-236 obtenus par l'interaction de neutrons lents avec le {sup 235}U. La technique experimentale est celle de la spectrometrie par temps de vol, les experiences ayant ete realisees aupres de l'accelerateur lineaire d'electrons de Saclay, Dans une premiere partie nous examinons les donnees techniques et physiques conditionnant les experiences: compromis entre resolution et taux de comptage, dispersion en temps due au ralentissement des neutrons, effet des liaisons cristallines. Dans une deuxieme partie sont exposes les resultats experimentaux: sections efficaces totales, de fission et de fission ternaire du {sup 235}U. Une troisieme partie porte sur l'analyse de ces resultats: determination des parametres ({tau}{sub n}, {tau}{sub {gamma}}, {tau}{sub f}), etude de leurs distributions statistiques et des correlations entre ces

Critical mass analysis for 235U and 239Pu systems moderated and reflected by D2O

International Nuclear Information System (INIS)

Loaiza, D.; Stratton, W.

1998-01-01

Criticality dimensions for highly enriched 235 U (93.5) and 239 Pu (95.5) systems mixed with D 2 O were studied. The objective of this work is to investigate the minimum critical mass and concentration of uranium and plutonium systems in a reflector-moderated arrangement. The present work demonstrates the critical instability of some of these systems that are reflected by D 2 O and expands from previously published and unpublished work. These calculations were performed in a spherical geometry with the DANTSYS codes using the Hansen-Roach cross-section library. Densities examined ranged from normal to very small and are assumed to be uniform throughout the core. These spherical systems are reflected by 100 cm of D 2 O

Dicty_cDB: AFF235 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFF235 (Link to dictyBase) - - - - AFF235F (Link to Original s...ite) AFF235F 602 - - - - - - Show AFF235 Library AF (Link to library) Clone ID AFF235 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...date 2001.11.24 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dict... 3 CK420742 |CK420742.1 AUF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to ER

Evaluation of covariances for resolved resonance parameters of 235U, 238U, and 239Pu in JENDL-3.2

International Nuclear Information System (INIS)

Kawano, Toshihiko; Shibata, Keiichi

2003-02-01

Evaluation of covariances for resolved resonance parameters of 235 U, 238 U, and 239 Pu was carried out. Although a large number of resolved resonances are observed for major actinides, uncertainties in averaged cross sections are more important than those in resonance parameters in reactor calculations. We developed a simple method which derives a covariance matrix for the resolved resonance parameters from uncertainties in the averaged cross sections. The method was adopted to evaluate the covariance data for some important actinides, and the results were compiled in the JENDL-3.2 covariance file. (author)

Prompt Gamma Radiation from Fragments in the Thermal Fission of {sup 235}U

Energy Technology Data Exchange (ETDEWEB)

Albinsson, H [Chalmers Univ. of Technology, Goteborg (Sweden); Lindow, L [AB Atomenergi, Nykoeping (Sweden)

1970-06-15

Measurements were made on the gamma radiation emitted from fission fragments in slow neutron induced fission of {sup 235}U. The fragments were detected with solid state detectors of the surface barrier type and the gamma radiation with a Nal(Tl) scintillator. Mass selection was used so that the gamma radiation could be measured as a function of fragment mass. Time discrimination between the fission gammas and the prompt neutrons released in the fission process was employed to reduce the background. The gamma radiation emitted during different time intervals after the fission event was studied with the help of a collimator, the position of which was changed along the path of the fission fragments. In this way a decay curve was obtained from which the life-time of one of the gamma-emitting states could be estimated. The relative yield of the gamma-rays was determined as a function of mass for different gamma-ray energy portions and two specific time intervals after the fission events. Comparisons were made with data obtained from {sup 252} Cf-fission. Attention is drawn to some features which seem to be the same in {sup 235}U and {sup 252} Cf-fission.

Mass dependence of azimuthal asymmetry in the fission of 232Th and 233,235,236,238U by polarized photons

International Nuclear Information System (INIS)

Denyak, V.V.; Khvastunov, V.M.; Paschuk, S.A.; Schelin, H.R.

2013-01-01

Fission of the even-even nuclei 232 Th, 236,238 U and even-odd nuclei 233,235 U by linearly polarized photons has been studied at excitation energies in the region of a giant dipole resonance. The performed investigations unambiguously showed the existence of the fragment mass dependence of the cross section azimuthal asymmetry in the photofission of 236 U and 238 U. In addition, the obtained results provided the first evidence for the possible difference between the asymmetry values in asymmetric and symmetric mass distribution regions in the case of 236 U. The measured cross section azimuthal asymmetry of the fission of 232 Th does not show any fragment mass dependence. In the even-odd nuclei 233 U and 235 U the difference between the far-asymmetric and other mass distribution regions was also observed but with the statistical uncertainty not small enough for definitive conclusion. (orig.)

Proposal for Analysis of the Safeguarded Nuclear Materials 235U and 239Pu by Delayed Neutrons Technique

International Nuclear Information System (INIS)

El-Mongy, S.A.

2000-01-01

This paper introduces, describes and initiates a very sensitive and rapid non-destructive technique to be used for analysis of the safeguarded nuclear materials 235 U and 239 Pu. The technique is based on fission of the nuclear material by neutrons and then measuring the delayed neutrons produced from the neutron rich fission products. By this technique, fissile isotope content ( 235 U) can be determined in the presence of the other fissile (e.g. 239 Pu) or fertile isotopes (e.g. 238 U) in fresh and spent fuel. The time consumed for analysis of bulk materials by this technique is only 4 minutes. The method is also used for analysis of uranium in rock, sediment, soil, meteorites, lunar, biological, urine, archaeological, zircon sand and seawater samples. The method enables uranium in a sample to be measured without respect to its oxidation state, organic and inorganic elements

Energy dependence of average half-life of delayed neutron precursors in fast neutron induced fission of 235U and 236U

International Nuclear Information System (INIS)

Isaev, S.G.; Piksaikin, L.E.; Kazakov, L.E.; Tarasko, M.Z.

2000-01-01

The measurements of relative abundances and periods of delayed neutrons from fast neutron induced fission of 235 U and 236 U have been made at the electrostatic accelerator CG-2.5 at IPPE. The preliminary results were obtained and discussed in the frame of the systematics of the average half-life of delayed neutron precursors. It was shown that the average half-life value in both reactions depends on the energy of primary neutrons [ru

Fission cross section of 235U from 1 to 6 MeV

International Nuclear Information System (INIS)

Barton, D.M.; Diven, B.C.; Hansen, G.E.; Jarvis, G.A.; Koontz, P.G.; Smith, R.K.

1976-01-01

The ratio of the neutron-induced fission cross section of 235 U to the neutron-proton scattering cross section was measured in the neutron energy region from 1 to 6 MeV. The neutron source was the T(p,n) reaction produced by a pulsed Van de Graaff proton beam on a thin tritium gas target. The use of monoenergetic neutrons allowed time-of-flight methods to be used to study carefully backgrounds and source characteristics

Determination of 233U, 235U, 238U and 239Pu fission yields induced by fission and 14.7 MeV neutrons

International Nuclear Information System (INIS)

Laurec, Jean; Adam, Albert; Bruyne, Thierry de.

1981-12-01

The 233 U, 235 U, 238 U, 239 Pu fission yields have been determined by a radiochemical method. A target and a fission chamber made of same fissible material are irradied together. The total fission number is measured from the fission chamber. The fission product activities are directly measured on the target using calibrated Ge-Li detectors. The fissible material masses are determined by alpha and mass spectrometries. The irradiations were made on the critical assemblies PROSPERO and CALIBAN and on the 14 MeV neutron generator of C.E. VALDUC. 3 to 5% fission yield errors are got for the most measured nuclides: 95 Zr, 97 Zr, 99 Mo, 103 Ru, 131 I, 132 Te, 140 Ba, 141 Ce, 143 Ce, 144 Ce, 147 Nd [fr

Corrosion rate of parent and weld materials of F82H and JPCA steels under LBE flow with active oxygen control at 450 and 500 deg. C

International Nuclear Information System (INIS)

Kikuchi, Kenji; Kamata, Kinya; Ono, Mikinori; Kitano, Teruaki; Hayashi, Kenichi; Oigawa, Hiroyuki

2008-01-01

Corrosion behavior of parent and weld materials of F82H and JPCA was studied in the circulating LBE loop under impinging flow. These are candidate materials for Japanese Accelerator Driven System (ADS) beam windows. Maximum temperatures were kept to 450 and 500 deg. C with 100 deg. C constant temperature difference. Main flow velocity was 0.4-0.6 m/s in every case. Oxygen concentration was controlled to 2-4 x 10 -5 mass% although there was one exception. Testing time durations were 500-3000 h. Round bar type specimens were put in the circular tube of the loop. An electron beam weld in the middle of specimens was also studied. Optical microscopy, electron microscopy, X-ray element analyses and X-ray diffraction were used to investigate corrosion in these materials. Consequently corrosion depth and stability of those oxide layers were characterized based on the analyses. For a long-term behavior a linear law is recommended to predict corrosion in the ADS target design

Monte Carlo analyses of simple U233 O2-ThO2 and U235 O2-ThO2 lattices with ENDF/B-IV data (AWBA development program)

International Nuclear Information System (INIS)

Hardy, J. Jr.; Ullo, J.J.

1980-09-01

A number of water-moderated Th-U235 and Th-U233 lattice integral experiments were analyzed in a consistent manner, with ENDF/B-IV data and detailed Monte Carlo methods. These experiments provide a consistent test of the nuclear data. The ENDF/B-IV data are found to perform reasonably well. Adequate agreement is found with integral measurements of thorium capture. Calculated K/sub eff/ values show a generally coherent pattern which is consistent with K/sub eff/ results obtained for homogeneous aqueous critical assemblies. Harder prompt fission spectra for U233 and U235 can correct the principal discrepancy observed with ENDF/B-IV, a bias trend in K/sub eff/ attributed to an underprediction of leakage

Contribution to the study of the interaction of slow neutrons with {sup 235}U using the time-of-flight method; Contribution a l'etude par la methode du temps de vol de l'interaction de neutrons lents avec l'U{sup 235}

Energy Technology Data Exchange (ETDEWEB)

Michaudon, A. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1964-05-15

This study concerns the properties of the excited levels of uranium 236 obtained by interaction of slow neutron with uranium 235. The experiments have been carried out at the Saclay linear electron accelerator by use of the time of flight method. In the first part of this paper, we examine the technical and physical conditions which rule the experiments: compromise between resolution and counting rate, time dispersion due to the slowing down of the neutrons and crystalline binding effects. In a second part the experimental results i.e. total, fission and ternary fission cross sections are given. The third part deals with the analysis of these results: the resonance parameters determination ({tau}{sub n}, {tau}{sub {gamma}}, {tau}{sub f}), the study of their statistical distribution and of their correlations. We tried some classifications of the resonances according to their parameters and compared these classifications to each other and to other results. At least the evidence of a cross section correlation with a range smaller than 100 eV seems to be confirmed. (author) [French] Cette etude porte sur les proprietes des niveaux excites de l'Uranium-236 obtenus par l'interaction de neutrons lents avec le {sup 235}U. La technique experimentale est celle de la spectrometrie par temps de vol, les experiences ayant ete realisees aupres de l'accelerateur lineaire d'electrons de Saclay, Dans une premiere partie nous examinons les donnees techniques et physiques conditionnant les experiences: compromis entre resolution et taux de comptage, dispersion en temps due au ralentissement des neutrons, effet des liaisons cristallines. Dans une deuxieme partie sont exposes les resultats experimentaux: sections efficaces totales, de fission et de fission ternaire du {sup 235}U. Une troisieme partie porte sur l'analyse de ces resultats: determination des parametres ({tau}{sub n}, {tau}{sub {gamma}}, {tau}{sub f}), etude de leurs distributions statistiques et

Characterization of bauxite residue (red mud) for 235U, 238U, 232Th and 40K using neutron activation analysis and the radiation dose levels as modeled by MCNP.

Science.gov (United States)

Landsberger, S; Sharp, A; Wang, S; Pontikes, Y; Tkaczyk, A H

2017-07-01

This study employs thermal and epithermal neutron activation analysis (NAA) to quantitatively and specifically determine absorption dose rates to various body parts from uranium, thorium and potassium. Specifically, a case study of bauxite residue (red mud) from an industrial facility was used to demonstrate the feasibility of the NAA approach for radiological safety assessment, using small sample sizes to ascertain the activities of 235 U, 238 U, 232 Th and 40 K. This proof-of-concept was shown to produce reliable results and a similar approach could be used for quantitative assessment of other samples with possible radiological significance. 238 U and 232 Th were determined by epithermal and thermal neutron activation analysis, respectively. 235 U was determined based on the known isotopic ratio of 238 U/ 235 U. 40 K was also determined using epithermal neutron activation analysis to measure total potassium content and then subtracting its isotopic contribution. Furthermore, the work demonstrates the application of Monte Carlo Neutral-Particle (MCNP) simulations to estimate the radiation dose from large quantities of red mud, to assure the safety of humans and the surrounding environment. Phantoms were employed to observe the dose distribution throughout the human body demonstrating radiation effects on each individual organ. Copyright © 2016 Elsevier Ltd. All rights reserved.

Electrodeposition Behavior of U into Liquid Cd Cathode at Low Current Density

International Nuclear Information System (INIS)

Kim, Si Hyung; Kim, Gha-Young; Sim, Jun-Bo; Paek, Seungwoo; Ahn, Do-Hee

2015-01-01

According to the U-Cd phase diagram, U and UCd 11 are, respectively, present as a stable phase above and below 473 .deg. C when both U and Cd elements coexist at such temperatures. U metals deposited on the surface of the LCC around 500 .deg. C tends to form a dendrite shape having a large surface area and the U dendrites floating on the surface of the LCC have a role of a solid cathode, and from that time, co-deposition of U and TRU can be hampered. If the UCd 11 phase does not have a dendrite form during electrodeposition, this phase may sink into the liquid Cd. This can be a good method to simplify the equipment configuration through the omission of the stirring tool. In this study, the deposition behavior of U metal was observed when electrodeposition using a LCC was carried out at 450 and 500 .deg. C at low current density. To observe the deposition behavior of U when using a liquid cadmium cathode (LCC), several deposition experiments were conducted in the LiCl- KCl-UCl 3 salt at a current density of 50 mA/cm 2 at 450 and 500 .deg.C. At 500 .deg. C, the U metal deposited on the LCC grew in the form of a dendrite shape having a large surface area, and thus it was not sunk into the liquid Cd even though the density of U was much larger than that of liquid Cd. On the other hand, the UCd 11 phase was stable according to the U-Cd phase diagram at 450 .deg. C

Quantification of 235 U and 226 Ra in soil samples by means of Gamma spectroscopy

International Nuclear Information System (INIS)

Quintero P, E.; Rojas M, V.P.; Montes M, F.R.; Gaso P, M.I.; Cervantes N, M.L.

2000-01-01

In this work it is presented the Gamma Spectroscopy method which is realized in the Environmental Radiological Surveillance Laboratory using the option of deconvolution of a commercial software for the quantification of 235 U and 226 Ra; also is presented the method for the 226 Ra correction activity. (Author)

The fission cross sections of /sup 230/Th, /sup 232/Th, /sup 233/U, /sup 234/U, /sup 236/U, /sup 238/U, /sup 237/Np, /sup 239/Pu and /sup 242/Pu relative /sup 235/U at 14. 74 MeV neutron energy

Energy Technology Data Exchange (ETDEWEB)

Meadows, J.W.

1986-12-01

The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.

Growth of C60 thin films on Al2O3/NiAl(100) at early stages

Science.gov (United States)

Hsu, S.-C.; Liao, C.-H.; Hung, T.-C.; Wu, Y.-C.; Lai, Y.-L.; Hsu, Y.-J.; Luo, M.-F.

2018-03-01

The growth of thin films of C60 on Al2O3/NiAl(100) at the earliest stage was studied with scanning tunneling microscopy and synchrotron-based photoelectron spectroscopy under ultrahigh-vacuum conditions. C60 molecules, deposited from the vapor onto an ordered thin film of Al2O3/NiAl(100) at 300 K, nucleated into nanoscale rectangular islands, with their longer sides parallel to direction either [010] or [001] of NiAl. The particular island shape resulted because C60 diffused rapidly, and adsorbed and nucleated preferentially on the protrusion stripes of the crystalline Al2O3 surface. The monolayer C60 film exhibited linear protrusions of height 1-3 Å, due to either the structure of the underlying Al2O3 or the lattice mismatch at the boundaries of the coalescing C60 islands; such protrusions governed also the growth of the second layer. The second layer of the C60 film grew only for a C60 coverage >0.60 ML, implying a layer-by-layer growth mode, and also ripened in rectangular shapes. The thin film of C60 was thermally stable up to 400 K; above 500 K, the C60 islands dissociated and most C60 desorbed.

Efficiency of the low energy detection system for the measurement of {sup 235} U in lung of the Nuclear Regulatory Authority; Eficiencia del sistema de deteccion de baja energia para la medicion de {sup 235} U en pulmon de la Autoridad Regulatoria Nuclear

Energy Technology Data Exchange (ETDEWEB)

Spinella, M.R.; Krimer, M.; Gregori, B.N.; Rojo, A.M. [Autoridad Regulatoria Nuclear, Av. Del Libertador 8250 (C1429BNP), Buenos Aires (Argentina)]. e-mail: mspinell@cae.arn.gov.ar

2006-07-01

This work presents the results of the calibration process of the detection system of {sup 235} U in lung of the Nuclear Regulatory Authority. The phantom used in the calibration is the denominated Lawrence Livermore Realistic Phantom, provided of lungs and active nodules and of 4 thoracic covers that its simulate muscular tissue with thickness that vary between 1.638 and 3.871 cm. The spectra are acquired by four detecting of denominated LEGe ACTII Canberra marks, each one with an active area of 3800 mm{sup 2}, a diameter of 70 mm and a thickness of 20 mm, the sign is processed by a SYSTEM100 multichannel and the spectra are analyzed with the GENIE2K program. The detectors are suspended by mobile structures that allow to vary the position with regard to a horizontal stretcher that defines the measurement geometry. The whole system is located in the interior of an armored enclosure of 200 x 150 x 200 cm{sup 3} of steel of 15 cm thickness, inside recovered with layers of 0.5 cm lead and 0.05 cm cadmium. The total weight of the enclosure is 40 ton. For the described system the efficiency curves versus muscular thoracic tissue thickness (ETM) corresponding to the energy of 143.76, 163.358 and 185.72 keV of the {sup 235} U radioisotope were obtained. Its were also practiced displacements of those detectors of approximately 1 cm with respect to the reference position and its were analyzed the corresponding changes of magnitude in the efficiencies. The obtained variations oscillate, for vertical displacements, between 5% and 7.8% for the smallest value in ETM (1.638 cm) and between 4.2% to 6.7% for the ETM 3.871 cm. While for the practiced lateral displacements, the variations go from 4% to 15%. The detection limits corresponding to each energy and thickness were determined. The results showed for the photopeak of 185.72 keV, the more outstanding in the evaluations that saying limit it oscillates between 3.7 and 6.4 Bq {sup 235} U inside the considered thickness range

Measurement of 235U content and flow of UF6 using delayed neutrons or gamma rays following induced fission

International Nuclear Information System (INIS)

Stromswold, D.C.; Peurrung, A.J.; Reeder, P.L.; Perkins, R.W.

1996-06-01

Feasibility experiments conducted at Pacific Northwest National Laboratory demonstrate that either delayed neutrons or energetic gamma rays from short-lived fission products can be used to monitor the blending of UF 6 gas streams. A 252 Cf neutron source was used to induce 235 U fission in a sample, and delayed neutrons and gamma rays were measured after the sample moved open-quotes down-stream.close quotes The experiments used a UO 2 powder that was transported down the pipe to simulate the flowing UF 6 gas. Computer modeling and analytic calculation extended the test results to a flowing UF 6 gas system. Neutron or gamma-ray measurements made at two downstream positions can be used to indicate both the 235 U content and UF 6 flow rate. Both the neutron and gamma-ray techniques have the benefits of simplicity and long-term reliability, combined with adequate sensitivity for low-intrusion monitoring of the blending process. Alternatively, measuring the neutron emission rate from (a, n) reactions in the UF 6 provides an approximate measure of the 235 U content without using a neutron source to induce fission

Beta and gamma decay heat measurements between 0.1s--50,000s for neutron fission of 235U, 238U and 239Pu. Final report, June 1, 1992--December 31, 1996

International Nuclear Information System (INIS)

Schier, W.A.; Couchell, G.P.

1996-01-01

This is a final reporting on the composition of separate beta and gamma decay heat measurements following neutron fission of 235 U and 238 U and 239 Pu and on cumulative and independent yield measurements of fission products of 235 U and 238 U. What made these studies unique was the very short time of 0.1 s after fission that could be achieved by incorporating the helium jet and tape transport system as the technique for transporting fission fragments from the neutron environment of the fission chamber to the low-background environment of the counting area. This capability allowed for the first time decay heat measurements to extend nearly two decades lower on the logarithmic delay time scale, a region where no comprehensive aggregate decay heat measurements had extended to. This short delay time capability also allowed the measurement of individual fission products with half lives as short as 0.2s. The purpose of such studies was to provide tests both at the aggregate level and at the individual nuclide level of the nation's evaluated nuclear data file associated with fission, ENDF/B-VI. The results of these tests are in general quite encouraging indicating this data base generally predicts correctly the aggregate beta and aggregate gamma decay heat as a function of delay time for 235 U, 238 U and 239 Pu. Agreement with the measured individual nuclide cumulative and independent yields for fission products of 235 U and 238 U was also quite good although the present measurements suggest needed improvements in several individual cases

$\\gamma$-ray energy spectra and multiplicities from the neutron-induced fission of $^{235}$U using STEFF

CERN Document Server

An experiment is proposed to use the STEFF spectrometer at n_TOF to study fragment $\\gamma$-correlations following the neutron-induced fission of $^{235}$U. The STEFF array of 12 NaI detectors will allow measurements of the single $\\gamma$-energy, the $\\gamma$ multiplicity, and the summed $\\gamma$energy distributions as a function of the mass and charge split, and deduced excitation energy in the fission event. These data will be used to study the origin of fission-fragment angular momenta, examining angular distribution eects as a function of incident neutron energy. The principal application of this work is in meeting the NEA high-priority request for improved $\\gamma$ray data from $^{235}$U(n; F). To improve the detection rate and expand the range of detection angles, STEFF will be modied to include two new ssion-fragment detectors each at 45 to the beam direction.

Absolute calibration of the neutron yield measurement on JT-60 Upgrade

International Nuclear Information System (INIS)

Nishitani, Takeo; Takeuchi, Hiroshi; Barnes, C.W.

1991-10-01

Absolutely calibrated measurements of the neutron yield are important for the evaluation of the plasma performance such as the fusion gain Q in DD operating tokamaks. Total neutron yield is measured with 235 U and 238 U fission chambers and 3 He proportional counters in JT-60 Upgrade. The in situ calibration was performed by moving the 252 Cf neutron source toroidally through the JT-60 vacuum vessel. Detection efficiencies of three 235 U and two 3 He detectors were measured for 92 locations of the neutron point source in toroidal scans at two different major radii. The total detection efficiency for the torus neutron source was obtained by averaging the point efficiencies over the whole toroidal angle. The uncertainty of the resulting absolute plasma neutron source calibration is estimated to be ± 10%. (author)

Fission cross sections of some thorium, uranium, neptunium and plutonium isotopes relative to /sup 235/U

Energy Technology Data Exchange (ETDEWEB)

Meadows, J W

1983-10-01

Earlier results from the measurements, at this Laboratory, of the fission cross sections of /sup 230/Th, /sup 232/Th, /sup 233/U, /sup 234/U, /sup 236/U, /sup 238/U, /sup 237/Np, /sup 239/Pu, /sup 240/Pu, and /sup 242/Pu relative to /sup 235/U are reviewed with revisions to include changes in data processing procedures, alpha half lives and thermal fission cross sections. Some new data have also been included. The current experimental methods and procedures and the sample assay methods are described in detail and the sources of error are presented in a systematic manner. 38 references.

Study of 235U very asymmetric thermal fission

International Nuclear Information System (INIS)

Sida, J.L.

1989-12-01

The fission fragment separator Lohengrin of the Institut Laue-Langevin in Grenoble was used to determine the yields of the very asymmetric light fission products (A=84-69) as a function of A, Z, and the kinetic energy E. The proton pairing effect causes fine structures in the mass distribution, in the mean nuclear charge anti Z and its variance σ z , and in the mean kinetic energies of the elements. The neutron pairing effect in the production yields is found for the first time of the same order of magnitude than the proton pairing effect. In the mass region investigated both are the largest observed in fission of 235 U. A decrease in the mean kinetic energy for the isotopes of Ni and Cu was observed. It points to a large deformation at scission. Our results support the view that very asymmetric low-energy fission is a weakly dissipative process. The highly deformed transient system breaks by a slow necking-in process [fr

Quantification of {sup 235} U and {sup 226} Ra in soil samples by means of Gamma spectroscopy; Cuantificacion de {sup 235} U y {sup 226} Ra en muestras de suelo por medio de espectrometria gamma

Energy Technology Data Exchange (ETDEWEB)

Quintero P, E.; Rojas M, V.P.; Montes M, F.R.; Gaso P, M.I.; Cervantes N, M.L. [Gerencia de Innovacion Tecnologica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)

2000-07-01

In this work it is presented the Gamma Spectroscopy method which is realized in the Environmental Radiological Surveillance Laboratory using the option of deconvolution of a commercial software for the quantification of {sup 235} U and {sup 226} Ra; also is presented the method for the {sup 226} Ra correction activity. (Author)

Measurement of neutron-induced fission cross-sections of Th232, U238, U233 and Np237 relative to U235 from 1 MeV to 200 MeV

Energy Technology Data Exchange (ETDEWEB)

Shcherbakov, O.A.; Laptev, A.B.; Petrov, G.A. [Petersburg Nuclear Physics Inst., Gatchina, Leningrad district (Russian Federation); Fomichev, A.V.; Donets, A.Y.; Osetrov, O.I.

1998-11-01

The measurements of neutron-induced cross-section ratios for Th232, U238, U233 and Np237 relative to U235 have been carried out in the energy range from 1 MeV up to 200 MeV using the neutron time-of-flight spectrometer GNEIS based on 1 GeV proton synchrocyclotron. Below 20 MeV, the results of present measurements are roughly in agreement with evaluated data though there are some discrepances to be resolved. (author)

Study of the variation with the energy of the fission cross-sections of {sup 233}U, {sup 235}U, {sup 239}Pu for the fast neutrons; Etude de la variation avec l'energie des sections efficaces de fission de {sup 233}U, {sup 235}U, {sup 239}Pu pour les neutrons rapides

Energy Technology Data Exchange (ETDEWEB)

Szteinsznaider, D; Naggiar, V; Netter, F [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1955-07-01

This measurements have been done while taking the value of the fission cross-sections of {sup 238}U as reference. The neutrons are produced by the reaction {sup 7}Li(p,n) in the Van de Graaff generator of Saclay. The explored domain spreads from some tenths to 2000 keV. We find: for {sup 239}Pu: {sigma}{sub f} = 2,04 {+-} 0,12 barns, cross-section constant between 150 and 2000 keV, for {sup 235}U: {sigma}{sub f} = 1,15 {+-} 0,15 barns, cross-section constant between 700 and 1000 keV, for {sup 233}U: {sigma}{sub f} = 1,92 {+-} 0,25 barns, for neutrons of 850 keV. (authors) [French] Ces mesures ont ete effectuees en prenant la valeur de la section efficace de fission de {sup 238}U comme reference. Les neutrons sont produits par la reaction {sup 7}Li(p,n) au generateur Van de Graaff de Saclay. Le domaine explore s'etend de quelques dizaines de kev a 2000 kev. Nous trouvons: pour {sup 239}Pu: {sigma}{sub f} = 2,04 {+-} 0,12 barns, section efficace constante entre 150 et 2000 kev. pour {sup 235}U: {sigma}{sub f} = 1,15 {+-} 0,15 barns, section efficace constante entre 700 et 1000 kev. pour {sup 233}U: {sigma}{sub f} = 1,92 {+-} 0,25 barns, pour des neutrons de 850 kev. (auteurs)

48 CFR 252.235-7002 - Animal welfare.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Animal welfare. 252.235... Clauses 252.235-7002 Animal welfare. As prescribed in 235.072(a), use the following clause: Animal Welfare... animals only from dealers licensed by the Secretary of Agriculture under 7 U.S.C. 2133 and 9 CFR subpart A...

Development of a rapid radiochemical procedure for the separation of /sup 235m/U from 239Pu

International Nuclear Information System (INIS)

Attrep, M. Jr.; Efurd, D.W.; Roensch, F.R.

1987-01-01

We have developed a rapid radiochemical procedure for the isolation and purification of /sup 235m/U (t/sub 1/2/ = 26 minutes) from 239 Pu samples up to 250 mg. Purpose of developing the procedure was to measure the thermal neutron fission cross section of the isomeric meta state of 235 U. We used rapid small-scale anion exchange columns that absorbed uranium in concentrated HBr but did not absorb plutonium. Uranium was easily eluted with very dilute HF. The separation time required 25 to 35 minutes. We were able to attain a separation factor of uranium from plutonium of approximately 1 x 10 10 with samples ranging from 1 x 10 10 to 3 x 10 11 . The ratio of the fission cross sections for the meta to ground state was measured to be 1.42. 4 figs., 1 tab

Uranium ((234)U, (235)U and (238)U) contamination of the environment surrounding phosphogypsum waste heap in Wiślinka (northern Poland).

Science.gov (United States)

Olszewski, Grzegorz; Boryło, Alicja; Skwarzec, Bogdan

2015-08-01

The aim of this work was to determine the uranium concentration ((234)U, (235)U and (238)U) and values of the activity ratio (234)U/(238)U in soil samples collected near phosphogypsum waste heap in Wiślinka (northern Poland). On the basis of the studies it was found that the values of the (234)U/(238)U activity ratio in the analyzed soils collected in the vicinity of phosphogypsum dump in Wiślinka are in most cases close to one and indicate the phosphogypsum origin of the analyzed nuclides. The obtained results of uranium concentrations are however much lower than in previous years before closing of the phosphogypsum stockpile. After this process and covering the phosphogypsum stockpile in Wiślinka with sewage sludge, phosphogypsum particles are successfully immobilized. In the light of the results the use of phosphate fertilizers seems to be a major problem. Prolonged and heavy rains can cause leaching accumulated uranium isotopes in the phosphogypsum stockpile, which will be washed into the Martwa Wisła and on the fields in the immediate vicinity of this storage. Copyright © 2015 Elsevier Ltd. All rights reserved.

Derivation of decay heat benchmarks for U235 and Pu239 by a least squares fit to measured data

International Nuclear Information System (INIS)

Tobias, A.

1989-05-01

A least squares technique used by previous authors has been applied to an extended set of available decay heat measurements for both U235 and Pu239 to yield simultaneous fits to the corresponding beta, gamma and total decay heat. The analysis takes account of both systematic and statistical uncertainties, including correlations, via calculations which use covariance matrices constructed for the measured data. The results of the analysis are given in the form of beta, gamma and total decay heat estimates following fission pulses and a range of irradiation times in both U235 and Pu239. These decay heat estimates are considered to form a consistent set of benchmarks for use in the assessment of summation calculations. (author)

Transition Probabilities in the 1/2+(631) Band in {sup 235}U

Energy Technology Data Exchange (ETDEWEB)

Hoejeberg, M; Malmskog, S G

1969-09-15

Measurements of absolute transition probabilities in the rotational band built on the 1/2{sup +}(631) single particle state in {sup 235}U have been performed using delayed coincidence technique. The following half-lives were obtained: T{sub 1/2} (13.0 keV level) = (0.50 {+-} 0.03) nsec. T{sub 1/2} (51.7 k e V level) = (0.20 {+-} 0.02) nsec. From the deduced B(E2) and B(M1) values magnetic and electric parameters were determined which could be compared with predictions from the Nilsson model.

22 CFR 208.100 - What does this part do?

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What does this part do? 208.100 Section 208.100 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION...., p. 235) and 31 U.S.C. 6101 note (Section 2455, Public Law 103-355, 108 Stat. 3327). ...

