WorldWideScience

Sample records for u-12 groups

  1. U12 type introns were lost at multiple occasions during evolution

    Directory of Open Access Journals (Sweden)

    Bartschat Sebastian

    2010-02-01

    Full Text Available Abstract Background Two categories of introns are known, a common U2 type and a rare U12 type. These two types of introns are removed by distinct spliceosomes. The phylogenetic distribution of spliceosomal RNAs that are characteristic of the U12 spliceosome, i.e. the U11, U12, U4atac and U6atac RNAs, suggest that U12 spliceosomes were lost in many phylogenetic groups. We have now examined the distribution of U2 and U12 introns in many of these groups. Results U2 and U12 introns were predicted by making use of available EST and genomic sequences. The results show that in species or branches where U12 spliceosomal components are missing, also U12 type of introns are lacking. Examples are the choanoflagellate Monosiga brevicollis, Entamoeba histolytica, green algae, diatoms, and the fungal lineage Basidiomycota. Furthermore, whereas U12 splicing does not occur in Caenorhabditis elegans, U12 introns as well as U12 snRNAs are present in Trichinella spiralis, which is deeply branching in the nematode tree. A comparison of homologous genes in T. spiralis and C. elegans revealed different mechanisms whereby U12 introns were lost. Conclusions The phylogenetic distribution of U12 introns and spliceosomal RNAs give further support to an early origin of U12 dependent splicing. In addition, this distribution identifies a large number of instances during eukaryotic evolution where such splicing was lost.

  2. Temperature behavior of 12 wt.% U TRIGA fuel

    Energy Technology Data Exchange (ETDEWEB)

    Levine, S H; Geisler, G C; Totenbier, R E [Pennsylvania State University (United States)

    1974-07-01

    Stainless steel clad 12 wt % U TRIGA fuel elements have been used to refuel the Penn State University's Breazeale Reactor (PSBR). When 12 wt % U fuel containing nominally 55 gms of {sup 235}U per fuel element is substituted for the 8.5 wt % U fuel containing nominally 38 gms {sup 235}U, higher fuel temperatures were produced in the 12 wt % U fuel than in the 8.5 wt % U fuel at the same reactor powers. The higher fuel temperature can be related to the higher power densities in the 12 wt % U fuel. The power density is calculated to be 35% higher in the 12 wt % U fuel when 6 of these fuel elements are substituted for 8.5 wt % U fuel in the innermost ring, the B ring. Temperatures have been calculated for the 12 wt % U fuel in the above configuration for both steady state and pulse conditions, assuming a 35% higher fuel density in the 12 wt % U fuel and the results compare favorably with the experimental measurements. This is particularly true when the comparison is made with temperature data taken after exposing the new fuel elements to a series of pulses. These calculations and data will be presented at the meeting. (author)

  3. The [U{sub 2}F{sub 12}]{sup 2-} anion of Sr[U{sub 2}F{sub 12}

    Energy Technology Data Exchange (ETDEWEB)

    Scheibe, Benjamin; Pietzonka, Clemens; Conrad, Matthias; Kraus, Florian [Fachbereich Chemie, Philipps-Universitaet Marburg (Germany); Mustonen, Otto; Karppinen, Maarit; Karttunen, Antti J. [Department of Chemistry, Aalto University (Finland); Atanasov, Mihail; Neese, Frank [Max-Planck Institute for Chemical Energy Conversion, Muelheim an der Ruhr (Germany)

    2018-03-05

    The D{sub 2h}-symmetric dinuclear complex anion [U{sub 2}F{sub 12}]{sup 2-} of pastel green Sr[U{sub 2}F{sub 12}] shows a hitherto unknown structural feature: The coordination polyhedra around the U atoms are edge-linked monocapped trigonal prisms, the U{sup V} atoms are therefore seven-coordinated. This leads to a U-U distance of 3.8913(6) Aa. A weak U{sup V}-U{sup V} interaction is observed for the dinuclear [U{sub 2}F{sub 12}]{sup 2-} complex and described by the antiferromagnetic exchange J{sub exp} of circa -29.9 cm{sup -1}. The crystalline compound can be easily prepared from SrF{sub 2} and β-UF{sub 5} in anhydrous hydrogen fluoride (aHF) at room temperature. It was studied by means of single crystal X-ray diffraction, IR, Raman and UV/VIS spectroscopy, magnetic measurements, and by molecular as well as by solid-state quantum chemical calculations. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. Theoretical assessment of the electro-optical features of the group III nitrides (B{sub 12}N{sub 12}, Al{sub 12}N{sub 12} and Ga{sub 12}N{sub 12}) and group IV carbides (C{sub 24}, Si{sub 12}C{sub 12} and Ge{sub 12}C{sub 12}) nanoclusters encapsulated with alkali metals (Li, Na and K)

    Energy Technology Data Exchange (ETDEWEB)

    Tahmasebi, Elham [Chemistry Department, Faculty of Science, Lorestan University, Khorram Abad, Lorestan (Iran, Islamic Republic of); Shakerzadeh, Ehsan, E-mail: e.shakerzadeh@scu.ac.ir [Chemistry Department, Faculty of Science, Shahid Chamran University, Ahvaz (Iran, Islamic Republic of); Biglari, Zeinab [Chemistry Department, Faculty of Science, Lorestan University, Khorram Abad, Lorestan (Iran, Islamic Republic of)

    2016-02-15

    Graphical abstract: - Highlights: • Encapsulation of Li, Na and K narrow the HOMO–LUMO gaps of the clusters. • The group III nitrides nanoclusters strongly interacted with the alkali metals. • First hyperpolarizabilities remarkably enhance for B{sub 12}N{sub 12} encapsulated with Na/K. - Abstract: Density functional theory (DFT) calculations have been carried out to study the influence of alkali metals (Li, Na and K) encapsulation within the group III nitrides (B{sub 12}N{sub 12}, Al{sub 12}N{sub 12} and Ga{sub 12}N{sub 12}) and the group IV carbides (C{sub 24}, Si{sub 12}C{sub 12}and Ge{sub 12}C{sub 12}) nanoclusters. The encapsulation of Li, Na and K atoms is found to narrow the HOMO–LUMO gaps of the considered clusters. The electronic properties of these clusters, especially the group III nitrides nanoclusters, are strongly sensitive to interaction with the alkali metals. Moreover it is observed that the encapsulation of alkali metals enhances the first hyperpolarizabilities of B{sub 12}N{sub 12} nanocluster. Surprisingly, due to the alkali metals encapsulation within B{sub 12}N{sub 12} nanocluster, the first hyperpolarizability values are remarkably increased to 8505.49 and 122,503.76 a.u. for Na@B{sub 12}N{sub 12} and K@B{sub 12}N{sub 12}, respectively. Also the TD-DFT calculations at both CAM-B3LYP/6-311+G(d) and PBE0/6-311+G(d) levels of theory are also performed to investigate the origin of first hyperpolarizabilities.

  5. Hidden U$_{q}$(sl(2)) x U$_{q}$(sl(2)) quantum group symmetry in two dimensional gravity

    CERN Document Server

    Cremmer, E; Schnittger, J

    1997-01-01

    In a previous paper, we proposed a construction of U_q(sl(2)) quantum group symmetry generators for 2d gravity, where we took the chiral vertex operators of the theory to be the quantum group covariant ones established in earlier works. The basic idea was that the covariant fields in the spin 1/2 representation themselves can be viewed as generators, as they act, by braiding, on the other fields exactly in the required way. Here we transform this construction to the more conventional description of 2d gravity in terms of Bloch wave/Coulomb gas vertex operators, thereby establishing for the first time its quantum group symmetry properties. A U_q(sl(2))\\otimes U_q(sl(2)) symmetry of a novel type emerges: The two Cartan-generator eigenvalues are specified by the choice of matrix element (bra/ket Verma-modules); the two Casimir eigenvalues are equal and specified by the Virasoro weight of the vertex operator considered; the co-product is defined with a matching condition dictated by the Hilbert space structure of...

  6. Increasing TRIGA fuel lifetime with 12 wt.% U TRIGA fuel

    Energy Technology Data Exchange (ETDEWEB)

    Naughton, W F; Cenko, M J; Levine, S H; Witzig, W F [Pennsylvania State University (United States)

    1974-07-01

    In-core fuel management studies have been performed for the Penn State Breazeale Reactor (PSBR) wherein 12 wt % U fuel elements are used to replace the standard 8.5 wt % U TRIGA fuel. The core configuration used to develop a calculational model was a 90-element hexagonal array, which is representative of the PSBR core, and consists of five hexagonal rings surrounding a central thimble containing water. The technique employed for refueling the core fully loaded with 8.5 wt % U fuel involves replacing 8.5 wt % U fuel with 12 wt % U fuel using an in-out reloading scheme. A batch reload consists of 6 new 12 wt % U fuel elements. Placing the 12 wt % U fuel in the B ring produces fuel temperatures ({approx}450 {sup o}C) that are well below the 800{sup o}C maximum limitation when the PSBR is operating at its maximum allowed power of 1 Megawatt. The advantages of using new 12 wt % U fuel to replace the burned up 8.5 wt % U fuel in the B ring over refueling strictly with 8.5 wt % U-Zr TRIGA fuel are clearly delineated in Table 1 where cost calculations used the General Atomic pre-1972 prices for TRIGA fuel, i.e., $1500 and $1650 for an 8.5 and 12 wt % U fuel element, respectively. Experimental results obtained to date utilizing the 12 wt % U fuel elements agree with the computed results. (author)

  7. Geology and History of Water-Containment Ponds at U12n, U12t, and U12e Tunnels, Rainier Mesa, Nevada National Security Site

    International Nuclear Information System (INIS)

    Huckins-Gang, H.; Townsend, M.

    2011-01-01

    Tunnels constructed in Rainier Mesa at the Nevada National Security Site (formerly Nevada Test Site) intersected water-producing areas (perched well above the regional groundwater system) during mining and drilling. There was enough overall sustained flow from three of the tunnel complexes (U12n, U12t, and U12e, also known as N-Tunnel, T-Tunnel, and E-Tunnel), that ponds were constructed in drainages below the portals to contain the discharged water. Water flow has now been blocked from N-Tunnel and T-Tunnel, and the ponds there are dry; however, E-Tunnel continues to produce water. The Underground Test Area Sub-Project of the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office is examining the possibility that contaminants from the tunnel complexes may be able to reach the regional groundwater flow system. Because some radiologically contaminated water was conveyed to these ponds, the ponds have been viewed as a potential source of groundwater contamination (in addition to the tunnel complexes themselves but part of the same hydrologic source term). Although the regional water table is very deep (greater than 305 meters [1,000 feet]) beneath the pond locations, some of the ponds were constructed on carbonate rocks, which some scientists think might provide a 'fast path' to the regional groundwater system. This report describes the geology and hydrologic conditions in the area of these three sets of tunnel ponds to aid in determining whether the ponds should be modeled as sources of contaminant migration. Data concerning the locations of the ponds, the volume of effluent discharged, and the concentration of tritium and other radionuclides in the water have been compiled from published and unpublished sources and included also.

  8. Path integral for coherent states of the dynamical U2 group and U2/1 supergroup

    International Nuclear Information System (INIS)

    Kochetov, E.A.

    1992-01-01

    A part-integral formulation in the representation of coherent states for the unitary U 2 group and U 2/1 supergroup is introduced. U 2 and U 2/1 path integrals are shown to be defined on the coset spaces U 2 /U 1 xU 1 and U 2/1 /U 1/1 xU 1 , respectively. These coset appears as curved classical phase spaces. Partition functions are expressed as path integrals over these spaces. In the case when U 2 and U 2/1 are the dynamical groups, the corresponding path integrals are evaluated with the help of linear fractional transformations that appear as the group (supergroup) action in the coset space (superspace). Possible applications for quantum models are discussed. 9 refs

  9. U(N) instantons on N=(1/2) superspace: Exact solution and geometry of moduli space

    International Nuclear Information System (INIS)

    Britto, Ruth; Feng Bo; Lunin, Oleg; Rey, Soo-Jong

    2004-01-01

    We construct the exact solution of one (anti-)instanton in N=(1/2) super Yang-Mills theory defined on non(anti-)commutative superspace. We first identify N=(1/2) superconformal invariance as maximal spacetime symmetry. For the gauge group U(2), the SU(2) part of the solution is given by the standard (anti-)instanton, but the U(1) field strength also turns out to be nonzero. The solution is SO(4) rotationally symmetric. For the gauge group U(N), in contrast with the U(2) case, we show that the entire U(N) part of the solution is deformed by non(anti-)commutativity and fermion zero modes. The solution is no longer rotationally symmetric; it is polarized into an axially symmetric configuration because of the underlying non(anti-)commutativity. We compute the 'information metric' of one (anti-)instanton. We find that the moduli space geometry is deformed from the hyperbolic space H 5 (Euclidean anti-de Sitter space) in a way anticipated from reduced spacetime symmetry. Remarkably, the volume measure of the moduli space turns out to be independent of the non(anti-)commutativity. Implications for D branes in the Ramond-Ramond flux background and the gauge-gravity correspondence are discussed

  10. 78 FR 18624 - U.S. Extractive Industries Transparency Initiative Multi-Stakeholder Group (USEITI MSG) Advisory...

    Science.gov (United States)

    2013-03-27

    ... DEPARTMENT OF THE INTERIOR Office of the Secretary [Docket No. ONRR-2012-0003] U.S. Extractive Industries Transparency Initiative Multi- Stakeholder Group (USEITI MSG) Advisory Committee AGENCY: Policy..., teleconference and the May 1-2, 2013, meeting of the United States Extractive Industries Transparency Initiative...

  11. 11 CFR 100.11 - State (2 U.S.C. 431(12)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false State (2 U.S.C. 431(12)). 100.11 Section 100.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) General Definitions § 100.11 State (2 U.S.C. 431(12)). State means each State of the United States, the District of...

  12. Minimal unitary realizations of exceptional U-duality groups and their subgroups as quasiconformal groups

    International Nuclear Information System (INIS)

    Gunaydin, Murat; Pavlyk, Oleksandr

    2005-01-01

    We study the minimal unitary representations of noncompact exceptional groups that arise as U-duality groups in extended supergravity theories. First we give the unitary realizations of the exceptional group E 8(-24) in SU*(8) as well as SU(6,2) covariant bases. E 8(-24) has E 7 x SU(2) as its maximal compact subgroup and is the U-duality group of the exceptional supergravity theory in d=3. For the corresponding U-duality group E 8(8) of the maximal supergravity theory the minimal realization was given. The minimal unitary realizations of all the lower rank noncompact exceptional groups can be obtained by truncation of those of E 8(-24) and E 8(8) . By further truncation one can obtain the minimal unitary realizations of all the groups of the 'Magic Triangle'. We give explicitly the minimal unitary realizations of the exceptional subgroups of E 8(-24) as well as other physically interesting subgroups. These minimal unitary realizations correspond, in general, to the quantization of their geometric actions as quasi-conformal groups. (author)

  13. Cleanup Summary Report for the Defense Threat Reduction Agency Fiscal Year 2007, Task 6.7, U12u-Tunnel (Legacy Site), Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    2008-01-01

    This letter serves as notice of completion for cleanup of the U12u-Tunnel (Legacy Site) as specified in the Defense Threat Reduction Agency (DTRA) Fiscal Year 2007 Statement of Work, Task 6.7. The U12u-Tunnel Legacy Site is located near the intersection of the U12u-Tunnel access road and the U12n-Tunnel access road in Area 12 of the Nevada Test Site (see Figure 1). The site encompasses 1.2 acres and was used to store miscellaneous mining equipment and materials that were used to support DTRA testing in Area 12. Field activities commenced February 11, 2008, and were completed February 20, 2008. Radiological surveys were performed on a drill jumbo and all material stored at the site. The drill jumbo was relocated to U12p-Tunnel portal and consolidated with other critical mining equipment for future use or storage. Ten truck loads of solid waste (53 tons) were shipped to the Nevada Test Site, Area 9 U10c Sanitary Landfill for disposal. No hazardous or radiological waste was generated at this site

  14. 12 CFR 7.5009 - Location under 12 U.S.C. 85 of national banks operating exclusively through the Internet.

    Science.gov (United States)

    2010-01-01

    ... operating exclusively through the Internet. 7.5009 Section 7.5009 Banks and Banking COMPTROLLER OF THE... under 12 U.S.C. 85 of national banks operating exclusively through the Internet. For purposes of 12 U.S.C. 85, the main office of a national bank that operates exclusively through the Internet is the...

  15. Transfer in the light Hg isotopes and the U(6/12) models

    International Nuclear Information System (INIS)

    Vergnes, M.; Grafeuille, S.; Rotbard, G.

    1985-01-01

    It was suggested recently that the level schemes of the odd Hg isotopes with 193 200 Hg, 198 Hg, 196 Hg(p,d) 199 Hg, 197 Hg, 195 Hg. The comparison of the experimental spectroscopic factors with the ones computed using the U(6/12) model shows that, among the three nuclei studied, 195 Hg and 197 Hg can be considered as reasonably described. The agreement in this case with U(6/12) is better in the U(5) limit than in the O(6) limit

  16. Contribution of meat to vitamin B-12, iron, and zinc intakes in five ethnic groups in the U.S.: Implications for developing food-based dietary guidelines

    Science.gov (United States)

    Sharma, Sangita; Sheehy, Tony; Kolonel, Laurence N

    2016-01-01

    Background To describe the sources of meat and their contributions to vitamin B-12, iron, and zinc in five ethnic groups in the USA. Methods Dietary data for the Multiethnic Cohort, established in Hawaii and Los Angeles, were collected using a quantitative food frequency questionnaire from more than 215,000 subjects aged 45–75 years at baseline (1993–1996). Participants included African American, Latino, Japanese American (JpAm), Native Hawaiian (NH) and Caucasian men and women. Servings of meat items were calculated based on the USDA recommendations and their contributions to intakes of total meat, red meat, vitamin B-12, iron, and zinc were determined. Results Of all types of meat, poultry contributed the most to meat consumption, followed by red meat and fish among all ethnicities, except for Latino (born in Mexico and Central/South America) men who consumed more beef. Lean beef was the most commonly consumed red meat for all ethnic-sex groups (9.3–14.3%), except for NH and JpAm men, and JpAm women whose top contributor was stew/curry with beef/lamb and stir-fried beef/pork with vegetables respectively. The contribution of meat was most substantial for zinc (11.1–29.3%) and vitamin B-12 (19.7–40%), and to a lesser extent for iron (4.3–14.2%). Conclusions This is the first large multiethnic cohort study to describe meat sources and their contributions to selected nutrients among ethnic minorities in the U.S. These findings may be used to develop ethnic-specific recommendations for meat consumption to improve dietary quality among these groups. PMID:23398393

  17. Geology of the U12n.07 UG-3 drill hole, area 12, Nevada Test Site

    International Nuclear Information System (INIS)

    Terry, S.S.; Cunningham, M.J.

    1975-11-01

    The U12n.07 UG-3 horizontal drill hole, located near the eastern edge of the center of Rainier Mesa, Nevada Test Site, was drilled to a total depth of 809 m (2,653 ft). This hole was drilled to further evaluate the tunnel-level stratigraph, and structure southwest of the U12n tunnel complex. The drill hole is collared in the middle of Tertiary tunnel bed 3A and penetrates upsection through tunnel beds 3 and 4 and terminates in subunit 4K, all of Tertiary age. Stratigraphy, structure, engineering geology, and physical properties and their relation to tunnel engineering are discussed

  18. 12 CFR 211.3 - Foreign branches of U.S. banking organizations.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Foreign branches of U.S. banking organizations. 211.3 Section 211.3 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Operations of U.S. Banking...

  19. Oral health status of two 12-year-old socially disadvantaged groups in South India: a comparative study.

    Science.gov (United States)

    Singh, Abhinav; Sequiera, Peter; Acharya, Shashidhar; Bhat, Maghashyam

    2011-01-01

    The aim of the present study was to compare and assess the oral health status of 12-year-old children from two socially disadvantaged groups in the Udupi district of South India. A total of 327 children were examined in Ashrama schools, and 340 children were randomly selected for comparison from other government schools. Modified WHO proforma was used for clinical examination. Oral hygiene practices, dental fluorosis, periodontal status, dentition status and dentofacial anomalies were assessed and compared. Chi square test was used for comparison between categorical variables and Mann-Whitney test for comparison between two groups for quantitative variables. P u 0.05 was considered as statistically significant. Dental fluorosis was detected in 22.9% children from Ashrama schools, whereas in the comparison group 14.4% children had dental fluorosis (P u 0.001). Mean Decayed teeth and DMFT value in Ashrama school children were 1.15 ± 1.62, and 1.15 ± 1.62, respectively. In the comparison group, the corresponding values were 0.46 ± 0.98 and 0.48 ± 1.04, respectively (P u 0.001). The mean number of sextants in the Ashrama school children with Community Periodontal Index score 2 was 2.00 ± 1.53, whereas in the comparison group it was 1.31 ± 1.53 (P u 0.001). No significant differences were noted between two groups with respect to Dental Aesthetic Index scores. The present study revealed higher levels of dental caries experience, untreated dental disease and social disadvantage of the children attending Ashrama schools, providing evidence for the need to address the health inequalities of these children.

  20. Renormalization group aspects of 3-dimensional Pure U(1) lattice gauge theory

    International Nuclear Information System (INIS)

    Gopfert, M.; Mack, G.

    1983-01-01

    A few surprises in a recent study of the 3-dimensional pure U(1) lattice gauge theory model, from the point of view of the renormalization group theory, are discussed. Since the gauge group U(1) of this model is abelian, the model is subject to KramersWannier duality transformation. One obtains a ferromagnet with a global symmetry group Z. The duality transformation shows that the surface tension alpha of the model equals the strong tension of the U(1) gauge model. A theorem to represent the true asymptotic behaviour of alpha is derived. A second theorem considers the correlation functions. Discrepiancies between the theorems result in a solution that ''is regarded as a catastrophe'' in renormalization group theory. A lesson is drawn: To choose a good block spin in a renormalization group procedure, know what the low lying excitations of the theory are, to avoid integrating some of them by mischief

  1. U.S.-GERMAN BILATERAL WORKING GROUP PHASE 3 ACTIVITIES-AN OVERVIEW

    Science.gov (United States)

    The U.S.-German Bilateral Working Group originated in 1990 in order to share and transfer information, ideas, tools and techniques regarding environmental research. The U.S. Environmental Protection Agency (EPA) and the German Federal Ministry for Education and Research (BMBF) de...

  2. Age differences in outcomes among patients in the "Stimulant Abuser Groups to Engage in 12-Step" (STAGE-12) intervention.

    Science.gov (United States)

    Garrett, Sharon B; Doyle, Suzanne R; Peavy, K Michelle; Wells, Elizabeth A; Owens, Mandy D; Shores-Wilson, Kathy; DiCenzo, Jessica; Donovan, Dennis M

    2018-01-01

    Emerging adults (roughly 18-29years) with substance use disorders can benefit from participation in twelve-step mutual-help organizations (TSMHO), however their attendance and participation in such groups is relatively low. Twelve-step facilitation therapies, such as the Stimulant Abuser Groups to Engage in 12-Step (STAGE-12), may increase attendance and involvement, and lead to decreased substance use. Analyses examined whether age moderated the STAGE-12 effects on substance use and TSMHO meeting attendance and participation. We utilized data from a multisite randomized controlled trial, with assessments at baseline, mid-treatment (week 4), end-of-treatment (week 8), and 3- and 6- months post-randomization. Participants were adults with DSM-IV diagnosed stimulant abuse or dependence (N=450) enrolling in 10 intensive outpatient substance use treatment programs across the U.S. A zero-inflated negative binomial random-effects regression model was utilized to examine age-by-treatment interactions on substance use and meeting attendance and involvement. Younger age was associated with larger treatment effects for stimulant use. Specifically, younger age was associated with greater odds of remaining abstinent from stimulants in STAGE-12 versus Treatment-as-Usual; however, among those who were not abstinent during treatment, younger age was related to greater rates of stimulant use at follow-up for those in STAGE-12 compared to TAU. There was no main effect of age on stimulant use. Younger age was also related to somewhat greater active involvement in different types of TSMHO activities among those in STAGE-12 versus TAU. There were no age-by-treatment interactions for other types of substance use or for treatment attendance, however, in contrast to stimulant use; younger age was associated with lower odds of abstinence from non-stimulant drugs at follow-up, regardless of treatment condition. These results suggest that STAGE-12 can be beneficial for some emerging adults

  3. Point group invariants in the Uqp(u(2)) quantum algebra picture

    International Nuclear Information System (INIS)

    Kibler, M.

    1993-07-01

    Some consequences of a qp-quantization of a point group invariant developed in the enveloping algebra of SU(2) are examined. A set of open problems concerning such invariants in the U qp (u(2)) quantum algebra picture is briefly discussed. (author) 18 refs

  4. Duality invariance of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory

    International Nuclear Information System (INIS)

    Dayi, Oemer F.; Kelleyane, Lara T.; Uelker, Kayhan

    2005-01-01

    A parent action is introduced to formulate (S-) dual of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory. Partition function for parent action in phase space is utilized to establish the equivalence of partition functions of the theories which this parent action produces. Thus, duality invariance of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory follows. The results which we obtained are valid at tree level or equivalently at the first order in the nonanticommutativity parameter C μν

  5. 12 CFR 268.601 - EEO group statistics.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false EEO group statistics. 268.601 Section 268.601... RULES REGARDING EQUAL OPPORTUNITY Matters of General Applicability § 268.601 EEO group statistics. (a... solely statistical purpose for which the data is being collected, the need for accuracy, the Board's...

  6. Solvability in D1,2(Ω) of the equation -Δu+c=Keu

    International Nuclear Information System (INIS)

    Duong Minh Duc.

    1989-06-01

    We establish the Sobolev inequality for a limiting case. Using this result, the Ekeland variational principle and our generalized critical values results we get the existence, nonexistence and nonuniqueness of solutions in D 1,2 (Ω) of the equation -Δu+c=Ke u . (author). 18 refs

  7. Sensitivity coefficients for the 238U neutron-capture shielded-group cross sections

    International Nuclear Information System (INIS)

    Munoz-Cobos, J.L.; de Saussure, G.; Perez, R.B.

    1981-01-01

    In the unresolved resonance region cross sections are represented with statistical resonance parameters. The average values of these parameters are chosen in order to fit evaluated infinitely dilute group cross sections. The sensitivity of the shielded group cross sections to the choice of mean resonance data has recently been investigated for the case of 235 U and 239 Pu by Ganesan and by Antsipov et al; similar sensitivity studies for 238 U are reported

  8. Physical Activity in U.S. Youth Aged 12-15 Years, 2012

    Science.gov (United States)

    ... Order from the National Technical Information Service NCHS Physical Activity in U.S. Youth Aged 12–15 Years, 2012 ... percentage of youth engaged in moderate-to-vigorous physical activity for at least 60 minutes each day? About ...

  9. Borehole Data Package for 216-U-12 Crib Well 299-W22-79

    International Nuclear Information System (INIS)

    DG Horton; BA Williams

    1999-01-01

    One new Resource Conservation and Recovery Act (RCRA) groundwater monitoring well was installed at the 216-U-12 crib in September 1998 in support of Tri-Parly Agreement (Ecology 1996) milestone M-24-36. The new well is 299-W22-79 and is a downgradient well in the groundwater monitoring network. There are a total of six wells in the groundwater monitoring network for the 216-U-12 crib and their locations are shown on Figure 1. The groundwater assessment monitoring plan for the 216-U-12 crib (Chou and Williams 1993) describes the hydrogeology of the 200 West Area and the 216-U-12 crib area. An Interim Change Notice to the assessment plan provides justification for the well (Chou and Williams 1997). The new well was constructed to the specifications and requirements described in Washington Administrative Code (WAC) 173-160, and WAC-173-303, and in Chou and Williams (1997). This document compiles information on the drilling and construction, well development and permanent pump installation applicable to well 299-W22-79. Appendix A contains the geologist's log, the Well Construction Summary Report, and Well Summary Sheet (as-built diagram). Additional documentation concerning well construction is on file with Bechtel Hanford, Inc., Richland, Washington. English units are used in this report because they are used by drillers to measure and report depths and well construction details. The conversion is made by multiplying feet by 0.3048 to obtain meters; or multiplying inches by 2.54 to obtain centimeters

  10. Facility Closure Report for T-Tunnel (U12T), Area 12, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    2008-01-01

    This Facility Closure Report (FCR) has been prepared to document the actions taken to permanently close the remaining accessible areas of U12t-Tunnel (T-Tunnel) in Area 12 of the Nevada Test Site (NTS). The closure of T-Tunnel was a prerequisite to transfer facility ownership from the Defense Threat Reduction Agency (DTRA) to the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office (NNSA/NSO). Closure of the facility was accomplished with the cooperation and concurrence of both NNSA/NSO and the Nevada Division of Environmental Protection (NDEP). The purpose of this FCR is to document that the closure of T-Tunnel complied with the closure requirements specified in the Facility Closure Plan for N- and T-Tunnels Area 12, Nevada Test Site (Appendix D) and that the facility is ready for transfer to NNSA/NSO. The Facility Closure Plan (FCP) is provided in Appendix D. T-Tunnel is located approximately 42 miles north of Mercury in Area 12 of the NTS (Figure 1). Between 1970 and 1987, T-Tunnel was used for six Nuclear Weapons Effects Tests (NWETs). The tunnel was excavated horizontally into the volcanic tuffs of Rainier Mesa. The T-Tunnel complex consists of a main access drift with two NWET containment structures, a Gas Seal Plug (GSP), and a Gas Seal Door (GSD) (Figure 2). The T-Tunnel complex was mothballed in 1993 to preserve the tunnel for resumption of testing, should it happen in the future, to stop the discharge of tunnel effluent, and to prevent unauthorized access. This was accomplished by sealing the main drift GSD

  11. Lusztig symmetries and Poincare-Birkhoff-Witt basis for wU{sub r,s}{sup d}(osp(1|2n))

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Junli [Mathematics and Information College, Langfang Teachers' College, Langfang 065000 (China); College of Applied Sciences, Beijing University of Technology, Beijing 100124 (China); Yang, Shilin [College of Applied Sciences, Beijing University of Technology, Beijing 100124 (China)

    2013-12-15

    We investigate a new kind of two-parameter weak quantized superalgebra wU{sub r,s}{sup d}(osp(1|2n)), which is a weak Hopf superalgebra. It has a homomorphic image which is isomorphic to the usual two-parameter quantum superalgebra U{sub r,s}(osp(1|2n)) of osp(1|2n). We also discuss the basis of wU{sub r,s}{sup d}(osp(1|2n)) by Lusztig's symmetries.

  12. 7 CFR 318.13-12 - Movement by the U.S. Department of Agriculture.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Movement by the U.S. Department of Agriculture. 318.13-12 Section 318.13-12 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE STATE OF HAWAII AND TERRITORIES QUARANTINE...

  13. 216-U-12 Crib supplemental information to the Hanford Facility Contingency Plan (DOE/RL-93-75)

    International Nuclear Information System (INIS)

    Ingle, S.J.

    1996-05-01

    This document is a unit-specific contingency plan for the 216-U-12 Crib and is intended to be used as a supplement to DOE/RL-93-75, Hanford Facility Contingency Plan (DOE-RL 1993). This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of the Washington Administrative Code, Chapter 173- 303 for certain Resource Conservation and Recovery Act of 1976 waste management units. The 216-U-12 Crib is a landfill that received waste from the 291-U-1 Stack, 244-WR Vault, 244-U via tank C-5, and the UO 3 Plant. The crib pipeline was cut and permanently capped in 1988, and the crib has been backfilled. The unit will be closed under final facility standards. Waste management activities are no longer required at the unit. The crib does not present a significant hazard to adjacent units, personnel, or the environment. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the 216-U-12 Crib

  14. U.S. Environmental Protection Agency, Region 6 National Priorities List (NPL) Sites - 05/12/2014

    Data.gov (United States)

    U.S. Environmental Protection Agency — Point locations for sites in U.S. Environmental Protection Agency, Region 6 which are documented as being part of the National Priorities List as of May 12, 2014....

  15. IAEA INTOR Workshop report, group 12

    International Nuclear Information System (INIS)

    1980-01-01

    This report gives the material for the IAEA INTOR Workshop for data base discussion in Group 12, Start-up, Burn and Shutdown. Number of problem areas from the generation of a plasma to the termination of the discharge are covered, which should be assessed to develop a scenario for sustaining a plasma for the whole duration of a pulse. The reactor relevant burn pulse is also assessed. (author)

  16. EnviroAtlas - Percent of Each 12-Digit HUC in the Contiguous U.S. with Potentially Restorable Wetlands

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset shows the percent of each 12-digit Hydrologic Unit (HUC) subwatershed in the contiguous U.S. with potentially restorable wetlands. Beginning...

  17. Friction stir processing on high carbon steel U12

    Energy Technology Data Exchange (ETDEWEB)

    Tarasov, S. Yu., E-mail: tsy@ispms.ru; Rubtsov, V. E., E-mail: rvy@ispms.ru [Institute of Strength Physics and Materials Science SB RAS, Tomsk, 634055 (Russian Federation); National Research Tomsk Polytechnic University, Tomsk, 634050 (Russian Federation); Melnikov, A. G., E-mail: melnikov-ag@tpu.ru [National Research Tomsk Polytechnic University, Tomsk, 634050 (Russian Federation)

    2015-10-27

    Friction stir processing (FSP) of high carbon steel (U12) samples has been carried out using a milling machine and tools made of cemented tungsten carbide. The FSP tool has been made in the shape of 5×5×1.5 mm. The microstructural characterization of obtained stir zone and heat affected zone has been carried out. Microhardness at the level of 700 MPa has been obtained in the stir zone with microstructure consisting of large grains and cementitte network. This high-level of microhardness is explained by bainitic reaction developing from decarburization of austenitic grains during cementite network formation.

  18. quatre-quart1 is an indispensable U12 intron-containing gene that plays a crucial role in Arabidopsis development.

    Science.gov (United States)

    Kwak, Kyung Jin; Kim, Bo Mi; Lee, Kwanuk; Kang, Hunseung

    2017-05-17

    Despite increasing understanding of the importance of the splicing of U12-type introns in plant development, the key question of which U12 intron-containing genes are essential for plant development has not yet been explored. Here, we assessed the functional role of the quatre-quart1 (QQT1) gene, one of the ~230 U12 intron-containing genes in Arabidopsis thaliana. Expression of QQT1 in the U11/U12-31K small nuclear ribonucleoprotein mutant (31k) rescued the developmental-defect phenotypes of the 31k mutant, whereas the miRNA-mediated qqt1 knockdown mutants displayed severe defects in growth and development, including severely arrested stem growth, small size, and the formation of serrated leaves. The structures of the shoot apical meristems in the qqt1 mutants were abnormal and disordered. Identification of QQT1-interacting proteins via a yeast two-hybrid screening and a firefly luciferase complementation-imaging assay revealed that a variety of proteins, including many chloroplast-targeted proteins, interacted with QQT1. Importantly, the levels of chloroplast-targeted proteins in the chloroplast were reduced, and the chloroplast structure was abnormal in the qqt1 mutant. Collectively, these results provide clear evidence that QQT1 is an indispensable U12 intron-containing gene whose correct splicing is crucial for the normal development of Arabidopsis. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  19. Environmental Working Group Joint U.S.-Russian Atlas of the Arctic Ocean

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Environmental Working Group (EWG) was established in June 1995 under the framework of the U.S.-Russian Joint Commission on Economic and Technological...

  20. U.S. Geological Survey investigations in connection with the dining car event, U12e.18 tunnel, rainier mesa, Nevada test site

    International Nuclear Information System (INIS)

    1978-06-01

    The Dining Car event was a Defense Nuclear Agency nuclear weapons test located in the U12e.18 drift of the E-tunnel complex, central Rainier Mesa, Area 12, Nevada Test Site. The main drift and bypass drift were mined in zeolitized tuff to a total length of 544 m (1,785 ft). The overburden thickness above the experiment is approximately 396 m (1,300 ft) in the U12e.18 area. The pre-Tertiary surface, which is most probably quartzite in this area, is located approximately 243.8 to 274.3 m (800 to 900 ft) below tunnel level. Site geology and geophysical investigations were made in one vertical and two horizontal drill holes prior to mining of the U12e.18 drift. Electric logs in the two horizontal holes indicate no extensive zones of argillization which might create problems in tunnelling. Geophysical logs in the vertical exploratory hole suggest that the tuff is saturated at a depth of about 244 m (800 ft). Electric logs in all three holes show a pronounced signature in tunnel bed 4J. Seismic velocities obtained in the tunnel after mining compare favorably with sonic velocities obtained in one hole by means of a sonic probe, indicating that the bulk geologic structure is not significant in affecting seismic-wave propagation. This condition is not always observed in such comparisons. A repeat seismic survey in the tunnel showed no change in seismic velocity 4 months after mining. In situ stresses determined by the overcore technique are within experience for the Rainier Mesa tunnel complex

  1. U-Pb ages of detrital zircon from Pegasus Group, Stewart Island

    International Nuclear Information System (INIS)

    Walker, N.; Tulloch, A.J.; Allibone, A.

    1998-01-01

    Stewart Island (New Zealand) is relatively unaffected by Cenozoic deformation related to the present-day plate boundary and has thus been a locale of investigations that focus on the relationship between Mesozoic continental margin magmatic rocks and the Western Province (WP) of NZ. Pegasus Group metasedimentary rocks represent the only candidate for WP equivalents on Stewart Island. We measured U-Pb and 207 Pb / 206 Pb ages of detrital zircons from the Pegasus Group in an effort to validate the correlation with the WP. On SI, Pegasus Group is exposed over a small area in the southern Tin Range where it forms amphibolite facies roof pendants and screens among plutons of mid Paleozoic to mid Cretaceous age. Mica schists predominate, with lesser amounts of psammite and metaquartzite and rare calcareous schist and amphibolite. Zircons were extracted from metaquarzite and 24 grains were chosen on the basis of morphology for geochronologic investigation. Sixteen single crystals were dated by U-Pb TIMS; 8 additional grains were studied by the total evaporation method described by Kober. Despite vigorous air abrasion prior to processing, the 16 grains measured by conventional U-Pb TIMS yielded slightly normally discordant ages that we interpret to reflect minor Pb-loss. The 8 grains studied by the total evaporation method yielded more than four analytically identical /sup 207 Pb / 206 Pb ages within each grain at progressively higher temperatures (1515-1580 degrees C) of evaporation. The results permit the following general conclusions: 1) the age range of 420-2700 Ma is grossly similar to that reported from the Greenland Group/Victoria Paragneiss (Ireland 1992) of the Buller Terrane, WP; 2) the zircon population is dominantly 530-680 Ma but a subsidiary population is 900-1100 Ma; 3) no zircons with ages that match the timing of the Ross Orogen (530-480 Ma) were identified; 4) two grains of 420 Ma and a 453 Ma are probably too young for the paleontogically

  2. Refractory Research Group - U.S. DOE, Albany Research Center [Institution Profile

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, James P.

    2004-09-01

    The refractory research group at the Albany Research Center (ARC) has a long history of conducting materials research within the U.S. Bureau of Mines, and more recently, within the U.S. Dept. of Energy. When under the U.S. Bureau of Mines, research was driven by national needs to develop substitute materials and to conserve raw materials. This mission was accomplished by improving refractory material properties and/or by recycling refractories using critical and strategic materials. Currently, as a U.S. Dept of Energy Fossil Energy field site, research is driven primarily by the need to assist DOE in meeting its vision to develop economically and environmentally viable technologies for the production of electricity from fossil fuels. Research at ARC impacts this vision by: • Providing information on the performance characteristics of materials being specified for the current generation of power systems; • Developing cost-effective, high performance materials for inclusion in the next generation of fossil power systems; and • Solving environmental emission and waste problems related to fossil energy systems. A brief history of past refractory research within the U.S. Bureau of Mines, the current refractory research at ARC, and the equipment and capabilities used to conduct refractory research at ARC will be discussed.

  3. Star of AOXiang: An innovative 12U CubeSat to demonstrate polarized light navigation and microgravity measurement

    Science.gov (United States)

    Yu, Xiaozhou; Zhou, Jun; Zhu, Peijie; Guo, Jian

    2018-06-01

    Most of the CubeSats have a volume range from 1U to 3U, which limits their applications due to the difficulty of miniaturizing payloads. To facilitate the needs on a larger but low-cost satellite platform, the AOXiang (AOX) project has been developed by Northwestern Polytechnical University (NPU). The primary objectives of AOX project are four-folds: 1) To demonstrate the world first 12U CubeSat Star of AOXiang and 12U orbit deployer which uses an innovative electromagnetic unlocking technology. 2) To investigate the feasibility of using polarized sunlight for spacecraft attitude determination and navigation, and perform microgravity research using a miniaturized gravimeter. 3) To test a fault tolerant on-board computer using the System On the Programmable Chip (SOPC) technology, and 4) To gain the experience from developing the CubeSat and the subsystems. The CubeSat was launched in June 2016. Now, the mission has achieved all the goals. This paper provides the detail information of the AOX project, with a focus on the introduction of the subsystems of the 12U CubeSat, the orbit deployer and the payloads. The recent in-orbit results of the first NPU are also presented. In addition to the educational objective that has been reached with more than 50 young scholars and students participated in the project.

  4. Comparative investigation of the solution species [U(CO3)5]6- and the crystal structure of Na6[U(CO3)5].12H2O.

    Science.gov (United States)

    Hennig, Christoph; Ikeda-Ohno, Atsushi; Emmerling, Fanziska; Kraus, Werner; Bernhard, Gert

    2010-04-21

    The limiting U(IV) carbonate species in aqueous solution was investigated by comparing its structure parameters with those of the complex preserved in a crystal structure. The solution species prevails in aqueous solution of 0.05 M U(IV) and 1 M NaHCO(3) at pH 8.3. Single crystals of Na(6)[U(CO(3))(5)].12H(2)O were obtained directly from this mother solution. The U(IV) carbonate complex in the crystal structure was identified as a monomeric [U(CO(3))(5)](6-) anionic complex. The interatomic distances around the U(IV) coordination polyhedron show average distances of U-O = 2.461(8) A, U-C = 2.912(4) A and U-O(dist) = 4.164(6) A. U L(3)-edge EXAFS spectra were collected from the solid Na(6)[U(CO(3))(5)].12H(2)O and the corresponding solution. The first shell of the Fourier transforms (FTs) revealed, in both samples, a coordination of ten oxygen atoms at an average U-O distance of 2.45 +/- 0.02 A, the second shell originates from five carbon atoms with a U-C distance of 2.91 +/- 0.02 A, and the third shell was fit with single and multiple scattering paths of the distal oxygen at 4.17 +/- 0.02 A. These data indicate the identity of the [U(CO(3))(5)](6-) complex in solid and solution state. The high negative charge of the [U(CO(3))(5)](6-) anion is compensated by Na(+) cations. In solid state the Na(+) cations form a bridging network between the [U(CO(3))(5)](6-) units, while in liquid state the Na(+) cations seem to be located close to the anionic complex. The average metal-oxygen distances of the coordination polyhedron show a linear correlation to the radius contraction of the neighbouring actinide(IV) ions and indicate the equivalence of the [An(CO(3))(5)](6-) coordination within the series of thorium, uranium, neptunium and plutonium.

  5. What is special about the group of the standard model?

    Science.gov (United States)

    Nielsen, H. B.; Brene, N.

    1989-06-01

    The standard model is based on the algebra of U 1×SU 2×SU 3. The systematics of charges of the fundamental fermions seems to suggest the importance of a particular group having this algebra, viz. S(UU 3). This group is distinguished from all other connected compact non semisimple groups with dimensionality up to 12 by a characteristic property: it is very “skew”. By this we mean that the group has relatively few “generalised outer automorphisms”. One may speculate about physical reasons for this fact.

  6. What is special about the group of the standard model?

    International Nuclear Information System (INIS)

    Nielsen, H.B.; Brene, N.

    1989-03-01

    The standard model is based on the algebra of U 1 xSU 2 xSU 3 . The systematics of charges of the fundamental fermions seems to suggest the importance of a particular group having this algebra, viz. S(U 2 xU 3 ). This group is distinguished from all other connected compact non semisimple groups with dimensionality up to 12 by a characteristic property: it is very 'skew'. By this we mean that the group has relatively few 'generalised outer automorphisms'. One may speculate about physical reasons for this fact. (orig.)