235U enrichment determination on UF6 cylinders with CZT detectors

Science.gov (United States)

Berndt, Reinhard; Mortreau, Patricia

2018-04-01

Measurements of uranium enrichment in UF6 transit cylinders are an important nuclear safeguards verification task, which is performed using a non-destructive assay method, the traditional enrichment meter, which involves measuring the count rate of the 186 keV gamma ray. This provides a direct measure of the 235U enrichment. Measurements are typically performed using either high-resolution detectors (Germanium) with e-cooling and battery operation, or portable devices equipped with low resolution detectors (NaI). Despite good results being achieved when measuring Low Enriched Uranium in 30B type cylinders and natural uranium in 48Y type containers using both detector systems, there are situations, which preclude the use of one or both of these systems. The focus of this work is to address some of the recognized limitations in relation to the current use of the above detector systems by considering the feasibility of an inspection instrument for 235U enrichment measurements on UF6 cylinders using the compact and light Cadmium Zinc Telluride (CZT) detectors. In the present work, test measurements were carried out, under field conditions and on full-size objects, with different CZT detectors, in particular for situations where existing systems cannot be used e.g. for stacks of 48Y type containers with depleted uranium. The main result of this study shows that the CZT detectors, actually a cluster of four μCZT1500 micro spectrometers provide as good results as the germanium detector in the ORTEC Micro-trans SPEC HPGe Portable spectrometer, and most importantly in particular for natural and depleted uranium in 48Y cylinders.

Determination of the activity of the uranium isotopes U-234, U-235 and U-238 in environmental samples by alpha spectrometry

International Nuclear Information System (INIS)

Kromphorn, G.

1996-02-01

Different materials containing urandium are regularly investigated in the Laboratory for Environmental Radioactivity of the Physikalisch-Technische Bundesanstalt (PTB) with respect to the activity of the uranium isotopes ( 234 U, 235 U, and 238 U). Moreover for reasons of quality assurance, the PTB takes part in international comparisons where also uranium contents are to be determined in environmental samples and in the framework of which reference materials can be certified. Finally in national comparisons the PTB has the task to determine values of the specific activity for the different isotopes which can play the role of nominal (orientation) values. The single steps of uranium analyses are described after a compilation of the most important data of the uranium isotopes contained in natural uranium: The use of 232 U as tracer, the chemical separation analytics, the production of α-sources and the measuring methods. Analyses of a soil sample and a waste water sample with respect to their specific uranium activity have been chosen as examples of a practical application. (orig.) [de

Determination of the isotopic abundance of 235U in rocks in search for an Oklo phenomenon in Brazil by activation analysis

International Nuclear Information System (INIS)

Vasconcellos, M.B.A.; Armelin, M.J.A.; Lima, F.W. de; Fulfaro, R.

1981-09-01

Isotopic analyses of uranium are generally carried out by mass spectrometry, with a precision better than 1%. In nuclear laboratories it is often necessary to perform rapid determinations of 235 U isotopic abundances. Thermal neutron activation analysis by delayed neutron counting or by high resolution gamma-ray spectrometry can be applied for this purpose, although with less precision than by mass spectrometry. In this work, delayed neutron counting and gamma-ray spectrometry are used for the determination of the isotopic abundance of 235 U in rocks from the Northeastern region of Brazil. In the case of the application of delayed neutron counting, the rocks are analyzed non-destructively. When high resolution gamma-ray spectrometry is applied, a pre-irradiation chemical separation had to be performed, by extraction of uranium with tributylphosphate. By both methods employed the results for the isotopic abundance of 235 U can be considered as equal to the natural value of 0.702%, for the rocks under study. The precision attained by gamma-ray spectrometry is better than that by delayed neutron couting. (Author) [pt

High accuracy measurement of the $^{235}$U(n,f) reaction cross-section in the 10-30 keV neutron energy range

CERN Multimedia

The analysis of the neutron flux of n_TOF (in EAR1) revealed an anomaly in the 10-30 keV neutron energy range. While the flux extracted on the basis of the $^{6}$Li(n,t)$^{4}$He and $^{10}$B(n,$\\alpha$)$^{7}$Li reactions mostly agreed with each other and with the results of FLUKA simulations of the neutron beam, the one based on the $^{235}$U(n,f) reaction was found to be systematically lower, independently of the detection system used. A possible explanation is that the $^{235}$U(n,f) crosssection in that energy region, where in principle should be known with an uncertainty of 1%, may be systematically overestimated. Such a finding, which has a negligible influence on thermal reactors, would be important for future fast critical or subcritical reactors. Furthermore, its interest is more general, since the $^{235}$U(n,f) reaction is often used at that energy to determine the neutron flux, or as reference in measurements of fission cross section of other actinides. We propose to perform a high-accuracy, high-r...

Determination of uranium-235 by differential gamma spectrometry

International Nuclear Information System (INIS)

Suner, A.A.; La Gamma de Batistoni, A.M.G.; Botbol, J.

1974-12-01

A method for the determination of U-235 contained in solutions of uranium, by gamma spectrometry with Ge(Li) detector is described. Ra-226 is coprecipitated in BaSO 4 . The activity at 186 keV is measured, substracted by the corresponding of a standard. The detection limit is 1% of increment of U-235 over the standard. (author)

Evaluation of fission cross sections and covariances for {sup 233}U, {sup 235}U, {sup 238}U, {sup 239}Pu, {sup 240}Pu, and {sup 241}Pu

Energy Technology Data Exchange (ETDEWEB)

Kawano, Toshihiko [Kyushu Univ., Fukuoka (Japan); Matsunobu, Hiroyuki [Data Engineering, Inc. (Japan); Murata, Toru [AITEL Corporation, Tokyo (JP)] [and others

2000-02-01

A simultaneous evaluation code SOK (Simultaneous evaluation on KALMAN) has been developed, which is a least-squares fitting program to absolute and relative measurements. The SOK code was employed to evaluate the fission cross sections of {sup 233}U, {sup 235}U, {sup 238}U, {sup 239}Pu, {sup 240}Pu, and {sup 241}Pu for the evaluated nuclear data library JENDL-3.3. Procedures of the simultaneous evaluation and the experimental database of the fission cross sections are described. The fission cross sections obtained were compared with evaluated values given in JENDL-3.2 and ENDF/B-VI. (author)

Prompt fission neutron spectra from fission induced by 1 to 8 MeV neutrons on 235U and 239Pu using the double time-of-flight technique

International Nuclear Information System (INIS)

Noda, S.; Haight, R. C.; Nelson, R. O.; Devlin, M.; O'Donnell, J. M.; Chatillon, A.; Granier, T.; Belier, G.; Taieb, J.; Kawano, T.; Talou, P.

2011-01-01

Prompt fission neutron spectra from 235 U and 239 Pu were measured for incident neutron energies from 1 to 200 MeV at the Weapons Neutron Research facility (WNR) of the Los Alamos Neutron Science Center, and the experimental data were analyzed with the Los Alamos model for the incident neutron energies of 1-8 MeV. A CEA multiple-foil fission chamber containing deposits of 100 mg 235 U and 90 mg 239 Pu detected fission events. Outgoing neutrons were detected by the Fast Neutron-Induced γ-Ray Observer array of 20 liquid organic scintillators. A double time-of-flight technique was used to deduce the neutron incident energies from the spallation target and the outgoing energies from the fission chamber. These data were used for testing the Los Alamos model, and the total kinetic energy parameters were optimized to obtain a best fit to the data. The prompt fission neutron spectra were also compared with the Evaluated Nuclear Data File (ENDF/B-VII.0). We calculate average energies from both experimental and calculated fission neutron spectra.

Current Status and Open Issues of the 235U Evaluation. Summary Report of an IAEA Consultants’ Meeting

International Nuclear Information System (INIS)

Noguere, Gilles; Trkov, Andrej

2016-08-01

The objective of this consultancy meeting was to discuss the status of the 235 U neutron cross sections from the thermal to MeV energy ranges, to identify the main difficulties and to propose recommendations for improving the current experimental and evaluation works

Estimation of covariances of 16O, 23Na, Fe, 235U, 238U and 239Pu neutron nuclear data in JENDL-3.2

International Nuclear Information System (INIS)

Shibata, Keiichi; Nakajima, Yutaka; Kawano, Toshihiko; Oh, Soo-Youl; Matsunobu, Hiroyuki; Murata, Toru.

1997-10-01

Covariances of nuclear data have been estimated for 6 nuclides contained in JENDL-3.2. The nuclides considered are 16 O, 23 Na, Fe, 235 U, 238 U, and 239 Pu, which are regarded as important for the nuclear design study of fast reactors. The physical quantities for which covariances are deduced are cross sections, resolved and unresolved resonance parameters, and the first order Legendre-polynomial coefficient for the angular distribution of elastically scattered neutrons. As for 235 U, covariances were obtained also for the average number of neutrons emitted in fission. The covariances were estimated by using the same methodology that had been used in the JENDL-3.2 evaluation in order to keep a consistency between mean values and their covariances. The least-squares fitting code GMA was used in estimating covariances for reactions of which JENDL-3.2 cross sections had been evaluated by taking account of measurements. In nuclear model calculations, the covariances were calculated by the KALMAN system. The covariance data obtained were compiled in the ENDF-6 format, and will be put into the JENDL-3.2 Covariance File which is one of JENDL special purpose files. (author). 193 refs

{sup 235}U(n,F) prompt fission neutron spectra

Energy Technology Data Exchange (ETDEWEB)

Maslov, M.V.; Tetereva, N.A. [Joint Institute of Nuclear and Energy Research, Minsk-Sosny (Belarus); Pronyaev, V.P.; Kagalenko, A.B. [Institute of Physics and Power Engineering, Obninsk (Russian Federation); Capote, R. [International Atomic Energy Agency, Vienna (Austria); Granier, T.; Morillon, B. [CEA, Centre DAM-IIe de France, 91 - Arpajon (France); Hambsch, F.J. [EC-JRC Institute for Reference Materials and Measurements, Geel (Belgium); Sublet, J.C. [CEA Cadarache, 13 - Saint Paul lez Durance (France)

2009-07-01

The longstanding problem of inconsistency of integral thermal data testing and differential prompt fission neutron spectra data (PFNS) is mostly due to rather poor fits of differential PFNS data in major data libraries. The measured database is updated by using modern standards including Manhart's evaluation of the spontaneous fission neutron spectra of {sup 252}Cf(sf). That largely removes the inconsistency of older thermal neutron-induced PFNS measurements with newest data of JRC IRMM by Hambsch et al. (2009). A phenomenological approach, developed by Kornilov et al. (1999), for the first-chance fission and extended for the emissive fission domain by Maslov et al. (2005) is calibrated at E{sub th} to predict both the PFNS average energy and PFNS shape up to 20 MeV. The latter is extremely important, since rather close values in fact correspond to quite discrepant spectra shapes, which influences reactor neutronics strongly. The proposed phenomenological representation of the PFNS reproduces both soft and hard energy tails of {sup 235}U(n{sub th},F) PFNS at thermal incident neutron energy E{sub th}. In the first-chance and emissive fission domain evaluated PFNS are consistent with the data by Ethvignot et al. (2005). A compiled MF=5 Endf/B-formatted file of the {sup 235}U(n,F) PFNS largely removes the inconsistencies of the evaluated differential PFNS with integral data benchmarks. Almost perfect fits are attained for available differential PFNS data from E{sub th} up to E{sub n}=14.7 MeV, with few exceptions at E{sub n}=2.9 and E{sub n}=5 MeV. Fast integral critical experiment like GODIVA or Flattop benchmarks might be reproduced almost with the same accuracy as with the PFNS of the major data libraries. That reveals a rather delicate compensation effect, since present and previous PFNS shapes are drastically different from each other. Thermal assemblies benchmarking reveals positive biases in k(eff), which might be attributed to the influence of

Efficiency of the low energy detection system for the measurement of 235 U in lung of the Nuclear Regulatory Authority

International Nuclear Information System (INIS)

Spinella, M.R.; Krimer, M.; Gregori, B.N.; Rojo, A.M.

2006-01-01

This work presents the results of the calibration process of the detection system of 235 U in lung of the Nuclear Regulatory Authority. The phantom used in the calibration is the denominated Lawrence Livermore Realistic Phantom, provided of lungs and active nodules and of 4 thoracic covers that its simulate muscular tissue with thickness that vary between 1.638 and 3.871 cm. The spectra are acquired by four detecting of denominated LEGe ACTII Canberra marks, each one with an active area of 3800 mm 2 , a diameter of 70 mm and a thickness of 20 mm, the sign is processed by a SYSTEM100 multichannel and the spectra are analyzed with the GENIE2K program. The detectors are suspended by mobile structures that allow to vary the position with regard to a horizontal stretcher that defines the measurement geometry. The whole system is located in the interior of an armored enclosure of 200 x 150 x 200 cm 3 of steel of 15 cm thickness, inside recovered with layers of 0.5 cm lead and 0.05 cm cadmium. The total weight of the enclosure is 40 ton. For the described system the efficiency curves versus muscular thoracic tissue thickness (ETM) corresponding to the energy of 143.76, 163.358 and 185.72 keV of the 235 U radioisotope were obtained. Its were also practiced displacements of those detectors of approximately 1 cm with respect to the reference position and its were analyzed the corresponding changes of magnitude in the efficiencies. The obtained variations oscillate, for vertical displacements, between 5% and 7.8% for the smallest value in ETM (1.638 cm) and between 4.2% to 6.7% for the ETM 3.871 cm. While for the practiced lateral displacements, the variations go from 4% to 15%. The detection limits corresponding to each energy and thickness were determined. The results showed for the photopeak of 185.72 keV, the more outstanding in the evaluations that saying limit it oscillates between 3.7 and 6.4 Bq 235 U inside the considered thickness range. (Author)

Photofission cross-section ratio measurement of 235U/238U using monoenergetic photons in the energy range of 9.0-16.6 MeV

Science.gov (United States)

Krishichayan; Bhike, Megha; Finch, S. W.; Howell, C. R.; Tonchev, A. P.; Tornow, W.

2017-05-01

Photofission cross-section ratios of 235U and 238U have been measured using monoenergetic photon beams at the HIγS facility of TUNL. These measurements have been performed in small energy steps between 9.0 and 16.6 MeV using a dual-fission ionization chamber. Measured cross-section ratios are compared with the previous experimental data as well as with the recent evaluated nuclear data library ENDF.

Mass dependence of azimuthal asymmetry in the fission of {sup 232}Th and {sup 233,235,236,238}U by polarized photons

Energy Technology Data Exchange (ETDEWEB)

Denyak, V.V. [National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkiv (Ukraine); Pele Pequeno Principe Research Institute, Curitiba (Brazil); Khvastunov, V.M. [National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkiv (Ukraine); Paschuk, S.A. [Federal University of Technology - Parana, Curitiba (Brazil); Schelin, H.R. [Federal University of Technology - Parana, Curitiba (Brazil); Pele Pequeno Principe Research Institute, Curitiba (Brazil)

2013-04-15

Fission of the even-even nuclei {sup 232}Th, {sup 236,238}U and even-odd nuclei {sup 233,235}U by linearly polarized photons has been studied at excitation energies in the region of a giant dipole resonance. The performed investigations unambiguously showed the existence of the fragment mass dependence of the cross section azimuthal asymmetry in the photofission of {sup 236}U and {sup 238}U. In addition, the obtained results provided the first evidence for the possible difference between the asymmetry values in asymmetric and symmetric mass distribution regions in the case of {sup 236}U. The measured cross section azimuthal asymmetry of the fission of {sup 232}Th does not show any fragment mass dependence. In the even-odd nuclei {sup 233}U and {sup 235}U the difference between the far-asymmetric and other mass distribution regions was also observed but with the statistical uncertainty not small enough for definitive conclusion. (orig.)

Pregestational diabetes with extreme insulin resistance: use of U-500 insulin in pregnancy.

Science.gov (United States)

Zuckerwise, Lisa C; Werner, Erika F; Pettker, Christian M; McMahon-Brown, Erin K; Thung, Stephen F; Han, Christina S

2012-08-01

Increased insulin requirements in pregnancy can hinder attainment of glycemic control in diabetic patients. U-500 insulin is a concentrated form of regular insulin that can be a valuable tool in the treatment of patients with severe insulin resistance. A 24-year-old woman with pregestational diabetes mellitus experienced increasing insulin requirements during pregnancy, peaking at 650 units daily. The frequent, large-volume injections of standard-concentration insulin were poorly tolerated by the patient and resulted in nonadherence. She subsequently achieved glycemic control on thrice-daily U-500 insulin. Pregnancy exacerbates insulin resistance in diabetic patients, and these patients may require high doses of insulin. U-500 insulin is an effective alternative for patients with severe insulin resistance and should be considered for pregnant women with difficulty achieving glycemic control.

Data Processing and Analysis Systems for JT-60U

International Nuclear Information System (INIS)

Matsuda, T.; Totsuka, T.; Tsugita, T.; Oshima, T.; Sakata, S.; Sato, M.; Iwasaki, K.

2002-01-01

The JT-60U data processing system is a large computer complex gradually modernized by utilizing progressive computer and network technology. A main computer using state-of-the-art CMOS technology can handle ∼550 MB of data per discharge. A gigabit ethernet switch with FDDI ports has been introduced to cope with the increase of handling data. Workstation systems with VMEbus serial highway drivers for CAMAC have been developed and used to replace many minicomputer systems. VMEbus-based fast data acquisition systems have also been developed to enlarge and replace a minicomputer system for mass data.The JT-60U data analysis system is composed of a JT-60U database server and a JT-60U analysis server, which are distributed UNIX servers. The experimental database is stored in the 1TB RAID disk of the JT-60U database server and is composed of ZENKEI and diagnostic databases. Various data analysis tools are available on the JT-60U analysis server. For the remote collaboration, technical features of the data analysis system have been applied to the computer system to access JT-60U data via the Internet. Remote participation in JT-60U experiments has been successfully conducted since 1996

The Distance Dependence of Regional Phase Discriminants

Science.gov (United States)

1992-11-09

600. 650. Ranqe fkml 19 RC - fenni obs 110. -rT T 105. 100. 95. 90. 85. 80. 75. 70. 65. S60. 00 55. S 50. 1- 45. 40. 35. 30. 25. 20. 15.L 10. 5. 0...Z -5.r. I...... , I . . I . 1.’ 111111, 111 LIL I J 50. 100. 150. 200. 250. 300. 350. 400. 450. 500. 550 600. 650 Range(kin] 20 TC - fenni obs 110...450. 500. 550. 600. 650. R;nnp fLNer] P&S - fenni 110. 105. 100. 95. 90. 85. 80. 75. 70.2 65. S60. 00 55.L c so 1- 45. 40. 35. 30. 25. 20

Determination of the isotopic ratio 235U/238U in UF6 using quadrupole mass spectrometry

International Nuclear Information System (INIS)

Kusahara, Helena Sueco

1979-01-01

In this work measurements of isotope ratios 235 U / 23 '8U in uranium hexafluoride are carried out using a quadrupole mass spectrometer. The operational parameters, which affect the final precision of the results, are standardized. Optimized procedures for the preparation of uranium hexafluoride samples by fluorination of uranium oxides using cobalt trifluoride method are established. Careful attention is given to the process of purification of uranium hexafluoride samples by fractional distillation. Adequate statistical methods for analysing the results obtained for single ratio measurements as well as the ratio ' of isotopic ratios of sample and standard ar.e developed. A precision of about 10 -4 for single ratio measurements and accuracy of about 0,3% for the ratio of sample and standard ratios are obtained. These results agree with the values which have been obtained using magnetic mass spectrometers. The procedures and methods established in this work can be employed in the systematic uranium isotope analysis in UF 6 form. (author)

Thermal-neutron fission cross section of 26. 1-min /sup 235/U/sup m/

Energy Technology Data Exchange (ETDEWEB)

Talbert W.L. Jr.; Starner, J.W.; Estep, R.J.; Balestrini, S.J.; Attrep M. Jr.; Efurd, D.W.; Roensch, F.R.

1987-11-01

The thermal-neutron fission cross section of /sup 235/U/sup m/ has been measured relative to the ground-state cross section. A rapid radiochemical separation procedure was developed to provide sizeable (10/sup 10/ to 10/sup 11/ atom) samples that were reasonably free of the parent /sup 239/Pu. From a series of eight measurements, the value of 1.42 +- 0.04 was obtained for the ratio sigma/sub m//sigma/sub g/.

Thermal-neutron fission cross section of 26.1-min /sup 235/U/sup m/

International Nuclear Information System (INIS)

Talbert, W.L. Jr.; Starner, J.W.; Estep, R.J.; Balestrini, S.J.; Attrep, M. Jr.; Efurd, D.W.; Roensch, F.R.

1987-01-01

The thermal-neutron fission cross section of /sup 235/U/sup m/ has been measured relative to the ground-state cross section. A rapid radiochemical separation procedure was developed to provide sizeable (10/sup 10/ to 10/sup 11/ atom) samples that were reasonably free of the parent /sup 239/Pu. From a series of eight measurements, the value of 1.42 +- 0.04 was obtained for the ratio σ/sub m//σ/sub g/

47 CFR 65.500 - Net income.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 3 2010-10-01 2010-10-01 false Net income. 65.500 Section 65.500... OF RETURN PRESCRIPTION PROCEDURES AND METHODOLOGIES Interexchange Carriers § 65.500 Net income. The net income methodology specified in § 65.450 shall be utilized by all interexchange carriers that are...

Independent yields of Rb and Cs isotopes from thermal-neutron induced fission of 235U

International Nuclear Information System (INIS)

Balestrini, S.J.; Decker, R.; Wollnik, H.; Wuensch, K.D.; Jung, G.; Koglin, E.; Siegert, G.

1979-01-01

The relative yields of Rb and Cs isotopes from thermal-neutron fission of 235 U have been redetermined using the mass separator OSTIS, on-line at a neutron guide of the High-Flux Beam Reactor at the Institut Laue-Langevin, Grenoble, France. The separator ion source was a hot oven containing 235 U in a graphite matrix. The neutron beam was pulsed. Alkali fission products diffused out of the graphite and were ionized, thus producing a stepwise increase in the analyzed ion beam proportional to the independent fission yield. The ion beam and the fissions in the source were monitored simultaneously. The diffusion of Rb and Cs from the source was exponential in time with half-lives ranging from 2.8 to 18 sec, depending upon the element and source temperature. The independent fission yields of Rb and Cs are normalized by equating their element yields to each other and to a value computed from the charge distributions observed with the recoil separator LOHENGRIN and well established mass yields. Fractional independent yields are deduced from the independent fission yields, and these compare very well with the EOZ model described by Wahl

Regional 500 mb heights and U.S. 1 000-500 mb thickness prior to the radiosonde era

Science.gov (United States)

Michaels, P. J.; Sappington, D. E.; Stooksbury, D. E.; Hayden, B. P.

1990-09-01

We developed a statistical model relating cyclone track eigenvectors over the U.S., southern Canada, and nearby oceans to a record of mean annual 500 mb heights. The length of the cyclone track record allowed us to calculate mean heights back to 1885. Use of mean annual surface pressure data allowed us to estimate the mean 1 000-500 mb thickness, which was related to mean annual temperature. This temperature calculation is unique in that it cannot suffer from urban or site bias. We find a warming of 1.5°C from the late 19th century to 1955, followed by a drop of 0.7° to 1980. By 1987, the calculated temperatures were 0.3° above the mean for 103 years of record. As an example of regional application, we examine results over the southwestern U.S.

Study of fission fragments produced by 14N + 235U reaction

International Nuclear Information System (INIS)

Yalcinkaya, M.; Erduran, M.N.; Ganioglu, E.; Akkus, B.; Bostan, M.; Gurdal, G.; Erturk, S.; Balabanski, D.; Minkova, A.; Danchev, M.

2005-01-01

This work was performed to understand the structure of neutron rich fission fragments around ∼ 130 region. A thin metallic 235 U target was bombarded by 14 N beam with 10 MeV/A from the Separated Sector Cyclotron at the National Accelerator Centre, Cape Town, South Africa. The main goal to detect and identify fission fragments and to obtain their mass distribution was achieved by using Solar Cell detectors in the AFRODITE (African Omnipurpose Detector for Innovative Techniques and Experiments) spectrometer. The X-rays emitted from fission fragments were detected by LEP detectors and γ rays emitted from excited states of the fission fragments were detected by CLOVER detectors in the spectrometer. (author)

Recent status of development and irradiation performance for plate type fuel elements with reduced 235U enrichment at NUKEM

International Nuclear Information System (INIS)

Hrovat, M.F.; Hassel, H.W.

1984-01-01

According to the present state of development full size test fuel elements with the maximum uranium densities of 2,2 g U/cm 3 meat for UAlsub(x), 3,2 g U/cm 3 meat for U 3 O 8 and 4,8 g U/cm 3 meat for U 3 Si 2 can be fabricated at NUKEM in production scale. Special chemical procedures for the uranium recovery were developed ensuring an economic fuel fabrication process. The post irradiation examinations (PIE) of 12 UAlsub(x) (U density 2,2 g U/cm 3 meat) and U 3 O 8 (up to 3,1 g U/cm 3 meat) test plates irradiated in the ORR, Oak Ridge research reactor, were terminated. All 12 test plates show unobjectionable irradiation behavior. Extensive irradiation tests on full size fuel elements were performed. All inserted elements show perfect irradiation behavior. The PIE of the first HFR Petten U 3 O 8 fuel elements are in progress. The full size ORR U 3 Si 2 fuel elements with so far highest uranium density of 4,76 g U/cm 3 meat achieved a burnup of 50 % loss of 235 U up to May 1983. One element was withdrawn from the reactor for PIE, the second will be irradiated to a burnup of 75 % loss of 235 U. The further development is concentrated on Usub(x)Sisub(y) fuel with highest uranium density. U 3 Si miniplates with up to 6,1 g U/cm 3 meat are supplied meeting the required specification, U 3 Si miniplates with 6,7 g U/cm 3 are in fabrication. (author)

Dicty_cDB: SFH450 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFH450 (Link to dictyBase) - - - Contig-U13857-1 SFH450F (Link... to Original site) SFH450F 623 - - - - - - Show SFH450 Library SF (Link to library) Clone ID SFH450 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13857-1 Original site URL http://dict...IMIIFLCLEATFDQPYHSIGGFIIVCSGYQLGQGIAGGAFSGIIPDVVHPSQSGI ASGWLGVGFSLGLLIGTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICT...GTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICTMHEDSND EWSFDGSLPSFFKSLHLPSSIYFNFYWVLITRFFNTLGIYMIFSFLLYFATDIIGQTNLM T

Moderation control in low enriched 235U uranium hexafluoride packaging operations and transportation

International Nuclear Information System (INIS)

Dyer, R.H.; Kovac, F.M.; Pryor, W.A.

1993-01-01

Moderation control is the basic parameter for ensuring nuclear criticality safety during the packaging and transport of low 235 U enriched uranium hexafluoride before its conversion to nuclear power reactor fuel. Moderation control has permitted the shipment of bulk quantities in large cylinders instead of in many smaller cylinders and, therefore, has resulted in economies without compromising safety. Overall safety and uranium accountability have been enhanced through the use of the moderation control. This paper discusses moderation control and the operating procedures to ensure that moderation control is maintained during packaging operations and transportation

On the Relative Signs of "ROT-Effects" in Ternary and Binary Fission of 233U and 235U Nuclei Induced by Polarized Cold Neutrons

Science.gov (United States)

Danilyan, G. V.

2018-02-01

Signs of the ROT-effects in ternary fission of 233U and 235U experimentally defined by PNPI group are the same, whereas in binary fission defined by ITEP group are opposite. This contradiction cannot be explained by the errors in the experiments of both groups, since such instrumental effects would be too large not to be noticed. Therefore, it is necessary to find the answer to this problem in the differences of the ternary and binary fission mechanisms.

COMPARATIVE ANALYSIS OF STRUCTURAL CHANGES IN U-MO DISPERSED FUEL OF FULL-SIZE FUEL ELEMENTS AND MINI-RODS IRRADIATED IN THE MIR REACTOR

Directory of Open Access Journals (Sweden)

ALEKSEY. L. IZHUTOV

2013-12-01

The full-size fuel rods were irradiated up to an average burnup of ∼ 60%235U; the mini-rods were irradiated to an average burnup of ∼ 85%235U. The presented data show a significant increase of the void fraction in the U-Mo alloy as the U-235 burnup rises from ∼ 40% up to ∼ 85%. The effect of irradiation test conditions and U-235 burnup were analyzed with regard to the formation of an interaction layer between the matrix and fuel particles as well as generation of porosity in the U-Mo alloy. Shown here are changes in distribution of U fission products as the U-235 burnup increases from ∼ 40% up to ∼ 85%.

235U Holdup Measurement Program in support of facility shutdown

International Nuclear Information System (INIS)

Thomason, R.S.; Griffin, J.C.; Lien, O.G.; McElroy, R.D.

1991-01-01

In 1989, the Department of Energy directed shutdown of an enriched uranium processing facility at Savannah River Site. As part of the shutdown requirements, deinventory and cleanout of process equipment and nondestructive measurement of the remaining 235 U holdup were required. The holdup measurements had safeguards, accountability, and nuclear criticality safety significance; therefore, a technically defensible and well-documented holdup measurement program was needed. Appropriate standards were fabricated, measurement techniques were selected, and an aggressive schedule was followed. Early in the program, offsite experts reviewed the measurement program, and their recommendations were adopted. Contact and far-field methods were used for most measurements, but some process equipment required special attention. All holdup measurements were documented, and each report was subjected to internal peer review. Some measured values were checked against values obtained by other methods; agreement was generally good

Isotopic analysis of uranium hexafluoride highly enriched in U-235

International Nuclear Information System (INIS)

Chaussy, L.; Boyer, R.

1968-01-01

Isotopic analysis of uranium in the form of the hexafluoride by mass-spectrometry gives gross results which are not very accurate. Using a linear interpolation method applied to two standards it is possible to correct for this inaccuracy as long as the isotopic concentrations are less than about 10 per cent in U-235. Above this level, the interpolations formula overestimates the results, especially if the enrichment of the analyzed samples is higher than 1.3 with respect to the standards. A formula is proposed for correcting the interpolation equation and for the extending its field of application to high values of the enrichment (≅2) and of the concentration. It is shown that by using this correction the results obtained have an accuracy which depends practically only on that of the standards, taking into account the dispersion in the measurements. (authors) [fr

Study of the variation with the energy of the fission cross-sections of 233U, 235U, 239Pu for the fast neutrons

International Nuclear Information System (INIS)

Szteinsznaider, D.; Naggiar, V.; Netter, F.

1955-01-01

This measurements have been done while taking the value of the fission cross-sections of 238 U as reference. The neutrons are produced by the reaction 7 Li(p,n) in the Van de Graaff generator of Saclay. The explored domain spreads from some tenths to 2000 keV. We find: for 239 Pu: σ f = 2,04 ± 0,12 barns, cross-section constant between 150 and 2000 keV, for 235 U: σ f = 1,15 ± 0,15 barns, cross-section constant between 700 and 1000 keV, for 233 U: σ f = 1,92 ± 0,25 barns, for neutrons of 850 keV. (authors) [fr

Are 0.1%-accurate gamma-ray assays possible for 235U solutions

International Nuclear Information System (INIS)

Parker, J.L.

1983-01-01

The factors influencing the accuracy of passive gamma-ray assay of uniform, homogeneous solution samples have been studied in some detail, particularly for the assay of 235 U in uranium solutions. Factors considered are the overall long-term electronic stability, the information losses caused by the rate-related electronic processes of pulse pileup and dead-time, and the self-attenuation of gamma rays within the samples. Both experimental and computational studies indicate that gamma-ray assay procedures for solution samples of moderate size (from approx. 10 to perhaps a few hundred milliliters) are now capable of accuracies approaching 0.1% in many practical cases

Investigation of neutronic behavior in a CANDU reactor with different (Am, Th, {sup 235}U)O{sub 2} fuel matrixes

Energy Technology Data Exchange (ETDEWEB)

Gholamzadeh, Z. [Talca Univ. (Chile). Dept. of Physics; Feghhi, S.A.H. [Shahid Beheshti Univ., Tehran (Iran, Islamic Republic of). Dept. of Radiation Application

2014-11-15

Recently thorium-based fuel matrixes are taken into consideration for nuclear waste incineration because of thorium proliferation resistance feature moreover its breeding or convertor ability in both thermal and fast reactors. In this work, neutronic influences of adding Am to (Th-{sup 235}U)O{sub 2} on effective delayed neutron fraction, reactivity coefficients and burn up of a fed CANDU core has been studied using MCNPX 2.6.0 computational code. Different atom fractions of Am have been introduced in the fuel matrix to evaluate its effects on neutronic parameters of the modeled core. The computational data show that adding 2% atom fraction of Am to thorium-based fuel matrix won't noticeably change reactivity coefficients in comparison with the fuel matrix containing 1% atom fraction of Am. The use of 2% atom fraction of Am resulted in a higher delayed neutron fraction. According to the obtained data, 32.85 GWd burn up of the higher Americium-containing fuel matrix resulted in 55.2%, 26.5%, 41.9% and 2.14% depletion of {sup 241}Am, {sup 243}Am, {sup 235}U and {sup 232}Th respectively. 132.8 kg of {sup 233}U fissile element is produced after the burn up time and the nuclear core multiplication factor increases in rate of 2390 pcm. The less americium-containing fuel matrix resulted in higher depletion of {sup 241/243}Am, {sup 235}U and {sup 232}Th while the nuclear core effective multiplication factor increases in rate of 5630 pcm after the burn up time with 9.8 kg additional {sup 233}U production.