  7. Selective removal of U(VI) from low concentration wastewater by functionalized HKUST-1@H3PW12O40

    International Nuclear Information System (INIS)

    Hui Zhang; Jinhua Xue; Nan Hu; Jing Sun; Dexin Ding; Yongdong Wang; Le Li

    2016-01-01

    The adsorption of U(VI) from low concentration solution by HKUST-1@H 3 PW 12 O 40 was studied as a function of various experimental parameters including pH, interfering ions, contact time, initial uranium concentration and temperature by batch experiments. Equilibrium data were found to fit with Langmuir isotherm model better than Freundlich isotherm model. The kinetic adsorption was fitted by the pseudo-second-order model well. Thermodynamic data from the adsorption experiments indicate that adsorption process is spontaneous and endothermic. HKUST-1@H 3 PW 12 O 40 can selectively adsorb U(VI) from multi-metal ion solutions and the adsorption capacity of HKUST-1@H 3 PW 12 O 40 don't decrease significantly after three cycles of desorption-reuse. The results show that HKUST-1@H 3 PW 12 O 40 is suitable for removal of U(VI) from low concentration solutions. (author)

  8. Sulforaphane inhibits invasion via activating ERK1/2 signaling in human glioblastoma U87MG and U373MG cells.

    Directory of Open Access Journals (Sweden)

    Chunliu Li

    Full Text Available Glioblastoma has highly invasive potential, which might result in poor prognosis and therapeutic failure. Hence, the key we study is to find effective therapies to repress migration and invasion. Sulforaphane (SFN was demonstrated to inhibit cell growth in a variety of tumors. Here, we will further investigate whether SFN inhibits migration and invasion and find the possible mechanisms in human glioblastoma U87MG and U373MG cells.First, the optimal time and dose of SFN for migration and invasion study were determined via cell viability and cell morphological assay. Further, scratch assay and transwell invasion assay were employed to investigate the effect of SFN on migration and invasion. Meanwhile, Western blots were used to detect the molecular linkage among invasion related proteins phosphorylated ERK1/2, matrix metalloproteinase-2 (MMP-2 and CD44v6. Furthermore, Gelatin zymography was performed to detect the inhibition of MMP-2 activation. In addition, ERK1/2 blocker PD98059 (25 µM was integrated to find the link between activated ERK1/2 and invasion, MMP-2 and CD44v6.The results showed that SFN (20 µM remarkably reduced the formation of cell pseudopodia, indicating that SFN might inhibit cell motility. As expected, scratch assay and transwell invasion assay showed that SFN inhibited glioblastoma cell migration and invasion. Western blot and Gelatin zymography showed that SFN phosphorylated ERK1/2 in a sustained way, which contributed to the downregulated MMP-2 expression and activity, and the upregulated CD44v6 expression. These molecular interactions resulted in the inhibition of cell invasion.SFN inhibited migration and invasion processes. Furthermore, SFN inhibited invasion via activating ERK1/2 in a sustained way. The accumulated ERK1/2 activation downregulated MMP-2 expression and decreased its activity and upregulated CD44v6. SFN might be a potential therapeutic agent by activating ERK1/2 signaling against human glioblastoma.

  9. The State of Wiki Usage in U.S. K-12 Schools: Leveraging Web 2.0 Data Warehouses to Study Quality and Equality in Online Learning Environments

    Science.gov (United States)

    Reich, Blair Justin Fire

    2012-01-01

    In the first part of this dissertation, I document wiki usage in U.S. K-12 settings by analyzing data on a representative sample drawn from a population of nearly 180,000 wikis. My research group, which I lead and managed, measured the opportunities wikis provide for students to develop 21st century skills such as expert thinking, complex…

  10. 28 CFR 522.12 - Relationship between existing criminal sentences imposed under the U.S. or D.C. Code and new...

    Science.gov (United States)

    2010-07-01

    ... sentences imposed under the U.S. or D.C. Code and new civil contempt commitment orders. 522.12 Section 522..., AND TRANSFER ADMISSION TO INSTITUTION Civil Contempt of Court Commitments § 522.12 Relationship between existing criminal sentences imposed under the U.S. or D.C. Code and new civil contempt commitment...

  11. 78 FR 64525 - U.S. Extractive Industries Transparency Initiative Multi-Stakeholder Group (USEITI MSG) Advisory...

    Science.gov (United States)

    2013-10-29

    ... DEPARTMENT OF THE INTERIOR Office of the Secretary [Docket No. ONRR-2012-0003; DS63600000 DR2PS0000.PX8000 134D0102R2] U.S. Extractive Industries Transparency Initiative Multi- Stakeholder Group...: This notice announces the rescheduling of the U.S. Extractive Industries Transparency Initiative...

  12. A Historical Evaluation of the U12n Tunnel, Nevada National Security Site, Nye County, Nevada Part 1

    Energy Technology Data Exchange (ETDEWEB)

    Drollinger, Harold [DRI; Jones, Robert C [DRI; Bullard, Thomas F [DRI; Ashbaugh, Laurence J [DRI; Griffin, Wayne R [DRI

    2011-06-01

    This report presents a historical evaluation of the U12n Tunnel on the Nevada National Security Site (NNSS) in southern Nevada. The work was conducted by the Desert Research Institute at the request of the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office and the U.S. Department of Defense, Defense Threat Reduction Agency (DTRA). The U12n Tunnel was one of a series of tunnels used for underground nuclear weapons effects tests in Rainier and Aqueduct Mesas. A total of 22 nuclear tests were conducted in the U12n Tunnel from 1967 to 1992. These tests include Midi Mist, Hudson Seal, Diana Mist, Misty North, Husky Ace, Ming Blade, Hybla Fair, Mighty Epic, Diablo Hawk, Miners Iron, Huron Landing, Diamond Ace, Mini Jade, Tomme/Midnight Zephyr, Misty Rain, Mill Yard, Diamond Beech, Middle Note, Misty Echo, Mineral Quarry, Randsburg, and Hunters Trophy. DTRA sponsored all tests except Tomme and Randsburg which were sponsored by the Lawrence Livermore National Laboratory. Midnight Zephyr, sponsored by DTRA, was an add on experiment to the Tomme test. Eleven high explosive tests were also conducted in the tunnel and included a Stemming Plan Test, the Pre-Mill Yard test, the two seismic Non-Proliferation Experiment tests, and seven Dipole Hail tests. The U12n Tunnel complex is composed of the portal and mesa areas, encompassing a total area of approximately 600 acres (240 hectares). Major modifications to the landscape have resulted from four principal activities. These are road construction and maintenance, mining activities related to development of the tunnel complex, site preparation for activities related to testing, and construction of retention ponds. A total of 202 cultural features were recorded for the portal and mesa areas. At the portal area, features relate to the mining, construction, testing, and general everyday operational support activities within the tunnel. These include concrete foundations for buildings, ventilation

  13. 76 FR 14950 - Closed Meeting of the U.S. Strategic Command Strategic Advisory Group

    Science.gov (United States)

    2011-03-18

    ... DEPARTMENT OF DEFENSE Office of the Secretary Closed Meeting of the U.S. Strategic Command Strategic Advisory Group AGENCY: Department of Defense. ACTION: Notice of advisory committee closed meeting.... Strategic Command Strategic Advisory Group. DATES: April 7, 2011, from 8 a.m. to 5 p.m. and April 8, 2011...

  14. Lie Algebras Associated with Group U(n)

    International Nuclear Information System (INIS)

    Zhang Yufeng; Dong Huanghe; Honwah Tam

    2007-01-01

    Starting from the subgroups of the group U(n), the corresponding Lie algebras of the Lie algebra A 1 are presented, from which two well-known simple equivalent matrix Lie algebras are given. It follows that a few expanding Lie algebras are obtained by enlarging matrices. Some of them can be devoted to producing double integrable couplings of the soliton hierarchies of nonlinear evolution equations. Others can be used to generate integrable couplings involving more potential functions. The above Lie algebras are classified into two types. Only one type can generate the integrable couplings, whose Hamiltonian structure could be obtained by use of the quadratic-form identity. In addition, one condition on searching for integrable couplings is improved such that more useful Lie algebras are enlightened to engender. Then two explicit examples are shown to illustrate the applications of the Lie algebras. Finally, with the help of closed cycling operation relations, another way of producing higher-dimensional Lie algebras is given.

  15. Corrective action baseline report for underground storage tanks 0439-U, 0440-U, 2073-U, 2074-U, and 2075-U at the East End Fuel Station, Buildings 9754 and 9754-2, Oak Ridge Y-12 Plant, Oak Ridge, Tennessee, Facility ID No. 0-010117

    International Nuclear Information System (INIS)

    1994-01-01

    The purpose of this report is to provide baseline geochemical and hydrogeologic data relative to corrective action for underground storage tanks (USTs) 0439-U, 0440-U, 2073-U, 2074-U, and 2075-U at the East End Fuel Station, Buildings 9754 and 9754-2 at the Oak Ridge Y-12 Plant. Progress in support of corrective action at the East End Fuel Station has included monitoring well installation, tank removal, and baseline groundwater sampling and analysis. This document represents the baseline report for corrective action at the East End Fuel Station and is organized into three sections. Section 1 presents introductory information relative to the site, including the regulatory initiative, site description, and progress to date. Section 2 includes a summary of additional monitoring well installation activities, the results of baseline groundwater sampling, a summary of tank removal activities, and the results of confirmatory soil sampling performed during tank removal. Section 3 presents the baseline hydrogeology and planned zone of influence for groundwater remediation

  16. The Fourier U(2 Group and Separation of Discrete Variables

    Directory of Open Access Journals (Sweden)

    Kurt Bernardo Wolf

    2011-06-01

    Full Text Available The linear canonical transformations of geometric optics on two-dimensional screens form the group Sp(4,R, whose maximal compact subgroup is the Fourier group U(2_F; this includes isotropic and anisotropic Fourier transforms, screen rotations and gyrations in the phase space of ray positions and optical momenta. Deforming classical optics into a Hamiltonian system whose positions and momenta range over a finite set of values, leads us to the finite oscillator model, which is ruled by the Lie algebra so(4. Two distinct subalgebra chains are used to model arrays of N^2 points placed along Cartesian or polar (radius and angle coordinates, thus realizing one case of separation in two discrete coordinates. The N^2-vectors in this space are digital (pixellated images on either of these two grids, related by a unitary transformation. Here we examine the unitary action of the analogue Fourier group on such images, whose rotations are particularly visible.

  17. Differences in spirometry values between U.S. children 6-11 years and adolescents 12-19 years with current asthma, 2007-2010.

    Science.gov (United States)

    Kit, Brian K; Simon, Alan E; Tilert, Timothy; Okelo, Sande; Akinbami, Lara J

    2016-03-01

    National Asthma Education and Prevention Program (NAEPP) guidelines recommend that periodic spirometry be performed in youth with asthma. NAEPP uses different spirometry criteria to define uncontrolled asthma for children (6-11 years) and adolescents (12+ years). To describe differences in spirometry between U.S. children and adolescents with current asthma. We examined cross-sectional spirometry data from 453 U.S. youth with current asthma age 6-19 years from the 2007-2010 National Health and Nutrition Examination Surveys. The main outcomes were percentage predicted forced expiratory volume at 1 sec (FEV1%) ≤80 and the ratio of FEV1 to forced vital capacity (FEV1/FVC) ≤0.80. We also examined the prevalence of youth with spirometry values consistent with uncontrolled asthma, using NAEPP age-specific criteria, defined for children aged 6-11 years as FEV1% ≤80 or FEV1/FVC ≤0.80, and for adolescents aged 12-19 years as FEV1% ≤80. Children 6-11 years and adolescents 12-19 years did not differ in prevalence of FEV1% ≤80 (10.1% vs. 9.0%) or FEV1/FVC ≤0.80 (30.6% vs. 29.8%). However, based on the NAEPP age-specific criteria, 33.0% of children 6-11 years and 9.0% of adolescents 12-19 years had spirometry values consistent with uncontrolled asthma (P spirometry values consistent with uncontrolled asthma did differ. The difference appears to stem mainly from the different spirometry criteria for the two age groups. © 2015 Wiley Periodicals, Inc.

  18. Research Award: Policy and Planning Group (PPG) Deadline: 12 ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Jean-Claude Dumais

    2012-09-12

    Sep 12, 2012 ... mentorship in research, research management, and grant administration allows research awardees to pursue their research goals in a dynamic team environment in one of the world's leaders in generating new knowledge to meet global challenges. The Policy and Planning Group (PPG) is responsible for ...

  19. A Historical Evaluation of the U12t Tunnel, Nevada Test Site, Nye County, Nevada, Volume 6 of 6

    Energy Technology Data Exchange (ETDEWEB)

    Harold Drollinger; Robert C. Jones; and Thomas F. Bullard; Desert Research Institute, Laurence J. Ashbaugh, Southern Nevada Courier Service and Wayne R. Griffin, Stoller-Navarro Joint Venture

    2009-02-01

    This report presents a historical evaluation of the U12t Tunnel on the Nevada Test Site in southern Nevada. The work was conducted by the Desert Research Institute at the request of the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office and the U.S. Department of Defense, Defense Threat Reduction Agency (DTRA). The U12t Tunnel is one of a series of tunnels used for underground nuclear weapons effects tests on the east side of Rainier and Aqueduct Mesas. Six nuclear weapons effects tests, Mint Leaf, Diamond Sculls, Husky Pup, Midas Myth/Milagro, Mighty Oak, and Mission Ghost, and one high explosive test, SPLAT, were conducted within the U12t Tunnel from 1970 to 1987. All six of the nuclear weapons effects tests and the high explosive test were sponsored by DTRA. Two conventional weapons experiments, Dipole Knight and Divine Eagle, were conducted in the tunnel portal area in 1997 and 1998. These experiments were sponsored by the Defense Special Weapons Agency. The U12t Tunnel complex is composed of the Portal and Mesa Areas and includes an underground tunnel with a main access drift and nine primary drifts, a substantial tailings pile fronting the tunnel portal, a series of discharge ponds downslope of the tailings pile, and two instrumentation trailer parks and 16 drill holes on top of Aqueduct Mesa. A total of 89 cultural features were recorded: 54 at the portal and 35 on the mesa. In the Portal Area, cultural features are mostly concrete pads and building foundations; other features include the portal, rail lines, the camel back, ventilation and cooling system components, communication equipment, and electrical equipment. On the mesa are drill holes, a few concrete pads, a loading ramp, and electrical equipment.

  20. A Historical Evaluation of the U12t Tunnel, Nevada Test Site, Nye County, Nevada, Volume 1 of 6

    Energy Technology Data Exchange (ETDEWEB)

    Drollinger, Harold [Desert Research Institute (DRI), Nevada System of Higher Education, Reno,NV (United States); Jones, Robert C. [Desert Research Institute (DRI), Nevada System of Higher Education, Reno,NV (United States); Bullard, Thomas F. [Desert Research Institute (DRI), Nevada System of Higher Education, Reno,NV (United States); Ashbaugh, Laurence J. [Southern Nevada Courier Service, NV (United States); Griffin, Wayne R. [Stoller-Navarro Joint Venture, Las Vegas, NV (United States)

    2009-02-01

    This report presents a historical evaluation of the U12t Tunnel on the Nevada Test Site in southern Nevada. The work was conducted by the Desert Research Institute at the request of the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office and the U.S. Department of Defense, Defense Threat Reduction Agency (DTRA). The U12t Tunnel is one of a series of tunnels used for underground nuclear weapons effects tests on the east side of Rainier and Aqueduct Mesas. Six nuclear weapons effects tests, Mint Leaf, Diamond Sculls, Husky Pup, Midas Myth/Milagro, Mighty Oak, and Mission Ghost, and one high explosive test, SPLAT, were conducted within the U12t Tunnel from 1970 to 1987. All six of the nuclear weapons effects tests and the high explosive test were sponsored by DTRA. Two conventional weapons experiments, Dipole Knight and Divine Eagle, were conducted in the tunnel portal area in 1997 and 1998. These experiments were sponsored by the Defense Special Weapons Agency. The U12t Tunnel complex is composed of the Portal and Mesa Areas and includes an underground tunnel with a main access drift and nine primary drifts, a substantial tailings pile fronting the tunnel portal, a series of discharge ponds downslope of the tailings pile, and two instrumentation trailer parks and 16 drill holes on top of Aqueduct Mesa. A total of 89 cultural features were recorded: 54 at the portal and 35 on the mesa. In the Portal Area, cultural features are mostly concrete pads and building foundations; other features include the portal, rail lines, the camel back, ventilation and cooling system components, communication equipment, and electrical equipment. On the mesa are drill holes, a few concrete pads, a loading ramp, and electrical equipment.

  1. Environmental Working Group Joint U.S.-Russian Atlas of the Arctic Ocean, Version 1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Environmental Working Group (EWG) was established in June 1995 under the framework of the U.S.-Russian Joint Commission on Economic and Technological...

  2. What is special about the group of the standard model

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, H.B.; Brene, N.

    1989-06-15

    The standard model is based on the algebra of U/sub 1/xSU/sub 2/xSU/sub 3/. The systematics of charges of the fundamental fermions seems to suggest the importance of a particular group having this algebra, viz. S(U/sub 2/xU/sub 3/). This group is distinguished from all other connected compact non semisimple groups with dimensionality up to 12 by a characteristic property: it is very ''skew''. By this we mean that the group has relatively few ''generalised outer automorphisms''. One may speculate about physical reasons for this fact. (orig.).

  3. 7 CFR 3401.12 - Establishment and operation of peer review groups.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Establishment and operation of peer review groups... GRANTS PROGRAM Scientific Peer Review of Research Applications for Funding § 3401.12 Establishment and operation of peer review groups. Subject to § 3401.7, the Administrator will adopt procedures for the...

  4. Addendum to the corrective action plan for Underground Storage Tanks 1219-U, 1222-U, 2082-U, 2068-U at the Rust Garage Facility, Buildings 9720-15 and 9754-1: Oak Ridge Y-12 Plant, Oak Ridge, Tennessee, Facility ID number-sign 0-010117

    International Nuclear Information System (INIS)

    1994-01-01

    This document represents an addendum to the Corrective Action Plan (CAP) for underground storage tanks 1219-U, 2082-U, and 2068-U located at Buildings 9720-15 and 9754-1, Oak Ridge Y-12 Plant, Oak Ridge, TN. The site of the four underground storage tanks is commonly referred to as the Rust Garage Facility. The original CAP was submitted to the Tennessee Department of Environment and Conservation (TDEC) for review in May 1992. During the time period after submission of the original CAP for the Rust Garage Facility, Y-12 Plant Underground Storage Tank (UST) Program personnel continued to evaluate improvements that would optimize resources and expedite the activities schedule presented in the original CAP. Based on these determinations, several revisions to the original corrective action process options for remediation of contaminated soils are proposed. The revised approach will involve excavation of the soils from the impacted areas, on-site thermal desorption of soil contaminants, and final disposition of the treated soils by backfilling into the subject site excavations. Based on evaluation of the corrective actions with regard to groundwater, remediation of groundwater under the Y-12 Plant CERCLA Program is proposed for the facility

  5. 78 FR 32270 - U.S. Extractive Industries Transparency Initiative Multi-Stakeholder Group (USEITI MSG) Advisory...

    Science.gov (United States)

    2013-05-29

    ... DEPARTMENT OF THE INTERIOR Office of the Secretary [Docket No. ONRR-2012-0003; DS63600000 DR2PS0000.PX8000 134D0102R2] U.S. Extractive Industries Transparency Initiative Multi- Stakeholder Group... Transparency Initiative (USEITI) Multi- Stakeholder Group Advisory Committee. DATES: The meetings will be held...

  6. Manifesting Destiny: Re/Presentations of Indigenous Peoples in K-12 U.S. History Standards

    Science.gov (United States)

    Shear, Sarah B.; Knowles, Ryan T.; Soden, Gregory J.; Castro, Antonio J.

    2015-01-01

    In this mixed-methods study, we use a postcolonial framework to investigate how state standards represent Indigenous histories and cultures. The research questions that guided this study include: (a) What is the frequency of Indigenous content (histories, cultures, current issues) covered in state-level U.S. history standards for K-12? (b) What is…

  7. Site-specific standard request for underground storage tanks 1219-U, 1222-U, 2082-U, and 2068-U at the rust garage facility buildings 9754-1 and 9720-15: Oak Ridge Y-12 Plant, Oak Ridge, Tennessee, Facility ID No. 0-010117

    International Nuclear Information System (INIS)

    1994-12-01

    This document represents a Site-specific Standard Request for underground storage tanks (USTs) 1219-U,1222-U and 2082-U previously located at former Building 9754-1, and tank 2086-U previously located at Building 9720-15, Oak Ridge Y-12 Plant, Oak Ridge, Tennessee. The tanks previously contained petroleum products. For the purposes of this report, the two building sites will be regarded as a single UST site and will be referred to as the Rust Garage Facility. The current land use associated with the Y-12 Plant is light industrial and the operational period of the plant is projected to be at least 30 years. Thus, potential future residential exposures are not expected to occur for at least 30 years. Based on the degradation coefficient for benzene (the only carcinogenic petroleum constituent detected in soils or groundwater at the Rust Garage Facility), it is expected that the benzene and other contaminants at the site will likely be reduced prior to expiration of the 30-year plant operational period. As the original sources of petroleum contamination have been removed, and the area of petroleum contamination is limited, a site-specific standard is therefore being requested for the Rust Garage Facility

  8. Possible Involvement of Hydrosulfide in B12-Dependent Methyl Group Transfer

    Directory of Open Access Journals (Sweden)

    John I. Toohey

    2017-04-01

    Full Text Available Evidence from several fields of investigation lead to the hypothesis that the sulfur atom is involved in vitamin B12-dependent methyl group transfer. To compile the evidence, it is necessary to briefly review the following fields: methylation, the new field of sulfane sulfur/hydrogen sulfide (S°/H2S, hydrosulfide derivatives of cobalamins, autoxidation of hydrosulfide radical, radical S-adenosylmethionine methyl transfer (RSMT, and methionine synthase (MS. Then, new reaction mechanisms for B12-dependent methyl group transfer are proposed; the mechanisms are facile and overcome difficulties that existed in previously-accepted mechanisms. Finally, the theory is applied to the effect of S°/H2S in nerve tissue involving the “hypomethylation theory” that was proposed 50 years ago to explain the neuropathology resulting from deficiency of vitamin B12 or folic acid. The conclusions are consistent with emerging evidence that sulfane sulfur/hydrogen sulfide may be beneficial in treating Alzheimer’s disease.