Distribution of equilibrium burnup for an homogeneous core with fuel elements of slightly enriched uranium (0.85% U-235) at Atucha I nuclear power plant

International Nuclear Information System (INIS)

Sidelnik, J.I.; Perez, R.A.; Salom, G.F.

1987-01-01

At Atucha I, the present fuel management with natural uranium comprises three burnup areas and one irradiation path, sometimes performing four steps in the reactor core, according to the requirements. The discharge burnup is 6.0 Mw d/kg U for a waste reactivity of 6.5 m k and a heavy water purity of 99.75%. This is a preliminary study to obtain the distribution of equilibrium burnup of an homogeneous core with slightly enriched uranium (0.85% by weight U-235), using the time-averaged method implemented in the code PUMA and a representative model of one third of core and fixed rod position. It was found a strategy of three areas and two paths that agrees with the present limits of channel power and specific power in fuel rod. The discharge burnup obtained is 11.6 Mw d/kg U. This strategy is calculated with the same method and a full core representation model is used to verify the obtained results. (Author)

Monte Carlo cross section testing for thermal and intermediate 235U/238U critical assemblies, ENDF/B-V vs ENDF/B-VI

International Nuclear Information System (INIS)

Weinman, J.P.

1997-06-01

The purpose of this study is to investigate the eigenvalue sensitivity to changes in ENDF/B-V and ENDF/B-VI cross section data sets by comparing RACER vectorized Monte Carlo calculations for several thermal and intermediate spectrum critical experiments. Nineteen Oak Ridge and Rocky Flats thermal solution benchmark critical assemblies that span a range of hydrogen-to- 235 U (H/U) concentrations (2052 to 27.1) and above-thermal neutron leakage fractions (0.555 to 0.011) were analyzed. In addition, three intermediate spectrum critical assemblies (UH3-UR, UH3-NI, and HISS-HUG) were studied

Independent yields of Rb and Cs isotopes from thermal-neutron induced fission of /sup 235/U

Energy Technology Data Exchange (ETDEWEB)

Balestrini, S.J.; Decker, R.; Wollnik, H.; Wuensch, K.D.; Jung, G.; Koglin, E.; Siegert, G.

1979-12-01

The relative yields of Rb and Cs isotopes from thermal-neutron fission of /sup 235/U have been redetermined using the mass separator OSTIS, on-line at a neutron guide of the High-Flux Beam Reactor at the Institut Laue-Langevin, Grenoble, France. The separator ion source was a hot oven containing /sup 235/U in a graphite matrix. The neutron beam was pulsed. Alkali fission products diffused out of the graphite and were ionized, thus producing a stepwise increase in the analyzed ion beam proportional to the independent fission yield. The ion beam and the fissions in the source were monitored simultaneously. The diffusion of Rb and Cs from the source was exponential in time with half-lives ranging from 2.8 to 18 sec, depending upon the element and source temperature. The independent fission yields of Rb and Cs are normalized by equating their element yields to each other and to a value computed from the charge distributions observed with the recoil separator LOHENGRIN and well established mass yields. Fractional independent yields are deduced from the independent fission yields, and these compare very well with the EOZ model described by Wahl.

Photo-fission Product Yield Measurements at Eγ=13 MeV on 235U, 238U, and 239Pu

Science.gov (United States)

Tornow, W.; Bhike, M.; Finch, S. W.; Krishichayan, Fnu; Tonchev, A. P.

2016-09-01

We have measured Fission Product Yields (FPYs) in photo-fission of 235U, 238U, and 239Pu at TUNL's High-Intensity Gamma-ray Source (HI γS) using mono-energetic photons of Eγ = 13 MeV. Details of the experimental setup and analysis procedures will be discussed. Yields for approximately 20 fission products were determined. They are compared to neutron-induced FPYs of the same actinides at the equivalent excitation energies of the compound nuclear systems. In the future photo-fission data will be taken at Eγ = 8 . 0 and 10.5 MeV to find out whether photo-fission exhibits the same so far unexplained dependence of certain FPYs on the energy of the incident probe, as recently observed in neutron-induced fission, for example, for the important fission product 147Nd. Work supported by the U. S. Dept. of Energy, under Grant No. DE-FG02-97ER41033, and by the NNSA, Stewardship Science Academic Alliances Program, Grant No. DE-NA0001838 and the Lawrence Livermore, National Security, LLC under Contract No. DE-AC52-07NA27344.

Effective cross sections of U-235 and Au in a TRIGA-type reactor core

International Nuclear Information System (INIS)

Harasawa, S.; Auu, G.A.

1992-01-01

The dependence of effective cross sections of gold and uranium for neutron spectrum in Rikkyo University Reactor (TRIGA Mark- II, RUR) fuel cell was studied using computer calculations. The dependence of thermal neutron spectrum with temperature was also investigated. The effective cross section of gold in water of the fuel cell at 32degC was 90.3 barn and the fission cross section of U-235, 483 barn. These two values are similar to the cross sections for neutron energy of 0.034 eV. (author)

8-group relative delayed neutron yields for epithermal neutron induced fission of 235U and 239Pu

International Nuclear Information System (INIS)

Piksaikin, V.M.; Kazakov, L.E.; Isaev, S.G.; Korolev, G.G.; Roshchenko, V.A.; Tertychnyj, R.G

2002-01-01

An 8-group representation of relative delayed neutron yields was obtained for epithermal neutron induced fission of 235 U and 239 Pu. These data were compared with ENDF/B-VI data in terms of the average half- life of the delayed neutron precursors and on the basis of the dependence of reactivity on the asymptotic period. (author)

Measurements of Pu239:U235 fission ratio using foils at temperatures up to 400 deg. C

Energy Technology Data Exchange (ETDEWEB)

Carter, D H; Puckett, B J; Richards, A E [General Reactor Physics Division, Atomic Energy Establishment, Winfrith, Dorchester, Dorset (United Kingdom)

1964-05-15

The paper describes the use of activation foils for the measurement of Pu239:U235 fission ratios in subcritical lattices at temperatures up to 390 deg C. Counting techniques and the method of analysis of the results are described in detail and the results are compared with fission chamber measurements. (author) 4 refs., 6 figs., 7 tabs.

Integral parameters for the Godiva benchmark calculated by using theoretical and adjusted fission spectra of 235U

International Nuclear Information System (INIS)

Caldeira, A.D.

1987-05-01

The theoretical and adjusted Watt spectrum representations for 235 U are used as weighting functions to calculate K eff and θ f 28 /θ f 25 for the benchmark Godiva. The results obtained show that the values of K eff and θ f 28 /θ f 25 are not affected by spectrum form change. (author) [pt

Enzymatic reduction of U60 nanoclusters by Shewanella oneidensis MR-1

Energy Technology Data Exchange (ETDEWEB)

Yu, Qiang; Fein, Jeremy B. [Notre Dame Univ., IN (United States). Dept. of Civil and Environmental Engineering and Earth Sciences

2018-04-01

In this study, a series of reduction experiments were conducted using a representative uranyl peroxide nanocluster, U60 (K{sub 16}Li{sub 44}[UO{sub 2}(O{sub 2})OH]{sub 60}) and a bacterial species, Shewanella oneidensis MR-1, that is capable of enzymatic U(VI) reduction. U60 was reduced by S. oneidensis in the absence of O{sub 2}, but the reduction kinetics for U60 were significantly slower than was observed in this study for aqueous uranyl acetate, and were faster than was reported in previous studies for solid phase U(VI). Our results indicate that U60 aggregates bigger than 0.2 μm formed immediately upon mixing with the bacterial growth medium, and that these aggregates were gradually broken down during the process of reduction. Neither reduction nor dissolution of U60 was observed during 72 h of control experiments open to the atmosphere, indicating that the breakdown and dissolution of U60 aggregates is caused by the reduction of U60, and that S. oneidensis is capable of direct reduction of the U(VI) within the U60 nanoclusters, likely due to the adsorption of U60 aggregates onto bacterial cells. This study is first to show the reduction capacity of bacteria for uranyl peroxide nanoclusters, and the results yield a better understanding of the long term fate of uranium in environmental systems in which uranyl peroxide nanoclusters are present.

235U, 238U, 232Th, 40K and 137Cs activity concentrations in marine sediments along the northern coast of Oman Sea using high-resolution gamma-ray spectrometry

International Nuclear Information System (INIS)

Zare, Mohammad Reza; Mostajaboddavati, Mojtaba; Kamali, Mahdi; Abdi, Mohammad Reza; Mortazavi, Mohammad Seddigh

2012-01-01

The natural radioactivity levels in sediment samples of the northern coast of Oman Sea, covering the coastal strip from Hormoz canyon to Goatr seaport, as the first time has been determined. The results of measurements will serve as background reference level for Oman Sea coastlines. Sediments from 36 coastal and near shore locations were collected for analysis. Analysis on the collected samples were carried out to determine 235 U, 238 U, 232 Th, 40 K and 137 Cs using two high purity germanium detectors with 38.5% and 55% relative efficiencies. The concentration of 235 U, 238 U, 232 Th, 40 K and 137 Cs in sediment samples ranged between 1.01 and 2.87 Bq/kg, 11.83 and 22.68 Bq/kg, 10.7 and 25.02 Bq/kg, 222.89 and 535.07 Bq/kg and 0.14 and 2.8 Bq/kg, respectively. The radium equivalent activity was well below the defined limit of 370 Bq/kg. The external hazard indices were found to be less than 1, indicating a low dose.

Design study of a negative-ion based NBI system for JT-60U

International Nuclear Information System (INIS)

Akino, Noboru; Araki, Masanori; Ebisawa, Noboru

1994-03-01

A high energy negative-ion based NBI system for JT-60U has been designed. The objective of the NBI system is to demonstrate mega-ampere level NB current drive and plasma core heating in a reactor-grade high density plasma. This is the first negative-ion based NBI system in the world. The required specifications of the NBI system are; a beam energy of 500 keV, an injection power of 10 MW, a beam pulse duration of 10 sec with a duty cycle of 1/60 and a beam species of deuterium or hydrogen. The neutral beam power of 10 MW is injected tangentially using one beam-line with two large negative-ion sources. The construction of the NBI system has been started, and will be operational in 1996. (author)

Measurement of the fission cross-section ratio for 237Np/235U around 14 MeV neutron energies

International Nuclear Information System (INIS)

Desdin, L.; Szegedy, S.; Csikai, J.

1989-01-01

Fission cross-section ratio was determined for 237 Np/ 235 U around 14 MeV neutron energies with a back-to-back ionization chamber. Neutrons were produced by a 180 KV accelerator using T(d,n) 4 He reaction. No significant energy dependence was found in the cross section ratio

Measurements of the prompt neutron spectra in 233U, 235U, 239Pu thermal neutron fission in the energy range of 0.01-5 MeV and in 252Cf spontaneous fission in the energy range of 0.01-10 MeV

International Nuclear Information System (INIS)

Starostov, B.I.; Semenov, A.F.; Nefedov, V.N.

1978-01-01

The measurement results on the prompt neutron spectra in 233 U, 235 U, 239 Pu thermal neutron fission in the energy range of 0.01-5 MeV and in 252 Cf spontaneous fission in the energy range of 0.01-10 MeV are presented. The time-of-flight method was used. The exceeding of the spectra over the Maxwell distributions is observed at E 252 Cf neutron fission spectra. The spectra analysis was performed after normalization of the spectra and corresponding Maxwell distributions for one and the same area. In the range of 0.05-0.22 MeV the yield of 235 U + nsub(t) fission neutrons is approximately 8 and approximately 15 % greater than the yield of 252 Cf and 239 Pu + nsub(t) fission neutrons, respectively. In the range of 0.3-1.2 MeV the yield of 235 U + nsub(t) fission neutrons is 8 % greater than the fission neutron yield in case of 239 Pu + nsub(t) fission. The 235 U + nsub(t) and 233 U + nsub(t) fission neutron spectra do not differ from one another in the 0.05-0.6 MeV range

Protective effect of tea polyphenols against paracetamol-induced hepatotoxicity in mice is significantly correlated with cytochrome P450 suppression.

Science.gov (United States)

Chen, Xia; Sun, Chang-Kai; Han, Guo-Zhu; Peng, Jin-Yong; Li, Ying; Liu, Yan-Xia; Lv, Yuan-Yuan; Liu, Ke-Xin; Zhou, Qin; Sun, Hui-Jun

2009-04-21

To investigate the hepatoprotective activity of tea polyphenols (TP) and its relation with cytochrome P450 (CYP450) expression in mice. Hepatic CYP450 and CYPb(5) levels were measured by UV-spectrophotometry in mice 2 d after intraperitoneal TP (25, 50 and 100 mg/kg per day). Then the mice were intragastricly pre-treated with TP (100, 200 and 400 mg/kg per day) for six days before paracetamol (1000 mg/kg) was given. Their acute mortality was compared with that of control mice. The mice were pre-treated with TP (100, 200, and 400 mg/kg per day) for five days before paracetamol (500 mg/kg) was given. Hepatic CYP2E1 and CYP1A2 protein and mRNA expression levels were evaluated by Western blotting, immunohistochemical staining and transcriptase-polymerase chain reaction. The hepatic CYP450 and CYPb(5) levels in mice of TP-treated groups (100, 200 and 400 mg/kg per day) were decreased in a dose-dependent manner compared with those in the negative control mice. TP significantly attenuated the paracetamol-induced hepatic injury and dramatically reduced the mortality of paracetamol-treated mice. Furthermore, TP reduced CYP2E1 and CYP1A2 expression at both protein and mRNA levels in a dose-dependent manner. TP possess potential hepatoprotective properties and can suppress CYP450 expression.

Fission/milligram of 235U in BIG-10 Tests A, C, E, and B

International Nuclear Information System (INIS)

Gilliam, D.M.; Grundl, J.A.; Hansen, G.E.

1976-01-01

The entire series of dosimetry foil tests at BIG-10 (including the preliminary Test A, five fission foil set irradiations--Tests C, five non-fission foil set irradiations--Tests E, and five track-etch detector irradiations--Tests B) were monitored continuously by the NBS double fission chamber PP5 in the central test cavity. The accuracy of the absolute fission counting data (fissions/milligram of 235 U) is estimated to be 1.4% for Tests A, C, and E and 1.5% for Test B. Deposit mass assay uncertainties remain the dominant error

Short Lived Fission Product Yield Measurements in 235U, 238U and 239Pu

Science.gov (United States)

Silano, Jack; Tonchev, Anton; Tornow, Werner; Krishichayan, Fnu; Finch, Sean; Gooden, Matthew; Wilhelmy, Jerry

2017-09-01

Yields of short lived fission products (FPYs) with half lives of a few minutes to an hour contain a wealth of information about the fission process. Knowledge of short lived FPYs would contribute to existing data on longer lived FPY mass and charge distributions. Of particular interest are the relative yields between the ground states and isomeric states of FPYs since these isomeric ratios can be used to determine the angular momentum of the fragments. Over the past five years, a LLNL-TUNL-LANL collaboration has made precision measurements of FPYs from quasi-monoenergetic neutron induced fission of 235U, 238U and 239Pu. These efforts focused on longer lived FPYs, using a well characterized dual fission chamber and several days of neutron beam exposure. For the first time, this established technique will be applied to measuring short lived FPYs, with half lives of minutes to less than an hour. A feasibility study will be performed using irradiation times of < 1 hour, improving the sensitivity to short lived FPYs by limiting the buildup of long lived isotopes. Results from this exploratory study will be presented, and the implications for isomeric ratio measurements will be discussed. This work was performed under the auspices of US DOE by LLNL under Contract DE-AC52-07NA27344.

Operation and Development on the Positive-Ion Based Neutral Beam Injection System for JT-60 and JT-60U

International Nuclear Information System (INIS)

Kuriyama, M.; Akino, N.; Ebisawa, N.; Honda, A.; Itoh, T.; Kawai, M.; Mogaki, K.; Ohga, T.; Oohara, H.; Umeda, N.; Usui, K.; Yamamoto, M.; Yamamoto, T.; Matsuoka, M.

2002-01-01

The positive-ion based neutral beam injection (NBI) system for JT-60, which consists of 14 beamline units and has a beam energy of 70 to 100 keV, started operation in 1986 with hydrogen beams and injected a neutral beam power of 27 MW at 75 keV into the JT-60 plasma. In 1991, the NBI system was modified to be able to handle deuterium beams as part of the JT-60 upgrade modification. After executing some research and developments, deuterium beams of 40 MW at 95 keV were injected in 1996. As a result, NBI has contributed to the achievement of the highest performance plasmas, a DT-equivalent fusion power gain of 1.25 and a fusion triple product of 1.55 x 10 21 keVs/m 3 , in the world on JT-60U

The Prompt Fission Neutron Spectrum of 235U for Einc 0.7-5.0 MeV

Energy Technology Data Exchange (ETDEWEB)

Gomez, Jaime A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Devlin, Matthew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Haight, Robert Cameron [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); O' Donnell, John M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Lee, Hye Young [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mosby, Shea Morgan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Taddeucci, Terry Nicholas [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kelly, Keegan John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Fotiadis, Nikolaos [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Neudecker, Denise [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); White, Morgan Curtis [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Talou, Patrick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rising, Michael Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Solomon, Clell Jeffrey Jr. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Wu, Ching-Yen [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bucher, Brian Michael [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Buckner, Matthew Quinn [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Henderson, Roger Alan [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-03-23

The Chi-Nu experiment aims to accurately measure the prompt fission neutron spectrum (PFNS) for the major actinides. At the Los Alamos Neutron Science Center (LANSCE), fission can be induced using the white neutron source. Using a two arm time of flight (T.O.F) technique; Chi-Nu presents a preliminary result of the low energy component of the 235U PFNS measured using an array of 22-Lithium glass scintillators.

Photofission cross-section ratio measurement of {sup 235}U/{sup 238}U using monoenergetic photons in the energy range of 9.0–16.6 MeV

Energy Technology Data Exchange (ETDEWEB)

Krishichayan, E-mail: krishi@tunl.duke.edu [Department of Physics, Duke University, Durham, NC 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Bhike, Megha; Finch, S.W.; Howell, C.R. [Department of Physics, Duke University, Durham, NC 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States); Tonchev, A.P. [Nuclear and Chemical Sciences Division, Lawrence Livermore National Laboratory, Livermore, CA 94550 (United States); Tornow, W. [Department of Physics, Duke University, Durham, NC 27708 (United States); Triangle Universities Nuclear Laboratory, Durham, NC 27708 (United States)

2017-05-11

Photofission cross-section ratios of {sup 235}U and {sup 238}U have been measured using monoenergetic photon beams at the HIγS facility of TUNL. These measurements have been performed in small energy steps between 9.0 and 16.6 MeV using a dual-fission ionization chamber. Measured cross-section ratios are compared with the previous experimental data as well as with the recent evaluated nuclear data library ENDF.

Neutron induced fission cross sections for /sup 232/Th, /sup 235,238/U, /sup 237/Np and /sup 239/Pu from 1 to 400 MeV

Energy Technology Data Exchange (ETDEWEB)

Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

1988-01-01

Neutron-induced fission cross section ratios for samples of /sup 232/Th, /sup 235,238/U, /sup 237/Np and /sup 239/Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence up to 30 MeV. These data provided the shape of the /sup 235/U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known values were determined using the neutron fluence measured with a second proton recoil telescope. Cross section values for /sup 232/Th, /sup 238/U, /sup 237/Np, and /sup 239/Pu were computed from the ratio data using our values for /sup 235/U(n,f). In addition to providing new results at high neutron energies, these data resolve long standing discrepancies among different data sets. 1 ref., 1 fig.

Decay heat from products of 235U thermal fission by fast-response boil-off calorimetry

International Nuclear Information System (INIS)

Yarnell, J.L.; Bendt, P.J.

1977-09-01

A cryogenic boil-off calorimeter was used to measure the decay heat from the products of thermal-neutron-induced fission of 235 U. Data are presented for cooling times between 10 and 10 5 s following a 2 x 10 4 s irradiation at constant thermal-neutron flux. The experimental uncertainty (1 sigma) in these measurements was approximately 2 percent, except at the shortest cooling times where it rose to approximately 4 percent. The beta and gamma energy from an irradiated 235 U sample was absorbed in a thermally isolated 52-kg copper block that was held at 4 K by an internal liquid helium reservoir. The absorbed energy evaporated liquid helium from the reservoir and a hot-film anemometer flowmeter recorded the evolution rate of the boil-off gas. The decay heat was calculated from the gas-flow rate using the heat of vaporization of helium. The calorimeter had a thermal time constant of 0.85 s. The energy loss caused by gamma leakage from the absorber was less than or equal to 3 percent; a correction was made by Monte Carlo calculations based on experimentally determined gamma spectra. The data agree within the combined uncertainties with summation calculations using the ENDF/B-IV data base. The experimental data were combined with summation calculations to give the decay heat for infinite (10 13 s) irradiation

76 FR 72858 - Airworthiness Directives; The Boeing Company Model 737-100, -200, -200C, -300, -400, and -500...

Science.gov (United States)

2011-11-28

... Model 737-100, -200, -300, -400, and -500 series airplanes, a one-time detailed inspection is added to... Information Initial Compliance Time (i) For all Model 737-100, -200, -200C, -300, -400, and -500 series... by paragraph (r) of this AD. If any fastener is missing, before further flight, repair using a method...

Criticality Data for Spherical 235U, 239Pu, and 237Np Systems Reflector-Moderated by Low Capturing-Moderator Materials

International Nuclear Information System (INIS)

Loaiza, David J.; Stratton, William

2004-01-01

The critical dimensions of spherical systems moderated and reflected by low-capturing materials such as D 2 O, BeO, Be, and C were investigated. A parametric study of the critical mass of enriched uranium, plutonium, and neptunium is examined and tabulated. The results obtained expand on the understanding of reflector-moderated critical systems, and they show regions of unstable criticality for 235 U and 239 Pu reflected cores at intermediate densities. This instability is illustrated by calculations of the positive reactivity coefficient of volume expansion. The coefficient is positive, not negative, in the intermediate density region for 235 U and 239 Pu systems. For 237 Np cores reflected by the same moderator, the effect is negligible. The critical dimensions were calculated with the DANTSYS codes using the Hansen-Roach cross-section libraries. This study is both a summary of mostly unpublished calculations and new calculations. Experimental data for these configurations are extremely limited. These are examined in the text when applicable

Translating U-500R Randomized Clinical Trial Evidence to the Practice Setting: A Diabetes Educator/Expert Prescriber Team Approach.

Science.gov (United States)

Bergen, Paula M; Kruger, Davida F; Taylor, April D; Eid, Wael E; Bhan, Arti; Jackson, Jeffrey A

2017-06-01

Purpose The purpose of this article is to provide recommendations to the diabetes educator/expert prescriber team for the use of human regular U-500 insulin (U-500R) in patients with severely insulin-resistant type 2 diabetes, including its initiation and titration, by utilizing dosing charts and teaching materials translated from a recent U-500R clinical trial. Conclusions Clinically relevant recommendations and teaching materials for the optimal use and management of U-500R in clinical practice are provided based on the efficacy and safety results of and lessons learned from the U-500R clinical trial by Hood et al, current standards of practice, and the authors' clinical expertise. This trial was the first robustly powered, randomized, titration-to-target trial to compare twice-daily and three-times-daily U-500R dosing regimens. Modifications were made to the initiation and titration dosing algorithms used in this trial to simplify dosing strategies for the clinical setting and align with current glycemic targets recommended by the American Diabetes Association. Leveraging the expertise, resources, and patient interactions of the diabetes educator who can provide diabetes self-management education and support in collaboration with the multidisciplinary diabetes team is strongly recommended to ensure patients treated with U-500R receive the timely and comprehensive care required to safely and effectively use this highly concentrated insulin.

Average cross section measurements in U-235 fission neutron spectrum for some threshold reactions

International Nuclear Information System (INIS)

Maidana, N.L.

1993-01-01

The average cross section in the 235 U fission spectrum has been measured by the activation technique, for the following thresholds reactions: 115 In(n,n') 115m In, 232 Th(n,f) P.F., 46 , 47 , 48 Ti(n,p) 46,47 , 48 Sc, 55 Mn(n,2 n) 54 Mn, 51 V(n,α) 48 Sc, 90 Zr(n,2 n) 89 Zr, 93 Nb(n,2 n) 92m Nb, 58 Ni(n,2 n) 57 Ni, 24 Mg(n,p) 24 Na, 56 Fe(n,p) 56 Mn, 59 Co(n,α) 56 Mn and 63 Cu(n,α) 60 Co. The activation foils were irradiated close (∼ 4 mm) to the core of the IEA-R1 research reactor in the IPEN-CNEN/SP. The reactor was operated at 2 MW yielding a fast neutron flux around 5 x 10 12 n.cm -2 . s -1 . The neutron flux density was monitored by activation reactions with well known averaged cross sections and with effective thresholds above 1 MeV. The foil activities were measured in a calibrated HPGe spectrometer. The neutron spectrum has been calculated using the SAIPS unfolding system applied to the activation data. A detailed error analysis was performed using the covariance matrix methodology. The results were compared with those from other authors. (author)

Long Pulse Operation on NBI Systems for JT-60U

International Nuclear Information System (INIS)

Akino, N.; Ebisawa, N.; Honda, A.; Ikeda, Y.; Kawai, M.; Kazawa, M.; Mogaki, K.; Ohga, T.; Umeda, N.; Usui, K.; Yamamoto, T.; Grisham, L.

2005-01-01

In the neutral beam injection (NBI) system, an extension of the pulse duration up to 30 sec has been intended to study quasi-steady state plasma on JT-60U. The four positive-ion based (P-NBI) units, which tangentially inject neutral beam to plasma, were mainly modified on the electric power supplies and the beam limiters to extend the pulse duration up to 30 sec with 2 MW at 80 keV per each. The seven P-NBI units, each of which perpendicularly injects for 10 sec, were conducted to operate in series for the total pulse duration of 30 sec. The ion source of the negative-ion based (N-NBI) unit, whose target beam energy is 500 keV for 10 sec, was also modified to reduce the heat load of the grid for long pulse operation. The reduction of the re-ionization of the neutral beam in the beam drift duct was a key to achieve a long pulse injection. It was found that the pressure rise in the beam drift duct, which gives the re-ionization rate, depended on the temperature of the re-ionization plates during NBI injection. Up to now, it was attained successfully that the pulse duration of the tangential P-NBI unit was extended up to 30 sec. 310 MJ of the total integrated injection energy into JT-60U plasma was achieved, including the negative-ion based NBI operation for 17 sec at 366 keV

Studies of the Fission Integrals of U-{sup 235} and Pu-{sup 239} with Cadmium and Filters

Energy Technology Data Exchange (ETDEWEB)

Hellstrand, E

1965-04-15

The resonance fissions in U{sup 235} and Pu{sup 239} have been studied using cadmium and boron filters. Fission chambers were used as detectors and the experiments were performed in beam geometry. The neutron energy distribution in the beams transmitted through the different filters was determined with a fast chopper. From the cadmium filter, measurements the fission resonance integrals were determined. The values obtained were 278{+-}9 b for U{sup 235} and 301{+-}10 b for Pu{sup 239}; 0.5 eV < E < 1 MeV. Complementary Pu{sup 239} measurements were made in which the fission events were detected from the fission product activity in irradiated foils. Contrary to what has been reported elsewhere the value of the Pu{sup 239} resonance integral, found in this way, agreed well with that obtained from the fission chamber measurement. The experiments with the boron filters yielded results which, for the thin filter, agreed well with those calculated from the cross section data given in the Karlsruhe compilation. The discrepancy was larger for the thick filter but the values did not disagree outside the common limits of error.

Standard test method for analysis of urine for uranium-235 and uranium-238 isotopes by inductively coupled plasma-mass spectrometry

CERN Document Server

American Society for Testing and Materials. Philadelphia

2010-01-01

1.1 This test method covers the determination of the concentration of uranium-235 and uranium-238 in urine using Inductively Coupled Plasma-Mass Spectrometry. This test method can be used to support uranium facility bioassay programs. 1.2 This method detection limits for 235U and 238U are 6 ng/L. To meet the requirements of ANSI N13.30, the minimum detectable activity (MDA) of each radionuclide measured must be at least 0.1 pCi/L (0.0037 Bq/L). The MDA translates to 47 ng/L for 235U and 300 ng/L for 238U. Uranium– 234 cannot be determined at the MDA with this test method because of its low mass concentration level equivalent to 0.1 pCi/L. 1.3 The digestion and anion separation of urine may not be necessary when uranium concentrations of more than 100 ng/L are present. 1.4 Units—The values stated in picoCurie per liter units are to be regarded as standard. The values given in parentheses are mathematical conversions to SI units that are provided for information only and are not considered standard. 1....

Measurements of the {sup 235}U(n,f) cross section in the 3 to 30 MeV neutron energy region

Energy Technology Data Exchange (ETDEWEB)

Carlson, A.D.; Wasson, O.A. [National Institute of Standards and Technology, Gaithersburg, MD (United States); Lisowski, P.W. [Los Alamos National Lab., NM (United States)] [and others

1991-12-31

To improve the accuracy of the {sup 235}U(n,f) cross section, measurements have been made of this standard cross section at the target 4 facility at Los Alamos National Laboratory (LANL). The data were obtained at the 20-meter flight path of that facility. The fission reaction rate was determined with a fast parallel plate ionization chamber and the neutron fluence was measured with an annular proton recoil telescope. The measurements provide the shape of the {sup 235}U(n,f) cross section relative to the hydrogen scattering cross section for neutron energies from about 3 to 30 MeV neutron energy. The data have been normalized to the very accurately known value near 14 MeV. The results are in good agreement with the ENDF/B-VI evaluation up to about 15 MeV neutron energy. Above this energy differences as large as 5% are observed.

Pleistocene apparent ages by U-Pb isotope and U-series methods for uranium ore in Dakota Sandstone near Gallup, New Mexico

International Nuclear Information System (INIS)

Ludwig, K.R.; Szabo, B.J.; Granger, H.C.

1977-01-01

Radiometric dates of a high-grade uranium ore from the Hogback No. 4 mine in Dakota Sandstone near Gallup, N. Mex., indicate a late Pleistocene age of mineralization. The 206 Pb/ 238 U and 207 Pb/ 235 U apparent ages of about 70,000 y and 100,000 y, respectively, are discordant, but are in broad agreement with the discordant 230 Th/ 238 U and 230 Pa/ 235 U apparent ages of 130,000 y and 78,000 y, respectively. Although it is not clear how the analyzed sample relates to the main period of mineralization at this mine, these dates are consistent with previous age limits suggested for Dakota Sandstone uranium ores

Comparative studies for determining U-235/U-238 relation in solutions of natural and depleted uranium using gamma spectrometry and neutron activation analysis

International Nuclear Information System (INIS)

Cassorla F, V.; Valle M, L.; Pena V, L.

1988-01-01

Two experimental methods were developed for determining U-235/U-238 ratio in uranium solutions. The isotopic was measured by high resolution ratio gamma-ray spectrometry (G.S.) and neutron activation analysis (N.A.A.). The precision obtained was similar for both methods, but better sensitivity was obtained by N.A.A. The accuracy in both cases was stablished by comparison with samples previously analyzed by mass spectrometry, the results were satisfactory for both techniques. Studies involving the influence of the nitric acid concentration on the isotopic ratio measurement, also were done. In addition, computer programs for faster data reduction were developped, in the case of N.A.A. (author)

Inelastic scattering of 1-2.5 MeV neutrons by 235U and 238U nuclei

International Nuclear Information System (INIS)

Kornilov, N.V.; Kagalenko, A.B.; Baryba, V.Ya.; Balitskij, A.V.; Androsenko, A.A.; Androsenko, P.A.

1993-07-01

The inelastic scattering cross-sections of 1-2.5 MeV neutrons for 235 U and 238 0 nuclei were measured. A detailed description is given of the data processing procedures used, and the methods for determining the neutron flux in the sample. The Monte Carlo method was used to calculate the corrections for multiple neutron scattering and neutron flux attenuation in the sample. Pursuant to an analysis of the fission neutron spectra, we concluded that the systematic error level of the results is ± 3.27%. The results of these cross-section and spectrum measurements for inelastically scattered neutrons are compared with results from other sources and existing evaluations, the possible causes of the divergences for neutrons with an energy level of less than 1 MeV are analysed, and suggestions are put forward for future research work. (author)

Design study of a new P-NBI control system for 100-s injection in JT-60SA

International Nuclear Information System (INIS)

Honda, Atsushi; Okano, Fuminori; Shinozaki, Shinichi; Ooshima, Katsumi; Ikeda, Yoshitaka; Numazawa, Susumu

2007-03-01

The modification of the JT-60U to a fully superconducting coil tokamak, JT-60SA (Super Advanced), has been programmed as the satellite devise for the ITER (International Thermonuclear Experimental Reactor) and as the national centralized tokamak. The present positive-ion-based NBI system (P-NBI), which has been operated for 20 years and will be the main heating system on JT-60SA, is required to manage the long pulse injection extended from 30 s to 100 s at the power of 24 MW with 12 units. To realize such a requirement, the original control system handling more than 4000 digital data is to be fully remodeled. Design study of the new control system has been conducted from viewpoint of market availability, system extensibility, cost-effectiveness and independent development in programming. It has been concluded that a distributed control system using PLC (Programmable Logic Controller) could be applied to the large-scale control system for 100-s operations with satisfaction of the evaluation viewpoints. (author)

Experimental determination of nuclear reaction rates in 238U and 235U along of the radius of fuel pellets of the IPEN/MB-01 reactor

International Nuclear Information System (INIS)

Mura, Luis Felipe Liambos

2015-01-01

This research presents and consolidates an alternative methodology for determining nuclear reaction rates along the radial direction of the fuel pellets which does not require high neutron flux. This technique is based on irradiating a thin UO 2 disk inserted into a removable fuel rod at the IPEN/MB-01 reactor core. Several gamma spectrometry are performed after irradiation using a HPGe detector. Six lead collimators with different diameters are sequentially alternated during this process, thus, the nuclear radioactive capture which occurs in 238 U and the fissions which occur in both 235 U and 238 U are measured according to six different radial regions of the fuel disk. Geometric efficiency corrections due to the introduction of collimators in HPGe detection system are determined by MCNP-5 code. The fission rate measurements are performed using the 99 Mo. This radionuclide was studied and proved ideal for these measurements because it is formed in linear behavior in the reactor core, have a high yield fission and emits low-energy photons. Measurements were performed irradiating UO 2 disks (with 4.3% enrichment) in the central position of the IPEN/MB-01 core at 100 watts power level during one hour. Some measurements were performed using a cadmium glove wrapped in the fuel rod to determine the nuclear reaction rates in the epithermal energy range. The experimental results obtained are compared with nuclear reaction rate calculations by means of MCNP-5 with ENDF/B-VII.0 data library showing discrepancies of up to 9% in 238 U capture rates and 14% for U fission rates for epithermal energies. Uncertainties regarding the nuclear capture rates have maximum values of 4.5% and the fission rates has maximum values of 11.3%. (author)

Accurate measurement of the first excited nuclear state in 235U

Science.gov (United States)

Ponce, F.; Swanberg, E.; Burke, J.; Henderson, R.; Friedrich, S.

2018-05-01

We have used superconducting high-resolution radiation detectors to measure the energy level of metastable Um235 as 76.737 ± 0.018 eV. The Um235 isomer is created from the α decay of 239Pu and embedded directly into the detector. When the Um235 subsequently decays, the energy is fully contained within the detector and is independent of the decay mode or the chemical state of the uranium. The detector is calibrated using an energy comb from a pulsed UV laser. A comparable measurement of the metastable Thm229 nucleus would enable a laser search for the exact transition energy in 229Th-Thm229 as a step towards developing the first ever nuclear (baryonic) clock.

Delayed Fission Gamma-ray Characteristics of Th-232 U-233 U-235 U-238 and Pu-239

Energy Technology Data Exchange (ETDEWEB)

Lane, Taylor [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Parma, Edward J. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)

2015-08-01

Delayed fission gamma-rays play an important role in determining the time dependent ioniz- ing dose for experiments in the central irradiation cavity of the Annular Core Research Reactor (ACRR). Delayed gamma-rays are produced from both fission product decay and from acti- vation of materials in the core, such as cladding and support structures. Knowing both the delayed gamma-ray emission rate and the time-dependent gamma-ray energy spectrum is nec- essary in order to properly determine the dose contributions from delayed fission gamma-rays. This information is especially important when attempting to deconvolute the time-dependent neutron, prompt gamma-ray, and delayed gamma-ray contribution to the response of a diamond photo-conducting diode (PCD) or fission chamber in time frames of milliseconds to seconds following a reactor pulse. This work focused on investigating delayed gamma-ray character- istics produced from fission products from thermal, fast, and high energy fission of Th-232, U-233, U-235, U-238, and Pu-239. This work uses a modified version of CINDER2008, a transmutation code developed at Los Alamos National Laboratory, to model time and energy dependent photon characteristics due to fission. This modified code adds the capability to track photon-induced transmutations, photo-fission, and the subsequent radiation caused by fission products due to photo-fission. The data is compared against previous work done with SNL- modified CINDER2008 [ 1 ] and experimental data [ 2 , 3 ] and other published literature, includ- ing ENDF/B-VII.1 [ 4 ]. The ability to produce a high-fidelity (7,428 group) energy-dependent photon fluence at various times post-fission can improve the delayed photon characterization for radiation effects tests at research reactors, as well as other applications.

Experimental study of the lifetime and phase transition in neutron-rich Zr 98 ,100 ,102

Science.gov (United States)

Ansari, S.; Régis, J.-M.; Jolie, J.; Saed-Samii, N.; Warr, N.; Korten, W.; Zielińska, M.; Salsac, M.-D.; Blanc, A.; Jentschel, M.; Köster, U.; Mutti, P.; Soldner, T.; Simpson, G. S.; Drouet, F.; Vancraeyenest, A.; de France, G.; Clément, E.; Stezowski, O.; Ur, C. A.; Urban, W.; Regan, P. H.; Podolyák, Zs.; Larijani, C.; Townsley, C.; Carroll, R.; Wilson, E.; Mach, H.; Fraile, L. M.; Paziy, V.; Olaizola, B.; Vedia, V.; Bruce, A. M.; Roberts, O. J.; Smith, J. F.; Scheck, M.; Kröll, T.; Hartig, A.-L.; Ignatov, A.; Ilieva, S.; Lalkovski, S.; Mǎrginean, N.; Otsuka, T.; Shimizu, N.; Togashi, T.; Tsunoda, Y.

2017-11-01

Rapid shape changes are observed for neutron-rich nuclei with A around 100. In particular, a sudden onset of ground-state deformation is observed in the Zr and Sr isotopic chains at N = 60: Low-lying states in N ≤58 nuclei are nearly spherical, while those with N ≥60 have a rotational character. Nuclear lifetimes as short as a few picoseconds can be measured using fast-timing techniques with LaBr3(Ce) scintillators, yielding a key ingredient in the systematic study of the shape evolution in this region. We used neutron-induced fission of 241Pu and 235U to study lifetimes of excited states in fission fragments in the A ˜100 region with the EXILL-FATIMA array located at the PF1B cold neutron beam line at the Institut Laue-Langevin. In particular, we applied the generalized centroid difference method to deduce lifetimes of low-lying states for the nuclei 98Zr (N = 58), 100Zr, and 102Zr (N ≥60 ). The results are discussed in the context of the presumed phase transition in the Zr chain by comparing the experimental transition strengths with the theoretical calculations using the interacting boson model and the Monte Carlo shell model.

Determination of uranium isotopes (235U, 238U) and trace elements (Cd, Pb, Cu and As) in bottled drinking water by Icp-SFMS

International Nuclear Information System (INIS)

Lara A, N.; Hernandez M, H.; Romero G, E. T.; Kuri de la C, A.; Perez B, M. A.

2016-09-01

In the present work we propose an optimized method for the quantification of uranium isotopes ( 235 U, 2 38 U) and the elements Cd, Pb, Cu and As in bottled water for drinking at trace levels of concentration. Based on the multi-element detection capability, the high sensitivity and resolution that the Mass Spectrometry with Magnetic Sector with Inductively Coupled Plasma Source (Icp-SFMS) technique offers; the high, medium and low resolution analysis conditions for the elements under study were established and optimized using and Element 2/Xr equipment and the 23 multi-elemental Certified Reference Material (CRM). The analysis method was validated using the standard reference material Nist 1643d and CRM mono-elemental s as external standards for the quantification of the analytes. Samples, targets and CRM were acidified with 2% of HNO 3 and analyzed without pretreatment under the established analysis conditions. The results obtained show concentrations of 235 U, 238 U, 111 Cd, 208 Pb, 63 Cu and 75 As in the range of μg L -1 , the linearity obtained from the calibration curves for each element has correlation coefficients < 0.99 in all cases, the accuracy of the method in terms of percent relative standard deviation (RSD %) was less than 5%, the mean recovery rate of Nist 1643d ranged from 96.46% to 101.12%. The optimization of the method guarantees the stability and calibration of the equipment throughout the analysis, as well as the ability to resolve interferences. In conclusion, the method proposed using Icp-SFMS offers the advantages of being fast and simple for the multi-elemental analysis in water at trace levels, with low limits of quantification and detection, with good linearity, accuracy, precision and reproducibility to a degree of reliability of 95%. (Author)

49 CFR 450.13 - Granting of delegation.

Science.gov (United States)

2010-10-01

... 49 Transportation 6 2010-10-01 2010-10-01 false Granting of delegation. 450.13 Section 450.13... SECURITY SAFETY APPROVAL OF CARGO CONTAINERS GENERAL Procedure for Delegation to Approval Authorities § 450.13 Granting of delegation. (a) The Chief, Office of Operating and Environmental Standards (CG-522), U...

A nondestructive testing device for determining 235U enrichment in power reactor fuel elements

International Nuclear Information System (INIS)

Liu Lanhua; Liu Nangai

1990-07-01

The development and application of a nondestructive testing device are presented, which is used for determining the 235 U enrichment in the mixed fuel of fuel elements with UO 2 pellets. The testing efficiency is improved because the passive gamma ray method and a hole-bored NaI crystal and four channel multichannel analyzer are used. The false discrimination rate is reduced as the average comparing method is taken. This device is simple in structure and easy in operation. It has provided a new testing tool for the fuel elements production in China. This device has successfully been used in Qinshan Nuclear Power Plant in testing its fuel elements

Dicty_cDB: SLC450 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLC450 (Link to dictyBase) - - - Contig-U16382-1 SLC450Z (Link... to Original site) - - SLC450Z 416 - - - - Show SLC450 Library SL (Link to library) Clone ID SLC450 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC450Q.Seq.d/ Representative seq. ID SLC45...0Z (Link to Original site) Representative DNA sequence >SLC450 (SLC450Q) /CSM/SL/SLC4-C/SLC450Q.Seq.d/ XXXXX...cant alignments: (bits) Value SLC450 (SLC450Q) /CSM/SL/SLC4-C/SLC450Q.Seq.d/ 678 0.0 VFO858 (VFO858Q) /CSM/V

Fission fragment yields and total kinetic energy release in neutron-induced fission of235,238U,and239Pu

Science.gov (United States)

Tovesson, F.; Duke, D.; Geppert-Kleinrath, V.; Manning, B.; Mayorov, D.; Mosby, S.; Schmitt, K.

2018-03-01

Different aspects of the nuclear fission process have been studied at Los Alamos Neutron Science Center (LANSCE) using various instruments and experimental techniques. Properties of the fragments emitted in fission have been investigated using Frisch-grid ionization chambers, a Time Projection Chamber (TPC), and the SPIDER instrument which employs the 2v-2E method. These instruments and experimental techniques have been used to determine fission product mass yields, the energy dependent total kinetic energy (TKE) release, and anisotropy in neutron-induced fission of U-235, U-238 and Pu-239.

Determination of uranium isotopes ({sup 235}U, {sup 238}U) and trace elements (Cd, Pb, Cu and As) in bottled drinking water by Icp-SFMS; Determinacion de isotopos de uranio ({sup 235}U, {sup 238}U) y elementos traza (Cd, Pb, Cu y As) en agua embotellada para beber por ICP-SFMS

Energy Technology Data Exchange (ETDEWEB)

Lara A, N.; Hernandez M, H.; Romero G, E. T.; Kuri de la C, A.; Perez B, M. A., E-mail: nancy.lara@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

2016-09-15

In the present work we propose an optimized method for the quantification of uranium isotopes ({sup 235}U, 2{sup 38}U) and the elements Cd, Pb, Cu and As in bottled water for drinking at trace levels of concentration. Based on the multi-element detection capability, the high sensitivity and resolution that the Mass Spectrometry with Magnetic Sector with Inductively Coupled Plasma Source (Icp-SFMS) technique offers; the high, medium and low resolution analysis conditions for the elements under study were established and optimized using and Element 2/Xr equipment and the 23 multi-elemental Certified Reference Material (CRM). The analysis method was validated using the standard reference material Nist 1643d and CRM mono-elemental s as external standards for the quantification of the analytes. Samples, targets and CRM were acidified with 2% of HNO{sub 3} and analyzed without pretreatment under the established analysis conditions. The results obtained show concentrations of {sup 235}U, {sup 238}U, {sup 111}Cd, {sup 208}Pb, {sup 63}Cu and {sup 75}As in the range of μg L{sup -1}, the linearity obtained from the calibration curves for each element has correlation coefficients < 0.99 in all cases, the accuracy of the method in terms of percent relative standard deviation (RSD %) was less than 5%, the mean recovery rate of Nist 1643d ranged from 96.46% to 101.12%. The optimization of the method guarantees the stability and calibration of the equipment throughout the analysis, as well as the ability to resolve interferences. In conclusion, the method proposed using Icp-SFMS offers the advantages of being fast and simple for the multi-elemental analysis in water at trace levels, with low limits of quantification and detection, with good linearity, accuracy, precision and reproducibility to a degree of reliability of 95%. (Author)

The 235U prompt fission neutron spectrum measured by the Chi-Nu project at LANSCE

Directory of Open Access Journals (Sweden)

Gomez J.A.

2017-01-01

Full Text Available The Chi-Nu experiment aims to accurately measure the prompt fission neutron spectrum for the major actinides. At the Los Alamos Neutron Science Center (LANSCE, fission can be induced with neutrons ranging from 0.7 MeV and above. Using a two arm time-of-flight (TOF technique, the fission neutrons are measured in one of two arrays: a 22-6Li glass array for lower energies, or a 54-liquid scintillator array for outgoing energies of 0.5 MeV and greater. Presented here are the collaboration's preliminary efforts at measuring the 235U PFNS.

Estimation of covariances of {sup 16}O, {sup 23}Na, Fe, {sup 235}U, {sup 238}U and {sup 239}Pu neutron nuclear data in JENDL-3.2

Energy Technology Data Exchange (ETDEWEB)

Shibata, Keiichi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Nakajima, Yutaka; Kawano, Toshihiko; Oh, Soo-Youl; Matsunobu, Hiroyuki; Murata, Toru

1997-10-01

Covariances of nuclear data have been estimated for 6 nuclides contained in JENDL-3.2. The nuclides considered are {sup 16}O, {sup 23}Na, Fe, {sup 235}U, {sup 238}U, and {sup 239}Pu, which are regarded as important for the nuclear design study of fast reactors. The physical quantities for which covariances are deduced are cross sections, resolved and unresolved resonance parameters, and the first order Legendre-polynomial coefficient for the angular distribution of elastically scattered neutrons. As for {sup 235}U, covariances were obtained also for the average number of neutrons emitted in fission. The covariances were estimated by using the same methodology that had been used in the JENDL-3.2 evaluation in order to keep a consistency between mean values and their covariances. The least-squares fitting code GMA was used in estimating covariances for reactions of which JENDL-3.2 cross sections had been evaluated by taking account of measurements. In nuclear model calculations, the covariances were calculated by the KALMAN system. The covariance data obtained were compiled in the ENDF-6 format, and will be put into the JENDL-3.2 Covariance File which is one of JENDL special purpose files. (author). 193 refs.

The main conditions ensured problemless implementation of 235U high enriched fuel in Kozloduy NPP (Bulgaria) - WWER-1000 Units

International Nuclear Information System (INIS)

Dobrevski, I.; Zaharieva, N.; Minkova, K.; Michaylov, G.; Penev, P.; Gerchev, N.

2009-01-01

The collected water chemistry and radiochemistry data during the operation of the Kozloduy NPP Unit 5 for the period 2006-2009 (12-th, 13-th 14-th and 15-th fuel cycles) undoubtedly indicate for WWER-1000 Units (whose specific features are: Steam generators with austenitic stainless steel 08Cr18N10T tubing; Steam generators are with horizontal straight tubing and Fuel elements cladding material is Zr-1%Nb (Zr1Nb) alloy), that one realistic way for problemless implementation of 235 U high enriched fuel have been found. The main feature characteristics of this way are: Implementation of solid neutron burnable absorbers together with the dissolved in coolant neutron absorber - natural boric acid; Application of fuel cladding materials with enough corrosion resistance by the specific fuel cladding environment created by presence of SNB; Keeping of suitable coolant water chemistry which ensures low corrosion rates of core- and out-of-core- materials and limits in core (cladding) depositions and restricts out-of-core radioactivity buildup. The realization of this way in WWER-1000 Units in Kozloduy NPP was practically carried out through: 1) Implementation of Russian fuel assemblies TVSA which have as fuel cladding material E-110 alloy (Zr1Nb) with enough high corrosion resistance by presence of sub-cooled nucleate boiling (SNB) and use burnable absorber (Gd) integrated in the uranium-gadolinium (U-Gd 2 O 3 ) fuel (fuel rod with 5.0% Gd 2 O 3 ); 2) Development and implementation of water chemistry primary circuit guidelines, which require the relation between boric acid concentration and total alkalising agent concentrations to ensure coolant pH 300 = 7.0 - 7.2 values during the whole operation period. The above mentioned conditions by the passing of WWER-1000 Units in NPP Kozloduy to uranium fuel with 4.4% 235 U (TVSA fuel assemblies) practically ensured avoidance of the creation of the necessary conditions for AOA onset. The operational experience (2006-2009) of the

Feasibility study of {sup 235}U and {sup 239}Pu characterization in radioactive waste drums using neutron-induced fission delayed gamma rays

Energy Technology Data Exchange (ETDEWEB)

Nicol, T. [CEA, DEN, Cadarache, Nuclear Measurement Laboratory, F-13108 Saint-Paul-lez-Durance (France); FZJ, Institute of Energy and Climate Research – Nuclear Waste Management and Reactor Safety, Wilhelm-Johnen-Straße, d-52425 Jülich (Germany); Pérot, B., E-mail: bertrand.perot@cea.fr [CEA, DEN, Cadarache, Nuclear Measurement Laboratory, F-13108 Saint-Paul-lez-Durance (France); Carasco, C. [CEA, DEN, Cadarache, Nuclear Measurement Laboratory, F-13108 Saint-Paul-lez-Durance (France); Brackx, E. [CEA, DEN, Marcoule, Metallography and Chemical Analysis Laboratory, F-30207 Bagnols-sur-Cèze (France); Mariani, A.; Passard, C. [CEA, DEN, Cadarache, Nuclear Measurement Laboratory, F-13108 Saint-Paul-lez-Durance (France); Mauerhofer, E. [FZJ, Institute of Energy and Climate Research – Nuclear Waste Management and Reactor Safety, Wilhelm-Johnen-Straße, d-52425 Jülich (Germany); Collot, J. [Laboratoire de Physique Subatomique et de Cosmologie, Université Grenoble Alpes, CNRS/IN2P3 Grenoble (France)

2016-10-01

This paper reports a feasibility study of {sup 235}U and {sup 239}Pu characterization in 225 L bituminized waste drums or 200 L concrete waste drums, by detecting delayed fission gamma rays between the pulses of a deuterium-tritium neutron generator. The delayed gamma yields were first measured with bare samples of {sup 235}U and {sup 239}Pu in REGAIN, a facility dedicated to the assay of 118 L waste drums by Prompt Gamma Neutron Activation Analysis (PGNAA) at CEA Cadarache, France. Detectability in the waste drums is then assessed using the MCNPX model of MEDINA (Multi Element Detection based on Instrumental Neutron Activation), another PGNAA cell dedicated to 200 L drums at FZJ, Germany. For the bituminized waste drum, performances are severely hampered by the high gamma background due to {sup 137}Cs, which requires the use of collimator and shield to avoid electronics saturation, these elements being very penalizing for the detection of the weak delayed gamma signal. However, for lower activity concrete drums, detection limits range from 10 to 290 g of {sup 235}U or {sup 239}Pu, depending on the delayed gamma rays of interest. These detection limits have been determined by using MCNPX to calculate the delayed gamma useful signal, and by measuring the experimental gamma background in MEDINA with a 200 L concrete drum mock-up. The performances could be significantly improved by using a higher interrogating neutron emission and an optimized experimental setup, which would allow characterizing nuclear materials in a wide range of low and medium activity waste packages.

Fissility of actinide nuclei induced by 60-130 MeV photons

International Nuclear Information System (INIS)

Morcelle, Viviane; Tavares, Odilon A.P.

2004-06-01

Nuclear fissilities obtained from recent photofission reaction cross section measurements carried out at Saskatchewan Accelerator Laboratory (Saskatoon, Canada) in the energy range 60-130 MeV for 232 Th, 233 U, 235 U, 238 U, and 237 Np nuclei have been analysed in a systematic way. To this aim, a semiempirical approach has been developed based on the quasi-deuteron nuclear photoabsorption model followed by the process of competition between neutron evaporation and fission for the excited nucleus. The study reproduces satisfactorily well the increasing trend of nuclear fissility with parameter Z 2 =A. (author)

Analysis of photofission reactions of 235U, 238U, 232Th, 209Bi, natPb, 197Au, natPt, natW, 181Ta, and 27Al by photons of 69 MeV

International Nuclear Information System (INIS)

Paiva, Eduardo de

1997-04-01

Fission reactions induced in 235 U, 238 U, 232 Th, 209 Bi nat Pb, 197 Au, nat Pt, nat W, 181 Ta. and 27 Al nuclei by monochromatic photons of 69 MeV produced at the LADON facility of the Frascati National Laboratories (INFN-LNF, Frascati, Italy) have been analyzed on the basis of a simplified two-step model. In the first step of the reaction the incoming photon is considered to be absorbed by a neutron-proton pair ('quasi-deuteron') leading to excitation of the nucleus, followed, in the second step, by a mechanism of particle evaporation-fission competition for the excited residual nucleus. Estimates of nuclear fissility at 69 MeV show to be critically dependent on the parameter r (ratio of the level-density parameter at the fission saddle point to the level-density parameter of the residual nucleus after neutron evaporation), which can be determined in a semiempirical way from induced fission reaction data for various nuclei obtained at 60 - 80 MeV of excitation energy. Fissilities calculated by means of the simplified photofission reactions model are then compared with experimental data available in the literature. (author)

8 CFR 235.10 - U.S. Citizen Identification Card.

Science.gov (United States)

2010-01-01

... Section 235.10 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS INSPECTION... demands an opportunity to see and rebut the adverse evidence. Any rebuttal, explanation, or evidence... whom it was issued admits in a statement signed before an immigration officer that he or she is an...

Design, fabrication and test of double-wall vacuum vessel for JT-60U

International Nuclear Information System (INIS)

Uchikawa, Takashi; Ioki, Kimihiro; Ninomiya, Hiromasa.

1994-01-01

A double-wall vacuum vessel was designed and fabricated for JT-60U (an upgraded machine of JT-60), which has a plasma current up to 6 MA and a large plasma volume (100 m 3 ). A new concept of Inconel 625 all-welded structure was adopted to the vessel, that comprises an inner plate, square tubes and an outer plate. The vacuum vessel with a multi-arc D-shaped cross section was fabricated by using hot-sizing press. The electromagnetic and structural analysis has been performed for plasma disruption loads. Dynamic responses of the vessel were measured during plasma disruptions, and the observed displacement had a good agreement with the result of FEM analysis. (author)

Comparative Analysis of Structural Changes In U-Mo Dispersed Fuel of Full-Size Fuel Elements And Mini-Rods Irradiated In The MIR Reactor

Energy Technology Data Exchange (ETDEWEB)

Izhutov, Aleksey L.; Iakovlev, Valeriy V.; Novoselov, Andrey E. and others

2013-12-15

The paper summarizes the irradiation test and post-irradiation examination (PIE) data for the U-Mo low-enriched fuel that was irradiated in the MIR reactor under the RERTR Program. The PIE data were analyzed for both full-size fuel rods and mini-rods with atomized powder dispersed in Al matrix as well as with additions of 2%, 5% and 13% of silicon in the matrix and ZrN protective coating on the fuel particles. The full-size fuel rods were irradiated up to an average burnup of ∼ 60%{sup 235}U; the mini-rods were irradiated to an average burnup of ∼ 85%{sup 235}U. The presented data show a significant increase of the void fraction in the U-Mo alloy as the U-235 burnup rises from ∼ 40% up to ∼ 85%. The effect of irradiation test conditions and U-235 burnup were analyzed with regard to the formation of an interaction layer between the matrix and fuel particles as well as generation of porosity in the U-Mo alloy. Shown here are changes in distribution of U fission products as the U-235 burnup increases from ∼ 40% up to ∼ 85%.

Comparative Analysis of Structural Changes In U-Mo Dispersed Fuel of Full-Size Fuel Elements And Mini-Rods Irradiated In The MIR Reactor

International Nuclear Information System (INIS)

Izhutov, Aleksey L.; Iakovlev, Valeriy V.; Novoselov, Andrey E. and others

2013-01-01

The paper summarizes the irradiation test and post-irradiation examination (PIE) data for the U-Mo low-enriched fuel that was irradiated in the MIR reactor under the RERTR Program. The PIE data were analyzed for both full-size fuel rods and mini-rods with atomized powder dispersed in Al matrix as well as with additions of 2%, 5% and 13% of silicon in the matrix and ZrN protective coating on the fuel particles. The full-size fuel rods were irradiated up to an average burnup of ∼ 60% 235 U; the mini-rods were irradiated to an average burnup of ∼ 85% 235 U. The presented data show a significant increase of the void fraction in the U-Mo alloy as the U-235 burnup rises from ∼ 40% up to ∼ 85%. The effect of irradiation test conditions and U-235 burnup were analyzed with regard to the formation of an interaction layer between the matrix and fuel particles as well as generation of porosity in the U-Mo alloy. Shown here are changes in distribution of U fission products as the U-235 burnup increases from ∼ 40% up to ∼ 85%

11 CFR 100.11 - State (2 U.S.C. 431(12)).

Science.gov (United States)

2010-01-01

... 11 Federal Elections 1 2010-01-01 2010-01-01 false State (2 U.S.C. 431(12)). 100.11 Section 100.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) General Definitions § 100.11 State (2 U.S.C. 431(12)). State means each State of the United States, the District of...

Criticality benchmark results for the ENDF60 library with MCNP trademark

International Nuclear Information System (INIS)

Keen, N.D.; Frankle, S.C.; MacFarlane, R.E.

1995-01-01

The continuous-energy neutron data library ENDF60, for use with the Monte Carlo N-Particle radiation transport code MCNP4A, was released in the fall of 1994. The ENDF60 library is comprised of 124 nuclide data files based on the ENDF/B-VI (B-VI) evaluations through Release 2. Fifty-two percent of these B-VI evaluations are translations from ENDF/B-V (B-V). The remaining forty-eight percent are new evaluations which have sometimes changed significantly. Among these changes are greatly increased use of isotopic evaluations, more extensive resonance-parameter evaluations, and energy-angle correlated distributions for secondary particles. In particular, the upper energy limit for the resolved resonance region of 235 U, 238 U and 239 Pu has been extended from 0.082, 4.0, and 0.301 keV to 2..25, 10.0, and 2.5 keV respectively. As regulatory oversight has advanced and performing critical experiments has become more difficult, there has been an increased reliance on computational methods. For the criticality safety community, the performance of the combined transport code and data library is of interest. The purpose of this abstract is to provide benchmarking results to aid the user in determining the best data library for their application

Conversion from insulin glargine U-100 to insulin glargine U-300 or insulin degludec and the impact on dosage requirements.

Science.gov (United States)

Pearson, Scott M; Trujillo, Jennifer M

2018-04-01

We wanted to determine whether basal insulin requirements change when patients transition from insulin glargine U-100 (Gla-100) to insulin glargine U-300 (Gla-300) or insulin degludec. This study involved subjects seen in the University of Colorado Health Endocrine Clinic who were transitioned from Gla-100 to either Gla-300 ( n = 95) or insulin degludec ( n = 39). The primary outcome was the difference between baseline Gla-100 dose and dose of Gla-300 or insulin degludec prescribed after first follow-up visit within 1-12 months. Secondary outcomes included changes in glycemic control and empiric dose conversion from Gla-100 to Gla-300 or insulin degludec on the day of transition. Wilcoxon rank sum tests evaluated changes in insulin doses, and paired t tests assessed changes in glycemic control using GraphPad statistical software. Median daily basal insulin dose increased for individuals transitioned from Gla-100 to Gla-300 from 30 [19-60 interquartile range (IQR)] units at baseline to 34.5 (19-70 IQR) units after follow up ( p = 0.01). For patients transitioned to insulin degludec, dose changes from baseline to follow up were not significantly different ( p = 0.56). At the time of transition, the prescribed dose of Gla-300 or insulin degludec did not significantly differ from the previous dose of Gla-100 ( p = 0.73 and 0.28, respectively), indicating that empiric dose adjustments were not routinely prescribed. Patients who transitioned from Gla-100 to Gla-300 had increased basal insulin requirements between visits, while basal insulin requirements for those transitioned from Gla-100 to insulin degludec were not significantly different.

Measurement of the neutron-induced fission cross section of 237Np relative to 235U from 0.02 to 30 MeV

International Nuclear Information System (INIS)

Behrens, J.W.; Magana, J.W.; Browne, J.C.

1977-01-01

The 237 Np/ 235 U fission cross section ratio has been measured from 0.02 to 30 MeV. Using the threshold method, a value of 1.294 +- 0.019 is obtained for the average cross section ratio in the interval from 1.75 to 4.00 MeV

A state-of-the-art passive gamma-ray assay system

International Nuclear Information System (INIS)

Sampson, T.E.; Parker, J.L.; Cowder, L.R.; Kern, E.A.; Garcia, D.L.; Ensslin, N.

1987-01-01

We report details of the development of a high-accuracy, high-precision system for the non-destructive assay of 235 U in solution. The system can measure samples with concentrations ranging from 0.0001 to 500 g 235 U/l using 200-ml samples at low concentrations, 30-ml samples at high concentrations, and 1000-s measurement times. The accuracy and precision goals of 0.1% were essentially attained for concentrations above 100 g/l. This at-line system, designed for a production plant environment, represents a significant improvement in the state of the art

{sup 5}He ternary fission yields of {sup 252}Cf and {sup 235}U(n,f)

Energy Technology Data Exchange (ETDEWEB)

Hwang, J. K. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Ramayya, A. V. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Hamilton, J. H. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Beyer, C. J. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Kormicki, J. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Zhang, X. Q. [Department of Physics, Vanderbilt University, Nashville, Tennessee 37235 (United States); Rodin, A. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation); Formichev, A. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation); Kliman, J. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation); Krupa, L. [Flerov Laboratory for Nuclear Reactions, Joint Institute for Nuclear Research, Dubna, Russia (Russian Federation)] (and others)

2000-04-01

The relative {sup 4}He and {sup 5}He ternary fission yields were determined from a careful analysis of the energy distribution of {alpha} spectra from a new measurement with a {sup 252}Cf source and from published data on {sup 252}Cf and {sup 235}U(n,f). The kinetic energies of the {sup 5}He and {sup 4}He ternary particles were found to be approximately 11 and 16 MeV, respectively. {sup 5}He particles contribute 10-20 % to the total alpha yield with the remainder originating from {sup 4}He accompanied fission. (c) 2000 The American Physical Society.

Experiments to determine the rate of beta energy release following fission of Pu239 andU235 in a fast reactor

International Nuclear Information System (INIS)

Murphy, M.F.; Taylor, W.H.; Sweet, D.W.; March, M.R.

1979-02-01

Measurements have been made of the rate of beta energy release from Pu239 and U235 fission fragments over a period of 107 seconds following a 105 second irradiation in the zero-power fast reactor Zebra. Results are compared with predictions using the UKFPDD-1 decay data file and two different sets of fission product yield data. (author)

Safe Sleep for Babies PSA (:60)

Centers for Disease Control (CDC) Podcasts

This 60 second public service announcement is based on the January 2018 CDC Vital Signs report. Every year, there are about 3,500 sleep-related deaths among U.S. babies. Learn how to create a safe sleep environment for babies.

The measurement of tripartition alpha particle low energy spectrum in 235U fission induced by thermal neutrons

International Nuclear Information System (INIS)

El Hage Sleiman, F.