  9. Evolution of tidal capture X-ray binaries - 4U 2127+12 (M15) to 4U 1820-30 (NGC 6624)

    International Nuclear Information System (INIS)

    Bailyn, C.D.; Grindlay, J.E.

    1987-01-01

    A new evolutionary scenario for X-ray binaries in globular clusters, which begins with a tidal capture of a main-sequence star by a neutron star and ends with a white dwarf-neutron star system, is presented. For tidal captures of main-sequence stars into orbits too wide to begin mass transfer immediately, the subsequent evolution of the secondary can lead to a common envelope binary similar to what the 9 hr X-ray binary 4U 2127+12 in M15 is suspected to be. If the common envelope is thick enough, it may cause the neutron star and the white dwarf core of the secondary to spiral in, producing a detached white dwarf-neutron star system. Subsequently, gravitational radiation losses may evolve this into the configuration seen in the 11 minute X-ray binary 4U 1820-30 in NGC 6624. This model appears more likely on statistical grounds than formation by collision of a neutron star and a red giant. In some circumstances, the latter process may result in unstable mass transfer, which would result in coalescence rather than a binary system like 4U 1820-30. 34 references

  10. A Historical Evaluation of the U12n Tunnel, Nevada national Security Site, Nye County, Nevada Part 2 of 2

    Energy Technology Data Exchange (ETDEWEB)

    Drollinger, Harold [DRI; Jones, Robert C [DRI; Bullard, Thomas F [DRI; Ashbaugh, Laurence J [DRI; Griffin, Wayne R

    2011-06-01

    This report presents a historical evaluation of the U12n Tunnel on the Nevada National Security Site (NNSS) in southern Nevada. The work was conducted by the Desert Research Institute at the request of the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office and the U.S. Department of Defense, Defense Threat Reduction Agency (DTRA). The U12n Tunnel was one of a series of tunnels used for underground nuclear weapons effects tests in Rainier and Aqueduct Mesas. A total of 22 nuclear tests were conducted in the U12n Tunnel from 1967 to 1992. These tests include Midi Mist, Hudson Seal, Diana Mist, Misty North, Husky Ace, Ming Blade, Hybla Fair, Mighty Epic, Diablo Hawk, Miners Iron, Huron Landing, Diamond Ace, Mini Jade, Tomme/Midnight Zephyr, Misty Rain, Mill Yard, Diamond Beech, Middle Note, Misty Echo, Mineral Quarry, Randsburg, and Hunters Trophy. DTRA sponsored all tests except Tomme and Randsburg which were sponsored by the Lawrence Livermore National Laboratory. Midnight Zephyr, sponsored by DTRA, was an add on experiment to the Tomme test. Eleven high explosive tests were also conducted in the tunnel and included a Stemming Plan Test, the Pre-Mill Yard test, the two seismic Non-Proliferation Experiment tests, and seven Dipole Hail tests. The U12n Tunnel complex is composed of the portal and mesa areas, encompassing a total area of approximately 600 acres (240 hectares). Major modifications to the landscape have resulted from four principal activities. These are road construction and maintenance, mining activities related to development of the tunnel complex, site preparation for activities related to testing, and construction of retention ponds. A total of 202 cultural features were recorded for the portal and mesa areas. At the portal area, features relate to the mining, construction, testing, and general everyday operational support activities within the tunnel. These include concrete foundations for buildings, ventilation

  11. Geology, geophysics, and physical properties of the U12n.25 non-proliferation experiment site

    Energy Technology Data Exchange (ETDEWEB)

    Baldwin, M.J.; Bradford, R.P.; Hopkins, S.P. [Raytheon Services Nevada, Mercury, NV (United States)] [and others

    1994-12-31

    The Nuclear Non-Proliferation Experiment was conducted in the U12n.25 drift in N-Tunnel at the Nevada Test Site. The geologic characterization of the site was performed by Raytheon Services Nevada geologists in the standard manner used for all underground nuclear weapons-effects tests executed by the Defense Nuclear Agency. The U12n.25 test bed was constructed in zeolitized ash-fall tuff of the Tunnel Beds Tuff, Subunit 4K, 389.0 m below the surface of Rainier Mesa. The structural geology of the site was simple, with the nearest fault plane projected to be 12 m below the mined cavity at closest approach, and an average bedding dip of seven degrees to the northwest. The cavity excavation revealed several small fractures, including one which produced minor amounts of free water during construction. The physical properties of the site were well within the range of experience for the zeolitized tuff of N-Tunnel and no geology-related problems were encountered during construction. The zeolitized tuff of N-Tunnel has been the site of twenty nuclear tests conducted by the Defense Nuclear Agency. The similarities of geologic setting, site geometry, and physical properties allow many comparisons of Non-Proliferation Experiment results with the large nuclear-test data base.

  12. Simulation of 200-400 MeV/u "1"2C + "1"2C elastic scattering on SHARAQ spectrometer

    International Nuclear Information System (INIS)

    Yu Lei; Zhang Gaolong; Terashima, S.; Le Xiaoyun; Tanihata, I.

    2015-01-01

    In order to further obtain the information of three-body force (TBF) from 200-400 MeV/u "1"2C + "1"2C elastic scattering, we plan to perform this experiment on a SHARAQ spectrometer. Based on the experimental condition of the Radioactive Ion Beam Factory (RIBF)-SHARAQ facility, a simulation is given to find a compromise between the better energy and angular resolutions, and higher yield by optimizing the target thickness, beam transport mode, beam intensity and angular step. From the simulation, we found that the beam quality mainly limits the improvements of energy and angular resolutions. A beam tracking system as well as a lateral and angular dispersion-matching technique are adopted to reduce the influence of beam quality. According to the two angular settings of SHARAQ as well as the expected cross sections on the basis of the theoretical model, the energy and angular resolutions, and statistical accuracy are estimated. (authors)

  13. 76 FR 52642 - Notice of Advisory Committee Closed Meeting; U.S. Strategic Command Strategic Advisory Group

    Science.gov (United States)

    2011-08-23

    ... DEPARTMENT OF DEFENSE Notice of Advisory Committee Closed Meeting; U.S. Strategic Command Strategic Advisory Group AGENCY: Department of Defense. ACTION: Notice of Advisory Committee closed meeting.... Strategic Command Strategic Advisory Group. DATES: November 1, 2011, from 8 a.m. to 5 p.m. and November 2...

  14. Constructive tensorial group field theory I: The {U(1)} -{T^4_3} model

    Science.gov (United States)

    Lahoche, Vincent

    2018-05-01

    The loop vertex expansion (LVE) is a constructive technique using canonical combinatorial tools. It works well for quantum field theories without renormalization, which is the case of the field theory studied in this paper. Tensorial group field theories (TGFTs) are a new class of field theories proposed to quantize gravity. This paper is devoted to a very simple TGFT for rank three tensors with U(1) group and quartic interactions, hence nicknamed -. It has no ultraviolet divergence, and we show, with the LVE, that it is Borel summable in its coupling constant.

  15. Design and simulation for the pulse high-voltage DC power supply (HVPS) of 1.2 MW/2.45 GHz HT-7U lower hybrid current drive system

    International Nuclear Information System (INIS)

    Huang Yiyun; Kuang Guangli; Xu Weihua; Liu Baohua; Lin Jianan; Wu Junshuan; Zheng Guanghua; Yang Chunshen

    2000-01-01

    The superconducting tokamak HT-7U has been designed by the Institute of Plasma Physics since 1998 and will be set up before 2003. The 1.2 MW/2.45 GHz HT-7U LHCD (Lower hybrid current drive) system which being the most efficient non-induction device can heat the plasma and drive the plasma current has been efficiently in operation now, and a particular design of the 2.8 MW/-35 kV high-voltage DC power supply has been already completed and will apply to the klystron of LHCD on HT-7 and the future HT-7U, and the project of the power supply has been examined and approved professionally by an authorized group of high-level specialist in the Institute of Plasma Physics. The detailed design of the power supply and the simulation results are referred

  16. Cenomanian-? early Turonian minimum age of the Chubut Group, Argentina: SHRIMP U-Pb geochronology

    Science.gov (United States)

    Suárez, Manuel; Márquez, Marcelo; De La Cruz, Rita; Navarrete, César; Fanning, Mark

    2014-03-01

    Four new SHRIMP U-Pb zircon ages older than 93 Ma from samples of the two uppermost formations accumulated in two different depocenters (Golfo de San Jorge and Cañadón Asfalto basins) of the Chubut Group in central Argentinean Patagonia, establish a pre-late Cenomanian-? early Turonian age for the group. It also confirms a coeval and comparable evolution of the two depocenters, where distal pyroclastic material was deposited together with fluvial and lacustrine facies.

  17. Disconnected forms of the standard group

    International Nuclear Information System (INIS)

    McInnes, B.

    1996-10-01

    Recent work in quantum gravity has led to a revival of interest in the concept of disconnected gauge groups. Here we explain how to classify all of the (non-trivial) groups which have the same Lie algebra as the ''standard group'', SU(3) x SU(2) x U(1), without requiring connectedness. The number of possibilities is surprisingly large. We also discuss the geometry of the ''Kiskis effect'', the ambiguity induced by non-trivial spacetime topology in such gauge theories. (author). 12 refs

  18. 7 CFR 51.2541 - U.S. Fancy, U.S. Extra No. 1, U.S. No. 1 And U.S. Select Grades.

    Science.gov (United States)

    2010-01-01

    ... PRODUCTS 1,2 (INSPECTION, CERTIFICATION, AND STANDARDS) United States Standards for Grades of Pistachio.... Fancy,” “U.S. Extra No. 1,” “U.S. No. 1,” and “U.S. Select” consists of pistachio nuts in the shell...

  19. The valence state of uranium in K{sub 6}Cu{sub 12}U{sub 2}S{sub 15}

    Energy Technology Data Exchange (ETDEWEB)

    Schilder, H; Speldrich, M; Lueken, H; Sutorik, A C; Kanatzidis, M G

    2004-07-14

    The paramagnetic behaviour of K{sub 6}Cu{sub 12}U{sub 2}S{sub 15} has been analysed, regarding copper as diamagnetic (Cu{sup +}), sulfur as mixed-valent S{sup 2-}/S{sup -} with magnetically silent delocalized S{sup -} holes in the valence band, and the actinide as either U{sup 5+}[5f{sup 1}] or U{sup 4+}[5f{sup 2}] in trigonally distorted octahedral surrounding (pseudosymmetry 3-bar) of sulfur. Fitting procedures have been carried out, accounting for spin-orbit coupling, ligand-field potential (parameters B{sup k}{sub q}), interelectronic repulsion (for U{sup 4+}[5f{sup 2}]), cooperative magnetic effects (molecular field parameter {lambda}), and applied magnetic field. Keeping the ratios B{sup 4}{sub 3}/B{sup 4}{sub 0}, B{sup 6}{sub 3}/B{sup 6}{sub 0}, B{sup 6}{sub 6}/B{sup 6}{sub 0} on their point charge electrostatic values with respect to the sulfur ligands, the three axial parameters B{sup k}{sub 0} (k=2,4,6) and {lambda} were refined. Agreement between measured and calculated susceptibility data was obtained for U{sup 5+} with B{sup k}{sub 0} values expected for octahedral surrounding and {lambda}<0 speaking for antiferromagnetic interactions. The U{sup 4+} model does yield a fit of comparable quality, but gives B{sup k}{sub 0} values that are unreasonable with respect to sign and magnitude. To conclude, on the basis of the magnetic properties the title compound is a 5f{sup 1} system corresponding to the elements formal charges (K{sup +}){sub 6}(Cu{sup +}){sub 12}(U{sup 5+}){sub 2}(S{sup 2-}){sub 13}(S{sup -}){sub 2}.

  20. U.S. Census Annual Estimates of the Resident Population for Selected Age Groups by Sex for the United States

    Data.gov (United States)

    U.S. Department of Health & Human Services — 2010-2015. U.S. Census Annual Estimates of the Resident Population for Selected Age Groups by Sex for the United States. The estimates are based on the 2010 Census...

  1. Experimentally verifiable Yang-Mills spin 2 gauge theory of gravity with group U(1) x SU(2)

    International Nuclear Information System (INIS)

    Peng, H.

    1988-01-01

    In this work, a Yang-Mills spin 2 gauge theory of gravity is proposed. Based on both the verification of the helicity 2 property of the SU(2) gauge bosons of the theory and the agreement of the theory with most observational and experimental evidence, the authors argues that the theory is truly a gravitational theory. An internal symmetry group, the eigenvalues of its generators are identical with quantum numbers, characterizes the interactions of a given class. The author demonstrates that the 4-momentum P μ of a fermion field generates the U(1) x SU(2) internal symmetry group for gravity, but not the transformation group T 4 . That particles are classified by mass and spin implies that the U(1) x SU(2), instead of the Poincare group, is a symmetry group of gravity. It is shown that the U(1) x SU(2) group represents the time displacement and rotation in ordinary space. Thereby internal space associated with gravity is identical with Minkowski spacetime, so a gauge potential of gravity carries two space-time indices. Then he verifies that the SU(2) gravitational boson has helicity 2. It is this fact, spin from internal spin, that explains alternatively why the gravitational field is the only field which is characterized by spin 2. The Physical meaning of gauge potentials of gravity is determined by comparing theory with the results of experiments, such as the Collella-Overhauser-Werner (COW) experiment and the Newtonian limit, etc. The gauge potentials this must identify with ordinary gravitational potentials

  2. 77 FR 25706 - Notice of Advisory Committee Closed Meeting; U.S. Strategic Command Strategic Advisory Group

    Science.gov (United States)

    2012-05-01

    ... DEPARTMENT OF DEFENSE Notice of Advisory Committee Closed Meeting; U.S. Strategic Command Strategic Advisory Group AGENCY: Department of Defense. ACTION: Notice of Advisory Committee closed meeting.... [[Page 25707

  3. Second quarter trims earnings gain of OGJ group of U.S. oil companies

    International Nuclear Information System (INIS)

    Beck, R.J.; Biggs, J.B.

    1991-01-01

    This paper reports that first half of 1991 profits for the Oil and Gas Journal group of 22 large U.S. oil companies totaled $10,553 billion, down a scant 0.1% from the same period the year before. However, second quarter profits were down sharply, dipping to $3.656 billion or 27.4% below the second quarter of 1990. This is in sharp contrast with first quarter profits, which totaled $6.897 billion and were up 24.8% from the same period of 1990. First half individuals results were widely diverse, with seven companies showing profit improvements from last year and 15 companies a decline. Only one, Murphy Oil Co., posted a loss in the first half. Six companies showed profit gains of more than 20% and 11 posted declines greater than 20%. In the second quarter 16 of the group had lower earnings than they booked in the same period of 1990. Restructuring charges and gains, along with provisions for future environmental costs, continued to have a great deal of influence over year to year changes in profits. Chemical earnings were down for the 6 months and in the second quarter for most companies. U.S. refining and marketing earnings were mixed but generally lower for both periods. Due to an economic recession product demand was down in the first half of this year. Non-U.S. refining and marketing profits were up for the first half, but the gain stemmed from improved margins in the first quarter

  4. Semidirect product gauge group [SU(3)cxSU(2)L]xU(1)Y and quantization of hypercharge

    International Nuclear Information System (INIS)

    Hattori, Chuichiro; Matsunaga, Mamoru; Matsuoka, Takeo

    2011-01-01

    In the standard model the hypercharges of quarks and leptons are not determined by the gauge group SU(3) c xSU(2) L xU(1) Y alone. We show that, if we choose the semidirect product group [SU(3) c xSU(2) L ]xU(1) Y as its gauge group, the hyperchages are settled to be n/6 mod Z(n=0,1,3,4). In addition, the conditions for gauge-anomaly cancellation give strong constraints. As a result, the ratios of the hypercharges are uniquely determined and the gravitational anomaly is automatically canceled. The standard charge assignment to quarks and leptons can be properly reproduced. For exotic matter fields their hypercharges are also discussed.

  5. Adequate & Equitable U.S. PK-12 Infrastructure: Priority Actions for Systemic Reform. A Report from the Planning for PK-12 School Infrastructure National Initiative

    Science.gov (United States)

    Filardo, Mary; Vincent, Jeffrey M.

    2017-01-01

    To formulate a "systems-based" plan to address the PK-12 infrastructure crisis, in 2016, the 21st Century School Fund (21CSF) and the University of California-Berkeley's Center for Cities + Schools (CC+S), in partnership with the National Council on School Facilities and the Center for Green Schools at the U.S. Green Building Council,…

  6. 36 CFR 12.12 - Information collection.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Information collection. 12.12... NATIONAL CEMETERY REGULATIONS § 12.12 Information collection. The information collection requirements... U.S.C. 3501 et seq., and assigned clearance number 1024-0026. The information is being collected to...

  7. Genetic disorders of vitamin B12 metabolism: eight complementation groups – eight genes

    Science.gov (United States)

    Froese, D. Sean; Gravel, Roy A.

    2010-01-01

    Vitamin B12 (cobalamin, Cbl) is an essential nutrient in human metabolism. Genetic diseases of vitamin B12 utilisation constitute an important fraction of inherited newborn disease. Functionally, B12 is the cofactor for methionine synthase and methylmalonyl CoA mutase. To function as a cofactor, B12 must be metabolised through a complex pathway that modifies its structure and takes it through subcellular compartments of the cell. Through the study of inherited disorders of vitamin B12 utilisation, the genes for eight complementation groups have been identified, leading to the determination of the general structure of vitamin B12 processing and providing methods for carrier testing, prenatal diagnosis and approaches to treatment. PMID:21114891

  8. Boson-fermion mass splittings in four-dimensional heterotic string models with anomalous U(1) gauge groups

    International Nuclear Information System (INIS)

    Yamaguchi, Masahiro; Yamamoto, Hisashi; Onogi, Tetsuya

    1989-01-01

    In four-dimensional heterotic string models with anomalous U(1) gauge groups, space-time supersymmetry (SUSY) breaks down spontaneously at one loop. In this paper, the Ward-Takahashi identity of broken SUSY in one-loop two-point amplitudes is investigated in all generalities. The boson-fermion mass splitting of any supersymmetric pair in an arbitrary model is proportional to the product of the D-term expectation value (the sum of (chirality)x(U(1) charge) of massless fermions in the model) and the U(1) charge of the external particle. In order to give a better understanding of the results, we present some examples of the mass splittings in a simple Z 3 orbifold model. (orig.)

  9. The small molecule Mek1/2 inhibitor U0126 disrupts the chordamesoderm to notochord transition in zebrafish

    Directory of Open Access Journals (Sweden)

    Szabó Gábor

    2008-04-01

    Full Text Available Abstract Background Key molecules involved in notochord differentiation and function have been identified through genetic analysis in zebrafish and mice, but MEK1 and 2 have so far not been implicated in this process due to early lethality (Mek1-/- and functional redundancy (Mek2-/- in the knockout animals. Results Here, we reveal a potential role for Mek1/2 during notochord development by using the small molecule Mek1/2 inhibitor U0126 which blocks phosphorylation of the Mek1/2 target gene Erk1/2 in vivo. Applying the inhibitor from early gastrulation until the 18-somite stage produces a specific and consistent phenotype with lack of dark pigmentation, shorter tail and an abnormal, undulated notochord. Using morphological analysis, in situ hybridization, immunhistochemistry, TUNEL staining and electron microscopy, we demonstrate that in treated embryos the chordamesoderm to notochord transition is disrupted and identify disorganization in the medial layer of the perinotochordal basement mebrane as the probable cause of the undulations and bulges in the notochord. We also examined and excluded FGF as the upstream signal during this process. Conclusion Using the small chemical U0126, we have established a novel link between MAPK-signaling and notochord differentiation. Our phenotypic analysis suggests a potential connection between the MAPK-pathway, the COPI-mediated intracellular transport and/or the copper-dependent posttranslational regulatory processes during notochord differentiation.

  10. Analysis list: TCF12 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available TCF12 Blood,Breast,Liver,Neural,Pluripotent stem cell,Uterus + hg19 http://dbarchiv...e.biosciencedbc.jp/kyushu-u/hg19/target/TCF12.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/TC...F12.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/TCF12.10.tsv http://dbarchive.biosciencedb...c.jp/kyushu-u/hg19/colo/TCF12.Blood.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/TC...F12.Breast.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/TCF12.Liver.tsv,http://dba

  11. 75 FR 15419 - Notice of Intent To Grant Exclusive License of U.S. Patent Application No. 12/432,842 Filed April...

    Science.gov (United States)

    2010-03-29

    ... Exclusive License of U.S. Patent Application No. 12/432,842 Filed April 30, 2009 Entitled: ``A Soil Stabilization Soil Comprising Same, and a Method of Stabilizing Soil'' AGENCY: Department of the Army, U.S. Army... climates with sandy, gravelly soils where emulsions and hydraulic cements will not effectively cure. If...

  12. Age of meta-rhyolite of Marata sequence, Araxa Group, Goias: geochronology study by U-Pb in zircon, Rb-Sr and Sm-Nd methods

    International Nuclear Information System (INIS)

    Pimentel, M.M.; Heaman, L.; Fuck, R.A.

    1992-01-01

    U-Pb isotopic analyses in eight zircon fractions separated from a meta-rhyolite sample of the Marata sequence (Araxa Group, Goias) are presented. Two morphologically distinct zircon populations were identified: stubby prismatic crystals (width:length of 1:2 to 1:3) in which core-overgrowth relationships are observed; long prismatic crystals (needles) with width:length ratios of ca. 1:10. Analyses performed on group zircons indicated the presence of a ca. 2.0 Ga. old inherited component. Analyses of group zircons plot very close to the concordia and yield an upper intercepts age of 794 ± 10 Ma for the crystallization of the volcanic protolith. The study was complemented with whole-rock isotopic analyses by the Rb-Sr and Sm-Nd methods. Rb-Sr isochron obtained with samples from two different outcrops gave data of 829 ± 82 Ma (initial 87 Sr/ 86 Sr of 0.7057 ± 0.0157) and 691 ± 30 Ma (initial 87 Sr/ 86 Sr of 0.7337 ± 0.0034). The latter reflects a later Sr-isotopic re-homogenization episode, possibly associated with the intense deformation and metamorphism suffered by these rocks. Sm-Nd isotopic analyses on three samples reveal EN d (T) (T =794 Ma) values in the range of -6.1 to -9.5 which indicate the presence of older (early Proterozoic) crustal Nd. This is consistent with the inheritance pattern shown in the U-Pb isotopic results. (author)

  13. Analysis list: daf-12 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available daf-12 Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/daf-12....1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/daf-12.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/daf...-12.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/daf-12.Larvae.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...