1980-01-01

The energy spectrum of the α particles emitted in the thermal neutron induced fission of 235 U was measured from 11.5 MeV down to 2 MeV using the parabola mass spectrometer Lohengrin at the ILL high flux reactor. A Monte Carlo program, that simulates the α particle motion to the spectrometer, has been developed. Numerical results of Monte Carlo calculations for differents values of parameter are reported. The overall energy spectrum is slightly asymmetric at low energy. The possible reasons for the existence of this asymmetry are discussed [fr

Recent results of JT-60U ICRF antenna operation

International Nuclear Information System (INIS)

Fujii, T.; Saigusa, M.; Kimura, H.

1994-01-01

Ion cyclotron range of frequencies (ICRF) heating is one of attractive plasma heating methods for reactor grade tokamaks, because it is quite effective in the wide ranges of plasma density and temperature. An antenna which should inject high power into plasma has been developed intensively because the heating efficiency and the coupling properties depend on its design. The antenna was operated at a small antenna-plasma gap in the JT-60 in out of phase mode, which showed the high heating efficiency to obtain high loading resistance, and similarly to other tokamaks. However, in order to reduce heat load to the antenna from plasma, a wide gap is required in reactor grade tokamaks such as ITER, in which the gap is designed to be 0.15 m in CDA. Two new antennas were fabricated for the JT-60U, which were designed to obtain high loading resistance at a wide gap for (π,0) phasing. The JT-60U ICRF heating system is explained. Also the JT-60U antenna is described. Antenna conditioning has been conducted well in the initial operation period. The phasing mode was set at (π,0) phasing, in which high heating efficiency is expected. The procedure is explained. The coupling and radiation loss properties during ICRF heating are reported. The JT-60U ICRF antennas were conditioned quickly with about 70 shots. The maximum coupled power was 6.4 MW for (π,0) phasing, and the power density was 6.1 MW/m 2 . (K.I.)

Plate impact experiments on DC745U cooled to ~ -60 °C

Energy Technology Data Exchange (ETDEWEB)

Gustavsen, Richard L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Dattelbaum, Dana M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Bartram, Brian Douglas [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Gibson, Lloyd Lee [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Jones, Justin Daniel [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics; Goodbody, Austin Bernard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Shock and Detonation Physics

2016-08-11

Using gas-gun driven plate impact experiments, we have measured the U_S - u_p Hugoniot of the silicone elastomer DC745U cooled to -60 °C. In summary, the initial density changes from p₀ (23°C) = 1.312 ± 0.010 g/cm³ to p₀ (-60°C) = 1.447 ± 0.011 g/cm³. The linear U_S - u_p Hugoniot changes from U_S = 1.62 + 1.74u_p km/s at +23°C, to U_S = 2.03 ± 0.06 + (2.03 ± 0.06) u_p km/s at -60°C. DC745U, therefore is much stiffer at -60°C than at +23°C, probably due to the crystallization that occurs at ~ -50°C. Caveats/deficiencies: 1) This report does not provide an adequate pedigree of the DC745U used. 2) References to unpublished room temperature shock compression data on the elastomer are inadequate. 3) The report has not been fact checked by a DC745 subject matter expert.

Employing the Management Internal Control Toolset (MICT) Across the Enterprise

Science.gov (United States)

2012-06-16

He announced: We would like the wing to inspect units according to the Exemplary Conduct Law, Title 10 U.S. Code 8583 , that requires all commanders...to day operations. 4.50 4.50 5.00 0.55 0.00 Wing PM Before 2.00 1.00 1.00 1.41 N/A Wing PM After we also created a  ISO  9000 based internal auditing

Remedial Investigation/Feasibility Study, Operable Unit 5, Elmendorf AFB, Anchorage, Alaska. Volume 2. Text and Appendices A - J

Science.gov (United States)

1994-03-04

hitting abandoned paper sheathed copper wire telephone cable at 4.2’. Boring moved. No discernible floating product. 35.0 . 40.0 45.0 50.0 55.0 - jPROJECT...0.60 U N/C Magnesium, Mg 14.3 U 14.3 U N/C Manganese, Mn 0.80 U 0.80 U N/C Mercury, Hg 0.10 U 0.10 U N/C Nikel , Ni 7.7 U 7.7 U N/C Potassium, K 191 U

Structural evolution of a uranyl peroxide nano-cage fullerene: U60, at elevated pressures

Science.gov (United States)

Turner, K. M.; Lin, Y.; Zhang, F.; McGrail, B.; Burns, P. C.; Mao, W. L.; Ewing, R. C.

2015-12-01

U60 is a uranyl peroxide nano-cage that adopts a highly symmetric fullerene topology; it is topologically identical to C60. Several studies on the aqueous-phase of U60 clusters, [UO2(O2)(OH)]6060-, have shown its persistence in complex solutions and over lengthy time scales. Peroxide enhances corrosion of nuclear fuel in a reactor accident-uranyl peroxides often form near contaminated sites. U60 (Fm-3) crystallizes with approximate formula: Li68K12(OH)20[UO2(O2)(OH)]60(H2O)310. Here, we have used the diamond anvil cell (DAC) to examine U60 to understand the stability of this cluster at high pressures. We used a symmetric DAC with 300 μm culet diamonds and two different pressure-transmitting media: a mixture of methanol+ethanol and silicone oil. Using a combination of in situ Raman spectroscopy and synchrotron XRD, and electrospray ionization mass spectroscopy (ESI-MS) ex situ, we have determined the pressure-induced evolution of U60. Crystalline U60 undergoes an irreversible phase transition to a tetragonal structure at 4.1 GPa, and irreversibly amorphizes at 13 GPa. The amorphous phase likely consists of clusters of U60. Above 15 GPa, the U60 cluster is irreversibly destroyed. ESI-MS shows that this phase consists of species that likely have between 10-20 uranium atoms. Raman spectroscopy complements the diffraction measurements. U60 shows two dominant vibrational modes: a symmetric stretch of the uranyl U-O triple bond (810 cm-1), and a symmetric stretch of the U-O2-U peroxide bond (820 cm-1). As pressure is increased, these modes shift to higher wavenumbers, and overlap at 4 GPa. At 15 GPa, their intensity decreases below detection. These experiments reveal several novel behaviors including a new phase of U60. Notably, the amorphization of U60 occurs before the collapse of its cluster topology. This is different from the behavior of solvated C60 at high pressure, which maintains a hcp structure up to 30 GPa, while the clusters disorder. These results suggest

42 CFR 137.410 - For the purposes of section 110 of the Act [25 U.S.C. 450m-1] does the term contract include...

Science.gov (United States)

2010-10-01

....C. 450m-1] does the term contract include compacts, funding agreements, and construction project... the term contract include compacts, funding agreements, and construction project agreements entered into under Title V? Yes, for the purposes of section 110 of the Act [25 U.S.C. 450m-1] the term...

Experimental measurements of U60 nanocluster stability in aqueous solution

Science.gov (United States)

Flynn, Shannon L.; Szymanowski, Jennifer E. S.; Gao, Yunyi; Liu, Tianbo; Burns, Peter C.; Fein, Jeremy B.

2015-05-01

In this study, the aqueous behavior of isolated U60 nanoclusters (K16Li25[UO2(O2)OH]60)-19 was studied under several pH conditions and nanocluster concentrations to determine if the nanoclusters exhibit solid phase buffering behavior or if they exhibit behavior more like aqueous complexes. U60 is a cage cluster consisting of 60 (UO2)(O2)2(OH)2 uranyl polyhedral which share OH and O2 groups with their neighboring uranyl polyhedral, resulting in negatively charged cage clusters whose charge is at least partially offset by K+ and Li+ in the aqueous phase. Batch experiments to monitor nanocluster stability were conducted for 16 days at pH 7.5, 8.0 and 8.5 at nanocluster suspension concentrations of 1.4, 2.8 and 6.0 g/L. The aqueous concentrations of U, Li, and K, determined after 10 kDa molecular weight filtration, achieved steady-state with the nanoclusters within 24 h. The steady-state aqueous U, Li, and K concentrations were independent of solution pH, however they increased with increasing nanocluster concentration, indicating that the nanoclusters do not buffer the aqueous activities as a bulk solid phase would, but exhibit behavior that is more characteristic of dissolved aqueous complexes. The ion activity product (I.A.P.) value was calculated using two approaches: (1) treating the nanoclusters as a solid phase with an activity of one, and (2) treating the nanoclusters as aqueous complexes with a non-unit activity equal to their concentration in solution. The I.A.P. values that were calculated with non-unit activity for the nanoclusters exhibited significantly less variation as a function of nanocluster concentration compared to the I.A.P. values calculated with a nanocluster activity of one. The results yield a calculated log dissociation constant for the U60 nanoclusters of 9.2 + 0.2/-0.3 (1σ). Our findings provide a better understanding of the thermodynamic stability and behavior of U60 nanoclusters in aqueous systems, and can be used to estimate the

Evaluation of Total Daily Dose and Glycemic Control for Patients on U-500 Insulin Admitted to the Hospital

Science.gov (United States)

2016-05-20

regular insulin has significantly increased in recent years. These patients are severely insulin resistant requiring high doses of insulin to achieve...on U-500 Insulin Admitted to the Hospital presented at SURF Conference, San Antonio, TX 20 May 201 6 with MDWI 41-108, and has been assigned local...59th CSPG/SGVU) C.201 4 . I 52d PROTOCOL TITLE Evaluation of Total Dai ly Dose and Glycemic Control for Patients on U-500 Insulin Admitted to the

Fission-product energy release for times following thermal-neutron fission of 235U between 2 and 14000 seconds

International Nuclear Information System (INIS)

Dickens, J.K.; Emery, J.F.; Love, T.A.; McConnell, J.W.; Northcutt, K.J.; Peelle, R.W.; Weaver, H.

1977-10-01

Fission-product decay energy-releases rates were measured for thermal-neutron fission of 235 U. Samples of mass 1 to 10 μg were irradiated for 1 to 100 sec by use of the fast pneumatic-tube facility at the Oak Ridge Research Reactor. The resulting beta- and gamma-ray emissions were counted for times-after-fission between 2 and 14,000 seconds. The data were obtained for beta and gamma rays separately as spectral distributions, N(E/sub γ/) vs E/sub γ/ and N(E/sub beta/) vs E/sub β/. For the gamma-ray data the spectra were obtained by using a NaI detector, while for the beta-ray data the spectra were obtained by using an NE-110 detector with an anticoincidence mantle. The raw data were unfolded to provide spectral distributions of modest resolution. These were integrated over E/sub γ/ and E/sub β/ to provide total yield and energy integrals as a function of time after fission. Results are low compared to the present 1973 ANS Decay-heat standard. A complete description of the experimental apparatus and data-reduction techniques is presented. The final integral data are given in tabular and graphical form and are compared with published data. 41 figures, 13 tables

Critical experiments with 4.31 wt % 235U-enriched UO2 rods in highly borated water lattices

International Nuclear Information System (INIS)

Durst, B.M.; Bierman, S.R.; Clayton, E.D.

1982-08-01

A series of critical experiments were performed with 4.31 wt % 235 U enriched UO 2 fuel rods immersed in water containing various concentrations of boron ranging up to 2.55 g/l. The boron was added in the form of boric acid (H 3 BO 3 ). Critical experimental data were obtained for two different lattice pitches wherein the water-to-uranium oxide volume ratios were 1.59 and 1.09. The experiments provide benchmarks on heavily borated systems for use in validating calculational techniques employed in analyzing fuel shipping casks and spent fuel storage systems that may utilize boron for criticality control

Fuel cycle cost, reactor physics and fuel manufacturing considerations for Erbia-bearing PWR fuel with > 5 wt% U-235 content

Energy Technology Data Exchange (ETDEWEB)

Franceschini, F.; Lahoda, E. J.; Kucukboyaci, V. N. [Westinghouse Electric Co. LLC, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

2012-07-01

The efforts to reduce fuel cycle cost have driven LWR fuel close to the licensed limit in fuel fissile content, 5.0 wt% U-235 enrichment, and the acceptable duty on current Zr-based cladding. An increase in the fuel enrichment beyond the 5 wt% limit, while certainly possible, entails costly investment in infrastructure and licensing. As a possible way to offset some of these costs, the addition of small amounts of Erbia to the UO{sub 2} powder with >5 wt% U-235 has been proposed, so that its initial reactivity is reduced to that of licensed fuel and most modifications to the existing facilities and equipment could be avoided. This paper discusses the potentialities of such a fuel on the US market from a vendor's perspective. An analysis of the in-core behavior and fuel cycle performance of a typical 4-loop PWR with 18 and 24-month operating cycles has been conducted, with the aim of quantifying the potential economic advantage and other operational benefits of this concept. Subsequently, the implications on fuel manufacturing and storage are discussed. While this concept has certainly good potential, a compelling case for its short-term introduction as PWR fuel for the US market could not be determined. (authors)

Standard specification for uranium hexafluoride enriched to less than 5 % 235U

CERN Document Server

American Society for Testing and Materials. Philadelphia

2010-01-01

1.1 This specification covers nuclear grade uranium hexafluoride (UF6) that either has been processed through an enrichment plant, or has been produced by the blending of Highly Enriched Uranium with other uranium to obtain uranium of any 235U concentration below 5 % and that is intended for fuel fabrication. The objectives of this specification are twofold: (1) To define the impurity and uranium isotope limits for Enriched Commercial Grade UF6 so that, with respect to fuel design and manufacture, it is essentially equivalent to enriched uranium made from natural UF6; and (2) To define limits for Enriched Reprocessed UF6 to be expected if Reprocessed UF6 is to be enriched without dilution with Commercial Natural UF6. For such UF6, special provisions, not defined herein, may be needed to ensure fuel performance and to protect the work force, process equipment, and the environment. 1.2 This specification is intended to provide the nuclear industry with a standard for enriched UF6 that is to be used in the pro...

Measurement of 235U enrichment in UF6 by passive gamma spectrometry

International Nuclear Information System (INIS)

Sawai, Hideo; Ochiai, Ken-ichi; Kaya, Akira

1979-01-01

For the assay of UF 6 , a single-channel analyzer (SCA) system of a passive gamma spectrometer has been developed. Basic measuring conditions were studied: such as the effects of sample density and heterogeneity and the effects of cylinder material and wall thickness. Called ''enrichment analyzer'', the system is operated to carry out the measurement and calculation of 235 U enrichment by a directive of the program in a calculator. The resulting data are available in real time output. Measurements were carried out in two modes: ''all way'' mode which measured in the rotation of the cylinder and the up-and-down motion of the detector, and ''spot'' mode which measured at one point on the cylinder. The average accuracy was about 1.8% in case of the former, and 3.2% in case of the latter. It was shown that the ''all way'' mode is preferable, but the ''spot'' mode is also necessary for the assay of large cylinders such as 30 A type. (J.P.N.)

Energy dependence of the neutron multiplicity P/sub nu/ in fast neutron induced fission of /sup 235,238/U and 239Pu

International Nuclear Information System (INIS)

Zucker, M.S.; Holden, N.E.

1986-01-01

Certain applications require knowledge of the higher moments of the neutron multiplicity probability. It can be shown that the second factorial moment is proportional to the fission rate in the sample, and that the third factorial moment can be of use in disentangling spontaneous fission from induced fission. Using a source of unpublished work in which neutron multiplicities were derived for the fast neutron induced fission of U-235, U-238, and Pu-239, the multiplicity probability has been calculated as a function of neutron energy for the energy range 0 to 10 MeV

Effect of low-dose ritonavir (100 mg twice daily) on the activity of cytochrome P450 2D6 in healthy volunteers

NARCIS (Netherlands)

Aarnoutse, Rob E; Kleinnijenhuis, Johanneke; Koopmans, Peter P; Touw, Daan J; Wieling, Jaap; Hekster, Yechiel A; Burger, David M

2005-01-01

OBJECTIVE: In the treatment of human immunodeficiency virus infection, the protease inhibitor ritonavir is used in a low dose (100 mg twice daily) to inhibit cytochrome P450 (CYP) 3A4 and thereby increase plasma concentrations of coadministered protease inhibitors. When applied in a therapeutic dose

Effect of low-dose ritonavir (100 mg twice daily) on the activity of cytochrome P450 2D6 in healthy volunteers.

NARCIS (Netherlands)

Aarnoutse, R.E.; Kleinnijenhuis, J.; Koopmans †, P.P.; Touw, D.J.; Wieling, J.; Hekster, Y.A.; Burger, D.M.

2005-01-01

OBJECTIVE: In the treatment of human immunodeficiency virus infection, the protease inhibitor ritonavir is used in a low dose (100 mg twice daily) to inhibit cytochrome P450 (CYP) 3A4 and thereby increase plasma concentrations of coadministered protease inhibitors. When applied in a therapeutic dose

Disruption Studies in JT-60U

International Nuclear Information System (INIS)

Kawano, Y.; Yoshino, R.; Neyatani, Y.; Nakamura, Y.; Tokuda, S.; Tamai, H.

2002-01-01

Intensive studies on the physics of disruptions and developments of avoidance/mitigation methods of disruption-related phenomena have being carried out in JT-60U. The characteristics of the disruption sequence were well understood from the observation of the relationship between the heat pulse onto divertor plates during thermal quench and the impurity influx into the plasma, which determined the speed of the following current quench. A fast shutdown was first demonstrated by injecting impurity ice pellets to the plasma and intensively reducing the heat flux on first wall. The halo current and its toroidal asymmetry were precisely measured, and the halo current database was made for ITER in a wide parameter range. It was found that TPF x I h /I p0 was 0.52 at the maximum in a large tokamak like the JT-60U, whereas the higher factor of 0.75 had been observed in medium-sized tokamaks such as Alcator C-Mod and ASDEX-Upgrade. The vertical displacement event (VDE) at the start of the current quench was carefully investigated, and the neutral point where the VDE hardly occurs was discovered. MHD simulations clarified the onset mechanisms of the VDE, in which the eddy current effect of the up-down asymmetric resistive shell was essential. The real-time Z j measurement was improved for avoiding VDEs during slow current quench, and plasma-wall interaction was avoided by a well-optimized plasma equilibrium control. Magnetic fluctuations that were spontaneously generated at the disruption and/or enhanced by the externally applied helical field have been shown to avoid the generation of runaway electrons. Numerical analysis clarified an adequate rate of collisionless loss of runaway electrons in turbulent magnetic fields, which was consistent with the avoidance of runaway electron generation by magnetic fluctuations observed in JT-60U. Once generated, runaway electrons were suppressed when the safety factor at the plasma surface was reduced to 3 or 2

Evaluation of the neutron cross sections of 235U in the thermal energy region. Final report

International Nuclear Information System (INIS)

Leonard, B.R. Jr.; Kottwitz, D.A.; Thompson, J.K.

1976-02-01

The objective of this work has been to improve the knowledge of the thermal cross sections of the fissile nuclei as a step toward providing a standard data base for the nuclear industry. The methodology uses a form of the Adler-Adler multilevel-fission theory and Breit-Wigner multilevel-scattering theory. It incorporates these theories in a general nonlinear least-squares (LSQ) fitting program SIGLEARNThe analysis methodology in this work was applied to the thermal data on 235 U. A reference data file has been developed which includes most of the known data of interest. The first important result of this work is the assessment of the shape uncertainties of the partial cross sections. The results of our studies lead to the following values and error estimates for 235 U g factors in a thermal (20.44 0 C) energy spectrum: g/sub f/ = 0.97751 (+-0.11%); g/sub γ/ = 0.98230 (+-0.14%). A second important result of this study is the development of a recommended set of 2200 m/s (0.0253 eV) values of the parameters and the probable range of further adjustment which might be made. The analysis also provides the result of a common interpretation of energy-dependent absolute cross-section data of different measurements to yield a consistent set of experimental 0.0253 eV values with rigorous error estimates. It also provides normalization factors for relative fission and capture cross sections on a common basis with rigorous error estimates. The results of these analyses provide a basis for deciding what new measurements would be most beneficial. The most important of these would be improved direct capture data in the thermal region

Measurement of the ROT effect in the neutron induced fission of 235U in the 0.3 eV resonance at a hot source of polarized neutrons

Science.gov (United States)

Kopatch, Yuri; Novitsky, Vadim; Ahmadov, Gadir; Gagarsky, Alexei; Berikov, Daniyar; Danilyan, Gevorg; Hutanu, Vladimir; Klenke, Jens; Masalovich, Sergey

2018-03-01

The TRI and ROT asymmetries in fission of heavy nuclei have been extensively studied during more than a decade. The effects were first discovered in the ternary fission in a series of experiments performed at the ILL reactor (Grenoble) by a collaboration of Russian and European institutes, and were carefully measured for a number of fissioning nuclei. Later on, the ROT effect has been observed in the emission of prompt gamma rays and neutrons in fission of 235U and 233U, although its value was an order of magnitude smaller than in the α-particle emission from ternary fission. All experiments performed so far are done with cold polarized neutrons, what assumes a mixture of several spin states, the weights of these states being not well known. The present paper describes the first attempt to get "clean" data by performing the measurement of gamma and neutron asymmetries in an isolated resonance of 235U at the POLI instrument of the FRM2 reactor in Garching.

Identification of a cytochrome P450 gene in the earthworm Eisenia fetida and its mRNA expression under enrofloxacin stress.

Science.gov (United States)

Li, Yinsheng; Zhao, Chun; Lu, Xiaoxu; Ai, Xiaojie; Qiu, Jiangping

2018-04-15

Cytochrome P450 (CYP450) enzymes are a family of hemoproteins primarily responsible for detoxification functions. Earthworms have been used as a bioindicator of soil pollution in numerous studies, but no CYP450 gene has so far been cloned. RT-PCR and RACE-PCR were employed to construct and sequence the CYP450 gene DNA from the extracted mRNA in the earthworm Eisenia fetida. The cloned gene (EW1) has an open reading frame of 477bp. The 3'-terminal region contained both the consensus and the signature sequences characteristic of CYP450. It was closely related to the CYP450 gene from the flatworm genus Opisthorchis felineus with 87% homology. The predicted structure of the putative protein was 97% homologous to human CYP450 family 27. This gene has been deposited in GenBank (accession no. KM881474). Earthworms (E. fetida) were then exposed to 1, 10, 100, and 500mgkg -1 enrofloxacin in soils to explore the mRNA expression by real time qPCR. The effect of enrofloxacin on mRNA expression levels of EW1 exhibited a marked hormesis pattern across the enrofloxacin dose range tested. This is believed to be the first reported CYP450 gene in earthworms, with reference value for molecular studies on detoxification processes in earthworms. Copyright © 2017 Elsevier Inc. All rights reserved.

Development of U6Fe-Al dispersions for the use of LEU in research and test reactors

International Nuclear Information System (INIS)

Nazare, S.

1983-01-01

For some time now, efforts are being made to develop fuel dispersions that would permit the use of low (approx. 20% 235-U) enriched uranium (LEU) instead of the currently used highly (approx. 93% 235-U) enriched uranium (HEU) in research and test reactors. Since penalties in the performance of the reactor have to be avoided, the 235-U content in the dispersion has at least to be retained at current levels. On account of their high U-densities, the major development effort has been focussed on the uranium silicides (U 3 Si, U 3 Si(Al), and U 3 Si 2 -based dispersions). With silicides as dispersants, it is possible to fabricate fuel element plates with U-densities in the dispersion of about 6.0 gU/cm 3 . In comparison to the silicides, the U 6 Fe-phase offers several advantages namely: higher U-density (approx. 17.0 gU/cm 3 ); relative ease of formation compared to U 3 Si; possible advantages with regard to reprocessing of the spent fuel due to the absence of silicon. The studies outlined here were performed with a view to investigating the preparation, reaction behavior and dimensional stability after heat treatment of U 6 Fe-Al dispersions

Development of U6Fe-Al dispersions for the use of LEU in research and test reactors

International Nuclear Information System (INIS)

Nazare, S.

1983-01-01

For some time now, efforts are being made to develop fuel dispersions that would permit the use of low (∼ 20% 235-U) enriched uranium (LEU) instead of the currently used highly (∼ 93% 235-U) enriched uranium (HEU) in research and test reactors. Since penalties in the performance of the reactor have to be avoided, the 235-U content in the dispersion has at least to be retained at current levels. On account of their high U-densities, the major development effort has been focussed on the uranium silicides [U 3 Si, U 3 Si(Al), and U 3 Si 2 - based dispersions. With silicides as dispersants, it is possible to fabricate fuel element plates with U-densities in the dispersion of about 6.0 g U/cm 3 . In comparison to the silicides, the U 6 Fe-phase offers several advantages namely: - higher U-density (∼ 17.0 g U/cm 3 ); - relative ease of formation compared to U 3 Si; - possible advantages with regard to reprocessing of the spent fuel due to the absence of silicon. The studies outlined here were therefore performed with a view to investigating the preparation, reaction behaviour and dimensional stability after heat treatment of U 6 Fe-Al dispersions

Ion-induced swelling of ODS ferritic alloy MA957 tubing to 500 dpa

Energy Technology Data Exchange (ETDEWEB)

Toloczko, M.B., E-mail: mychailo.toloczko@pnnl.gov [Pacific Northwest National Laboratory, Richland, WA 99354 (United States); Garner, F.A. [Radiation Effects Consulting, Richland, WA 99354 (United States); Voyevodin, V.N.; Bryk, V.V.; Borodin, O.V.; Mel’nychenko, V.V.; Kalchenko, A.S. [Kharkov Institute of Physics and Technology, Kharkov (Ukraine)

2014-10-15

In order to study the potential swelling behavior of the ODS ferritic alloy MA957 at very high dpa levels, specimens were prepared from pressurized tubes that were unirradiated archives of tubes previously irradiated in FFTF to doses as high as 110 dpa. These unirradiated specimens were irradiated with 1.8 MeV Cr{sup +} ions to doses ranging from 100 to 500 dpa and examined by transmission electron microscopy. No co-injection of helium or hydrogen was employed. It was shown that compared to several tempered ferritic/martensitic steels irradiated in the same facility, these tubes were rather resistant to void swelling, reaching a maximum value of only 4.5% at 500 dpa and 450 °C. In this fine-grained material, the distribution of swelling was strongly influenced by the presence of void denuded zones along the grain boundaries.

HEU age determination by the activity ratio {sup 227}Th/{sup 235}U

Energy Technology Data Exchange (ETDEWEB)

Li, Junjie; Zeng, Lina; Wu, Jian; Zheng, Chun; Li, Jiansheng, E-mail: lastljj@hotmail.com

2014-02-15

It is important to measure the age of a highly enriched uranium (HEU) assembly for authentication of the material in the frame of arms control inspections. A new non-destructive gamma spectrometric method for HEU age-dating is reported. This method relies on measuring the daughter/parent activity ratio {sup 227}Th/{sup 235}U by high-resolution gamma spectrometry. Only a narrow gamma range of energy of uranium from 230 keV to 242 keV will be used for analysis. The relative efficiency of every characteristic gamma ray changes in a small range because it has a near energy, which makes the results more accurate in theory. It provides a quick and reliable method for HEU age determination. Several gamma spectra of the same HEU assembly have been measured with different conditions (gain settings, distance and measurement time). When a branching ratio of 12.6% was chosen for the 235.96 keV line of {sup 227}Th, we obtained the activity ratios of (5.61 ± 0.40) × 10{sup −4}, (5.17 ± 0.39) × 10{sup −4}, (5.26 ± 0.39) × 10{sup −4}, (5.10 ± 0.35) × 10{sup −4}, (5.50 ± 0.44) × 10{sup −4} and (5.47 ± 0.42) × 10{sup −4}, respectively. These ratios correspond to ages of 52.2 ± 2.4 years, 49.7 ± 2.3 years, 50.1 ± 2.3 years, 49.3 ± 2.2 years, 51.6 ± 2.5 years and 51.5 ± 2.4 years, respectively, which are consistent with the known age of this material and the results of the U–Bi method.

Review of JT-60U experimental results in 1997

International Nuclear Information System (INIS)

Adachi, H.; Akasaka, H.; Akino, N.

1998-08-01

The JT-60U experiments in 1997 focused mainly on the steady-state tokamak research with the newly installed W-shaped pumped divertor and the negative ion based neutral beam (NNB) in addition to the existing profile and shape control techniques developed in JT-60U. In particular, the research on divertor physics was accelerated under the new divertor system with many of fine diagnostics: Detachment characteristics, pumping control, impurity control, recycling characteristics, etc. in the W-shaped divertor were investigated in detail. The main purpose of confinement and stability studies in 1997 was to improve steadiness of high confinement plasmas with the new divertor. Researches progressed also for the formation conditions of the internal and the surface transport barriers in the high-β p mode, the reversed shear mode and the H-mode. Toward the advanced feedback controls of multiple parameters, the JT-60U started new feedback controls of central line density and divertor neutral gas pressure in addition to the existing controls of off-axis line density, radiation power and neutron production rate. The JT-60U team also carefully studied characteristics of halo current during disruptions. Optimization of NNB operation progressed steadily and injection power increased up to 4.2MW. The NNB-driven current was identified directly from the internal magnetic measurement and driven current profile was confirmed to be consistent with the ACCOME calculation. The current profile control with LHCD successfully sustained the internal transport barrier in reversed shear plasmas. Continuous TAE modes were observed with NNB for the first time as beam-driven TAE modes. (J.P.N.)

Review of JT-60U experimental results in 1997

Energy Technology Data Exchange (ETDEWEB)

Adachi, H.; Akasaka, H.; Akino, N. [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment] [and others

1998-08-01

The JT-60U experiments in 1997 focused mainly on the steady-state tokamak research with the newly installed W-shaped pumped divertor and the negative ion based neutral beam (NNB) in addition to the existing profile and shape control techniques developed in JT-60U. In particular, the research on divertor physics was accelerated under the new divertor system with many of fine diagnostics: Detachment characteristics, pumping control, impurity control, recycling characteristics, etc. in the W-shaped divertor were investigated in detail. The main purpose of confinement and stability studies in 1997 was to improve steadiness of high confinement plasmas with the new divertor. Researches progressed also for the formation conditions of the internal and the surface transport barriers in the high-{beta}{sub p} mode, the reversed shear mode and the H-mode. Toward the advanced feedback controls of multiple parameters, the JT-60U started new feedback controls of central line density and divertor neutral gas pressure in addition to the existing controls of off-axis line density, radiation power and neutron production rate. The JT-60U team also carefully studied characteristics of halo current during disruptions. Optimization of NNB operation progressed steadily and injection power increased up to 4.2MW. The NNB-driven current was identified directly from the internal magnetic measurement and driven current profile was confirmed to be consistent with the ACCOME calculation. The current profile control with LHCD successfully sustained the internal transport barrier in reversed shear plasmas. Continuous TAE modes were observed with NNB for the first time as beam-driven TAE modes. (J.P.N.)

Distinct 238U/235U ratios and REE patterns in plutonic and volcanic angrites: Geochronologic implications and evidence for U isotope fractionation during magmatic processes

Science.gov (United States)

Tissot, François L. H.; Dauphas, Nicolas; Grove, Timothy L.

2017-09-01

Angrites are differentiated meteorites that formed between 4 and 11 Myr after Solar System formation, when several short-lived nuclides (e.g., 26Al-26Mg, 53Mn-53Cr, 182Hf-182W) were still alive. As such, angrites are prime anchors to tie the relative chronology inferred from these short-lived radionuclides to the absolute Pb-Pb clock. The discovery of variable U isotopic composition (at the sub-permil level) calls for a revision of Pb-Pb ages calculated using an ;assumed; constant 238U/235U ratio (i.e., Pb-Pb ages published before 2009-2010). In this paper, we report high-precision U isotope measurement for six angrite samples (NWA 4590, NWA 4801, NWA 6291, Angra dos Reis, D'Orbigny, and Sahara 99555) using multi-collector inductively coupled plasma mass-spectrometry and the IRMM-3636 U double-spike. The age corrections range from -0.17 to -1.20 Myr depending on the samples. After correction, concordance between the revised Pb-Pb and Hf-W and Mn-Cr ages of plutonic and quenched angrites is good, and the initial (53Mn/55Mn)0 ratio in the Early Solar System (ESS) is recalculated as being (7 ± 1) × 10-6 at the formation of the Solar System (the error bar incorporates uncertainty in the absolute age of Calcium, Aluminum-rich inclusions - CAIs). An uncertainty remains as to whether the Al-Mg and Pb-Pb systems agree in large part due to uncertainties in the Pb-Pb age of CAIs. A systematic difference is found in the U isotopic compositions of quenched and plutonic angrites of +0.17‰. A difference is also found between the rare earth element (REE) patterns of these two angrite subgroups. The δ238U values are consistent with fractionation during magmatic evolution of the angrite parent melt. Stable U isotope fractionation due to a change in the coordination environment of U during incorporation into pyroxene could be responsible for such a fractionation. In this context, Pb-Pb ages derived from pyroxenes fraction should be corrected using the U isotope composition

TRANSPARENCY: Tracking Uranium under the U.S./Russian HEU Purchase Agreement

International Nuclear Information System (INIS)

Benton, J B; Decman, D J; Leich, D A

2005-01-01

By the end of August, 2005, the Russia Federation delivered to the United States (U.S.) more than 7,000 metric tons (MT) of low enriched uranium (LEU) containing approximately 46 million SWU and 75,000 MT of natural uranium. This uranium was blended down from weapons-grade (nominally enriched to 90% 235 U) highly enriched uranium (HEU) under the 1993 HEU Purchase Agreement that provides for the blend down of 500 MT HEU into LEU for use as fuel in commercial nuclear reactors. The HEU Transparency Program, under the National Nuclear Security Administration (NNSA), monitored the conversion and blending of the more than 250 MT HEU used to produce this LEU. The HEU represents more than half of the 500 MT HEU scheduled to be blended down through the year 2013 and is equivalent to the elimination of more than 10,000 nuclear devices. The HEU Transparency Program has made considerable progress in its mission to develop and implement transparency measures necessary to assure that Russian HEU extracted from dismantled Russian nuclear weapons is blended down into LEU for delivery to the United States. U.S. monitor observations include the inventory of inprocess containers, observation of plant operations, nondestructive assay measurements to determine 235 U enrichment, as well as the examination of Material Control and Accountability (MC and A) documents. During 2005, HEU Transparency Program personnel will conduct 24 Special Monitoring Visits (SMVs) to four Russian uranium processing plants, in addition to staffing a Transparency Monitoring Office (TMO) at one Russian site

Analysis of dependence of fission cross section and angular anisotropy of the 235U fission fragment escape induced by neutrons of intermediate energies (epsilon < or approximately200 keV) on target nucleus orientation

International Nuclear Information System (INIS)

Barabanov, A.L.

1985-01-01

Experimental data on dependence of fission cross section Σsub(f) (epsilon) and angular anisotropy W(epsilon, 0 deg)/W(epsilon, 90 deg) of sup(235)U fission fragment escape by neutrons with energy epsilon=100 and 200 keV on orientation of target nuclei are analyzed. 235 U (Isup(πsub(0))=7/2sup(-)) nuclei were orientated at the expense of interaction of quadrupole nucleus momenta with nonuniform electric field of uranyl-rubidium nitrate crystal at crystal cooling to T=0.2 K. The analysis was carried out with three different sets of permeability factors T(epsilon). Results of the analysis weakly depend on T(epsilon) choice. It is shown that a large number of adjusting parameters (six fissionabilities γsup(f)(Jsup(π), epsilon) and six momenta sub(Jsup(π))) permit to described experimental data on Σsub(f)(epsilon) and W(epsilon, 0 deg)/W(epsilon, 90 deg), obtained at epsilon=200 keV by introducing essential dependence of γsup(f)(Jsup(π), epsilon) and sub(Jsup(π)) on Jsup(π). Estimations of fission cross sections Σsub(f)(epsilon) and angular distribution W(epsilon, n vector) up to T approximately equal to 0.01 K in two geometries of the experiment: the orientation axis is parallel and perpendicular to momentum direction p vector of incident neutrons, are conducted

R-matrix analysis of 235U neutron transmission and cross sections in the energy range 0 to 2.25 keV

International Nuclear Information System (INIS)

Leal, L.C.; Derrien, H.; Larson, N.M.; Wright, R.Q.

1997-11-01

This document describes a new R-matrix analysis of 235 U cross section data in the energy range from 0 to 2,250 eV. The analysis was performed with the computer code SAMMY, that has recently been updated to permit, for the first time, inclusion of both differential and integral data within the analysis process. Fourteen differential data sets and six integral quantities were used in this evaluation: two measurements of fission plus capture, one of fission plus absorption, six of fission alone, two of transmission, and one of eta, plus standard values of thermal cross sections for fission, capture, and scattering, and of K1 and the Westcott g-factors for both fission and absorption. An excellent representation was obtained for the high-resolution transmission, fission, and capture cross-section data as well as for the integral quantities. The result is a single set of resonance parameters spanning the entire range up to 2,250 eV, a decided improvement over the present ENDF/VI evaluation, in which eleven discrete resonance parameter sets are required to cover that same energy range. This new evaluation is expected to greatly improve predictability of the criticality safety margins for nuclear systems in which 235 U is present

Measurements of neutron-induced capture and fission reactions on $^{235}$ U: cross sections and ${\\alpha}$ ratios, photon strength functions and prompt ${\\gamma}$-ray from fission

CERN Multimedia

We propose to measure the neutron-induced capture cross section of the fissile isotope $^{235}$U using a fission tagging set-up. This new set-up has been tested successfully in 2010 and combines the n_TOF 4${\\pi}$ Total Absorption Calorimeter (TAC) with MicroMegas (MGAS) fission detectors. It has been proven that such a combination of detectors allows distinguishing with very good reliability the electromagnetic cascades from the capture reactions from dominant ${\\gamma}$-ray background coming from the fission reactions. The accurate discrimination of the fission background is the main challenge in the neutron capture cross section measurements of fissile isotopes. The main results from the measurement will be the associated capture cross section and ${\\alpha}$ ratio in the resolved (0.3-2250 eV) and unresolved (2.25-30 keV) resonance regions. According to the international benchmarks and as it is mentioned in the NEA High Priority Request List (HPRL), the 235U(n,${\\gamma}$) cross section is of utmost impo...

48 CFR 235.006-70 - Manufacturing Technology Program.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Manufacturing Technology... CONTRACTING 235.006-70 Manufacturing Technology Program. In accordance with 10 U.S.C. 2521(d), for acquisitions under the Manufacturing Technology Program— (a) Award all contracts using competitive procedures...

Measurement of Fission Fragment Angular Distributions for 14 N+ 232 Th and 11 B+ 235 U at Near-Barrier Energies

International Nuclear Information System (INIS)

Behera, B.R.; Jena, S.; Satapathy, M.; Ison, V.V.; Kailas, S.; Chatterjee, A.; Shrivastava, A.; Mahata, K.; Satpathy, L.; Basu, P.; Roy, S.; Sharan, M.; Chatterjee, M.L; Datta, S.K.

2000-01-01

Fission fragment angular distributions of heavy-ion induced fission in actinide nuclei at near-barrier energies show anomalous fragment anisotropies. At above barrier energies entrance channel dependence is a probable cause and explanation in terms of pre-equilibrium fission and the critical mass asymmetry parameter (Businaro-Gallone) has been tried. Target deformation and ground state spin also seem to influence the measured anisotropy. To understand the extent of importance of some or all of these features, we performed a set of experiments where (i) entrance channel dependence (ii) mass asymmetry on the two sides of Businaro-Gallone and (iii) different ground state spins are present. The channels chosen are 14 N+ 232 Th and 11 B+ 235 U. Experiments were done using the Pelletron accelerators at NSC, New Delhi and BARC-TIFR, Bombay. Compound nucleus populated in both cases is 246 Bk. 232 Th has ground state spin zero and 235 U has spin 7/2. Fragment anisotropies have been measured from 10-15 % above barrier to 10 % below barrier at similar excitation energy (around 40 MeV to 58 MeV). The mean square angular momentum is matched at least at one energy. Results indicate that when both excitation energy and angular momentum are matched, there are differences in the measured values of fission anisotropies. This implies entrance channel dependence consistent with the expectation of pre-equilibrium fission model. (authors)

Preliminary study for the transport of the fuel rods of U235 enriched to 1.8 per cent

International Nuclear Information System (INIS)

Cardenas, H.; Perez, A.

1998-01-01

Transport of 1,8% U235 enriched fuel rods needs both the evaluation of the radiological risk and considerations about criticality aspects. Issues as diverse production characteristics, storage facilities in the source of origin an economical aspects have to be added to the radiological and nuclear considerations. Transport of those rods through national territory must comply with the Argentine Regulatory authority's regulations, based on the Safety Series No. 6, (ed. 1985) -as amended 1990- IAEA. Safety criteria are exposed, taking into account the amount of material to be transported, container characteristics, packaging type and expedition conditions. (author)

Accomplishment of JT-60U disassembly work dealing with radioactive components

International Nuclear Information System (INIS)

Ikeda, Yoshitaka

2015-01-01

The upgrade of the JT-60U to the superconducting tokamak 'JT-60SA' has been carried out to contribute the early realization of fusion energy by addressing key physics issues relevant for ITER and DEMO. Disassembly of the JT-60U tokamak was required so as to newly install the JT-60SA torus at the same position in the torus hall. The JT-60U tokamak was featured by the complicated and welded structure against the strong electromagnetic force, and by the radioactivation due to deuterium-deuterium (D-D) reactions of 1.5x10"2"0 (n) in total. Since this work was the first experience of disassembling a large radioactivated fusion device in Japan, careful preparations of disassembly activities, including treatment of the radioactivated materials and safety work, have been made. About 13,000 components with a total weight of more than 5,400 tonnes were removed from the torus hall and stored safely in storage facilities. All disassembly components were stored with recording the data such as dose rate, weight and kind of material, so as to apply the clearance level regulation in future. It was confirmed that the main radioactive material of the disassembly components was the stainless steel and that its dose rate was almost background level (∼0.1 μSv/h) at ∼10 m far from the vacuum vessel. It seems that the disassembly components with background dose level are in the clearance level. The assembly of JT-60SA tokamak has started in January 2013 after this disassembly of the JT-60U tokamak. (author)

On monitoring anthropogenic airborne uranium concentrations and 235U/238U isotopic ratio by Lichen - bio-indicator technique

International Nuclear Information System (INIS)

Golubev, A.V.; Golubeva, V.N.; Krylov, N.G.; Kuznetsova, V.F.; Mavrin, S.V.; Aleinikov, A.Yu.; Hoppes, W.G.; Surano, K.A.

2005-01-01

Lichens are widely used to assess the atmospheric pollution by heavy metals and radionuclides. However, few studies are available in publications on using lichens to qualitatively assess the atmospheric pollution levels. The paper presents research results applying epiphytic lichens as bio-monitors of quantitative atmospheric contamination with uranium. The observations were conducted during 2.5 years in the natural environment. Two experimental sites were used: one in the vicinity of a uranium contamination source, the other one - at a sufficient distance away to represent the background conditions. Air and lichens were sampled at both sites monthly. Epiphytic lichens Hypogimnia physodes were used as bio-indicators. Lichen samples were taken from various trees at about 1.5m from the ground. Air was sampled with filters at sampling stations. The uranium content in lichen and air samples as well as isotopic mass ratios 235 U/ 238 U were measured by mass-spectrometer technique after uranium pre-extraction. Measured content of uranium were 1.45mgkg -1 in lichen at 2.09E-04μgm -3 in air and 0.106mgkg -1 in lichen at 1.13E-05μgm -3 in air. The relationship of the uranium content in atmosphere and that in lichens was determined, C AIR =exp(1.1xC LICHEN -12). The possibility of separate identification of natural and man-made uranium in lichens was demonstrated in principle

Yields and isomeric ratio of xenon and krypton isotopes from thermal neutron fission of 235U

International Nuclear Information System (INIS)

Hsu, S.S.; Lin, J.T.; Yang, C.M.; Yu, Y.W.

1981-01-01

The experimental cumulative yields of 85 Kr/sup m/, 87 Kr, 88 Kr, 133 Xe/sup g/, 135 Xe/sup m/, and 135 Xe/sup g/ and the independent isomeric yield of 133 Xe/sup m/ in the thermal neutron fission of 235 U have been measured by the gas chromatographic method. The independent yields of 133 Xe/sup g/, 135 Xe/sup m/, and 135 Xe/sup g/ were deduced with the aid of 133 I and 135 I data. The isomeric yield ratios of 133 Xe and 135 Xe have been computed and compared with theoretical values since they have the same high spin state J = 11/2 - and low spin ground state J = 3/2 + . The influence of the shell effect on the fission isomeric yield ratio is discussed. From the measured independent yield of Xe isotopes plus the reported data, the Xe-isotopic distribution curve has been constructed. The curve is compared with the isotopic distribution curves of Xe isotopes formed in 11.5 GeV proton interactions with 238 U and Cs isotopes formed in 24 GeV proton interactions with 238 U. Upon fitting the yield curves we find that only those products with N/Z> or =1.48 fit a curve typical of a binary fission process

Recovery of enriched Uranium (20% U-235) from wastes obtained in the preparation of fuel elements for argonaut type reactors

International Nuclear Information System (INIS)

Uriarte, A.; Ramos, L.; Estrada, J.; del Val, J. L.

1962-01-01

Results obtained with the two following installations for recovering enriched uranium (20% U-235) from wastes obtained in the preparation of fuel elements for Argonaut type reactors are presented. Ion exchange unit to recover uranium form mother liquors resulting from the precipitation ammonium diuranate (ADU) from UO 2 F 2 solutions. Uranium recovery unit from solid wastes from the process of manufacture of fuel elements, consisting of a) waste dissolution, and b) extraction with 10% (v/v) TBP. (Author) 9 refs

Recovery of enriched Uranium (20% U-235) from wastes obtained in the preparation of fuel elements for argonaut type reactors

Energy Technology Data Exchange (ETDEWEB)

Uriarte, A; Ramos, L; Estrada, J; Val, J L. del

1962-07-01

Results obtained with the two following installations for recovering enriched uranium (20% U-235) from wastes obtained in the preparation of fuel elements for Argonaut type reactors are presented. Ion exchange unit to recover uranium form mother liquors resulting from the precipitation ammonium diuranate (ADU) from UO{sub 2}F{sub 2} solutions. Uranium recovery unit from solid wastes from the process of manufacture of fuel elements, consisting of a) waste dissolution, and b) extraction with 10% (v/v) TBP. (Author) 9 refs.

Measurement of the ROT effect in the neutron induced fission of 235U in the 0.3 eV resonance at a hot source of polarized neutrons

Directory of Open Access Journals (Sweden)

Kopatch Yuri

2018-01-01

Full Text Available The TRI and ROT asymmetries in fission of heavy nuclei have been extensively studied during more than a decade. The effects were first discovered in the ternary fission in a series of experiments performed at the ILL reactor (Grenoble by a collaboration of Russian and European institutes, and were carefully measured for a number of fissioning nuclei. Later on, the ROT effect has been observed in the emission of prompt gamma rays and neutrons in fission of 235U and 233U, although its value was an order of magnitude smaller than in the α-particle emission from ternary fission. All experiments performed so far are done with cold polarized neutrons, what assumes a mixture of several spin states, the weights of these states being not well known. The present paper describes the first attempt to get “clean” data by performing the measurement of gamma and neutron asymmetries in an isolated resonance of 235U at the POLI instrument of the FRM2 reactor in Garching.

2. Interferometry and polarimetry. 2.3. Polarimetry on JT-60U

International Nuclear Information System (INIS)

Kawano, Yasunori

2000-01-01

In order to establish an electron density measurement method with high reliability and stability for magnetic-confinement fusion devices, studies on infrared polarimetry have been carried out in JT-60U. Electron density measurement based on tangential Faraday rotation has been verified using a CO 2 laser polarimeter developed for JT-60U. In this article, basic ideas of studies, results from polarimetry experiments, and suggestions for future devices are presented. (author)

Monte Carlo simulation for fragment mass and kinetic energy distributions from the neutron-induced fission of 235U

International Nuclear Information System (INIS)

Montoya, M.; Rojas, J.; Saettone, E.

2007-01-01

The mass and kinetic energy distribution of nuclear fragments from the thermal neutron-induced fission of 235 U have been studied using a Monte Carlo simulation. Besides reproducing the pronounced broadening on the standard deviation of the final fragment kinetic energy distribution (σ e (m)) around the mass number m = 109, our simulation also produces a second broadening around m = 125 that is in agreement with the experimental data obtained by Belhafaf et al. These results are a consequence of the characteristics of the neutron emission, the variation in the primary fragment mean kinetic energy, and the yield as a function of the mass. (Author)

Application of distantiometric protections to 500 kV lines with AL 100% series compensation; Aplicacion de protecciones distanciometricas a lineas de 500 kV con compensacion serie AL 100%

Energy Technology Data Exchange (ETDEWEB)

Gaudio, Juan Carlos; Pesce, Jose Juan O.; Faure, Carlos Hugo [TRANSENER S.A., Buenos Aires (Argentina)

2001-07-01

The TRANSENER S.A. viewing the rising of the transmission capacity of the Northeastern Argentine Generators, assumed the installation costs of compensation by series capacitors. In the middle of the year 2000 was put into service a series capacitor bank on the extremity Recreo of the 500 kV to the Malvinas Argentina of the TRANSENER S.A.. The reactance compensation of the line in about 100% was responsible by the necessity of replacing the existent analogic electronic protection by new numerical distantiometric protections on the El Bracho and Malvinas Argentinas transformer station. This paper presents the imposed conditions for the selected line protection, the prior studies posterior the mentioned selection for validating the application, and the difficulties necessary to the task performing as well.

Reexamining the role of the (n ,γ f ) process in the low-energy fission of 235U and 239Pu

Science.gov (United States)

Lynn, J. E.; Talou, P.; Bouland, O.

2018-06-01

The (n ,γ f ) process is reviewed in light of modern nuclear reaction calculations in both slow and fast neutron-induced fission reactions on 235U and 239Pu. Observed fluctuations of the average prompt fission neutron multiplicity and average total γ -ray energy below 100-eV incident neutron energy are interpreted in this framework. The surprisingly large contribution of the M 1 transitions to the prefission γ -ray spectrum of 239Pu is explained by the dominant fission probabilities of 0+ and 2+ transition states, which can only be accessed from compound nucleus states formed by the interaction of s -wave neutrons with the target nucleus in its ground state, and decaying through M 1 transitions. The impact of an additional low-lying M 1 scissors mode in the photon strength function is analyzed. We review experimental evidence for fission fragment mass and kinetic-energy fluctuations in the resonance region and their importance in the interpretation of experimental data on prompt neutron data in this region. Finally, calculations are extended to the fast energy range where (n ,γ f ) corrections can account for up to 3% of the total fission cross section and about 20% of the capture cross section.

Design of a new P-NBI control system for 100-s injection in JT-60SA

International Nuclear Information System (INIS)

Okano, F.; Shinozaki, S.; Honda, A.; Ooshima, K.; Numazawa, S.; Ikeda, Y.

2008-01-01

Modification of JT-60U to a superconducting device (so-called JT-60SA) has been planned to contribute to ITER and DEMO. The positive-ion-based NBI system (P-NBI) is required to inject 24 MW for 100 s with 12 units. The P-NBI control system is to be fully remodeled with PLC (Programmable Logic Controller), which is featured by high market availability, system extensibility, cost-effectiveness, and independent development in programming. One of the critical issues to apply the PLC to the P-NBI control system is to control quickly the high voltage power supplies within 200 μs. For this purpose, the fastest PLC dealing with 4 refresh words at the processing time of 200 μs is to be employed. The second issue is to construct a data acquisition system for such a large number of data channels (∼2300 digital and ∼1300 analog data channels). The use of PLC linked with PC-based data measurement devices via Ethernet allows processing the large number of channels. The third issue is to make the man-machine interface simple. The marketed software giving an easy product of graphic menus is available for PLC programming. From these results, it is expected that commercial PLC could be applied to the large-scale control system of the P-NBI system for 100 s operations

Simultaneous measurement of fission fragments and prompt neutrons for thermal neutron-induced fission of U-235

Energy Technology Data Exchange (ETDEWEB)

Nishio, Katsuhisa; Yamamoto, Hideki; Kimura, Itsuro; Nakagome, Yoshihiro [Kyoto Univ. (Japan)

1997-03-01

Simultaneous measurement of fission fragments and prompt neutrons following the thermal neutron induced fission of U-235 has been performed in order to obtain the neutron multiplicity (v) and its emission energy ({eta}) against the specified mass (m{sup *}) and the total kinetic energy (TKE). The obtained value of -dv/dTKE(m{sup *}) showed a saw-tooth distribution. The average neutron energy <{eta}>(m{sup *}) had a distribution with a reflection symmetry around the half mass division. The measurement also gave the level density parameters of the specified fragment, a(m{sup *}), and this parameters showed a saw-tooth trend too. The analysis by a phenomenological description of this parameters including the shell and collective effects suggested the existence of a collective motion of the fission fragments. (author)

40 CFR 60.1455 - What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100...

Science.gov (United States)

2010-07-01

... reporting requirements for air curtain incinerators that burn 100 percent yard waste? 60.1455 Section 60... Reconstruction is Commenced After June 6, 2001 Air Curtain Incinerators That Burn 100 Percent Yard Waste § 60.1455 What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100...

40 CFR 60.1930 - What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100...

Science.gov (United States)

2010-07-01

... reporting requirements for air curtain incinerators that burn 100 percent yard waste? 60.1930 Section 60... Incinerators That Burn 100 Percent Yard Waste § 60.1930 What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100 percent yard waste? (a) Provide a notice of construction...

Energetic particle physics in JT-60U and JFT-2M

Energy Technology Data Exchange (ETDEWEB)

Shinohara, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Takechi, M [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Ishikawa, M [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Kusama, Y [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Tsuzuki, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Urata, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Kawashima, H [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Tobita, K [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Fukuyama, A [Department of Nuclear Engineering, Kyoto University, 606-8501, (Japan); Cheng, C Z [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Darrow, D S [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Kramer, G J [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Gorelenkov, N N [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Nazikian, R [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, NJ 08543 (United States); Todo, Y [National Institute for Fusion Science, Oroshi-cho, Toki, Gifu, 509-5292, (Japan); Miura, Y [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan); Ozeki, T [Naka Fusion Research Establishment, Japan Atomic Energy Research Institute, Naka, Ibaraki, 311-0193 (Japan)

2004-07-01

Recent energetic particle physics research in JT-60U and JFT-2M is reported. Alfven eigenmodes (AEs) are investigated in reversed-shear (RS) plasmas in JT-60U where frequency sweeping (FS) modes are observed to follow the q-profile evolution. The RS-induced AE model can explain the FS of the modes within the context of an evolving q-profile. Enhanced energetic ion transport is also investigated with the appearance of modes in the toroidicity-induced AE range of frequency in JT-60U using a multi-channel neutron profile monitor and in JFT-2M using a lost ion probe. Additionally, the ripple loss in the complex toroidal field ripple due to ferritic steel inserts in JFT-2M is shown and compared with model analysis. The simulation code developed to predict ripple loss in JFT-2M will be of use in estimating the heat flux in the complex ripple field of a future device such as ITER.

Neutron transmission and capture measurements and analysis of 60Ni from 1 to 450 keV

International Nuclear Information System (INIS)

Perey, C.M.; Harvey, J.A.; Macklin, R.L.; Winters, R.R.; Perey, F.G.

1982-11-01

High-resolution transmission and capture measurements of 60 Ni-enriched targets have been made at the Oak Ridge Electron Linear Accelerator (ORELA) from a few eV to 1800 keV in transmission and from 2.5 keV to 5 MeV in capture . The transmission data from 1 to 450 keV were analyzed with a multi-level R-matrix code which uses the Bayes' theorem for the fitting process. This code provides the energies and neutron widths of the resonances inside the 1- to 450-keV region as well as a possible parameterization for outside resonances to describe the smooth cross section in this region. The capture data were analyzed with a least-squares fitting code using the Breit-Wigner formula. From 2.5 to 450 keV, 166 resonances were seen in both sets of data. Correspondence between the energy scales shows a discontinuity around 300 keV which makes the matching of resonances at higher energies difficult. Eighty-nine resonances were seen in the capture data only. Average parameters for the 30 observed s-wave resonances were deduced. The average level spacing D 0 was found to be equal to 15.2 +- 1.5 keV, the strength function, S 0 , equal to (2.2 +- 0.6) x 10 -4 and the average radiation width, GAMMA/sub γ/, equal to 1.30 +- 0.07 eV. The staircase plot of the reduced level widths and the plot of the Lorentz-weighted strength function averaged over various energy intervals show possible evidence for doorway states. The level densities calculated with the Fermi-gas model for l = 0 and for l > 0 resonances were compared with the cumulative number of observed resonances, but the analysis is not conclusive. The average capture cross section as a function of the neutron incident energy is compared to the tail of the giant electric dipole resonance prediction

Dose intercomparison for 400–500 keV electrons using FWT-60 film and glutamine (spectrophotometric readout) dosimeters

DEFF Research Database (Denmark)

Gupta, B. L.; Nilekani, S. R.; Gehringer, P.

1986-01-01

This paper describes the dose and the depth dose measurements with FWT-60 film and glutamine (Spectrophotometric readout) dosimeters for 400–500 keV electrons. The glutamine powder was spread uniformly in polyethylene bags and the powder thickness in each bag was 5 mg cm−2. Both techniques show...

Regulation of rabbit lung cytochrome P-450 prostaglandin omega-hydroxylase (P-450/sub PG-omega/) during pregnancy

International Nuclear Information System (INIS)

Muerhoff, A.S.; Williams, D.E.; Jackson, V.; Leithauser, M.T.; Waterman, M.R.; Johnson, E.F.; Masters, B.S.S.

1987-01-01

The mechanism of induction during pregnancy of a rabbit lung prostaglandin omega-hydroxylase cytochrome P-450 has been investigated. This activity has been demonstrated to be induced over 100-fold in 28-day pregnant rabbits, as compared to nonpregnant rabbits. The induction is reflected by an increase in the amount of P-450/sub PG-omega/ protein as measured by Western blotting. P-450/sub PG-omega/ microsomal protein increases throughout gestation concomitant with an increase in PGE 1 omega-hydroxylase activity. Elucidation of the level of induction involved extraction of RNA from rabbit lungs obtained at various days of gestation followed by in vitro translation of the RNA in the presence of 35 S-methionine. Immunoprecipitation of newly synthesized P-450 and analysis of the immunoisolates by SDS-PAGE, autoradiography and densitometry of the P-450/sub PG-omega/ band revealed that the P-450/sub PG-omega/ mRNA levels followed the gestational time-dependent increase observed for both PGE 1 omega-hydroxylase activity and P-450/sub PG-omega/ protein, i.e., a gradual increase peaking at 28-days, dropping precipitously to near control levels following parturition. These data suggest that control of P-450/sub PG-omega expression occurs at the transcriptional level. Western blots of human lung bronchioloalveolar-carcinoma cell lines NCL-H322 and NCL-H358 utilizing a guinea pig IgG to P-450/sub PG-omega/ detect a cross-reactive species

High sensitivity isotope analysis with a 252Cf--235U fueled subcritical multiplier and low background photon detector systems

International Nuclear Information System (INIS)

Wogman, N.A.; Rieck, H.G. Jr.; Laul, J.C.; MacMurdo, K.W.

1976-09-01

A 252 Cf activation analysis facility has been developed for routine multielement analysis of a wide variety of solid and liquid samples. The facility contains six sources of 252 Cf totaling slightly over 100 mg. These sources are placed in a 93 percent 235 U-enriched uranium core which is subcritical with a K effective of 0.985 (multiplication factor of 66). The system produces a thermal flux on the order of 10 +1 neutrons per square centimeter per second. A pneumatic rabbit system permits automatic irradiation, decay, and counting regimes to be performed unattended on the samples. The activated isotopes are analyzed through their photon emissions with state-of-the-art intrinsic Ge detectors, Ge(Li) detectors, and NaI(Tl) multidimensional gamma ray spectrometers. High efficiency (25 percent), low background, anticoincidence shielded Ge(Li) gamma ray detector systems have been constructed to provide the lowest possible background, yet maintain a peak to Compton ratio of greater than 1000 to 1. The multidimensional gamma ray spectrometer systems are composed of 23 cm diameter x 20 cm thick NaI(Tl) crystals surrounded by NaI(Tl) anticoincidence shields. The detection limits for over 65 elements have been determined for this system. Over 40 elements are detectable at the 1 part per million level at a precision of +-10 percent

Novel extrahepatic cytochrome P450s

International Nuclear Information System (INIS)

Karlgren, Maria; Miura, Shin-ichi; Ingelman-Sundberg, Magnus

2005-01-01

The cytochrome P450 enzymes are highly expressed in the liver and are involved in the metabolism of xenobiotics. Because of the initiatives associated with the Human Genome Project, a great progress has recently been seen in the identification and characterization of novel extrahepatic P450s, including CYP2S1, CYP2R1, CYP2U1 and CYP2W1. Like the hepatic enzymes, these P450s may play a role in the tissue-specific metabolism of foreign compounds, but they may also have important endogenous functions. CYP2S1 has been shown to metabolize all-trans retinoic acid and CYP2R1 is a major vitamin D 25-hydroxylase. Regarding their metabolism of xenobiotics, much remains to be established, but CYP2S1 metabolizes naphthalene and it is likely that these P450s are responsible for metabolic activation of several different kinds of xenobiotic chemicals and contribute to extrahepatic toxicity and carcinogenesis

Review of JT-60U experimental results from March to October, 1991

International Nuclear Information System (INIS)

1992-06-01

Experimental results achieved in the initial operation of JT-60U are described in this paper. Experiments of JT-60U were initiated in March 1991, and deuterium experiments started in the middle of July. Multivariable non-interacting control, H-mode experiments, the high-q and high-β p regime with hot ion enhanced confinement, the divertor heat flux, etc. are reported. Achieved values of the first experiment of the JT-60U LHCD in 1991 were P LH = 1.5 MW, driven current I RF = 2MA, current drive efficiency η CD (=n-bar e R p I RF /P LH ) = 0.25 x 10 20 m -2 A/W and current driven product CDP(=n-bar e R p I RF ) = 3 x 10 20 m -2 MA. (J.P.N.)

Delayed neutron spectra from short pulse fission of uranium-235

International Nuclear Information System (INIS)

Atwater, H.F.; Goulding, C.A.; Moss, C.E.; Pederson, R.A.; Robba, A.A.; Wimett, T.F.; Reeder, P.; Warner, R.

1986-01-01

Delayed neutron spectra from individual short pulse (∼50 μs) fission of small 235 U samples (50 mg) were measured using a small (5 cm OD x 5 cm length) NE 213 neutron spectrometer. The irradiating fast neutron flux (∼10 13 neutrons/cm 2 ) for these measurements was provided by the Godiva fast burst reactor at the Los Alamos Critical Experiment Facility (LACEF). A high speed pneumatic transfer system was used to transfer the 50 mg 235 U samples from the irradiation position near the Godiva assembly to a remote shielded counting room containing the NE 213 spectrometer and associated electronics. Data were acquired in sixty-four 0.5 s time bins and over an energy range 1 to 7 MeV. Comparisons between these measurements and a detailed model calculation performed at Los Alamos is presented

Safe Sleep for Babies PSA (:60)

Centers for Disease Control (CDC) Podcasts

2018-01-09

This 60 second public service announcement is based on the January 2018 CDC Vital Signs report. Every year, there are about 3,500 sleep-related deaths among U.S. babies. Learn how to create a safe sleep environment for babies.  Created: 1/9/2018 by Centers for Disease Control and Prevention (CDC).   Date Released: 1/9/2018.

Determination of uranium concentrations and "2"3"4U/"2"3"8U activity ratio in some granitic rock samples by alpha spectrometry: application of a radiochemical procedure

International Nuclear Information System (INIS)

Khattab, Mahmoud R.

2016-01-01

The present study is an application of a radiochemical procedure using alpha spectrometry technique for determination of uranium isotopes "2"3"8U, "2"3"4U and "2"3"5U on 13 granitic samples. These samples were collected from Gabal Gattar area, Northeastern Desert, Egypt. The collected samples were digested using microwave technique with aqua regia and spiked with "2"3"2U for chemical yield and activity calculation. Separation of uranium isotopes from the samples was done by Dowex 1 x 4 (50-100 mesh) resin followed by source preparation using microprecipitation technique. The concentrations of "2"3"8U were ranged between 28.9±0.9 and 134.8±1.8 Bq/g, and the "2"3"4U concentrations were between 24±0.6 and 147.7±2.2 Bq/g. For the "2"3"5U, the activity concentrations were between 1.3±0.2 and 6.7±1.2 Bq/g. The activity ratio of "2"3"4U/"2"3"8U was calculated and varied from 0.80 to 1.30. (author)

Design of a negative-ion based NBI system for JT-60U

International Nuclear Information System (INIS)

Kuriyama, M.; Araki, M.; Inoue, T.; Kunieda, S.; Matsuoka, M.; Mizuno, M.; Ohara, Y.; Okumura, Y.; Oohara, H.; Watanabe, K.