  14. U12, a UDCA derivative, acts as an anti-hepatoma drug lead and inhibits the mTOR/S6K1 and cyclin/CDK complex pathways.

    Directory of Open Access Journals (Sweden)

    Yang Xu

    Full Text Available U12, one of 20 derivatives synthesized from ursodeoxycholic acid (UDCA, has been found to have anticancer effects in liver cancer cell lines (SMMC-7721 and HepG2 and to protect normal liver cells from deoxycholic acid (DCA damage (QSG-7701. Its anticancer mechanism was investigated using computer-aided network pharmacology and comparative proteomics. Results showed that its anti-malignancy activities were activated by mTOR/S6K1, cyclinD1/CDK2/4 and caspase-dependent apoptotic signaling pathways in hepatocellular carcinoma cells (HCC. The action of U12 may be similar to that of rapamycin. Animal testing confirmed that U12 exerted better anti-tumor activity than UDCA and had less severe side effects than fluorouracil (5-Fu. These observations indicate that U12 differs from UDCA and other derivatives and may be a suitable lead for the development of compounds useful in the treatment of HCC.

  15. 78 FR 50437 - U.S. Extractive Industries Transparency Initiative Multi-Stakeholder Group (USEITI MSG) Advisory...

    Science.gov (United States)

    2013-08-19

    ... DEPARTMENT OF THE INTERIOR Office of the Secretary [Docket No. ONRR-2012-0003; DS63600000 DR2PS0000.PX8000 134D0102R2] U.S. Extractive Industries Transparency Initiative Multi- Stakeholder Group...: This notice announces the next three meetings of the United States Extractive Industries Transparency...

  16. 78 FR 60304 - U.S. Extractive Industries Transparency Initiative Multi-Stakeholder Group (USEITI MSG) Advisory...

    Science.gov (United States)

    2013-10-01

    ... DEPARTMENT OF THE INTERIOR Office of the Secretary [Docket No. ONRR-2012-0003; DS63600000 DR2PS0000.PX8000 134D0102R2] U.S. Extractive Industries Transparency Initiative Multi- Stakeholder Group...: This notice announces the meeting date change of the United States Extractive Industries Transparency...

  17. Neutron magnetic scattering experiments performed by VIKRA group at the RA reactor in Vinca; Eksperimenti grupe VIKRA na reaktoru RA u Vinci sa rasejanjem neutrona na magnetnim materijalima

    Energy Technology Data Exchange (ETDEWEB)

    Kranicki, S; Rzany, H; Wanic, A [Institute of Nuclear Physics, Krakov (Poland); Szytula, A [Jagiellonian University, Krakov (Poland); Todorovic, J; Dimitrijevic, Z; Radenkovic, S [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Yugoslavia)

    1978-05-15

    A short communication about investigations of magnetic materials by means of the neutron magnetic scattering performed by Polish-Yugoslav group VIKRA (Vinca-Krakov) at the RA reactor in Vinca in the period 1962-1977 will be presented. In the field of neutron inelastic scattering information about magnetic interactions (exchange integrals) and their temperature behaviour in such substances as Fe{sub 7}S{sub 8}, {alpha}-Fe{sub 2}O{sub 3}, CR{sub 2}O{sub 3}, {alpha}-Co, Cu{sub 2}MnAl and Mn{sub 1.88}Cr{sub 0.12}Sb was obtained by measuring magnon dispersion relations. In the field of neutron elastic scattering valuable results concerning crystallographic and magnetic structures of oxyhydroxides, several Heusler alloys and intermetallic compounds of 3d metals (for instance of NiMnGe, CoMnSi) were obtained. A short description of the KSN spectrometer used in all experiments will also be given. (author) Dato je kratko saopstenje o istrazivanjima magnetnih materijala magnetnim neutronskim rasejanjem izvrsenim od strane poljsko-jugoslovenske grupe VIKRA (Vinca-Krakov) na reaktoru RA u Vinci u periodu od 1962-1977. U oblasti neelasticnog rasejanja neutrona, obavestenja o magnetnim uzajamnim dejstvima (integralima izmene) i njihovim temperaturskim ponasanjima su dobijeni merenjem disperzione relacije magnona u takvim materijalima kao sto su Fe{sub 7}S{sub 8}, {alpha}-Fe{sub 2}O{sub 3}, CR{sub 2}O{sub 3}, {alpha}-Co, Cu{sub 2}MnAl and Mn{sub 1.88}Cr{sub 0.12}Sb. U oblasti neutronskog elasticnog rasejanja dobijeni su korisni rezultati o kristalografskim i magnetnim strukturama oksihidroksida gvozdja, niza Heuslerovih legura i intermetalnih jedinjenja 3d metala (napr. NiMnGe, Co,MnSi). Dat je kratak opis KSN spektrometra upotrebljenog u svim ovim eksperimentima. (author)

  18. Tetragonal phase in Al-rich region of U-Fe-Al system

    International Nuclear Information System (INIS)

    Meshi, L.; Zenou, V.; Ezersky, V.; Munitz, A.; Talianker, M.

    2005-01-01

    A new ternary aluminide U 2 FeAl 20 with the approximate composition Al-4.2at% Fe-8.5at% U was observed in the Al-rich corner of the U-Al-Fe system. Transmission electron microscopy and electron microdiffraction technique were used for characterization of the structure of this phase. It has a tetragonal unit cell with the parameters a=12.4A and c=10.3A and can be described by the space group I4-bar 2m

  19. The integrable quantum group invariant A2n-1(2) and Dn+1(2) open spin chains

    Science.gov (United States)

    Nepomechie, Rafael I.; Pimenta, Rodrigo A.; Retore, Ana L.

    2017-11-01

    A family of A2n(2) integrable open spin chains with Uq (Cn) symmetry was recently identified in arxiv:arXiv:1702.01482. We identify here in a similar way a family of A2n-1(2) integrable open spin chains with Uq (Dn) symmetry, and two families of Dn+1(2) integrable open spin chains with Uq (Bn) symmetry. We discuss the consequences of these symmetries for the degeneracies and multiplicities of the spectrum. We propose Bethe ansatz solutions for two of these models, whose completeness we check numerically for small values of n and chain length N. We find formulas for the Dynkin labels in terms of the numbers of Bethe roots of each type, which are useful for determining the corresponding degeneracies. In an appendix, we briefly consider Dn+1(2) chains with other integrable boundary conditions, which do not have quantum group symmetry.

  20. The integrable quantum group invariant A2n−1(2 and Dn+1(2 open spin chains

    Directory of Open Access Journals (Sweden)

    Rafael I. Nepomechie

    2017-11-01

    Full Text Available A family of A2n(2 integrable open spin chains with Uq(Cn symmetry was recently identified in arXiv:1702.01482. We identify here in a similar way a family of A2n−1(2 integrable open spin chains with Uq(Dn symmetry, and two families of Dn+1(2 integrable open spin chains with Uq(Bn symmetry. We discuss the consequences of these symmetries for the degeneracies and multiplicities of the spectrum. We propose Bethe ansatz solutions for two of these models, whose completeness we check numerically for small values of n and chain length N. We find formulas for the Dynkin labels in terms of the numbers of Bethe roots of each type, which are useful for determining the corresponding degeneracies. In an appendix, we briefly consider Dn+1(2 chains with other integrable boundary conditions, which do not have quantum group symmetry.

  1. NRF2 Signaling Negatively Regulates Phorbol-12-Myristate-13-Acetate (PMA-Induced Differentiation of Human Monocytic U937 Cells into Pro-Inflammatory Macrophages.

    Directory of Open Access Journals (Sweden)

    Min-Gu Song

    Full Text Available Blood monocytes are recruited to injured tissue sites and differentiate into macrophages, which protect against pathogens and repair damaged tissues. Reactive oxygen species (ROS are known to be an important contributor to monocytes' differentiation and macrophages' function. NF-E2-related factor 2 (NRF2, a transcription factor regulating cellular redox homeostasis, is known to be a critical modulator of inflammatory responses. We herein investigated the role of NRF2 in macrophage differentiation using the human monocytic U937 cell line and phorbol-12-myristate-13-acetate (PMA. In U937 cells with NRF2 silencing, PMA-stimulated cell adherence was significantly facilitated when compared to control U937 cells. Both transcript and protein levels for pro-inflammatory cytokines, including interleukine-1β (IL-1β, IL-6, and tumor necrosis factor-α (TNFα were highly elevated in PMA-stimulated NRF2-silenced U937 compared to the control. In addition, PMA-inducible secretion of monocyte chemotactic protein 1 (MCP-1 was significantly high in NRF2-silenced U937. As an underlying mechanism, we showed that NRF2-knockdown U937 retained high levels of cellular ROS and endoplasmic reticulum (ER stress markers expression; and subsequently, PMA-stimulated levels of Ca2+ and PKCα were greater in NRF2-knockdown U937 cells, which caused enhanced nuclear accumulation of nuclear factor-ҡB (NFҡB p50 and extracellular signal-regulated kinase (ERK-1/2 phosphorylation. Whereas the treatment of NRF2-silenced U937 cells with pharmacological inhibitors of NFҡB or ERK1/2 largely blocked PMA-induced IL-1β and IL-6 expression, indicating that these pathways are associated with cell differentiation. Taken together, our results suggest that the NRF2 system functions to suppress PMA-stimulated U937 cell differentiation into pro-inflammatory macrophages and provide evidence that the ROS-PKCα-ERK-NFҡB axis is involved in PMA-facilitated differentiation of NRF2-silenced U937

  2. Analysis list: Su(z)12 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Su(z)12 Embryo,Larvae + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/S...u(z)12.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/Su(z)12.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/target/Su(z)12.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Su(z)12.Embryo....tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Su(z)12.Larvae.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Larvae.gml ...

  3. Competitive Wrestling-related Injuries in School Aged Athletes in U.S. Emergency Departments

    Directory of Open Access Journals (Sweden)

    Myers, Richard J

    2010-12-01

    Full Text Available Objective: To describe the characteristics of wrestling injuries occurring in male athletes aged 7-17 treated in United States (U.S. emergency departments (ED from 2000-2006, and to compare injury patterns between younger & older youth wrestlers.Methods: A stratified probability sample of U.S. hospitals providing emergency services in the National Electronic Injury Surveillance System was used for 2000-2006. ED visits for injuries sustained in organized wrestling were analyzed for male patients ages 7-17 years old (subdivided into 7-11 years old [youth group] and 12-17 years old [scholastic group].Results: During the study period, there were an estimated 167,606 ED visits for wrestling injuries in 7-17 years old U.S. males, with 152,710 (91.1% occurring in the older (12-17 years old group. The annual injury incidence was 6.49 injuries/1,000 wrestlers in the youth group and 29.57 injuries/1,000 wrestlers in the scholastic group. The distribution of diagnoses was similar in both age groups, with sprain/strain as the most common diagnosis, followed by fracture and contusion/abrasion. Distributions of injury by location were significantly different between groups (p=0.02, although both groups exhibited approximately 75% of all injuries from the waist up. Overexertion and struck by/against were the most common precipitating and direct mechanisms in both groups, respectively. Over 97% of all injured wrestlers were treated and released.Conclusion: The types of injury in youth (7-11 years old wrestlers are similar to those of scholastic (12-17 years old wrestlers, although the distribution of body parts injured differs between the age groups. The majority of injuries occurs above the waist and may be a target for prevention strategies. [West J Emerg Med. 2010; 11(5:442-449.

  4. Performance of 12Ah aerospace nickel-cadmium cells of design variable groups

    Science.gov (United States)

    Vasanth, K. L.

    1985-01-01

    The design variable program of NASA is a systematic approach to evaluate the performance of 12Ah aerospace nickel-cadmium cells of 9 important cell designs. These cells were life cycled in a Low-Earth Orbit (LEO) regime for 3 to 4 years. Representative cells taken from the design variable groups after different cycling periods have been examined. The results show that: (1) positive swelling and carbonate content in the electrolyte increases as a function of the number of cycles, (2) electrolyte distribution follows the order NEG greater than POS greater than SEP, 3) control and no PQ groups outperformed the rest of the groups and (4) the polypropylene group shows very heavy cadmium migration and poor performance.

  5. Sensitivity of 238U resonance absorption to library multigroup structure as calculated by WIMS-AECL

    International Nuclear Information System (INIS)

    Laughton, P.J.; Donnelly, J.V.

    1995-01-01

    In simulations of the TRX-1 experimental lattice, WIMS-AECL overpredicts, relative to MCNP, resonance absorption in neutron-energy groups containing the three large, low-lying resonances of 238 U when a standard ENDF/B-V-based library is used. A total excess in these groups of 4.0 neutron captures by 238 U per thousand fission neutrons has been observed. Similar comparisons are made in this work for the MIT-4 experimental lattice and simplified CANDU lattice cells containing 37-element fuel, with and without heavy-water coolant. Eleven different 89-group cross-section libraries were constructed for WIMS-AECL from ENDF/B-V data: only the neutron-energy-group boundaries used in generating multigroup cross sections and the Goldstein-Cohen correction factors differ from one library to the next. The first library uses the original 89-group structure, and the other ten involve energy groups of varying widths centred on the three large, low-lying resonances of 238 U. For TRX-1, some reduction in total discrepancy in 238 U capture can be achieved by using a new structure, although the improvement is small. The discrepancies in 238 U capture are of the same order for the MIT-4 case as those observed for TRX-1 for both the original group structure and the ten new structures. The WIMS-AECL calculation of 238 U resonance absorption in the same ranges of energy for the simplified CANDU 37-element lattice are in better agreement with MCNP than they are for TRX-1 and MIT-4: when the original structure is used, WIMS-AECL underpredicts total capture rate by 238 U in the energy range of interest by only 0.56 per thousand fission neutrons (coolant present) and 0.88 per thousand fission neutrons (voided coolant channel). The discrepancies are reduced when some of the new structures are used. For almost all of the cases considered here-TRX-1, MIT-4 and CANDU with coolant-better group-by-group agreement of 238 U capture around the 6.67-eV resonance is achieved by using a new library

  6. Algebraic formulas for some nontrivial U/sub n/ 6j symbols and U/sub m/n contains U/sub m/ x U/sub n/ 3jm symbols

    International Nuclear Information System (INIS)

    Haase, R.W.; Butler, P.H.

    1985-01-01

    We give tables of algebraic formulas for some nontrivial 6j symbols and 3jm symbols of the unitary groups. The tables demonstrate that the building-up method can be used successfully to obtain the rank dependence of unitary group j and jm symbols. To emphasize the rank-dependent nature of this calculation, we have employed the composite Young tableaux notation (or back-to-back notation) to label the unitary group irreps. In using this notation, the transpose conjugate symmetry of the corresponding composite Young diagram leads to a new symmetry of the unitary group 6j and 3jm symbols. The transposition of the groups U/sub m/ and U/sub n/ gives rise to a further symmetry of the 3jm symbols of U/sub m/n contains U/sub m/ x U/sub n/

  7. Flipped SU(5) from Z{sub 12-I} orbifold with Wilson line

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jihn E. [Department of Physics and Astronomy, and Center for Theoretical Physics, Seoul National University, Seoul 151-747 (Korea, Republic of)]. E-mail: jekim@phyp.snu.ac.kr; Kyae, Bumseok [School of Physics, Korea Institute for Advanced Study, 207-43 Cheongryangri-dong, Dongdaemun-gu, Seoul 130-722 (Korea, Republic of)]. E-mail: bkyae@kias.re.kr

    2007-05-14

    We construct a three family flipped SU(5) model from the heterotic string theory compactified on the Z{sub 12-I} orbifold with one Wilson line. The gauge group is SU(5)xU(1){sub X}xU(1){sup 3}x[SU(2)xSO(10)xU(1){sup 2}]{sup '}. This model does not derive any non-Abelian group except SU(5) from E{sub 8}, which is possible only for two cases in case of one shift V, one in Z{sub 12-I} and the other in Z{sub 12-II}. We present all possible Yukawa couplings. We place the third quark family in the twisted sectors and two light quark families in the untwisted sector. From the Yukawa couplings, the model provides the R-parity, the doublet-triplet splitting, and one pair of Higgs doublets. It is also shown that quark and lepton mixings are possible. So far we have not encountered a serious phenomenological problem. There exist vector-like flavor SU(5) exotics (including Q{sub em}=+/-16 color exotics and Q{sub em}=+/-12 electromagnetic exotics) and SU(5) vector-like singlet exotics with Q{sub em}=+/-12 which can be removed near the GUT scale. In this model, sin{sup 2}{theta}{sub W}{sup 0}=38 at the full unification scale.

  8. Quasi quantum group covariant q-oscillators

    International Nuclear Information System (INIS)

    Schomerus, V.

    1992-05-01

    If q is a p-th root of unity there exists a quasi-co-associative truncated quantum group algebra U T q (sl 2 ) whose indecomposable representations are the physical representations of U q (sl 2 ), whose co-product yields the truneated tensor product of physical representations of U q (sl 2 ), and whose R-matrix satisfies quasi Yang Baxter equations. For primitive p-th roots q, we consider a 2-dimensional q-oscillator which admits U T q (sl 2 ) as a symmetry algebra. Its wave functions lie in a space F T q of 'functions on the truncated quantum plane', i.e. of polynomials in noncommuting complex coordinate functions z a , on which multiplication operators Z a and the elements of U T q (sl 2 ) can act. This illustrates the concept of quasi quantum planes. Due to the truncation, the Hilbert space of states is finite dimensional. The subspaces F T(n) of monomials in x a of n-th degree vanish for n ≥ p-1, and F T(n) carries the 2J+1 dimensional irreducible representation of U T q (sl 2 ) if n=2J, J=0, 1/2, ... 1/2(p-2). Partial derivatives δ a are introduced. We find a *-operation on the algebra of multiplication operators Z i and derivatives δ b such that the adjoints Z * a act as differentiation on the truncated quantum plane. Multiplication operators Z a ('creation operators') and their adjoints ('annihilation operators') obey q -1/2 -commutation relations. The *-operation is used to determine a positive definite scalar product on the truncated quantum plane F T q . Some natural candidates of Hamiltonians for the q-oscillators are determined. (orig./HSI)

  9. Quasi exceptional E12 Lie symmetry group with 685 dimensions, KAC-Moody algebra and E-infinity Cantorian spacetime

    International Nuclear Information System (INIS)

    El Naschie, M.S.

    2008-01-01

    The short note gives a derivation for a new E12 exceptional Lie group corresponding to affine KAC-Moody algebra. We derive the dimension of the group by intersectionally embedding the intrinsic dimension of E8 namely D(E8) = 57 into the 12 spacetime dimensions of F theory and finding that Dim E12 = D(E8) (DF) + 1 = (57)(12) + 1 = 685

  10. Indirect zirconia-reinforced lithium silicate ceramic CAD/CAM restorations: Preliminary clinical results after 12 months.

    Science.gov (United States)

    Zimmermann, Moritz; Koller, Christina; Mehl, Albert; Hickel, Reinhard

    2017-01-01

    No clinical data are available for the new computer-aided design/computer-assisted manufacture (CAD/CAM) material zirconia-reinforced lithium silicate (ZLS) ceramic. This study describes preliminary clinical results for indirect ZLS CAD/CAM restorations after 12 months. Indirect restorations were fabricated, using the CEREC method and intraoral scanning (CEREC Omnicam, CEREC MCXL). Sixty-seven restorations were seated adhesively (baseline). Sixty restorations were evaluated after 12 months (follow-up), using modified FDI criteria. Two groups were established, according to ZLS restorations' post-processing procedure prior to adhesive seating: group I (three-step polishing, n = 32) and group II (fire glazing, n = 28). Statistical analysis was performed with Mann-Whitney U test and Wilcoxon test (P  .05). Statistically significant differences were found for criteria surface gloss for group I and group II (Mann-Whitney U test, P < .05). This study demonstrates ZLS CAD/CAM restorations have a high clinical success rate after 12 months. A longer clinical evaluation period is necessary to draw further conclusions.

  11. U(6)-phonon model of nuclear collective motion

    International Nuclear Information System (INIS)

    Ganev, H.G.

    2015-01-01

    The U(6)-phonon model of nuclear collective motion with the semi-direct product structure [HW(21)]U(6) is obtained as a hydrodynamic (macroscopic) limit of the fully microscopic proton–neutron symplectic model (PNSM) with Sp(12, R) dynamical group. The phonon structure of the [HW(21)]U(6) model enables it to simultaneously include the giant monopole and quadrupole, as well as dipole resonances and their coupling to the low-lying collective states. The U(6) intrinsic structure of the [HW(21)]U(6) model, from the other side, gives a framework for the simultaneous shell-model interpretation of the ground state band and the other excited low-lying collective bands. It follows then that the states of the whole nuclear Hilbert space which can be put into one-to-one correspondence with those of a 21-dimensional oscillator with an intrinsic (base) U(6) structure. The latter can be determined in such a way that it is compatible with the proton–neutron structure of the nucleus. The macroscopic limit of the Sp(12, R) algebra, therefore, provides a rigorous mechanism for implementing the unified model ideas of coupling the valence particles to the core collective degrees of freedom within a fully microscopic framework without introducing redundant variables or violating the Pauli principle. (author)

  12. 77 FR 59238 - Call for Expert Reviewers to the U.S. Government Review of the Working Group I Contribution to...

    Science.gov (United States)

    2012-09-26

    ... expert review process, which occurs in parallel with the U.S. government review. More information on the... DEPARTMENT OF STATE [Public Notice 8042] Call for Expert Reviewers to the U.S. Government Review... both experts and governments. The Second Order Draft of the Working Group I contribution to the 5th...