1992-01-01

This paper reports on a negative-ion based NBI system which is planned as a key device on the JT-60U in the experiments of current drive and plasma core heating with high density plasmas. The NBI system will inject neutral beams of 500keV, 10MW for 10sec from a beamline with two ion sources. The neutral beam will be injected tangentially in the codirection. Each ion source is a modified volume production-type negative-ion source with cesium vapor. The acceleration current is 22A with deuterium beam, and the current density is 13mA/cm 2 . An operational pressure in the negative-ion generator is less than 0.5 Pa. A three-stage electro static acceleration system is adopted as the accelerator. The beamline length between the ion source and the injection port is 24m. The beamline consists of an ion source tank, neutralizer cells of 10m in length, an ion dump tank and a drift duct. The ion source tank contains large cryopumps to maintain the exit of the ion source sufficiently low. The ion dump tank contains ion deflecting coils, ion dumps for positive and negative ions, a calorimeter, cryopumps and beam scrapers. Residual ions are deflected by the combined magnetic fields produced by the deflecting coils and the stray field form the tokamak. The two sources are connected to an acceleration power supply of 500kV/64A/10sec, while the negative-ion generator power, the extraction voltage, and electron-suppression voltage are fed individually

Coulex fission of 234U, 235U, 237Np, and 238Np studied within the SOFIA experimental program

International Nuclear Information System (INIS)

Martin, Julie-Fiona

2014-01-01

SOFIA (Studies On FIssion with Aladin) is an experimental project which aims at systematically measuring the fission fragments' isotopic yields as well as their total kinetic energy, for a wide variety of fissioning nuclei. The PhD work presented in this dissertation takes part in the SOFIA project, and covers the fission of nuclei in the region of the actinides: 234 U, 235 U, 237 Np and 238 Np. The experiment is led at the heavy-ion accelerator GSI in Darmstadt, Germany. This facility provides intense relativistic primary beam of 238 U. A fragmentation reaction of the primary beam permits to create a secondary beam of radioactive ions, some of which the fission is studied. The ions of the secondary beam are sorted and identified through the FR-S (Fragment Separator), a high resolution recoil spectrometer which is tuned to select the ions of interest.The selected - fissile - ions then fly further to Cave-C, an experimental area where the fission experiment itself takes place. At the entrance of the cave, the secondary beam is excited by Coulomb interaction when flying through an target; the de-excitation process involves low-energy fission. Both fission fragments fly forward in the laboratory frame, due to the relativistic boost inferred from the fissioning nucleus.A complete recoil spectrometer has been designed and built by the SOFIA collaboration in the path of the fission fragments, around the existing ALADIN magnet. The identification of the fragments is performed by means of energy loss, time of flight and deviation in the magnet measurements. Both fission fragments are fully (in mass and charge) and simultaneously identified.This document reports on the analysis performed for (1) the identification of the fissioning system, (2) the identification of both fission fragments, on an event-by-event basis, and (3) the extraction of fission observables: yields, TKE, total prompt neutron multiplicity. These results, concerning the actinides, are discussed, and

Phase transformation of metastable cubic γ-phase in U-Mo alloys

International Nuclear Information System (INIS)

Sinha, V.P.; Hegde, P.V.; Prasad, G.J.; Dey, G.K.; Kamath, H.S.

2010-01-01

Over the past decade considerable efforts have been put by many fuel designers to develop low enriched uranium (LEU 235 ) base U-Mo alloy as a potential fuel for core conversion of existing research and test reactors which are running on high enriched uranium (HEU > 85%U 235 ) fuel and also for the upcoming new reactors. U-Mo alloy with minimum 8 wt% molybdenum shows excellent metastability with cubic γ-phase in cast condition. However, it is important to characterize the decomposition behaviour of metastable cubic γ-uranium in its equilibrium products for in reactor fuel performance point of view. The present paper describes the phase transformation behaviour of cubic γ-uranium phase in U-Mo alloys with three different molybdenum compositions (i.e. 8 wt%, 9 wt% and 10 wt%). U-Mo alloys were prepared in an induction melting furnace and characterized by X-ray diffraction (XRD) method for phase determination. Microstructures were developed for samples in as cast condition. The alloys were hot rolled in cubic γ-phase to break the cast structure and then they were aged at 500 o C for 68 h and 240 h, so that metastable cubic γ-uranium will undergo eutectoid decomposition to form equilibrium phases of orthorhombic α-uranium and body centered tetragonal U 2 Mo intermetallic compound. U-Mo alloy samples with different ageing history were then characterized by XRD for phase and development of microstructure.

Neural-net disruption predictor in JT-60U

International Nuclear Information System (INIS)

Yoshino, R.

2003-01-01

The prediction of major disruptions caused by the density limit, the plasma current ramp-down with high internal inductance l i , the low density locked mode and the β-limit has been investigated in JT-60U. The concept of 'stability level', newly proposed in this paper to predict the occurrence of a major disruption, is calculated from nine input parameters every 2 ms by the neural network and the start of a major disruption is predicted when the stability level decreases to a certain level, the 'alarm level'. The neural network is trained in two steps. It is first trained with 12 disruptive and six non-disruptive shots (total of 8011 data points). Second, the target output data for 12 disruptive shots are modified and the network is trained again with additional data points generated by the operator. The 'neural-net disruption predictor' obtained has been tested for 300 disruptive shots (128 945 data points) and 1008 non-disruptive shots (982 800 data points) selected from nine years of operation (1991-1999) of JT-60U. Major disruptions except for those caused by the -limit have been predicted with a prediction success rate of 97-98% at 10 ms prior to the disruption and higher than 90% at 30 ms prior to the disruption while the false alarm rate is 2.1% for non-disruptive shots. This prediction performance has been confirmed for 120 disruptive shots (56 163 data points), caused by the density limit, as well as 1032 non-disruptive shots (1004 611 data points) in the last four years of operation (1999-2002) of JT-60U. A careful selection of the input parameters supplied to the network and the newly developed two-step training of the network have reduced the false alarm rate resulting in a considerable improvement of the prediction success rate. (author)

Prompt fission neutron spectra of n + 235U above the (n, nf) fission threshold

International Nuclear Information System (INIS)

Shu Nengchuan; Chen Yongjing; Liu Tingjin; Jia Min

2015-01-01

Calculations of prompt fission neutron spectra (PFNS) from the 235 U(n, f) reaction were performed with a semi-empirical method for En = 7.0 and 14.7 MeV neutron energies. The total PFNS were obtained as a superposition of (n, xnf) pre-fission neutron spectra and post-fission spectra of neutrons which were evaporated from fission fragments, and these two kinds of spectra were taken as an expression of the evaporation spectrum. The contributions of (n, xnf) fission neutron spectra on the calculated PFNS were discussed. The results show that emission of one or two neutrons in the (n, nf) or (n, 2nf) reactions influences the PFNS shape, and the neutron spectra of the (n, xnf) fission-channel are soft compared with the neutron spectra of the (n, f) fission channel. In addition, analysis of the multiple-chance fission component showed that second-chance fission dominates the PFNS with an incident neutron energy of 14.7 MeV whereas first-chance fission dominates the 7 MeV case. (authors)

Impurity and particle recycling reduction by boronization in JT-60U

International Nuclear Information System (INIS)

Higashijima, S.; Sugie, T.; Kubo, H.; Tsuji, S.; Shimada, M.; Asakura, N.; Hosogane, N.; Kawano, Y.; Nakamura, H.; Itami, K.; Sakasai, A.; Shimizu, K.; Ando, T.; Saidoh, M.

1995-01-01

In JT-60U boronization using decaborane was carried out. Boronization reduced the oxygen impurity in OH discharges and shortened the wall conditioning after the vacuum vessel vent and consequently enabled JT-60U to produce clean plasmas easily except for NB heated plasmas. After boronization, particle recycling was reduced drastically in OH and NB discharges. High confinement plasmas were obtained including high β p mode and H-mode discharges. In the latest boronization part of divertor plates were replaced with B 4 C coated tiles with a B 4 C thickness similar 300 μm. After introducing B 4 C divertor tiles, an explosive generation of boron particles from the tiles was observed. By the combined effects of boronization with decaborane and boron generation from B 4 C tiles, oxygen impurity was so low that oxygen line signals were reduced to noise levels after the latest boronization. On the other hand, boron burst from the B 4 C tiles restricted the operation of JT-60U. ((orig.))

Monte Carlo simulation for fragment mass and kinetic energy distributions from the neutron-induced fission of {sup 235}U

Energy Technology Data Exchange (ETDEWEB)

Montoya, M.; Rojas, J. [Instituto Peruano de Energia Nuclear, Av. Canada 1470, Lima 41 (Peru); Saettone, E. [Facultad de Ciencias, Universidad Nacional de lngenieria, Av. Tupac Amaru 210, Apartado 31-139, Lima (Peru)

2007-07-01

The mass and kinetic energy distribution of nuclear fragments from the thermal neutron-induced fission of {sup 235}U have been studied using a Monte Carlo simulation. Besides reproducing the pronounced broadening on the standard deviation of the final fragment kinetic energy distribution ({sigma}{sub e}(m)) around the mass number m = 109, our simulation also produces a second broadening around m = 125 that is in agreement with the experimental data obtained by Belhafaf et al. These results are a consequence of the characteristics of the neutron emission, the variation in the primary fragment mean kinetic energy, and the yield as a function of the mass. (Author)

7 CFR 500.6 - Gambling.

Science.gov (United States)

2010-01-01

... 7 Agriculture 6 2010-01-01 2010-01-01 false Gambling. 500.6 Section 500.6 Agriculture Regulations... NATIONAL ARBORETUM Conduct on U.S. National Arboreturm Property § 500.6 Gambling. Participating in games for money or other personal property, or the operation of gambling devices, the conduct of a lottery...

500 Cities: City Boundaries

Data.gov (United States)

U.S. Department of Health & Human Services — This city boundary shapefile was extracted from Esri Data and Maps for ArcGIS 2014 - U.S. Populated Place Areas. This shapefile can be joined to 500 Cities...

40 CFR 60.1445 - What are the emission limits for air curtain incinerators that burn 100 percent yard waste?

Science.gov (United States)

2010-07-01

... curtain incinerators that burn 100 percent yard waste? 60.1445 Section 60.1445 Protection of Environment... Air Curtain Incinerators That Burn 100 Percent Yard Waste § 60.1445 What are the emission limits for air curtain incinerators that burn 100 percent yard waste? If your air curtain incinerator combusts...

Optogalvanic measurement of isotope shifts of doubly ionized uranium (U III) made using natural-U samples

International Nuclear Information System (INIS)

Piyakis, K.N.; Gagne, J.

1989-01-01

An efficient method of identifying 235 U III (in natural-U samples), with the help of the optogalvanic effect in a hollow-cathode discharge, is presented. The use of this method enabled us to carry out the measurement of isotope shifts and the preliminary investigation of hyperfine structures of U III. The 238 U-- 235 U shifts for the 591.313-, 586.045-, and 610.497-nm U III lines are found to be 921(3), 417(6), and 392(12) mK, respectively

Measurement of the uranium-235 fission cross section over the neutron energy range 1 to 6 MeV

International Nuclear Information System (INIS)

Barton, D.M.; Diven, B.C.; Hansen, G.E.; Jarvis, G.A.; Koontz, P.G.; Smith, R.K.

1976-01-01

The ratio of the fission cross section of 235 U to the scattering cross section of 1 H was measured in the 1- to 6-MeV range using monoenergetic neutrons from a pulsed 3 H(p,n) 3 He source. In this measurement, solid-state detectors determined fission fragment and recoil proton emissions from back-to-back U(99.7%) and polyethylene disks. Timing permitted discrimination against room-scattered neutron backgrounds. Absolute values for 235 U(n,f) are obtained using the Hopkins-Breit evaluation of the hydrogen-scattering cross section

235Uranium isotope abundance certified reference material for gamma spectrometry EC nuclear reference material 171 certification report

International Nuclear Information System (INIS)

De Bievre, P.; Eschbach, H.L.; Lesser, R.; Meyer, H.; Audenhove, Van J.

1986-01-01

This certification report contains the information necessary for the final certification of EC nuclear reference material 171. It is also intended to inform the user of the reference material concerned on technical/scientific details which are not given in the certificate. The report describes the reference material which consists of sets of U 3 O 8 samples with five different 235 U/U abundances, filled in cylindrical aluminium cans. The can bottom serves as window for emitted gamma radiation. The report describes how the 235 U/U abundances were characterized, how the other properties relevant for gamma measurements were determined and gives all connected results as well as those from the verification measurements. Appendix A represents the draft certificate. 32 refs

Study of Photon Strength Functions of Actinides: the case of U-235, Np-238 and Pu-241

CERN Document Server

Guerrero, C; Cano-Ott, D; Martinez, T; Mendoza, E; Villamarin, D; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Andriamonje, S; Calviani, M; Chiaveri, E; Gonzalez-Romero, E; Kadi, Y; Vicente, M C; Vlachoudis, V; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Heil, M; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A

2011-01-01

The decay from excited levels in medium and heavy nuclei can be described in a statistical approach by means of Photon Strength Functions and Level Density distributions combined with the theory of the compound. The study of electromagnetic cascades following neutron capture by means of high efficiency detectors has been shown to be well suited for probing the properties of the Photon Strength Function of heavy (high level density) and/or radioactive (high background) nuclei. In this work we have investigated for the first time the validity of the recommended PSF for actinides, in particular 235U, 238Np and 241Pu. Our study includes the search for resonance structures in the PSF below Sn and draws conclusions regarding their existence and their characteristics in terms of energy, width and electromagnetic nature.

40 CFR 60.1920 - What are the emission limits for air curtain incinerators that burn 100 percent yard waste?

Science.gov (United States)

2010-07-01

... curtain incinerators that burn 100 percent yard waste? 60.1920 Section 60.1920 Protection of Environment... or Before August 30, 1999 Model Rule-Air Curtain Incinerators That Burn 100 Percent Yard Waste § 60.1920 What are the emission limits for air curtain incinerators that burn 100 percent yard waste? If...

Investigation of the microstructure influence in the thermo-physical properties of U-Mo alloys through the laser flash method

Energy Technology Data Exchange (ETDEWEB)

Pedrosa, Tercio A.; Alves, Fabio F.; Kelmer, Paula F.; Santos, Ana Maria M.; Camarano, Denise das M.; Ferraz, Wilmar B., E-mail: tap@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

2013-07-01

The U-Mo alloys are the most investigated and promising nuclear fuel material to be used in research and test reactors, according to the premises of the RERTR program, whose objective is to minimize the threats of nuclear weapons proliferation through the conversion of the nuclear fuels of research and test reactors form a high enrichment grade, HEU (235U>90%, to a low enrichment grade, LEU ({sup 235}U<20%). The high density of the U-Mo alloys associated with its ability to keep the gamma phase metastable at room temperature are the main advantages of these alloys, with Mo contents of 5, 7 and 10 wt% were induction melted and ageing heat treated at 300 and 500 deg C for 72, 120 and 240 h. Microstructural characterization was carried out in the as-cast and aged conditions through XRD and OM techniques. The laser Flash Method at environmental temperature was employed to investigate the variation of the thermal diffusivity as a function of the microstructure obtained in the as-cast and aged conditions. (author)

Investigation of the microstructure influence in the thermo-physical properties of U-Mo alloys through the laser flash method

International Nuclear Information System (INIS)

Pedrosa, Tercio A.; Alves, Fabio F.; Kelmer, Paula F.; Santos, Ana Maria M.; Camarano, Denise das M.; Ferraz, Wilmar B.

2013-01-01

The U-Mo alloys are the most investigated and promising nuclear fuel material to be used in research and test reactors, according to the premises of the RERTR program, whose objective is to minimize the threats of nuclear weapons proliferation through the conversion of the nuclear fuels of research and test reactors form a high enrichment grade, HEU (235U>90%, to a low enrichment grade, LEU ( 235 U<20%). The high density of the U-Mo alloys associated with its ability to keep the gamma phase metastable at room temperature are the main advantages of these alloys, with Mo contents of 5, 7 and 10 wt% were induction melted and ageing heat treated at 300 and 500 deg C for 72, 120 and 240 h. Microstructural characterization was carried out in the as-cast and aged conditions through XRD and OM techniques. The laser Flash Method at environmental temperature was employed to investigate the variation of the thermal diffusivity as a function of the microstructure obtained in the as-cast and aged conditions. (author)

24 CFR 235.1200 - Authority.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Authority. 235.1200 Section 235... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE... § 235.1200 Authority. In accordance with the authority contained in section 235(r) of the National...

Construction of negative-ion based NBI for JT-60U

International Nuclear Information System (INIS)

Kawai, Mikito; Akino, Noboru; Ebisawa, Noboru

2001-11-01

The world's first negative-ion based neutral beam injector (N-NBI) system has been developed for studies of non-inductive current drive and plasma core heating with high energy neutral beam injection in higher density plasma. Construction of the N-NBI system for JT-60U was completed in March 1996. The system is composed of a beamline with two ion sources, a set of ion source power supplies, control system and auxiliary sub-system such as cooling water, refrigeration and vacuum system. In July 2001, deuterium neutral beam injection of 400keV and 5.8MW into JT-60U plasma was achieved. In order to increase both beam power and energy we have to go on more improvement of the N-NBI. (author)

40 CFR 60.1450 - How must I monitor opacity for air curtain incinerators that burn 100 percent yard waste?

Science.gov (United States)

2010-07-01

... curtain incinerators that burn 100 percent yard waste? 60.1450 Section 60.1450 Protection of Environment... Air Curtain Incinerators That Burn 100 Percent Yard Waste § 60.1450 How must I monitor opacity for air curtain incinerators that burn 100 percent yard waste? (a) Use EPA Reference Method 9 in appendix A of...

40 CFR 60.1925 - How must I monitor opacity for air curtain incinerators that burn 100 percent yard waste?

Science.gov (United States)

2010-07-01

... curtain incinerators that burn 100 percent yard waste? 60.1925 Section 60.1925 Protection of Environment... or Before August 30, 1999 Model Rule-Air Curtain Incinerators That Burn 100 Percent Yard Waste § 60.1925 How must I monitor opacity for air curtain incinerators that burn 100 percent yard waste? (a) Use...

High accuracy 235U(n,f) data in the resonance energy region

International Nuclear Information System (INIS)

Paradela, C.; Duran, I.; Alvarez-Pol, H.; Tassan-Got, L.; Audouin, L.; Berthier, B.; Isaev, S.; Le Naour, C.; Stephan, C.; David, S.; Ferrant, L.; Tarrio, D.; Abbondanno, U.; Tagliente, G.; Terlizzi, R.; Aerts, G.; Andriamonje, S.; Berthoumieux, E.; Dridi, W.; Gunsing, F.; Pancin, S.J.; Perrot, L.; Plukis, A.; Alvarez-Velarde, F.; Cano-Ott, D.; Gonzalez-Romero, E.; Martinez, T.; Villamarin, D.; Andrzejewski, J.; Marganiec, J.; Badurek, G.; Jericha, E.; Lederer, C.; Leeb, H.; Baumann, P.; Kerveno, M.; Lukic, S.; Rudolf, G.; Becvar, F.; Embid-Segura, M.; Krticka, M.; Vincente, M.C.; Calvino, F.; Cortes, G.; Poch, A.; Pretel, C.; Calviani, M.; Cennini, P.; Chiaveri, E.; Dahlfors, M.; Ferrari, A.; Kadi, Y.; Rubbia, C.; Sarchiapone, L.; Vlachoudis, V.; Weiss, C.; Capote, R.; Quesada, J.; Carrapico, C.; Goncalves, I.F.; Salgado, J.; Santos, C.; Tavora, L.; Vaz, P.; Chepel, V.; Ferreira-Marques, R.; Lindote, A.; Colonna, N.; Marrone, S.; Couture, A.; Cox, J.; Wiesher, M.; Dillmann, I.; Heil, M.; Kaeppeler, F.; Mosconi, M.; Plag, R.; Voss, F.; Walter, S.; Wisshak, K.; Domingo-Pardo, C.; Tain, J.L.; Eleftheriadis, C.; Lampoudis, C.; Savvidis, I.; Fujii, K.; Milazzo, P.M.; Moreau, C.; Furman, W.; Konovalov, V.; Goverdovski, A.; Ketlerov, V.; Gramegna, F.; Mastinu, P.; Praena, J.; Guerrero, C.; Haight, R.; Koehler, P.; Reifarth, R.; Igashira, M.; Karadimos, D.; Vlastou, R.; Massimi, C.; Pavlopoulos, P.; Mengoni, A.; Plompen, A.; Rullhusen, P.; Rauscher, T.; Ventura, A.; Pavlik, A.

2016-01-01

The 235 U neutron-induced cross section is widely used as reference cross section for measuring other fission cross sections, but in the resonance region it is not considered as an IAEA standard because of the scarce experimental data covering the full region. In this work, we deal with a new analysis of the experimental data obtained with a detection setup based on parallel plate ionization chambers (PPACs) at the CERN n-TOF facility in the range from 1 eV to 10 keV. The relative cross section has been normalised to the IAEA value in the region between 7.8 and 11 eV, which is claimed as well-known. Its comparison with the last IAEA reference files and with the present version of the ENDF evaluation leads to the following conclusions: 1) there is very good agreement with the shape of the ENDF cross-section in the resolved resonance range, while showing a lower background; 2) the ENDF integral values, apart from a 2% difference in the normalisation value at 7.8-11.0 eV, show a sharp drop at the transition from the resolved to the unresolved resonance energy regions; And 3) There is a very good agreement with the IAEA integral-data set, provided that an offset of 0.09 barn is applied in the whole energy range

Alecto - results obtained with homogeneous critical experiments on plutonium 239, uranium 235 and uranium 233; Alecto - resultats des experiences critiques homogenes realisees sur le plutonium 239, l'uranium 235 et l'uranium 233

Energy Technology Data Exchange (ETDEWEB)

Bruna, J G; Brunet, J P; Caizegues, R; Clouet d' Orval, Ch; Kremser, J; Tellier, H; Verriere, Ph [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1965-07-01

In this report are given the results of the homogeneous critical experiments ALECTO, made on plutonium 239, uranium 235 and uranium 233. After a brief description of the equipment, the critical masses for cylinders of diameters varying from 25 to 42 cm, are given and compared with other values (foreign results, criticality guide). With respect to the specific conditions of neutron reflection in the ALECTO experiments the minimal values of critical masses are: Pu239 M{sub c} = 910 {+-} 10 g, U235 M{sub c} = 1180 {+-} 12 g and U233 M{sub c} = 960 {+-} 10 g. Experiments relating to cross sections and constants to be used on these materials are presented. Lastly, kinetic experiments allow to compare pulsed neutron methods to fluctuation methods. [French] On presente dans ce rapport les resultats des experiences critiques homogenes ALECTO, effectuees sur le plutonium 239, l'uranium 235 et l'uranium 233. Apres avoir rappele la description des installations, on donne les masses critiques pour des cylindres de diametres variant entre 25 et 42 cm, qui sont comparees avec d'autres chiffres (resultats etrangers, guide de criticite). Dans les gammes des diametres etudies pour des cuves a fond plat reflechies lateralement, la valeur minimale des masses critiques est la suivante: Pu239 M{sub c} = 910 {+-} 10 g, U235 M{sub c} = 1180 {+-} 12 g et U233 M{sub c} 960 {+-} 10 g. Des experiences portant sur les sections efficaces et les constantes a utiliser sur ces milieux sont ensuite presentees. Enfin des experiences de cinetique permettent une comparaison entre la methode des neutrons pulses et la methode des fluctuations. (auteur)

Routine Isotopic Analysis of 235U by Emission Spectrometry. 1. Interferometry using electrode-less discharge lamps 2. determination of the 235U/238U ratio using a spectrograph and electrode-less lamps

International Nuclear Information System (INIS)

Capitini, R.; Ceccaldi, M.; Leicknam, J.P.; Rabec, J.

1968-01-01

I. A 'HYPEAC' interferometric apparatus has been used for routine determination of uranium 235. In order to facilitate the examination of non-metallic samples and to reduce the time required for analysis it has been necessary to replace the hollow-cathode light sources usually used by electrode-less discharge lamps. The preparation outside the apparatus of such lamps containing uranium tetrachloride is described; the process is simple and rapid: about ninety minutes for each, and several lamps can be built simultaneously, thus reducing still further the total time required for each analysis. The amount of sample required is about a few milligrams. In order to counteract any spontaneous optical dis-adjustment which could prevent the application of the usual isotopic abundance method, it is necessary to compare the sample spectra with those of standards, all these spectra being recorded successively and alternately. A series of examples of determinations involving over 150 measurements is presented and discussed. For samples with abundances similar to that of natural uranium and up to 5 per cent of the 235 isotope., the reproducibility is of the order of 2 per cent, the relative accuracy being ± 2 to 3 per cent; for samples enriched in uranium 235 (5 to 93 per cent) the relative accuracy can attain ± 0.5 per cent. II. In spite of the large amount of research into the improvement of the accuracy of uranium isotope analyses using optical methods, it has not been possible up to the present to develop a method as good as mass spectrometry. When it is not necessary to have a high accuracy, however, emission spectroscopy which has no memory effect can constitute a complementary method of analysis if it is sufficiently fast and economical; for this to happen it seems to us that it should be possible to apply such a method in laboratories equipped with all the usual spectrochemical analysis equipment. In the present work we have therefore set out to obtain an acceptable

Ranges of the fragments from thermal (slow) neutron fission of /sup 235/U in water

Energy Technology Data Exchange (ETDEWEB)

Gu, H; Chao, Z; Sheng, Z; Wang, L; Feng, X

1980-05-01

According to the principle of thick target, we used the aqueous solutions of uranyl chloride of various concentrations as thick targets and platinum plates of known surface area as absorbers immersed in the target solutions. The ranges of the U(n, f) fission fragments /sup 89/Sr, /sup 91/Y, /sup 140/Ba, /sup 141/Ce and /sup 144/Ce in the aqueous solutions of uranyl chloride of various concentrations were determined. In the concentration region of 0.16 U% - 6.2 U%, the uranium concentration had no significant effect on the measurement of the range. Therefore, the ranges of the fission fragments in diluted UO/sub 2/Cl/sub 2/ solutions are very close to those in pure water, and the mean value of the ranges in UO/sub 2/Cl/sub 2/ solutions of various concentrations was taken as the range in water. The experimental results of the ranges of these five fission fragments in water were: R/sub Sr-90/ = 2.39 +- 0.04 mgcm/sup -2/, R/sub Y-91/ = 2.35 +- 0.09 mgcm/sup -2/, R/sub Ba-140/ = 1.92 +- 0.07 mgcm/sup -2/, R/sub Ce-141/ = 1.91 +- 0.12 mgcm/sup -2/, R/sub Ce-144/ = 1.84 +- 0.10 mgcm/sup -2/. In order to estimate the effect of back scattering of fission fragments in platinum plate, we did the experiments using stainless steel plate as absorber (the aqueous solutions of uranyl chloride as thick targets). The results were similar. Thus, the effect of back scattering was not significant. This work provides a convenient means for determining the ranges of the fission fragments in a liquid.

Transcriptome analysis and identification of P450 genes relevant to imidacloprid detoxification in Bradysia odoriphaga.

Science.gov (United States)

Chen, Chengyu; Wang, Cuicui; Liu, Ying; Shi, Xueyan; Gao, Xiwu

2018-02-07

Pesticide tolerance poses many challenges for pest control, particularly for destructive pests such as Bradysia odoriphaga. Imidacloprid has been used to control B. odoriphaga since 2013, however, imidacloprid resistance in B. odoriphaga has developed in recent years. Identifying actual and potential genes involved in detoxification metabolism of imidacloprid could offer solutions for controlling this insect. In this study, RNA-seq was used to explore differentially expressed genes in B. odoriphaga that respond to imidacloprid treatment. Differential expression data between imidacloprid treatment and the control revealed 281 transcripts (176 with annotations) showing upregulation and 394 transcripts (235 with annotations) showing downregulation. Among them, differential expression levels of seven P450 unigenes were associated with imidacloprid detoxification mechanism, with 4 unigenes that were upregulated and 3 unigenes that were downregulated. The qRT-PCR results of the seven differential expression P450 unigenes after imidacloprid treatment were consistent with RNA-Seq data. Furthermore, oral delivery mediated RNA interference of these four upregulated P450 unigenes followed by an insecticide bioassay significantly increased the mortality of imidacloprid-treated B. odoriphaga. This result indicated that the four upregulated P450s are involved in detoxification of imidacloprid. This study provides a genetic basis for further exploring P450 genes for imidacloprid detoxification in B. odoriphaga.

Development and evaluation of a technique for in vivo monitoring of 60Co in the lungs

International Nuclear Information System (INIS)

Mello, J.Q. de; Lucena, E.A.; Dantas, A.L.A.; Dantas, B.M.

2015-01-01

60 Co is a fission product of 235 U and represents a risk of internal exposure of workers in nuclear power plants, especially those involved in the maintenance of potentially contaminated parts and equipment. The control of 60 Co intake by inhalation can be performed through in vivo monitoring. This work describes the evaluation of a technique through the minimum detectable activity and the corresponding minimum detectable effective doses, based on biokinetic and dosimetric models of 60 Co in the human body. The results allow to state that the technique is suitable either for monitoring of occupational exposures or evaluation of accidental intakes. (author)

Cumulative fission yield of Ce-148 produced by thermal-neutron fission of U-235

International Nuclear Information System (INIS)

Hasan, A.A.

1984-12-01

Cumulative fission yield of 148 cesium isotopes and some other fission products produced by thermal-neutron fission of 235 uranium is determined by Germanium/Lithium spectroscopic methods. The measuremets were done at Tsing-Hua open pool reactor using 3 to 4 mg of 93.15% enriched 235 uranium samples. Gamma rays are assigned to the responsible fission products by matching gamma rays energies and half lives. Fission rate is calculated by fission track method. Cumulative fission yields of 148 cesium, 90 krypton, 130 iodine, 144 lanthanum, 89 krypton, 136 xenon, 137 xenon and 140 cesium are calculated. This values are compared with previously predicted values and showed good agreement. 21 Ref

Decay scheme of the U235

International Nuclear Information System (INIS)

Gaeta, R.

1965-01-01

A study of the Th 2 31 excited levels from the alpha decay of the U 2 35, is carried out. The alpha particle spectrum was measured by means of a semiconductor counter spectrometer with an effective resolution of 18 keV. Nineteen new lines were identified. The gamma-ray spectrum was measured with thin samples of U 2 35, free from decay products, and in such geometrical conditions, that most of the interference effects were eliminated. The gamma-gamma coincidence spectra have made easier a better knowledge of the transition between the several levels. (Author) 110 refs

Retention characteristics of hydrogen isotopes in JT-60U

International Nuclear Information System (INIS)

Masaki, K.; Sugiyama, K.; Hayashi, T.; Ochiai, K.; Gotoh, Y.; Shibahara, T.; Hirohata, Y.; Oya, Y.; Miya, N.; Tanabe, T.

2005-01-01

Erosion/deposition distribution and hydrogen isotope behavior in the JT-60U plasma-facing wall were investigated. Distribution of the tritium, which was produced by D-D nuclear reaction, was not correlated with erosion/deposition distribution. The tritium distribution can be explained by the distribution of high-energy tritium ion-implantation due to ripple loss. Deuterium distribution in the divertor region was different from the tritium distribution and not well correlated with the deposition. The highest D/C was ∼0.05 at the bottom of the outer dome wing, which is much less than that observed in other tokamaks. For the deuterium retention, at least two retention processes (ion-implantation and co-deposition) were found on the dome region. The systematic dust collection gave the small amount of dust (∼7 g: 0.2 mg/s production) in the whole vessel of JT-60U. Deposition was observed at the remote area of the outer divertor region

Creation and testing of an ENDF/B-VI neutron data library (ENDF60) for use with MCNP trademark

International Nuclear Information System (INIS)

Frankle, S.C.; MacFarlane, R.E.