  13. Perception of racial discrimination and psychopathology across three U.S. ethnic minority groups.

    Science.gov (United States)

    Chou, Tina; Asnaani, Anu; Hofmann, Stefan G

    2012-01-01

    To examine the association between the perception of racial discrimination and the lifetime prevalence rates of psychological disorders in the three most common ethnic minorities in the United States, we analyzed data from a sample consisting of 793 Asian Americans, 951 Hispanic Americans, and 2,795 African Americans who received the Composite International Diagnostic Interview through the Collaborative Psychiatric Epidemiology Studies. The perception of racial discrimination was associated with the endorsement of major depressive disorder, panic disorder with agoraphobia, agoraphobia without history of panic disorder, posttraumatic stress disorder, and substance use disorders in varying degrees among the three minority groups, independent of the socioeconomic status, level of education, age, and gender of participants. The results suggest that the perception of racial discrimination is associated with psychopathology in the three most common U.S. minority groups.

  14. Synthesis, Structure and Properties of Various Molecules Based on the 4,8,12-trioxa-4,8,12,12c-tetrahydrodibenzo[cd,mn]pyrene System With an Evaluation of the Effect Differing Molecular Substitution Patterns Has on the Space Group Symmetry

    DEFF Research Database (Denmark)

    Faldt, André; Krebs, Frederik C; Thorup, Niels

    1997-01-01

    of opposite chirality are present within the unit cell, Finally compound 13 crystallises in a centrosymmetric space group. The room temperature pyroelectric coefficient of 3 has been determined, The spatial extent of the trioxatriangulene ground system has been perturbed by chemical substitution......4,8,12-Trioxa-4,8,12,12c-tetrahydrodibenzo [cd,mn]pyrene (3),2,6,10-tri-tert-butyl-4,8,12 -trioxa-4,8,12,12c-tetrahydrodibenzo [cd,mn]pyrene (11) and 2,6,10-tri-tert-butyl-4,8,12-trioxa-12c -methyl-4,8,12,12c -tetrahydrodibenzo[cd,mn]pyrene (12)have been synthesised and their crystal structures...... and the effect: of the substitutions upon the space group symmetry of the chemical derivative has been uncovered by X-ray structural resolution, The non-centrosymmetric point group symmetry of the molecules is reflected in a non-centrosymmetric space group symmetry whenever the spatial perturbations do...

  15. The Higgs mass derived from the U(3) Lie group

    DEFF Research Database (Denmark)

    Trinhammer, Ole; Bohr, Henrik; Jensen, Mogens O Stibius

    2015-01-01

    The Higgs mass value is derived from a Hamiltonian on the Lie group U(3) where we relate strong and electroweak energy scales. The baryon states of nucleon and delta resonances originate in specific Bloch wave degrees of freedom coupled to a Higgs mechanism which also gives rise to the usual gauge...... boson masses. The derived Higgs mass is around 125 GeV. From the same Hamiltonian, we derive the relative neutron to proton mass ratio and the N and Delta mass spectra. All compare rather well with the experimental values. We predict scarce neutral flavor baryon singlets that should be visible...... in scattering cross-sections for negative pions on protons, in photoproduction on neutrons, in neutron diffraction dissociation experiments and in invariant mass spectra of protons and negative pions in B-decays. The fundamental predictions are based on just one length scale and the fine structure constant...

  16. 12 CFR 509.1 - Scope.

    Science.gov (United States)

    2010-01-01

    ... violation of: (1) Section 5 of the Home Owners' Loan Act (HOLA) or any regulation or order issued thereunder, pursuant to 12 U.S.C. 1464 (d), (s) and (v); (2) Section 9 of the HOLA or any regulation or order issued thereunder, pursuant to 12 U.S.C. 1467(d); (3) Section 10 of the HOLA, pursuant to 12 U.S.C. 1467a (i) and (r...

  17. 12 CFR 225.44 - Reporting of stock loans.

    Science.gov (United States)

    2010-01-01

    ..., including an endorsement or standby letter of credit; and any other type of transaction that extends credit... that has credit outstanding to any person or group of persons, in the aggregate, which is secured... section 1(b) of the International Banking Act of 1978 (12 U.S.C. 3101). (2) Credit outstanding includes...

  18. Supersymmetric U boson and the old U(1) problem

    International Nuclear Information System (INIS)

    Kim, B.R.

    1983-01-01

    In the supersymmetric SU(3)xSU(2)xU(1)xUsup(')(1) model the new gauge group Usup(')(1) enforces the introduction of mirror fermions. In this note we address the inverse question. If one starts with SU(3)xSU(2)xU(1) including mirror fermions, what physical arguments other than the supersymmetric require the introduction of a new gauge group Usup(')(1). It turns out that the old U(1) problem is closely related with this question. Further we give an estimate for the upper bound for the parameter of the supersymmetric U boson r and x. (orig.)

  19. Groundwater Protection Program Management Plan for the U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    None

    2001-06-01

    This document presents the Groundwater Protection Program (GWPP) management plan for the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12). The Y-12 GWPP functions as the primary point-of-contact for groundwater-related issues at Y-12, provides stewardship of the extensive network of groundwater monitoring wells at Y-12, and serves as a resource for technical expertise, support, and historical data for groundwater-related activities at Y-12. These organizational functions each serve the primary programmatic purpose of the GWPP, which is to ensure that groundwater monitoring activities within areas under Y-12 administrative control provide representative data in compliance with the multiple purposes of applicable state and federal regulations, DOE orders, and the corporate policies of BWXT Y-12, L.L.C. (hereafter referenced as BWXT Y-12), the Y-12 management and operations (M and O) subcontractor for DOE.

  20. Senegal: Background and U.S. Relations

    Science.gov (United States)

    2012-04-11

    Politique et Révolution Passive. ‘Sopi’ or not ‘Sopi’?” Politique Africaine, December 2004. 12 See, for example, Abdou Latif Coulibaly, Contes et ...regional presence of violent extremist groups. Al Qaeda in the Islamic Maghreb (AQIM), an criminal- terrorist network with ties to Al Qaeda and roots...FTF_2010_Implementation_Plan_Senegal.pdf. 27 U.N. Development Program and Government of Senegal, Changement Climatique, Sécurité Alimentaire et Développement Humain

  1. Tratamento cognitivo-comportamental de grupo na fobia social: resultados de 12 semanas Cognitive-behavioral group treatment in social phobia: 12-week outcome

    Directory of Open Access Journals (Sweden)

    Gustavo J. Fonseca D'El Rey

    2008-01-01

    Full Text Available CONTEXTO: A fobia social é um dos transtornos mentais mais prevalentes na população geral. A terapia cognitivo-comportamental é o modelo não-farmacológico mais estudado nesse transtorno de ansiedade. OBJETIVOS: Este estudo teve como objetivo verificar a efetividade da terapia cognitivo-comportamental de grupo em pacientes com fobia social generalizada. MÉTODOS: Trinta e um pacientes com diagnóstico de fobia social generalizada foram randomicamente distribuídos em dois grupos: um de terapia cognitivo-comportamental de grupo - TCCG (n = 15 e um grupo-controle na Lista de Espera - LE (n = 16. Os pacientes preencheram quatro escalas de avaliação (Inventário de Fobia Social, Escala de Medo de Avaliação Negativa, Inventário de Ansiedade Beck e Escala de Impressão Clínica Global na semana 1 de tratamento e na semana 12. RESULTADOS: Em todas as medidas de avaliações, ao final de 12 semanas, os pacientes que receberam TCCG apresentaram melhoras superiores aos da LE. CONCLUSÕES: Neste ensaio clínico randomizado, simples-cego, a terapia cognitivo-comportamental de grupo foi superior à Lista de Espera no tratamento da fobia social generalizada.BACKGROUND: Social phobia is a widespread mental disorder in the general population. Cognitive-behavioral therapy is the most thoroughly studied nonpharmacologic approach in this anxiety disorder. OBJECTIVES: The aim of this study is to assess the effectiveness of cognitive-behavioral group therapy in patients with generalized social phobia. METHODS: Thirty one patients with diagnosis of generalized social phobia were randomly allocated in two groups. One group of cognitive-behavioral group therapy - CBGT (n = 15 and one Waiting List control group - WL (n = 16. The patients completed four rating scales (Social Phobia Inventory, Fear of Negative Evaluation Scale, Beck Anxiety Inventory and Clinical Global Impression Scale in the weeks 1 and 12. RESULTS: In all rating scales in the week 12 of

  2. Arthroscopic repair of large U-shaped rotator cuff tears without margin convergence versus repair of crescent- or L-shaped tears.

    Science.gov (United States)

    Park, Jin-Young; Jung, Seok Won; Jeon, Seung-Hyub; Cho, Hyoung-Weon; Choi, Jin-Ho; Oh, Kyung-Soo

    2014-01-01

    For large-sized tears of the rotator cuff, data according to the tear shape have not yet been reported for repair methodology, configuration, and subsequent integrity. The retear rate after the repair of large mobile tears, such as crescent- or L-shaped tears, is believed to be lower compared with retear rates after the repair of large U-shaped tears that are accompanied by anterior or posterior leaves of the rotator cuff. Cohort study; Level of evidence, 3. Data were collected and analyzed from 95 consecutive patients with a large-sized rotator cuff tear who underwent arthroscopic suture-bridge repair. Patients were divided into 2 groups: those having crescent- or L-shaped tears (mobile tear group, 53 patients) and those having U-shaped tears (U-shaped tear group, 42 patients). The integrity of the repaired constructs was determined by ultrasonography at 4.5, 12, and 24 months. Moreover, clinical evaluations were performed by using the Constant score, the American Shoulder and Elbow Surgeons (ASES) score, and muscle strength at intervals of 3, 6, 12, and 24 months postoperatively. On ultrasonography at 4.5, 12, and 24 months, a retear was detected in 6, 2, and 1 patients in the mobile tear group and in 5, 2, and 1 patients in the U-shaped tear group, respectively. Significant differences in retear rates were not detected between the groups overall or at each time point. Moreover, clinical scores were similar between groups, except for the presence of a temporarily higher Constant score at 12 months in the mobile tear group. With regard to shoulder strength, between-group comparisons indicated no statistically significant difference, either in abduction or external rotation, except for the presence of temporarily higher external rotation strength at 3 months in the mobile tear group. Arthroscopic repair of large-sized rotator cuff tears yielded substantial improvements in shoulder function, regardless of tear retraction, during midterm follow-up. Moreover, the

  3. Determination of the concentration of 238U, 234U, 232Th, 228Th, 228Ra, 226Ra and 210Pb in the feces of workers from a mining company of niobium and their families

    International Nuclear Information System (INIS)

    Oliveira, Roges de; Lopes, Ricardo T.; Melo, Dunstana R.; Juliao, Ligia M.Q.C.

    2005-01-01

    The object of this study consists of an open mine from which Niobium ore (pyrochlore) is extracted and a metallurgy company, where Fe-Nb alloys are produced for export. For geological reasons, the main ore is associated to natural radionuclides U and Th, and its decay products. The concentration of 234 U, 238 U, 232 Th, 226 Ra and 228 Ra, 228 Th, including 210 Pb in fecal excretion of 12:0 am, 29 workers and 13 family members were determined. The technique employed for the determination of the elements was the sequential method of radiochemical separation, followed by alpha spectrometry and counting α and β in proportional detector. Statistically significant difference was observed in the concentration of 234 U and 238 U, in feces samples, among the group of mining workers and family members; as well as for 232 Th in the feces of workers of crushing and metallurgy groups when compared with the Family Group. No statistically significant difference was detected at a concentration of 226 Ra, 228 Ra and 210 Pb, in feces of any group of workers of the installation in relation to the family group

  4. When the tables are turned: The effects of the 2016 U.S. Presidential election on in-group favoritism and out-group hostility.

    Directory of Open Access Journals (Sweden)

    Burak Oc

    Full Text Available The outcome of the 2016 U.S. Presidential election was a big surprise to many, as the majority of polls had predicted the opposite outcome. In this two-stage cross-sectional study, we focus on how Democrats and Republicans reacted to this electoral surprise and how these reactions might have influenced the way they allocated resources to each other in small groups. We find that, before the election, Republicans showed greater in-group favoritism than Democrats, who treated others equally, regardless of their political affiliation. We then show that Democrats experienced the election outcome as an ego shock and, in the week following the election, reported significantly higher levels of negative emotions and lower levels of self-esteem than Republicans. These reactions then predicted how individuals' decided to allocate resources to others: after the election, Republicans no longer showed in-group favoritism, while Democrats showed out-group derogation. We find these decisions when the tables were turned can be partially explained by differences in participants' state self-esteem.

  5. U.S.-GERMAN BILATERAL WORKING GROUP: International Research Cooperation to Develop and Evaluate Tools and Techniques for Revitalization of Potentially Contaminated Sites

    Science.gov (United States)

    The U.S. German Bilateral Working Group originated in 1990 in order to share and transfer information, ideas, tools and techniques regarding environmental research. The U.S. Environmental Protection Agency (EPA)/Office of Research and Development (ORD) and the German Federal Mini...

  6. The cultural formation code of successfulness verticals of the U.S. ethnic groups

    Directory of Open Access Journals (Sweden)

    Liudmyla Petrashko

    2010-11-01

    Full Text Available In the article there are outlined the prospects of global economic development. There was built an evolutional model of theoretical studies of the phenomenon “culture” in the context of universal, system and value approaches. It gives the brief characteristics of the cultural assimilation model “melting crucible”. There have been determined the indicators of the successfulness verticals of the U.S. ethnic groups and made their assessment. By virtue of the author’s method is given the assessment of the comparative significance of the heterogeneous cultural codes of maternal (immigration and hosting environment of the USA, which gave the possibility to determine the factors that ensure the economic success of the American ethnic groups. The results of the research provide reasoning for the change of traditional vector of the cultures’ typology and confirm the existence of the progressive cultural codes.

  7. Groundwater Protection Program Calendar Year 1998 Groundwater Monitoring Report, U.S. Department of Energy Y-12 Plant, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    This annual monitoring report contains groundwater and surface water monitoring data obtained during calendar year (CY) 1998 by the Lockheed Martin Energy Systems, Inc. Y-12 Plant Groundwater Protection Program (GWPP) at the U.S. Department of Energy (DOE) Oak Ridge Y-12 Plant, Groundwater and surface water monitoring during CY 1998 was performed in three hydrogeologic regimes at the Y-12 Plant: the Bear Creek Hydrogeologic Regime (Bear Creek Regime), the Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime), and the Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime). The Bear Creek and East Fork regimes are located in Bear Creek Valley (BCV), and the Chestnut Ridge Regime which is located south of the Y-12 Plant.

  8. Groundwater Protection Program Calendar Year 1998 Groundwater Monitoring Report, U.S. Department of Energy Y-12 Plant, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1999-01-01

    This annual monitoring report contains groundwater and surface water monitoring data obtained during calendar year (CY) 1998 by the Lockheed Martin Energy Systems, Inc. Y-12 Plant Groundwater Protection Program (GWPP) at the U.S. Department of Energy (DOE) Oak Ridge Y-12 Plant, Groundwater and surface water monitoring during CY 1998 was performed in three hydrogeologic regimes at the Y-12 Plant: the Bear Creek Hydrogeologic Regime (Bear Creek Regime), the Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime), and the Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime). The Bear Creek and East Fork regimes are located in Bear Creek Valley (BCV), and the Chestnut Ridge Regime which is located south of the Y-12 Plant

  9. Spectroscopic constants and potential energy curve of the iodine weakly bound 1u state correlating with the I(2P1/2) + I(2P1/2) dissociation limit

    International Nuclear Information System (INIS)

    Akopyan, M E; Baturo, V V; Lukashov, S S; Poretsky, S A; Pravilov, A M

    2015-01-01

    The stepwise three-step three-color laser population of the I 2 (β1 g , ν β , J β ) rovibronic states via the B0 u + , ν B , J B rovibronic states and rovibronic levels of the 1 u (bb) and 0 g + (bb) states mixed by hyperfine interaction is used for determination of rovibronic level energies of the weakly bound I 2 (1 u (bb)) state. Dunham coefficients of the state, Y i0 (i = 0–3), Y i1 (i = 0–2), Y 02 and Y 12 for the v 1 u  = 1–5, 8, 10, 15 and J 1 u  ≈ 9–87 ranges, the dissociation energy of the state, D e , and equilibrium I–I distance, R e , as well as the potential energy curve are determined. There are aperiodicities in the excitation spectrum corresponding to the β, ν β  = 23, J β  ← 1 u (bb), ν 1u  = 4, 5, J 1u progressions in the I 2  + Rg = He, Ar mixture, namely, a great number of lines which do not coincide with the R or P line progressions. Their positions conflict with the ΔJ-even selection rule. Furthermore, they do not correspond to the ΔJ-odd progression. (paper)

  10. Binary and ternary fission yields induced by 12C and 20Ne ions on 238U targets

    International Nuclear Information System (INIS)

    Otto, R.J.

    1974-01-01

    Evidence for ternary fission of 250 Cf* and 258 No* compound nuclei has been found. Relative cross section data for nuclides with masses between 24 Na and 161 Tb have been determined for 12 C bombardments of natural uranium at laboratory energies of 122 MeV, 113 MeV and 105 MeV. Relative cross section data for 8 nuclides between 24 Na and 66 Ni were sought for 20 Ne bombardments of natural uranium at 150 MeV laboratory energies. The binary fission fragment mass distribution for 238 U( 12 C,f) was determined by analysis of fission fragment recoil collection foils using radiochemical techniques and high resolution gamma ray spectroscopy. The results indicated the existence of a ternary fission branch similar to mass distributions obtained for He induced fission of Th, U, and Pu nuclei at intermediate energies. Comparison of the data with He induced ternary fission data obtained previously in this laboratory indicated an increase in the ternary fission probability with increasing Z 2 /A of the compound nucleus and with excitation energy. A shift of the binary-ternary fission product intersection point to lower mass numbers with increasing Z 2 /A and excitation energy of the compound nucleus was also observed. (Diss. Abstr. Int., B)

  11. U-Pb zircon age for a volcanic suite in the Rankin Inlet Group, Rankin Inlet map area, District of Keewatin, Northwest Territories

    International Nuclear Information System (INIS)

    Tella, S.; Roddick, J.C.; VanBreemen, O.

    1996-01-01

    U-Pb zircon analyses from a felsic band within dominantly mafic volcanics of the Rankin Inlet Group yields a U-Pb upper concordia intercept age of 2663 ± 3 Ma. These supracrustals at Rankin Inlet appear to be 15-20 Ma younger than volcanics of the Kaminak Group in the Tavani area, 70 km to the southwest. The 2.68-2.66 Ga volcanism in the Tavani and Rankin Inlet areas coincided with the last stage of the main phase of magmatism in the Slave Structural Province. (author). 16 refs., 1 tab., 3 figs

  12. U-Pb zircon age for a volcanic suite in the Rankin Inlet Group, Rankin Inlet map area, District of Keewatin, Northwest Territories

    Energy Technology Data Exchange (ETDEWEB)

    Tella, S; Roddick, J C; VanBreemen, O [Geological Survey of Canada, Ottawa, ON (Canada)

    1997-12-31

    U-Pb zircon analyses from a felsic band within dominantly mafic volcanics of the Rankin Inlet Group yields a U-Pb upper concordia intercept age of 2663 {+-} 3 Ma. These supracrustals at Rankin Inlet appear to be 15-20 Ma younger than volcanics of the Kaminak Group in the Tavani area, 70 km to the southwest. The 2.68-2.66 Ga volcanism in the Tavani and Rankin Inlet areas coincided with the last stage of the main phase of magmatism in the Slave Structural Province. (author). 16 refs., 1 tab., 3 figs.

  13. 75 FR 32834 - U.S. Department of State Advisory Committee on Private International Law Study Group Notice of...

    Science.gov (United States)

    2010-06-09

    ... DEPARTMENT OF STATE [Public Notice 7041] U.S. Department of State Advisory Committee on Private International Law Study Group Notice of Meeting on the United Nations Commission on International Trade Law (UNCITRAL) Draft Legislative Guide on Secured Transactions and Its Treatment of Security Rights in...

  14. 12 CFR 509.100 - Scope.

    Science.gov (United States)

    2010-01-01

    ... following statutory provisions: (a) Proceedings under section 10(a)(2)(D) of the HOLA (12 U.S.C. 1467a(a)(2... this part; (b) Proceedings under section 10(g)(5)(A) of the HOLA (12 U.S.C. 1467a(g)(5)(A)) to...

  15. Master formula approach to broken chiral U(3)xU(3) symmetry

    Energy Technology Data Exchange (ETDEWEB)

    Hiroyuki Kamano

    2010-04-01

    The master formula approach to chiral symmetry breaking proposed by Yamagishi and Zahed is extended to the U_R(3)xU_L(3) group, in which effects of the U_A(1) anomaly and the flavor symmetry breaking m_u \

  16. Incidence and 12-month outcome of non-transient childhood conversion disorder in the U.K. and Ireland.

    Science.gov (United States)

    Ani, Cornelius; Reading, Richard; Lynn, Richard; Forlee, Simone; Garralda, Elena

    2013-06-01

    Little is known about conversion disorder in childhood. To document clinical incidence, features, management and 12-month outcome of non-transient conversion disorder in under 16-year-olds in the U.K. and Ireland. Surveillance through the British Paediatric Surveillance Unit and Child and Adolescent Psychiatry Surveillance System. In total, 204 cases (age range 7-15 years) were reported, giving a 12-month incidence of 1.30/100 000 (95% CI 1.11-1.52). The most common symptoms were motor weakness and abnormal movements. Presentation with multiple symptoms was the norm. Antecedent stressors were reported for 80.8%, most commonly bullying in school. Most children required in-patient admission with frequent medical investigations. Follow-up at 12 months was available for 147 children, when all conversion disorder symptoms were reported as improved. Most families (91%) accepted a non-medical explanation of the symptoms either fully or partially. Childhood conversion disorder represents an infrequent but significant clinical burden in the UK and Ireland.

  17. U-series dating using thermal ionisation mass spectrometry (TIMS)

    International Nuclear Information System (INIS)

    McCulloch, M.T.