1995-01-01

The continuous-energy neutron data library ENDF60, for use with the Monte Carlo N Particle radiation transport code MCNP4A, was released in the fall of 1994. The ENDF60 library is comprised of 124 nuclide data files based on the ENDF/B-VI evaluations through Release 2. Fifty-two percent of these ENDF/B-VI evaluations are translations from ENDF/B-V. The remaining forty-eight percent are new evaluations which have sometimes changed significantly. The new evaluations include important materials for criticality safety calculations, as well as significant enhancements such as isotopic evaluations, better resonance-range representations, and the new correlated energy-angle distributions for emitted particles. In particular, the upper energy limit for the resolved resonance region of 235 U, 238 U and 239 Pu has been extended from 0.082, 4.0, and 0.301 keV to 2.25, 10.0, and 2.5 keV respectively. As part of the overall quality assurance testing of the ENDF60 library, calculations for well known benchmark assemblies were performed. This benchmarking effort included revising the standard nine criticality benchmarks documented in previous Los Alamos National Laboratory Reports, LA-12212 and LA-12891, as well as the implementation of new Cross Section Evaluation Working Group (CSEWG) benchmarks. Comparisons of benchmark results for different data libraries can aid the user in understanding how well an evaluation performs for their application

Comparative Study Using 100–300 Versus 300–500 μm Microspheres for Symptomatic Patients Due to Enlarged-BPH Prostates

Energy Technology Data Exchange (ETDEWEB)

Gonçalves, Octavio Meneghelli, E-mail: octaviogalvao@hotmail.com; Carnevale, Francisco Cesar, E-mail: francisco.carnevale@criep.com.br; Moreira, Airton Mota, E-mail: motamoreira@gmail.com [University of Sao Paulo Medical School, Interventional Radiology Unit (Brazil); Antunes, Alberto Azoubel, E-mail: antunesuro@uol.com.br [University of Sao Paulo Medical School, Division of Urology (Brazil); Rodrigues, Vanessa Cristina, E-mail: vanessapaular@yahoo.com.br [University of Sao Paulo Medical School, Interventional Radiology Unit (Brazil); Srougi, Miguel, E-mail: srougi@terra.com.br [University of Sao Paulo Medical School, Division of Urology (Brazil)

2016-10-15

PurposeThe purpose of the study was to compare safety and efficacy outcomes following prostate artery embolization (PAE) for the treatment of lower urinary tract symptoms (LUTS) due to benign prostatic hyperplasia (BPH) with 100–300 versus 300–500 μm tris-acryl gelatin microspheres.Materials and MethodsPatients were prospectively treated between August 2011 and June 2013 to receive PAE with 100–300 μm (group A) or 300–500 μm (group B) tris-acryl gelatin microspheres. Patients were followed for a minimum of 12 months and were assessed for changes in International Prostate Symptom Score (IPSS), quality of life (QoL) index, prostate volume determined by magnetic resonance imaging, serum prostate specific antigen (PSA), and maximum urine flow rate (Q{sub max}), as well as any treatment-related adverse events.ResultsFifteen patients were included in each group, and PAE was technically successful in all cases. Both groups experienced significant improvement in mean IPSS, QoL, prostate volume, PSA, and Q{sub max} (p < 0.05 for all). The differences observed between the two groups included a marginally insignificant more adverse events (p = 0.066) and greater mean serum PSA reduction at 3 months of follow-up (p = 0.056) in group A.ConclusionsBoth 100–300 and 300–500 μm microspheres are safe and effective embolic agents for PAE to treat LUTS-related to BPH. Although functional and imaging outcomes did not differ significantly following use of the two embolic sizes, the greater incidence of adverse events with 100–300 μm microspheres suggests that 300–500 μm embolic materials may be more appropriate.

Comparative Study Using 100–300 Versus 300–500 μm Microspheres for Symptomatic Patients Due to Enlarged-BPH Prostates

International Nuclear Information System (INIS)

Gonçalves, Octavio Meneghelli; Carnevale, Francisco Cesar; Moreira, Airton Mota; Antunes, Alberto Azoubel; Rodrigues, Vanessa Cristina; Srougi, Miguel

2016-01-01

PurposeThe purpose of the study was to compare safety and efficacy outcomes following prostate artery embolization (PAE) for the treatment of lower urinary tract symptoms (LUTS) due to benign prostatic hyperplasia (BPH) with 100–300 versus 300–500 μm tris-acryl gelatin microspheres.Materials and MethodsPatients were prospectively treated between August 2011 and June 2013 to receive PAE with 100–300 μm (group A) or 300–500 μm (group B) tris-acryl gelatin microspheres. Patients were followed for a minimum of 12 months and were assessed for changes in International Prostate Symptom Score (IPSS), quality of life (QoL) index, prostate volume determined by magnetic resonance imaging, serum prostate specific antigen (PSA), and maximum urine flow rate (Q_m_a_x), as well as any treatment-related adverse events.ResultsFifteen patients were included in each group, and PAE was technically successful in all cases. Both groups experienced significant improvement in mean IPSS, QoL, prostate volume, PSA, and Q_m_a_x (p < 0.05 for all). The differences observed between the two groups included a marginally insignificant more adverse events (p = 0.066) and greater mean serum PSA reduction at 3 months of follow-up (p = 0.056) in group A.ConclusionsBoth 100–300 and 300–500 μm microspheres are safe and effective embolic agents for PAE to treat LUTS-related to BPH. Although functional and imaging outcomes did not differ significantly following use of the two embolic sizes, the greater incidence of adverse events with 100–300 μm microspheres suggests that 300–500 μm embolic materials may be more appropriate.

Nuclear reactor for breeding 233U

International Nuclear Information System (INIS)

Bohanan, C.S.; Jones, D.H.; Raab, H.F. Jr.; Radkowsky, A.

1976-01-01

A light-water-cooled nuclear reactor capable of breeding 233 U for use in a light-water breeder reactor includes physically separated regions containing 235 U fissile material and 238 U fertile material and 232 Th fertile material and 239 Pu fissile material, if available. Preferably the 235 U fissile material and 238 U fertile material are contained in longitudinally movable seed regions and the 239 Pu fissile material and 232 Th fertile material are contained in blanket regions surrounding the seed regions. 1 claim, 5 figures

Comparison of the ENDF/B-V and SOKRATOR evaluations of 235U, 239Pu, 240Pu and 241Pu at low neutron energies

International Nuclear Information System (INIS)

de Saussure, G.; Wright, R.Q.

1981-01-01

The US and USSR's most recent evaluationsof 235 U, 239 Pu, 240 Pu and 241 Pu are compared over the thermal region and over the first few resonances. The two evaluations rest on essentially the same experimental data base and the differences reflect different approaches to the representation of the cross sections or different weightings of the experimental results. It is found that over the thermal and resolved ranges the two evaluations are very similar. Some differences in approaches are briefly discussed

Energy Dependence of Fission Product Yields from 235U, 238U and 239Pu for Incident Neutron Energies Between 0.5 and 14.8 MeV

Science.gov (United States)

Gooden, M. E.; Arnold, C. W.; Becker, J. A.; Bhatia, C.; Bhike, M.; Bond, E. M.; Bredeweg, T. A.; Fallin, B.; Fowler, M. M.; Howell, C. R.; Kelley, J. H.; Krishichayan; Macri, R.; Rusev, G.; Ryan, C.; Sheets, S. A.; Stoyer, M. A.; Tonchev, A. P.; Tornow, W.; Vieira, D. J.; Wilhelmy, J. B.

2016-01-01

Fission Product Yields (FPY) have historically been one of the most observable features of the fission process. They are known to have strong variations that are dependent on the fissioning species, the excitation energy, and the angular momentum of the compound system. However, consistent and systematic studies of the variation of these FPY with energy have proved challenging. This is caused primarily by the nature of the experiments that have traditionally relied on radiochemical procedures to isolate specific fission products. Although radiochemical procedures exist that can isolate all products, each element presents specific challenges and introduces varying degrees of systematic errors that can make inter-comparison of FPY uncertain. Although of high importance in fields such as nuclear forensics and Stockpile Stewardship, accurate information about the energy dependence of neutron induced FPY are sparse, due primarily to the lack of suitable monoenergetic neutron sources. There is a clear need for improved data, and to address this issue, a collaboration was formed between Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL) and the Triangle Universities Nuclear Laboratory (TUNL) to measure the energy dependence of FPY for 235U, 238U and 239Pu. The measurements have been performed at TUNL, using a 10 MV Tandem Van de Graaff accelerator to produce monoenergetic neutrons at energies between 0.6 MeV to 14.8 MeV through a variety of reactions. The measurements have utilized a dual-fission chamber, with thin (10-100 μg/cm2) reference foils of similar material to a thick (100-400 mg) activation target held in the center between the chambers. This method allows for the accurate determination of the number of fissions that occurred in the thick target without requiring knowledge of the fission cross section or neutron fluence on target. Following activation, the thick target was removed from the dual-fission chamber and gamma

Magnetic properties of CoxPt100−x nanoparticles

Directory of Open Access Journals (Sweden)

Truong Thanh Trung

2016-03-01

Full Text Available CoxPt100−x nanoparticles (x = 50, 59, and 73 were prepared by the chemical reduction of Cobalt (II chloride and Chloroplatinic acid, then ultrasonicated for 2 h. After annealing at various temperatures from 450 °C to 700 °C for 1 h, structure change was observed and samples show hard magnetic properties which depend strongly on chemical composition and annealing temperature. The highest coercivity value of 1.15 kOe was obtained at room temperature for sample with x = 50 annealed at 500 °C. Chemical reduction combined with ultrasound is a useful method to prepare CoPt nanoparticles.

Development and evaluation of a technique for in vivo monitoring of {sup 60}Co in the lungs

Energy Technology Data Exchange (ETDEWEB)

Mello, J.Q. de; Lucena, E.A.; Dantas, A.L.A.; Dantas, B.M., E-mail: bmdantas@ird.gov.br [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

2015-07-01

{sup 60}Co is a fission product of {sup 235}U and represents a risk of internal exposure of workers in nuclear power plants, especially those involved in the maintenance of potentially contaminated parts and equipment. The control of {sup 60}Co intake by inhalation can be performed through in vivo monitoring. This work describes the evaluation of a technique through the minimum detectable activity and the corresponding minimum detectable effective doses, based on biokinetic and dosimetric models of {sup 60}Co in the human body. The results allow to state that the technique is suitable either for monitoring of occupational exposures or evaluation of accidental intakes. (author)

Comparison of transient electron heat transport in LHD helical and JT-60U tokamak plasmas

International Nuclear Information System (INIS)

Inagaki, S.; Ida, K.; Tamura, N.; Shimozuma, T.; Kubo, S.; Nagayama, Y.; Kawahata, K.; Sudo, S.; Ohkubo, K.; Takenaga, H.; Isayama, A.; Takizuka, T.; Kamada, Y.; Miura, Y.

2005-01-01

Transient transport experiments are performed in plasmas with and without Internal Transport Barrier (ITB) on LHD and JT-60U. The dependence of χ e on electron temperature, T e , and electron temperature gradient, ∇T e , is analyzed by an empirical non-linear heat transport model. In plasmas without ITB, two different types of non-linearity of the electron heat transport are observed from cold/heat pulse propagation. The χ e depends on T e and ∇T e in JT-60U, while the ∇T e dependence is weak in LHD. Inside the ITB region, there is no or weak ∇T e dependence both in LHD and JT-60U. A cold pulse growing driven by the negative T e dependence of χ e is observed inside the ITB region (LHD) and near the boundary of the ITB region (JT-60U). (author)

Energy Dependence of Fission Product Yields from 235U, 238U and 239Pu for Incident Neutron Energies Between 0.5 and 14.8 MeV

Science.gov (United States)

Gooden, Matthew; Bredeweg, Todd; Fowler, Malcolm; Vieira, David; Wilhelmy, Jerry; Tonchev, Anton; Stoyer, Mark; Bhike, Megha; Finch, Sean; Krishichayan, Fnu; Tornow, Werner

2017-09-01

The energy dependence of a number of cumulative fission product yields (FPY) have been measured using quasi- monoenergetic neutron beams for three actinide targets, 235U, 238U and 239Pu, between 0.5 and 14.8 MeV. The FPYs were measured by a combi- nation of fission counting using specially designed dual-fission chambers and -ray counting. Each dual-fission chamber is a back-to-back ioniza- tion chamber encasing an activation target in the center with thin de- posits of the same target isotope in each chamber. This method allows for the direct measurement of the total number of fissions in the activa- tion target with no reference to the fission cross-section, thus reducing uncertainties. γ-ray counting of the activation target was performed on well-shielded HPGe detectors over a period of 2 months post irradiation to properly identify fission products. Reported are absolute cumulative fission product yields for incident neutron energies of 0.5, 1.37, 2.4, 3.6, 4.6 and 14.8 MeV. New data in the second chance fission region of 5.5 - 9 MeV are included. Work performed for the U.S. Department of Energy by Los Alamos National Security, LLC under Contract DE-AC52-06NA25396.

Tritium processing in JT-60U

International Nuclear Information System (INIS)

Miya, Naoyuki; Masaki, Kei

1997-01-01

Tritium retention analysis and tritium concentration measurement have been made during the large Tokamak JT-60U deuterium operations. This work has been carried out to evaluate the tritium retention for graphite tiles inside the vacuum vessel and tritium release characteristics in the tritium cleanup operations. JT-60U has carried out D-D experiments since July 1991. In the deuterium operations during the first two years, about 1.7 x 10 19 D-D fusion neutrons were produced by D (d, p) T reactions in plasma, which are expected to produce ∼31 GBq of tritium. The tritium produced is evacuated by a pumping system. A part of tritium is, however, trapped in the graphite tiles. Several sample tiles were removed from the vessel and the retained tritium Distribution in the tiles was measured using a liquid scintillator. The results of poloidal distribution showed that the tritium concentration in the divertor tiles was higher than that in the first wall tiles and it peaked in the tiles between two strike points of divertor magnetic lines. Tritium concentration in the exhaust gas from the vessel have also been measured with an ion chamber during the tritium cleanup operations with hydrogen divertor discharges and He-GDC. Total of recovered tritium during the cleanup operations was ∼ 7% of that generated. The results of these measurements showed that the tritium of 16-23 GBq still remained in the graphite tiles, which corresponded to about 50-70% of the tritium generated in plasma. The vessel is ventilated during the in-vessel maintenance works, then the atmosphere is always kept lower than the legal concentration guide level of 0.7 Bq/cm 3 for radiation work permit requirements. (author)

Plasma equilibrium response modelling and validation on JT-60U

International Nuclear Information System (INIS)

Lister, J.B.; Sharma, A.; Limebeer, D.J.N.; Wainwright, J.P.; Nakamura, Y.; Yoshino, R.

2002-01-01

A systematic procedure to identify the plasma equilibrium response to the poloidal field coil voltages has been applied to the JT-60U tokamak. The required response was predicted with a high accuracy by a state-space model derived from first principles. The ab initio derivation of linearized plasma equilibrium response models is re-examined using an approach standard in analytical mechanics. A symmetric formulation is naturally obtained, removing a previous weakness in such models. RZIP, a rigid current distribution model, is re-derived using this approach and is compared with the new experimental plasma equilibrium response data obtained from Ohmic and neutral beam injection discharges in the JT-60U tokamak. In order to remove any bias from the comparison between modelled and measured plasma responses, the electromagnetic response model without plasma was first carefully tuned against experimental data, using a parametric approach, for which different cost functions for quantifying model agreement were explored. This approach additionally provides new indications of the accuracy to which various plasma parameters are known, and to the ordering of physical effects. Having taken these precautions when tuning the plasmaless model, an empirical estimate of the plasma self-inductance, the plasma resistance and its radial derivative could be established and compared with initial assumptions. Off-line tuning of the JT-60U controller is presented as an example of the improvements which might be obtained by using such a model of the plasma equilibrium response. (author)

Standard specification for uranium metal enriched to more than 15 % and less Than 20 % 235U

CERN Document Server

American Society for Testing and Materials. Philadelphia

2000-01-01

1.1 This specification covers nuclear grade uranium metal that has either been processed through an enrichment plant, or has been produced by the blending of highly enriched uranium with other uranium, to obtain uranium of any 235U concentration below 20 % (and greater than 15 %) and that is intended for research reactor fuel fabrication. The scope of this specification includes specifications for enriched uranium metal derived from commercial natural uranium, recovered uranium, or highly enriched uranium. Commercial natural uranium, recovered uranium and highly enriched uranium are defined in Section 3. The objectives of this specification are to define the impurity and uranium isotope limits for commercial grade enriched uranium metal. 1.2 This specification is intended to provide the nuclear industry with a standard for enriched uranium metal which is to be used in the production of research reactor fuel. In addition to this specification, the parties concerned may agree to other appropriate conditions. ...

Study of neutral particle behavior and particle confinement in JT-60U

International Nuclear Information System (INIS)

Takenaga, Hidenobu; Shimizu, Katsuhiro; Asakura, Nobuyuki; Shimada, Michiya; Kikuchi, Mitsuru; Tsuji-Iio, Shunji; Uchino, Kiichiro; Muraoka, Katsunori.

1995-07-01

In order to understand the particle confinement properties in JT-60U, the particle confinement time was estimated through analyses of the neutral particle behavior. First, the neutral particle transport simulation code DEGAS using a Monte-Carlo technique was combined with the simple divertor code for calculating the edge plasma parameters, and was developed to calculate under the experimental conditions in JT-60U. Then, the charged particle source in the main plasma due to the ionization of the neutral particles was evaluated from the analyses of the neutral particle penetration to the main plasma based on results of the simulation code and measurements of D α emission intensities. Finally, the particle confinement time was estimated from the analysis of particle balance. The analyses were performed systematically for the L-mode plasma and H-mode plasma of JT-60U, and a data base of the particle confinement time was obtained. The dependence of the particle confinement time on the plasma parameters and the relationship between the properties of the particle confinement and the energy confinement were examined. (author)

Mechanism of vertical displacement events in JT-60U disruptive discharges

International Nuclear Information System (INIS)

Nakamura, Y.; Yoshino, R.; Neyatani, Y.; Tsunematsu, T.; Azumi, M.; Pomphrey, N.; Jardin, S.C.

1996-01-01

Enhanced vertical displacement events (VDEs), which are frequently observed in JT-60U disruptive discharges, are investigated using the Tokamak Simulation Code (TSC). The rapid plasma current quench can accelerate the vertical displacement, owing to both the up/down asymmetry of the eddy current distribution arising from the asymmetric geometry of the JT-60U vacuum vessel and the degradation of magnetic field decay index n, leading to high growth rates of positional instability. For a slightly elongated configuration (n = -0.9), the asymmetry of attractive forces on the toroidal plasma plays a dominant role in the VDE mechanism. For a more elongated configuration (n = -1.7), the degradation of field decay index n plays an important role on VDEs, in addition to the effect of asymmetric attractive forces. It is shown that the VDE characteristics of a highly elongated configuration with a rapid plasma current quench can be dominated by the field decay index degradation. It is also pointed out that both the softening of current quenches as was experimentally developed in the JT-60U tokamak, and the optimization of the allowable elongation of the plasma cross-section are critical issues in the development of a general control strategy of discharge termination. (author). 21 refs, 10 figs

Incomplete deep inelastic processes in 100Mo + 100Mo and 120Sn + 120Sn at 18 and 24 MeV/u

International Nuclear Information System (INIS)

Petrovici, M.

1989-12-01

Experimental evidence on inclomplete deep inelastic process in 100 Mo + 100 Mo at 18.67 MeV/u, 23.75 MeV/u and in 120 Sn + 120 Sn at 18.34 MeV/u are presented. Such a mechanism is responsible for strong deviations observed at these incident energies in σ 2 Z -TKEL/l g (for two-body) and P 3 /(P 2 + P 3 )-TKEL (for three-body) systematics. Calculations which predict the number of preequilibrium emitted nucleons and the corresponding excitation energy per nucleon that remains in the dinuclear system could explain the observed discrepancies. (author)

Quantification of {sup 232}Th, {sup 234}U, {sup 235}U and {sup 238}U in river mollusks by magnetic sector mass spectrometry with inductively coupled plasma source (Icp-SFMS); Cuantificacion de {sup 232}Th, {sup 234}U, {sup 235}U y {sup 238}U en moluscos de rios por espectrometria de masas de sector magnetico con fuente de plasma acoplado inductivamente (ICP-SFMS)

Energy Technology Data Exchange (ETDEWEB)

Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Alfaro de la T, M. C., E-mail: arevalo0591@hotmail.com [Universidad Autonoma de San Luis Potosi, Dr. Salvador Nava s/n, Zona Universitaria, 78290 San Luis Potosi, SLP (Mexico)

2016-09-15

The present work deals with the methodology established for the quantification of {sup 232}Th, {sup 234}U, {sup 238}U and {sup 235}U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO{sub 3} minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of {sup 232}Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ({sup 232}Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of {sup 232}Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)

Study of carbon impurity generation by chemical sputtering in JT-60U

International Nuclear Information System (INIS)

Higashijima, S.; Kubo, H.; Sugie, T.; Shimizu, K.; Asakura, N.; Itami, K.; Hosogane, N.; Sakasai, A.; Konoshima, S.; Sakurai, S.; Takenaga, H.

1997-01-01

CD/CH-band intensities emitted from hydrocarbon molecules have been measured in the divertor region of JT-60U and the chemical sputtering yield of methane was estimated as a function of the surface temperature and the deuterium ion flux. The chemical sputtering yield increases with the surface temperature and decreases with increasing ion flux density in the L-mode plasmas. The B 4 C converted CFC tiles are installed in JT-60U and it is found that the chemical sputtering of B 4 C converted CFC tiles is suppressed in comparison to normal CFC tiles. (orig.)

Analysis of ELM stability with extended MHD models in JET, JT-60U and future JT-60SA tokamak plasmas

Science.gov (United States)

Aiba, N.; Pamela, S.; Honda, M.; Urano, H.; Giroud, C.; Delabie, E.; Frassinetti, L.; Lupelli, I.; Hayashi, N.; Huijsmans, G.; JET Contributors, the; Research Unit, JT-60SA

2018-01-01

The stability with respect to a peeling-ballooning mode (PBM) was investigated numerically with extended MHD simulation codes in JET, JT-60U and future JT-60SA plasmas. The MINERVA-DI code was used to analyze the linear stability, including the effects of rotation and ion diamagnetic drift ({ω }* {{i}}), in JET-ILW and JT-60SA plasmas, and the JOREK code was used to simulate nonlinear dynamics with rotation, viscosity and resistivity in JT-60U plasmas. It was validated quantitatively that the ELM trigger condition in JET-ILW plasmas can be reasonably explained by taking into account both the rotation and {ω }* {{i}} effects in the numerical analysis. When deuterium poloidal rotation is evaluated based on neoclassical theory, an increase in the effective charge of plasma destabilizes the PBM because of an acceleration of rotation and a decrease in {ω }* {{i}}. The difference in the amount of ELM energy loss in JT-60U plasmas rotating in opposite directions was reproduced qualitatively with JOREK. By comparing the ELM affected areas with linear eigenfunctions, it was confirmed that the difference in the linear stability property, due not to the rotation direction but to the plasma density profile, is thought to be responsible for changing the ELM energy loss just after the ELM crash. A predictive study to determine the pedestal profiles in JT-60SA was performed by updating the EPED1 model to include the rotation and {ω }* {{i}} effects in the PBM stability analysis. It was shown that the plasma rotation predicted with the neoclassical toroidal viscosity degrades the pedestal performance by about 10% by destabilizing the PBM, but the pressure pedestal height will be high enough to achieve the target parameters required for the ITER-like shape inductive scenario in JT-60SA.

Economic Effect on the Plutonium Cycle of Employing {sup 235}U in Fast Reactor Start-Up; Incidence Economique du Demarrage des Reacteurs Rapides a l'Aide d'Uranium-235 sur le Cycle du Plutonium

Energy Technology Data Exchange (ETDEWEB)

Van Dievoet, J.; Egleme, M.; Hermans, L. [BELGONUCLEAIRE, Bruxelles (Belgium)

1967-09-15

Preliminary results are presented of a study carried out under an agreement concluded between Euratom and the Belgian Government to evaluate the advantages of loading fast reactors with {sup 235}U. There are several ways of starting up a fast reactor with {sup 235}U: (1) the reactor can be operated entirely with enriched uranium, the plutonium produced being used to start up and operate other reactors; in this case the uranium is recycled within the reactor and more enriched uranium is added; (2) the plutonium produced can be partly recycled within the reactor together with the uranium; in this case the reactor is transformed gradually into a plutonium reactor. These two procedures can be combined and applied simultaneously in different enrichment zones of the same reactor, enriched uranium being added, for example, to the internal zone and plutonium recycled in the external zone. The method of reprocessing the fuel is also a complicating factor, depending on whether the core and the axial breeding blankets are reprocessed together or separately. Similarly, where a reactor has several enrichment zones, these can likewise be reprocessed either together or separately. The calculations are performed with the help of a code that uses the equivalence coefficients defined by Baker and Ross for the part relating to the characteristics of successive reactors, and the discounted fuel cycle cost method for the economic part. In the first stage of this work a rough analysis was made. The reloading of each zone was assumed to be carried out in a single operation, and the time spent by the fuel elements out of pile was ignored. In a later stage, progressive reloading by batches will be considered, with allowance for fabrication and reprocessing times, etc. The most interesting results relate to variations in fuel composition (plutonium content, isotopic composition) from one cycle to another, variations in the fuel cycle characteristics (doubling time, loading and unloading

Associations of ACE I/D, AGT M235T gene polymorphisms with pregnancy induced hypertension in Chinese population: a meta-analysis.

Science.gov (United States)

Zhu, Ming; Zhang, Jie; Nie, Shaofa; Yan, Weirong

2012-09-01

There have been many studies concerning the associations of angiotensin-converting enzyme (ACE) I/D, angiotensinogen (AGT) M235T polymorphisms with pregnancy induced hypertension (PIH) among Chinese populations. However, the results were inconsistent, prompting the necessity of meta-analysis. Studies published in English and Chinese were mainly searched in EMbase, PubMed and CBM up to January 2012. Twenty-three studies with 3,551 subjects for ACE I/D and seven studies with 1,296 subjects for AGT M235T were included. Significant associations were found between ACE I/D and PIH under dominant, recessive and allelic models. A separate analysis confined to preeclampsia suggested that ACE I/D was associated with preeclampsia under recessive model and allelic model, but not dominant model. Stratified analyses were conducted as meta-regression analysis indicated that the sample size of case group was a significant source of heterogeneity, which suggested no significant association between ACE I/D and PIH in the subgroup of more than 100 cases. Associations were found between AGT M235T and PIH under dominant genetic model (OR = 1.59; 95 %CI: 1.04-2.42), recessive genetic model (OR = 1.60; 95 %CI: 1.07-2.40), and allelic model (OR = 1.40; 95 %CI: 1.17-1.68). No publication bias was found in either meta-analysis. The present meta-analysis suggested significant associations between ACE I/D, AGT M235T and PIH in Chinese populations. However, no significant association was found between ACE I/D and PIH in the subgroup of more than 100 cases. Studies with larger sample sizes are necessary to investigate the associations between gene polymorphisms and PIH in Chinese populations.

46 CFR 108.235 - Construction.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Construction. 108.235 Section 108.235 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.235 Construction. (a) Each helicopter deck must be...

High performance experiments in JT-60U reversed shear discharges

International Nuclear Information System (INIS)

Fujita, T.; Kamada, Y.; Ishida, S.

2001-01-01

The operation of JT-60U reversed shear discharges has been extended to a high plasma current, low-q regime keeping a large radius of the internal transport barrier (ITB) and the record value of equivalent fusion multiplication factor in JT-60U, Q DT eq =1.25, has been achieved at 2.6 MA. Operational schemes to reach the low-q regime with good reproducibility have been developed. The reduction of Z eff was obtained in the newly installed W-shaped pumped divertor. The beta limit in the low-q min regime, which limited the performance of L-mode edge discharges, has been improved in H-mode edge discharges with a broader pressure profile, which was obtained by power flow control with ITB degradation. Sustainment of ITB and improved confinement for 5.5 seconds has been demonstrated in an ELMy H reversed shear discharge. (author)

Critical experiments in AQUILON with fuels slightly enriched in uranium 235 or in plutonium; Experiences critiques dans aquilon portant sur des combustibles legerement enrichis en uranium 235 et en plutonium

Energy Technology Data Exchange (ETDEWEB)

Chabrillac, M; Ledanois, G; Lourme, P; Naudet, R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1964-07-01

Reactivity comparisons have been, made in Aquilon II between geometrically identical lattices differing only by the composition of the fuel. The fuel elements consist in metallic uranium single rods with either slight differences of the isotopic composition (0.69 - 0.71 - 0.83 - 0.86 per cent of uranium 235) or slight additions of plutonium (0.043 per cent). Five lattices pitches have bean used, in order to produce a large variation of spectrum. Two additional sets of plutonium fuels are prepared to be used in the same conditions. The double comparisons: natural enriched 235 versus natural-enriched plutonium are made in such a way that a very precise interpretation is permitted. The results are perfectly consistent which seems to prove that the calculation methods are convenient. Further it can been inferred that the usual data, namely for the ratio of the {eta} of {sup 235}U and {sup 239}Pu seem reliable. (authors) [French] On a compare neutroniquement dans Aquilon II des reseaux geometriquement identiques mais comportant de petites differences de composition du combustible. EL s'agit de barres d'uranium metallique, les unes avec des teneurs differentes en isotopes 235 (0,69 - 0,71 - 0,83 - 0,86 pour cent) les autres comportant une legere addition de plutonium (0,043 pour cent). Les comparaisons ont ete faites a cinq pas differents, de maniere a mettre en jeu une assez large variation de spectre. Deux autres jeux de combustible au plutonium seront utilises ulterieurement dans les memes conditions. Les resultats des mesures se presentent sous forme de doubles comparaisons: naturel-enrichi 235/naturel-enrichi plutonium. On s'est place dans des conditions qui permettent des interpretations tres precises. Les resultats sont remarquablement coherents, ce qui semble montrer que les methodes de calcul sont bien adaptees, Ils tendent d'autre part a prouver que les valeurs numeriques admises dans la litterature, notamment pour le rapport des {eta} de l'U 235 et de Pu 239

7 CFR 235.3 - Administration.

Science.gov (United States)

2010-01-01

... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 235.3 Section 235.3 Agriculture... CHILD NUTRITION PROGRAMS STATE ADMINISTRATIVE EXPENSE FUNDS § 235.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the program for payment to...

Fission-fragment angular distributions and total kinetic energies for 235U(n,f) from .18 to 8.83 MeV

International Nuclear Information System (INIS)

Meadows, J.W.; Budtz-Joergensen, C.

1982-01-01

A gridded ion chamber was used to measure the fission fragment angular distribution and total kinetic energy for the 235 U(n,f) reaction from 0.18 to 8.81 MeV neutron energy. The anisotropies are in generally good agreement with earlier measurements. The average total kinetic energy is approx. 0.2 MeV greater than the thermal value at neutron energies < 2 MeV and shows a sudden decrease of approx. 0.8 MeV between 4 and 5 MeV neutron energy, well below the (n, n'f) threshold. Possible causes of this decrease are a change in the mass distribution or decreased shell effects in the heavy fragment

Cytochrome P450 induction by rifampicin in healthy subjects: determination using the Karolinska cocktail and the endogenous CYP3A4 marker 4beta-hydroxycholesterol.

Science.gov (United States)

Kanebratt, K P; Diczfalusy, U; Bäckström, T; Sparve, E; Bredberg, E; Böttiger, Y; Andersson, T B; Bertilsson, L

2008-11-01

The Karolinska cocktail, comprising caffeine, losartan, omeprazole, and quinine, was given before and after administration of rifampicin (20, 100, or 500 mg daily) to measure induction of cytochrome P450 (P450) enzymes. Rifampicin was given for 14 days to eight healthy subjects (all of whom possessed at least one wild-type CYP2C9 and one wild-type CYP2C19 gene) in each dose group. 4beta-hydroxycholesterol was assessed as an endogenous marker of CYP3A4 induction. A fourfold induction of CYP3A4 was seen at the highest dose by both quinine:3'-hydroxyquinine and 4beta-hydroxycholesterol measurements (P Karolinska cocktail and 4beta-hydroxycholesterol can be used for an initial screening of the induction properties of a drug candidate.

Review of JT-60U experimental results from February to October, 1995

International Nuclear Information System (INIS)

1996-03-01

Renewed theme group organization started from October 1994 for the upcoming experiments in JT-60U. This regime has three theme groups each of which is composed of two sub-theme groups as; (1) Plasma Operation Theme (Leader Y. Neyatani) with Operation Sub-Theme and Disruption Sub-Theme, (2) High Performance (Leader S. Ishida) with Confinement and MHD Sub-Theme and High Energy Particle Sub-Theme and (3) Steady State Theme (Leader A. Sakasai) with Current Drive Sub-Theme and Divertor Sub-Theme. The main results from the JT-60U experiments in 1995 are summarized in the overviews of the three theme group activities. (J.P.N.)

Review of JT-60U experimental results from February to October, 1995

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-03-01

Renewed theme group organization started from October 1994 for the upcoming experiments in JT-60U. This regime has three theme groups each of which is composed of two sub-theme groups as; (1) Plasma Operation Theme (Leader Y. Neyatani) with Operation Sub-Theme and Disruption Sub-Theme, (2) High Performance (Leader S. Ishida) with Confinement and MHD Sub-Theme and High Energy Particle Sub-Theme and (3) Steady State Theme (Leader A. Sakasai) with Current Drive Sub-Theme and Divertor Sub-Theme. The main results from the JT-60U experiments in 1995 are summarized in the overviews of the three theme group activities. (J.P.N.).

7 CFR 500.3 - Preservation of property.

Science.gov (United States)

2010-01-01

... 7 Agriculture 6 2010-01-01 2010-01-01 false Preservation of property. 500.3 Section 500.3 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL RESEARCH SERVICE, DEPARTMENT OF AGRICULTURE NATIONAL ARBORETUM Conduct on U.S. National Arboreturm Property § 500.3 Preservation...

Transformation temperatures γU → δUZr2 Y γU →αU in U-Zr-Nb alloys

International Nuclear Information System (INIS)

Komar Varela, Carolina L.; Arico, Sergio F.; Gribaudo, Luis M.; Comision Nacional de Energia Atomica, General San Martin