    1999-01-01

    U-series dating is based on the decay of the two long-lived isotopes 238 U1/2 =4.47 x 10 9 years) and 235 U1/2 0.7 x 10 9 years). 238 U and its intermediate daughter isotopes 234 U1/2 = 245.4 ka) and 230 Th (τ 1/2 = 75.4 ka) have been the main focus of recently developed mass spectrometric techniques (Edwards et al., 1987) while the other less frequently used decay chain is based on the decay 235 U to 231 Pa (τ 1/2 = 32.8 ka). Both the 238 U and 235 U decay chains terminate at the stable isotopes 206 Pb and 207 Pb respectively. Thermal ionization mass spectrometry (TIMS) has a number of inherent advantages, mainly the ability to measure isotopic ratios at high precision on relatively small samples. In spite of these now obvious advantages, it is only since the mid-1980's when Chen et al., (1986) made the first precise measurements of 234 U and 232 Th in seawater followed by Edwards et al., (1987) who made combined 234 U- 230 Th measurements, was the full potential of mass spectrometric methods first realised. Several examples are given to illustrate various aspects of TIMS U-series

  18. 8-group relative delayed neutron yields for epithermal neutron induced fission of 235U and 239Pu

    International Nuclear Information System (INIS)

    Piksaikin, V.M.; Kazakov, L.E.; Isaev, S.G.; Korolev, G.G.; Roshchenko, V.A.; Tertychnyj, R.G

    2002-01-01

    An 8-group representation of relative delayed neutron yields was obtained for epithermal neutron induced fission of 235 U and 239 Pu. These data were compared with ENDF/B-VI data in terms of the average half- life of the delayed neutron precursors and on the basis of the dependence of reactivity on the asymptotic period. (author)

  19. Lineage II (Serovar 1/2a and 1/2c) Human Listeria monocytogenes Pulsed-Field Gel Electrophoresis Types Divided into PFGE Groups Using the Band Patterns Below 145.5 kb.

    Science.gov (United States)

    Lopez-Valladares, Gloria; Danielsson-Tham, Marie-Louise; Goering, Richard V; Tham, Wilhelm

    2017-01-01

    Among 504 clinical lineage II isolates of Listeria monocytogenes isolated during 1958-2010 in Sweden, 119 pulsed-field gel electrophoresis (PFGE) types (AscI) have been identified based on the number and distribution of all banding patterns in each DNA profile. In this study, these types were further divided into PFGE groups based on the configuration of small bands with sizes kb. The 504 isolates included 483 serovar 1/2a isolates distributed into 114 PFGE types and 21 serovar 1/2c isolates distributed into 9 PFGE types; these were further divided into 21 PFGE groups. PFGE group, that is, configuration of small bands below 145.5 kb, and serovars were correlated. L. monocytogenes isolates belonging to PFGE groups A, B, C, E, F, H, K, L, M, S, V, W, Y, and Ö-6 to Ö-12 shared serovar 1/2a, with one exception. PFGE group E also included two PFGE types sharing serovar 1/2c and four PFGE types belonging to either serovar 1/2a or 1/2c. Isolates belonging to PFGE group N shared serovar 1/2c. In contrast to lineage I isolates, small fragments kb were visible in all L. monocytogenes isolates belonging to lineage II. In the results from both the present and previous studies, the genomic region of small bands was genetically more conservative than in large bands. The distribution of these small bands established the relatedness of strains and defined a genetic marker for both lineages I and II, while also establishing their serogroup. The division of L. monocytogenes PFGE types into PFGE groups is advantageous as the profile of every new isolate can be identified easily and quickly through first studying the PFGE group affiliation of the isolate based on the smaller band patterns kb, and then identifying the PFGE type based on the band patterns >145.5 kb.

  20. 12 CFR 508.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... meaning of section 2(4) of the Home Owners' Loan Act of 1933, as amended, 12 U.S.C. 1462(4) (“HOLA”), an... 10(a)(1)(D) of the HOLA, 12 U.S.C. 1467a(a)(1)(D) and a subsidiary of a savings and loan holding...

  1. Mianningite, (□,Pb,Ce,Na) (U{sup 4+},Mn,U{sup 6+}) Fe{sup 3+}{sub 2}(Ti,Fe{sup 3+}){sub 18}O{sub 38}, a new member of the crichtonite group from Maoniuping REE deposit, Mianning county, southwest Sichuan, China

    Energy Technology Data Exchange (ETDEWEB)

    Ge, Xiangkun; Fan, Guang; Chen, Zhangru; Ai, Yujie [Beijing Research Institute of Uranium Geology, Beijing (China); Li, Guowu [China Univ. of Geosciences, Beijing (China). Lab. of Crystal Structure; Shen, Ganfu [Chengdu Institute of Geology and Mineral Resources, Chengdu (China)

    2017-05-15

    Mianningite (IMA 2014-072), ideally (□,Pb,Ce,Na)(U{sup 4+},Mn,U{sup 6+}) Fe{sup 3+}{sub 2}(Ti,Fe{sup 3+}){sub 18}O{sub 38}, is a new member of the crichtonite group from the Maoniuping REE deposit, Mianning county, Sichuan province, China. It was found in fractures of lamprophyre veins and in the contact between lamprophyre and a later quartz-alkali feldspar syenite dyke with REE mineralization, and is named after its type locality. Associated minerals are microcline, albite, quartz, iron-rich phlogopite, augite, muscovite, calcite, baryte, fluorite, epidote, pyrite, magnetite, hematite, galena, hydroxylapatite, titanite, ilmenite, rutile, garnet-group minerals, zircon, allanite-(Ce), monazite-(Ce), bastnaesite-(Ce), parisite-(Ce), maoniupingite-(Ce), thorite, pyrochlore-group minerals and chlorite. Mianningite occurs as opaque subhedral to euhedral tabular crystals, up to 1-2 mm in size, black in color and streak, and with a submetallic luster. Mianningite is brittle, with a conchoidal fracture. Its average micro-indentation hardness is 83.8 kg/mm{sup 2} (load 0.2 kg), which is equivalent to ∝6 on the Mohs hardness scale. Its measured and calculated densities are 4.62 (8) g/cm{sup 3} and 4.77 g/cm{sup 3}, respectively. Under reflected light, mianningite is grayish white, with no internal reflections. It appears isotropic and exhibits neither bireflectance nor pleochroism. The empirical formula, calculated on the basis of 38 O atoms per formula unit (apfu), is [□{sub 0.322}(Pb{sub 0.215}Ba{sub 0.037}Sr{sub 0.036}Ca{sub 0.010}){sub Σ0.298}(Ce{sub 0.128}La{sub 0.077}Nd{sub 0.012}){sub Σ0.217} (Na{sub 0.127}K{sub 0.036}){sub Σ0.163}]{sub Σ01.000}(U{sup 4+}{sub 0.447}Mn{sub 00.293}U{sup 6} {sup +}{sub 0.112}Y{sub 0.091}Zr{sub 0.023}Th{sub 0.011}){sub Σ0.977}(Fe{sup 3+}{sub 1.224}Fe{sup 2+}{sub 0.243}Mg{sub 0.023}P{sub 0.008}Si{sub 0.006} □{sub 0.496}){sub Σ2.000}(Ti{sub 12.464}Fe{sup 3+}{sub 5.292}V{sup 5+}{sub 0.118}Nb{sub 0.083}Al{sub 0.026}Cr{sup 3

  2. The effects of MEK1/2 inhibition on cigarette smoke exposure-induced ET receptor upregulation in rat cerebral arteries

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Lei [Division of Experimental Vascular Research, Institute of Clinical Sciences in Lund, Lund University (Sweden); Department of Pharmacology, School of Basic Medical Sciences, Xi' an Jiaotong University Health Science Center, Xi' an, Shaanxi (China); Ping, Na-Na; Cao, Yong-Xiao [Department of Pharmacology, School of Basic Medical Sciences, Xi' an Jiaotong University Health Science Center, Xi' an, Shaanxi (China); Li, Wei, E-mail: 13572512207@163.com [Department of Hepatobiliary Surgery, First Affiliated Hospital of Xi' an Jiaotong University, Xi' an, Shaanxi (China); Cai, Yan [Department of Pharmacology, School of Basic Medical Sciences, Xi' an Jiaotong University Health Science Center, Xi' an, Shaanxi (China); Warfvinge, Karin; Edvinsson, Lars [Division of Experimental Vascular Research, Institute of Clinical Sciences in Lund, Lund University (Sweden)

    2016-08-01

    Cigarette smoking, a major stroke risk factor, upregulates endothelin receptors in cerebral arteries. The present study examined the effects of MEK1/2 pathway inhibition on cigarette smoke exposure-induced ET receptor upregulation. Rats were exposed to the secondhand smoke (SHS) for 8 weeks followed by intraperitoneal injection of MEK1/2 inhibitor, U0126 for another 4 weeks. The urine cotinine levels were assessed with high-performance liquid chromatography. Contractile responses of isolated cerebral arteries were recorded by a sensitive wire myograph. The mRNA and protein expression levels of receptor and MEK/ERK1/2 pathway molecules were examined by real-time PCR and Western blotting, respectively. Cerebral artery receptor localization was determined with immunohistochemistry. The results showed the urine cotinine levels from SHS exposure group were significantly higher than those from the fresh group. In addition, the MEK1/2 inhibitor, U0126 significantly reduced SHS exposure-increased ET{sub A} receptor mRNA and protein levels as well as contractile responses mediated by ET{sub A} receptors. The immunoreactivity of increased ET{sub A} receptor expression was primarily cytoplasmic in smooth muscle cells. In contrast, ET{sub B} receptor was noted in endothelial cells. However, the SHS-induced decrease in endothelium-dependent relaxation was unchanged after U0126 treatment. Furthermore, SHS increased the phosphorylation of MEK1/2 and ERK1/2 protein in cerebral arteries. By using U0126 could inhibit the phosphorylated ERK1/2 protein but not MEK1/2. Taken together, our data show that treatment with MEK1/2 pathway inhibitor offsets SHS exposure-induced ET{sub A} receptor upregulation in rat cerebral arteries. - Highlights: • Cigarette smoke exposure induces ET{sub A} receptor upregulation in rat cerebral arteries. • U0126 can alleviate the receptor upregulation. • The mechanism relies on MEK/ERK1/2 pathway activation. • We may provide a new target for the

  3. The effects of MEK1/2 inhibition on cigarette smoke exposure-induced ET receptor upregulation in rat cerebral arteries

    International Nuclear Information System (INIS)

    Cao, Lei; Ping, Na-Na; Cao, Yong-Xiao; Li, Wei; Cai, Yan; Warfvinge, Karin; Edvinsson, Lars

    2016-01-01

    Cigarette smoking, a major stroke risk factor, upregulates endothelin receptors in cerebral arteries. The present study examined the effects of MEK1/2 pathway inhibition on cigarette smoke exposure-induced ET receptor upregulation. Rats were exposed to the secondhand smoke (SHS) for 8 weeks followed by intraperitoneal injection of MEK1/2 inhibitor, U0126 for another 4 weeks. The urine cotinine levels were assessed with high-performance liquid chromatography. Contractile responses of isolated cerebral arteries were recorded by a sensitive wire myograph. The mRNA and protein expression levels of receptor and MEK/ERK1/2 pathway molecules were examined by real-time PCR and Western blotting, respectively. Cerebral artery receptor localization was determined with immunohistochemistry. The results showed the urine cotinine levels from SHS exposure group were significantly higher than those from the fresh group. In addition, the MEK1/2 inhibitor, U0126 significantly reduced SHS exposure-increased ET A receptor mRNA and protein levels as well as contractile responses mediated by ET A receptors. The immunoreactivity of increased ET A receptor expression was primarily cytoplasmic in smooth muscle cells. In contrast, ET B receptor was noted in endothelial cells. However, the SHS-induced decrease in endothelium-dependent relaxation was unchanged after U0126 treatment. Furthermore, SHS increased the phosphorylation of MEK1/2 and ERK1/2 protein in cerebral arteries. By using U0126 could inhibit the phosphorylated ERK1/2 protein but not MEK1/2. Taken together, our data show that treatment with MEK1/2 pathway inhibitor offsets SHS exposure-induced ET A receptor upregulation in rat cerebral arteries. - Highlights: • Cigarette smoke exposure induces ET A receptor upregulation in rat cerebral arteries. • U0126 can alleviate the receptor upregulation. • The mechanism relies on MEK/ERK1/2 pathway activation. • We may provide a new target for the treatment of SHS

  4. U(1) textures and Lepton Flavor Violation

    CERN Document Server

    Gómez, M E; Lola, S; Vergados, J D

    1999-01-01

    U(1) family symmetries have led to successful predictions of the fermion mass spectrum and the mixing angles of the hadronic sector. In the context of the supersymmetric unified theories, they further imply a non-trivial mass structure for the scalar partners, giving rise to new sources of flavour violation. In the present work, lepton flavour non-conserving processes are examined in the context of the MSSM augmented by a U(1) family symmetry. We calculate the mixing effects on the mu -> e gamma and tau-> mu gamma rare decays. All supersymmetric scalar masses involved in the processes are determined at low energies using two loop renormalisation group analysis and threshold corrections. Further, various novel effects are considered and found to have important impact on the branching ratios. Thus, a rather interesting result is that when the see-saw mechanism is applied in the (12X12)-sneutrino mass matrix, the mixing effects of the Dirac matrix in the effective light sneutrino sector are canceled at first ord...

  5. A critique on efficient market hypothesis (EMH): Empirical evidence of return anomalies in 12 U.S. industry portfolios

    OpenAIRE

    Lee, Cheng Hsun George

    2006-01-01

    This paper focuses on two major arguments the momentum effect and market-learns hypothesis concerning the validity of the Efficient Market Hypothesis are summarized. Six empirical experiments with 12 U.S. Industry Portfolio are conducted. They not only provide the evidence against some of the EMH assumptions, but also aim to address the formation of return anomalies. Of them, three are designed to assess the validity of EMH with different approaches (White Noise, Effectiveness, Forecastibilit...

  6. U Ananth Kini

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. U Ananth Kini. Articles written in Resonance – Journal of Science Education. Volume 6 Issue 12 December 2001 pp 69-79 General Article. Peer-to-Peer Networking - Is this the Future of Network Computing? U Ananth Kini Samarth M Shetty · More Details Fulltext ...

  7. U, Pu, and Am nuclear signatures of the Thule hydrogen bomb debris

    DEFF Research Database (Denmark)

    Eriksson, Mats; Lindahl, Patric; Roos, Per

    2008-01-01

    ). In the five hot particles examined, the measured uranium atomic ratio was U-235/U-238 = 1.02 +/- 0.16 and the Pu-isotopic ratios were as follows: Pu-240/Pu-239 0.0551 +/- 0.0008 (atom ratio), Pu-238/Pu239+240 = 0.0161 +/- 0.0005 (activity ratio), Pu-241/Pu239+240 = 0.87 +/- 0.12 (activity ratio), and Am-241...... than one Pu source involved in the accident, confirming earlier studies. The Pu-238/Pu239+240 activity ratio and the Pu-240/Pu-239 atomic ratio were divided into at least two Pu-isotopic ratio groups. For both Pu-isotopic ratios, one ratio group had identical ratios as the five hot particles described...... above and for the other groups the Pu isotopic ratios were lower (Pu-238/Pu239+240 activity ratio similar to 0.01 and the Pu-240/Pu-239 atomic ratio 0.03). On the studied particles we observed that the U/Pu ratio decreased as a function of the time these particles were present in the sediment. We...

  8. Evaluating Motoric Performance of 10 - 12 Age Group Football Players

    Directory of Open Access Journals (Sweden)

    Mehmet KUMARTAŞLI

    2014-08-01

    Full Text Available The aim of this study is to evaluate motoric perfromance of 10 - 12 age group football players. Akdeniz University tiny football team joined as experiment group and 80. Yıl Cumhuriyet Grammar School football team joined to the study as control group. An exercise programme with educational game format considering physical capacities and develeopment features was applied to the student as 8 weeks, 3 days a week. Standing long jump, flexibilty, 20 m. speed, handgrip strength, arm pull, vert ical jump, 10x5 shuttle run and leg strength tests were applied to the students. Handled data were compared at SPSS 10 statistic programme by using Independent Sample t Test. Students’ lenght and weight measurements were calculated. As a result of measurem ents, there were not found diffrences between experimental and control group’s standing long jump, flexibilty, 20 m. speed, handgrip strength, a vertical jump, 10x5 shuttle run and leg strength tests (p>0,05; but in arm pull test, statistically difference was found (p<0,01. While evaluating the physical performance in cihldren and adolescents, growth process is had to be considered. The results of football players that exercise regularly from small ages at physical and physiologic measurements have an importance according to their age. Performance observed in children is sudden and temporary. There are a few studies in the literature about negative psycological effects of starting trainings in early ages.

  9. Complex quantum groups

    International Nuclear Information System (INIS)

    Drabant, B.; Schlieker, M.

    1993-01-01

    The complex quantum groups are constructed. They are q-deformations of the real Lie groups which are obtained as the complex groups corresponding to the Lie algebras of type A n-1 , B n , C n . Following the ideas of Faddeev, Reshetikhin and Takhtajan Hopf algebras of regular functionals U R for these complexified quantum groups are constructed. One has thus in particular found a construction scheme for the q-Lorentz algebra to be identified as U(sl q (2,C). (orig.)

  10. Morbidity ranking of U.S. workers employed in 206 occupations: the National Health Interview Survey (NHIS) 1986-1994.

    Science.gov (United States)

    Lee, David J; Fleming, Lora E; Gómez-Marín, Orlando; LeBlanc, William G; Arheart, Kristopher L; Caban, Alberto J; Christ, Sharon L; Chung-Bridges, Katherine; Pitman, Terry

    2006-02-01

    The objective of this study was to rank U.S. occupations by worker morbidity. From 1986 through 1994, morbidity information was collected on over 410,000 U.S. workers who participated in the National Health Interview Survey, an annual household survey representative of the U.S. civilian noninstitutionalized population. A multivariate adjusted logistic regression morbidity summary score was created for each worker group based on seven indicators: days of restricted activity, bedrest, and missed work in the previous 2 weeks; doctor visits and hospitalizations in the previous 12 months; reported health conditions; and health status. Worker groups reporting the greatest morbidity included social workers, inspectors, postal clerks, psychologists, and grinding machine operators; worker groups reporting the least morbidity included dentists, pilots, physicians, pharmacists, and dietitians. These findings aid in the identification of worker groups that require increased attention for morbidity research and prevention.

  11. Nonlinear Schroedinger equation with U(p,q) isotopical group

    International Nuclear Information System (INIS)

    Makhankov, V.G.; Pashaev, O.K.

    1981-01-01

    The properties of the nonlinear Schroedinger equation (NLS) with U(1,1) isogroup are considered in detail. This example illustrates the essential difference between the system and the well-known ''vector'' NLS, i.e. the large set of allowed boundary conditions on the fields that leads to a rich set of solutions of the system. Four types of boundary conditions and related soliton solutions are considered. The Bohr-Sommerfeld quantization allows to interpret them in terms of ''drops'' and ''bubbles'' as bound states of a large number of constituent bosons subject to the thermodynamical relations for gas mixtures. The U(1,1) system under the vanishing boundary conditions may be considered as continuous analog of the Hubbard model and therefore the paper is concluded by studying the inverse scattering equations for this case [ru

  12. Binding site for the adenosyl group of coenzyme B12 in diol dehydrase

    International Nuclear Information System (INIS)

    Toraya, T.

    1985-01-01

    The binding of cob(II)alamin (CblII) and 5'-deoxyadenosine to diol dehydrase was studied spectroscopically and with [U- 14 C]5'-deoxyadenosine. CblII was bound to this enzyme forming a tight 1:1 complex which was resistant to oxidation by O 2 even in the presence of CN-. An irreversible 1:1:1 ternary complex was formed between enzyme, CblII, and 5'-deoxyadenosine, when the enzyme was incubated first with the nucleoside and then with CblII. When this order of addition of the constituents was reversed, no 5'-deoxyadenosine was bound to the enzyme-CblII complex. Hydroxocobalamin could also bind to the enzyme together with the nucleoside, while other cob(III)alamins bearing a bulkier Co beta ligand displaced the nucleoside upon binding to the enzyme. The binding of [U- 14 C]5'-deoxyadenosine was strongly inhibited by unlabeled 5'-deoxy-ara-adenosine, 4',5'-anhydroadenosine, adenosine, adenine, and 5',8-cyclic adenosine, in this order, but not by 5'-deoxyuridine. These results constitute direct evidence for the presence of the binding site for the adenosyl group of adenosylcobalamin, which is spatially limited to and highly specific for adenine nucleosides. The binding of 5'-deoxyadenosine to the apoenzyme was reversible

  13. Variations and Regularities in the Hemispheric Distributions in Sunspot Groups of Various Classes

    Science.gov (United States)

    Gao, Peng-Xin

    2018-05-01

    The present study investigates the variations and regularities in the distributions in sunspot groups (SGs) of various classes in the northern and southern hemispheres from Solar Cycles (SCs) 12 to 23. Here, we use the separation scheme that was introduced by Gao, Li, and Li ( Solar Phys. 292, 124, 2017), which is based on A/U ( A is the corrected area of the SG, and U is the corrected umbral area of the SG), in order to separate SGs into simple SGs (A/U ≤ 4.5) and complex SGs (A/U > 6.2). The time series of Greenwich photoheliographic results from 1875 to 1976 (corresponding to complete SCs 12 - 20) and Debrecen photoheliographic data during the period 1974 - 2015 (corresponding to complete SCs 21 - 23) are used to show the distributions of simple and complex SGs in the northern and southern hemispheres. The main results we obtain are reported as follows: i) the larger of the maximum annual simple SG numbers in the two hemispheres and the larger of the maximum annual complex SG numbers in the two hemispheres occur in different hemispheres during SCs 12, 14, 18, and 19; ii) the relative changing trends of two curves - cumulative SG numbers in the northern and southern hemispheres - for simple SGs are different from those for complex SGs during SCs 12, 14, 18, and 21; and iii) there are discrepancies between the dominant hemispheres of simple and complex SGs for SCs 12, 14, 18, and 21.

  14. New solutions of the Yang-Baxter equation based on root of 1 representations of the Para-Bose superalgebra Uq[osp(1/2)

    International Nuclear Information System (INIS)

    Palev, T.D.; Stoilova, N.I.

    1995-07-01

    New solutions of the quantum Yang-Baxter equation, depending in general on three arbitrary parameters, are written down. They are based on the root of unity representations of the quantum orthosymplectic superalgebra U q [osp(1/2)], which were found recently. Representations of the braid group B N are defined within any N th tensorial power of root of 1 U q [osp(1/2)] modules. (author). 40 refs

  15. The Globalization of Cooperative Groups

    Science.gov (United States)

    Valdivieso, Manuel; Corn, Benjamin W.; Dancey, Janet E.; Wickerham, D. Lawrence; Horvath, L. Elise; Perez, Edith A.; Urton, Alison; Cronin, Walter M.; Field, Erica; Lackey, Evonne; Blanke, Charles D.

    2015-01-01

    The National Cancer Institute-supported adult cooperative oncology research groups (now officially Network groups) have a long-standing history of participating in international collaborations throughout the world. Most frequently, the U.S. based cooperative groups work reciprocally with the Canadian national adult cancer clinical trial group, NCIC CTG (previously the National Cancer Institute of Canada Clinical Trials Group). Thus, Canada is the largest contributor to cooperative groups based in the U.S., and vice versa. Although international collaborations have many benefits, they are most frequently utilized to enhance patient accrual to large phase III trials originating in the U.S. or Canada. Within the cooperative group setting, adequate attention has not been given to the study of cancers that are unique to countries outside the U.S. and Canada, such as those frequently associated with infections in Latin America, Asia and Africa. Global collaborations are limited by a number of barriers, some of which are unique to the countries involved, while others are related to financial support and to U.S. policies that restrict drug distribution outside the U.S. This manuscript serves to detail the cooperative group experience in international research and describe how international collaboration in cancer clinical trials is a promising and important area that requires greater consideration in the future. PMID:26433551

  16. 12 CFR 1777.1 - Authority, purpose, scope, and implementation dates.

    Science.gov (United States)

    2010-01-01

    ....S.C. 4514), section 307(c) of the Federal Home Loan Mortgage Corporation Act (12 U.S.C. 1456(c... U.S.C. 4611 through 4623), section 303(b)(2) of the Federal Home Loan Mortgage Corporation Act (12 U... Housing Enterprises Financial Safety and Soundness Act (1992 Act) (12 U.S.C. 4513, 4631, 4632, and 4636...

  17. Motivational intervention to enhance post-detoxification 12-Step group affiliation: a randomized controlled trial.

    Science.gov (United States)

    Vederhus, John-Kåre; Timko, Christine; Kristensen, Oistein; Hjemdahl, Bente; Clausen, Thomas

    2014-05-01

    To compare a motivational intervention (MI) focused on increasing involvement in 12-Step groups (TSGs; e.g. Alcoholics Anonymous) versus brief advice (BA) to attend TSGs. Patients were assigned randomly to either the MI or BA condition, and followed-up at 6 months after discharge. One hundred and forty substance use disorder (SUD) patients undergoing in-patient detoxification (detox) in Norway. The primary outcome was TSG affiliation measured with the Alcoholics Anonymous Affiliation Scale (AAAS), which combines meeting attendance and TSG involvement. Substance use and problem severity were also measured. At 6 months after treatment, compared with the BA group, the MI group had higher TSG affiliation [0.91 point higher AAAS score; 95% confidence interval (CI) = 0.04 to 1.78; P = 0.041]. The MI group reported 3.5 fewer days of alcohol use (2.1 versus 5.6 days; 95% CI = -6.5 to -0.6; P = 0.020) and 4.0 fewer days of drug use (3.8 versus 7.8 days; 95% CI = -7.5 to -0.4; P = 0.028); however, abstinence rates and severity scores did not differ between conditions. Analyses controlling for duration of in-patient treatment did not alter the results. A motivational intervention in an in-patient detox ward was more successful than brief advice in terms of patient engagement in 12-Step groups and reduced substance use at 6 months after discharge. There is a potential benefit of adding a maintenance-focused element to standard detox. © 2014 The Authors. Addiction published by John Wiley & Sons Ltd on behalf of Society for the Study of Addiction.

  18. Effects of activin A and its downstream ERK1/2 in oxygen and glucose deprivation after isoflurane-induced postconditioning.

    Science.gov (United States)

    Wang, Qin; Yin, Jiangwen; Wang, Sheng; Cui, Di; Lin, Hong; Ge, Mingyue; Dai, Zhigang; Xie, Liping; Si, Junqiang; Ma, Ketao; Li, Li; Zhao, Lei

    2016-12-01

    Isoflurane postconditioning (ISPOC) plays a neuroprotection role in the brain. Previous studies confirmed that isoflurane postconditioning can provide better protection than preconditioning in acute hypoxic-ischemic brain damage, such as acute craniocerebral trauma and ischemic stroke. Numerous studies have reported that activin A can protect rat's brain from cell injury. However, whether activin A and its downstream ERK1/2 were involved in isoflurane postconditioning-induced neuroprotection is unknown. A total of 80 healthy Sprague-Dawley rats weighing 50-70g were randomly divided into 10 groups of 8: normal control, oxygen and glucose deprivation (OGD), 1.5% ISPOC, 3.0% ISPOC, 4.5% ISPOC, blocker of activin A (SB431542), blocker of ERK1/2 (U0126), 3.0% ISPOC+SB431542, 3.0% ISPOC+U0126, and vehicle (dimethyl sulfoxide(DMSO)) group. Blockers (SB431542 and U0126) were used in each concentration of isoflurane before OGD. Hematoxylin-eosin staining, 2,3,5-triphenyl tetrazolium chloride staining, and propidium iodide (PI) staining were conducted to assess the reliability in the brain slices. Immunofluorescence, Western blot, and quantitative real-time PCR(Q-PCR) were performed to validate the protein expression levels of activin A, Smad2/3, P-Smad2/3, ERK1/2, and phosphorylation ERK1/2 (P-ERK1/2). The number of damaged neurons and mean fluorescence intensity(MFI) of PI staining increased, but formazan generation, expression levels of activin A and P-ERK1/2 protein, and mRNA synthesis level of activin A decreased in the OGD group compared with the normal control group (pneurons and MFI of PI staining decreased, but formazan production, expression levels of activin A, P-Smad2/3, and P-ERK1/2, and mRNA synthesis level of activin A increased significantly in the 1.5% ISPOC and 3.0% ISPOC groups (pneuron and MFI of PI staining increased, but formazan production, expression levels of activin A, P-Smad2/3, and P-ERK1/2, and mRNA synthesis level of activin A decreased in the 4

  19. 12 CFR 545.92 - Branch offices.

    Science.gov (United States)

    2010-01-01

    ... United States and its territories unless the location would violate: (1) Section 5(r) of the HOLA (12 U.S.C. 1464(r)); (2) Section 10(e)(3) of the HOLA (12 U.S.C. 1467a(e)(3)); or (3) Section 13(k)(4) of...

  20. THE RELATIONSHIP BETWEEN MOTOR COMPETENCE AND PHYSICAL FITNESS IS WEAKER IN THE 15-16 YR. ADOLESCENT AGE GROUP THAN IN YOUNGER AGE GROUPS (4-5 YR. AND 11-12 YR.).

    Science.gov (United States)

    Haga, Monika; Gísladóttír, Thórdís; Sigmundsson, Hermundur

    2015-12-01

    Developing motor competence and physical fitness can affect the maintenance of a sufficient level of physical activity in children and adolescents. This study assesses the relationship between motor competence and physical fitness from childhood through early adolescence. A cross-sectional sample of 194 participants from 4 to 16 years old were divided into three groups; 4-6 yr. (n=42, M age=5.2, SD 0.6), 11-12 yr. (n=58, M age=12.4, SD=0.3), and 15-16 yr. (n=94, M age=15.9, SD=0.4). To assess motor competence, each child completed the Movement Assessment Battery for Children (MABC). To measure physical fitness, three tasks (strength, speed, and endurance) were selected from the Test of Physical Fitness (TPF). To analyze the significance of the difference between the correlation coefficient in the three age groups (samples) (4-6, 11-12, and 15-16 yr.), Fischer r-to-z transformation was used. The correlation (Pearson's) between motor competence and physical fitness in the age groups was statistically higher for the youngest age groups (4-6 and 11-12 yr.) and the adolescent group (age 15-16). The differences between the two youngest age groups were not statistically significant. The results demonstrate that the correlation between motor competence and physical fitness decreases with age.

  1. Developing Inventory Projection Models Using Empirical Net Forest Growth and Growing-Stock Density Relationships Across U.S. Regions and Species Group

    Science.gov (United States)

    Prakash Nepal; Peter J. Ince; Kenneth E. Skog; Sun J. Chang

    2012-01-01

    This paper describes a set of empirical net forest growth models based on forest growing-stock density relationships for three U.S. regions (North, South, and West) and two species groups (softwoods and hardwoods) at the regional aggregate level. The growth models accurately predict historical U.S. timber inventory trends when we incorporate historical timber harvests...

  2. Hurricanes and Climate: the U.S. CLIVAR Working Group on Hurricanes

    Science.gov (United States)

    Walsh, Kevin; Camargo, Suzana J.; Vecchi, Gabriel A.; Daloz, Anne Sophie; Elsner, James; Emanuel, Kerry; Horn, Michael; Lim, Young-Kwon; Roberts, Malcolm; Patricola, Christina; hide

    2015-01-01

    While a quantitative climate theory of tropical cyclone formation remains elusive, considerable progress has been made recently in our ability to simulate tropical cyclone climatologies and understand the relationship between climate and tropical cyclone formation. Climate models are now able to simulate a realistic rate of global tropical cyclone formation, although simulation of the Atlantic tropical cyclone climatology remains challenging unless horizontal resolutions finer than 50 km are employed. The idealized experiments of the Hurricane Working Group of U.S. CLIVAR, combined with results from other model simulations, have suggested relationships between tropical cyclone formation rates and climate variables such as mid-tropospheric vertical velocity. Systematic differences are shown between experiments in which only sea surface temperature is increases versus experiments where only atmospheric carbon dioxide is increased, with the carbon dioxide experiments more likely to demonstrate a decrease in numbers. Further experiments are proposed that may improve our understanding of the relationship between climate and tropical cyclone formation, including experiments with two-way interaction between the ocean and the atmosphere and variations in atmospheric aerosols.

  3. 12 CFR 329.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... the bank does not reserve the right to require at least seven days' written notice prior to withdrawal...-100 (12 U.S.C. 1832(a)(2)).1 1 Paragraph (1) of 12 U.S.C. 1832(a) authorizes banks to let certain... accounts which consist solely of funds in which the entire beneficial interest is held by one or more...

  4. Multichannel interactions in the (1σ/sub g/)2(1σ/sub u/)nsσ, ndλ(3Σ+/sub u/,3Σ+/sub u/,3Pi/sub u/,3Δ/sub u/) Rydberg structures of He2

    International Nuclear Information System (INIS)

    Ginter, D.S.; Ginter, M.L.

    1988-01-01

    We show that a minimal parameter coupled channel model based on eigenquantum defect theory can reproduce quantitatively the known Rydberg structures associated with six channels of nsσ,ndλ( 3 Σ + /sub u/, 3 Σ + /sub u/, 3 Pi/sub u/, 3 Δ/sub u/) v = 0 ancestry in He 2 . Except for a few levels affected by accidental perturbations, these extensive level structures can be reproduced to within average experimental uncertainties. Previously unreported spectral analyses for transitions to the b 3 Pi/sub g/ state from rotational levels in the nl channel segments with n = 12--18 are included in this work. These spectral transitions were predicted and observed in the early stages of this investigation and were used to determine a number of new energy levels for the n = 3--18 data base used in subsequent calculations. The model uses a U matrix modified slightly from a Hund's case (b) to case (d) transformation and energy dependent eigenquantum defects μ/sub α/. Discussed in detail is a specific 14 parameter representation for ∼500 energy levels in which 2 parameters modify U to include interactions between ns and nd and 12 parameters describe the variation of the μ/sub α/'s with energy

  5. Respiratory activity variations induced in groups of LD 12:12 synchronized Sprague-Dawley rats by a 100 dB white noise emitted at 12-h intervals.

    Science.gov (United States)

    Stupfel, M; Molin, D; Thierry, H; Busnel, M C

    1980-01-01

    A white noise is emitted during 2 h, either in the middle of the scotoperiod (activity period) or of the photoperiod (rest period), on grouped specific pathogen free (SPF) male Sprague-Dawley rats, LD 12:12 synchronized by light (L = 6 h = 150 lux). Continuous measurements of VCO2, taken as an index of respiratory activity shows: 1. a short increase both after the beginning and the end of the stimulus, with slight time length differences between young and older rats; 2. a slight (2-3%) continued increase during the photoperiod and a high decrease (13%) during the scotoperiod. These VCO2 variations obtained during and after the white noise emission correspond to measurements of activity displacement and observations of behavior performed on a small sample of rats.

  6. Changes in body mass, stature and BMI in South African elite U18 Rugby players from different racial groups from 2002-2012.

    Science.gov (United States)

    Durandt, Justin; Green, Mervin; Masimla, Herman; Lambert, Mike

    2018-03-01

    The purpose of this study was to determine whether there are differences between racial groups for body mass, stature and body mass index (BMI) in South African elite U18 rugby players and whether there were significant changes in these measurements between 2002 and 2012. Self-reported body mass and stature were obtained from U18 players (n = 4007) who attended the national tournament during this period. BMI was calculated for each player.White players were 9.8 kg heavier than black players, who were 2.3 kg heavier than coloured players (P body mass of all groups increased from 2002 to 2012 (P body mass, stature and BMI of elite under-18 rugby players in South Africa were significantly different between racial groups. This has implications for transforming the game to make it representative of the South African population.

  7. EURLIB-LWR-45/16 and - 15/5. Two board group libraries for LWR-shielding problems

    Energy Technology Data Exchange (ETDEWEB)

    Herrnberger, V

    1982-04-01

    Specifications of the broad group cross section libraries EURLIB-LWR-45/16 and -15/5 are given. They are based on EURLIB-III data and produced for LWR shielding problems. The elements considered are H, C{sub 12}, O, Na, Al, Si, Ca, Cr, Mn, Fe, Ni, Zr, U{sub 235}, U{sub 238}. The cross section libraries are available upon request from EIR, RSIC, NEA-CPL and IAEA-NDS. (author) Refs, figs, tabs

  8. Dicty_cDB: Contig-U11141-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11141-1 gap included 2122 2 1113359 1111236 MINUS 6 12 U11141 0 1 0 2 0 0 0... 1 0 2 0 0 0 0 Show Contig-U11141-1 Contig ID Contig-U11141-1 Contig update 2002.12.18 Contig sequence >Contig-U11141-1 (Contig...-U11141-1Q) /CSM_Contig/Contig-U11141-1Q.Seq.d AAAAAACAATCTTAAAACACACACACACTCAACACACTATCA...AAATCAAAATCAAAATCAAA ATAATAATAATTATAATAATAGCTATAATAAT Gap gap included Contig length 2122 Chromosome number ...HNYFGKVSRGIVSLSDYKYYGYLRSVHLIGYE QHEEELIKTIKSLPVGVSTLELSGHLNKIIFKEGSL--- ---DDSTIGAILNSFSSSSSRETFPRSVESLHLNI

  9. High Glucose-Induced PC12 Cell Death by Increasing Glutamate Production and Decreasing Methyl Group Metabolism

    Directory of Open Access Journals (Sweden)

    Minjiang Chen

    2016-01-01

    Full Text Available Objective. High glucose- (HG- induced neuronal cell death is responsible for the development of diabetic neuropathy. However, the effect of HG on metabolism in neuronal cells is still unclear. Materials and Methods. The neural-crest derived PC12 cells were cultured for 72 h in the HG (75 mM or control (25 mM groups. We used NMR-based metabolomics to examine both intracellular and extracellular metabolic changes in HG-treated PC12 cells. Results. We found that the reduction in intracellular lactate may be due to excreting more lactate into the extracellular medium under HG condition. HG also induced the changes of other energy-related metabolites, such as an increased succinate and creatine phosphate. Our results also reveal that the synthesis of glutamate from the branched-chain amino acids (isoleucine and valine may be enhanced under HG. Increased levels of intracellular alanine, phenylalanine, myoinositol, and choline were observed in HG-treated PC12 cells. In addition, HG-induced decreases in intracellular dimethylamine, dimethylglycine, and 3-methylhistidine may indicate a downregulation of methyl group metabolism. Conclusions. Our metabolomic results suggest that HG-induced neuronal cell death may be attributed to a series of metabolic changes, involving energy metabolism, amino acids metabolism, osmoregulation and membrane metabolism, and methyl group metabolism.

  10. U.S. Geological Survey Karst Interest Group Proceedings, Bowling Green, Kentucky, May 27-29, 2008

    Science.gov (United States)

    Kuniansky, Eve L.

    2008-01-01

    States are developed in carbonate rocks and karst areas. These aquifers and the springs that discharge from them, serve as major water-supply sources and as unique biological habitats. Commonly, there is competition for the water resources of karst aquifers, and urban development in karst areas can impact the ecosystem and water quality of these aquifers. The concept for developing a Karst Interest Group evolved from the November 1999 National Ground-Water Meeting of the U.S. Geological Survey (USGS), Water Resources Division. As a result, the Karst Interest Group was formed in 2000. The Karst Interest Group is a loose-knit grass-roots organization of USGS employees devoted to fostering better communication among scientists working on, or interested in, karst hydrology studies. The mission of the Karst Interest Group is to encourage and support interdisciplinary collaboration and technology transfer among USGS scientists working in karst areas. Additionally, the Karst Interest Group encourages cooperative studies between the different disciplines of the USGS and other Department of Interior agencies and university researchers or research institutes. The first Karst Interest Group workshop was held in St. Petersburg, Florida, February 13-16, 2001, in the vicinity of karst features of the Floridan aquifer system. The proceedings of that first meeting, Water-Resources Investigations Report 01-4011 are available online at: http://water.usgs.gov/ogw/karst/ The second Karst Interest Group workshop was held August 20-22, 2002, in Shepherdstown, West Virginia, in close proximity to the carbonate aquifers of the northern Shenandoah Valley. The proceedings of the second workshop were published in Water-Resources Investigations Report 02-4174, which is available online at the previously mentioned website. The third workshop of the Karst Interest Group was held September, 12-15, 2005, in Rapid City, South Dakota, which is in close proximity to karst features

  11. U-series dating using thermal ionisation mass spectrometry (TIMS)

    Energy Technology Data Exchange (ETDEWEB)

    McCulloch, M.T. [Australian National University, Canberra, ACT (Australia). Research School of Earth Science

    1999-11-01

    U-series dating is based on the decay of the two long-lived isotopes{sup 238}U({tau}{sub 1/2}=4.47 x 10{sup 9} years) and {sup 235}U ({tau}{sub 1/2} 0.7 x 10{sup 9} years). {sup 238}U and its intermediate daughter isotopes {sup 234}U ({tau}{sub 1/2} = 245.4 ka) and {sup 230}Th ({tau}{sub 1/2} = 75.4 ka) have been the main focus of recently developed mass spectrometric techniques (Edwards et al., 1987) while the other less frequently used decay chain is based on the decay {sup 235}U to {sup 231}Pa ({tau}{sub 1/2} = 32.8 ka). Both the {sup 238}U and {sup 235}U decay chains terminate at the stable isotopes {sup 206}Pb and {sup 207}Pb respectively. Thermal ionization mass spectrometry (TIMS) has a number of inherent advantages, mainly the ability to measure isotopic ratios at high precision on relatively small samples. In spite of these now obvious advantages, it is only since the mid-1980`s when Chen et al., (1986) made the first precise measurements of {sup 234}U and {sup 232}Th in seawater followed by Edwards et al., (1987) who made combined {sup 234}U-{sup 230}Th measurements, was the full potential of mass spectrometric methods first realised. Several examples are given to illustrate various aspects of TIMS U-series 9 refs., 3 figs.

  12. Spontaneously broken SU(2) gauge invariance and the ΔI=1/2 rule

    International Nuclear Information System (INIS)

    Shito, Okiyasu

    1977-01-01

    A model of nonleptonic weak interactions is proposed which is based on spontaneously broken SU(2) gauge invariance. The SU(2) group is taken analogously to the U-spin. To this scheme, the source of nonleptonic decays consists of only neutral currents, and violation of strangeness stems from weak vector boson mixings. The model can provide a natural explanation of the ΔI=1/2 rule and of the bulk of the ΔI=1/2 nonleptonic amplitude. As a consequence, a picture is obtained that weak interactions originate in spontaneously broken gauge invariance under orthogonal SU(2) groups. Finally, a possibility of unifying weak and electromagnetic interactions is indicated. (auth.)

  13. Optogalvanic measurement of isotope shifts of doubly ionized uranium (U III) made using natural-U samples

    International Nuclear Information System (INIS)

    Piyakis, K.N.; Gagne, J.

    1989-01-01

    An efficient method of identifying 235 U III (in natural-U samples), with the help of the optogalvanic effect in a hollow-cathode discharge, is presented. The use of this method enabled us to carry out the measurement of isotope shifts and the preliminary investigation of hyperfine structures of U III. The 238 U-- 235 U shifts for the 591.313-, 586.045-, and 610.497-nm U III lines are found to be 921(3), 417(6), and 392(12) mK, respectively

  14. Isotopic resolution of fission fragments from 238U + 12C transfer and fusion reactions

    International Nuclear Information System (INIS)

    Caamano, M.; Rejmund, F.; Derkx, X.; Schmidt, K. H.; Andouin, L.; Bacri, C. O.; Barreau, G.; Benlliure, J.; Casarejos, E.; Fernandez-Dominguez, B.; Gaudefroy, L.; Golabek, C.; Jurado, B.; Lemasson, A.; Navin, A.; Rejmund, M.; Roger, T.; Shrivastava, A.; Schmitt, C.; Taieb, J.

    2010-01-01

    Recent results from an experiment at GANIL, performed to investigate the main properties of fission-fragment yields and energy distributions in different fissioning nuclei as a function of the excitation energy, in a neutron-rich region of actinides, are presented. Transfer reactions in inverse kinematics between a 238 U beam and a 12 C target produced different actinides, within a range of excitation energy below 30 MeV. These fissioning nuclei are identified by detecting the target-like recoil, and their kinetic and excitation energy are determined from the reconstruction of the transfer reaction. The large-acceptance spectrometer VAMOS was used to identify the mass, atomic number and charge state of the fission fragments in flight. As a result, the characteristics of the fission-fragment isotopic distributions of a variety of neutron-rich actinides are observed for the first time over the complete range of fission fragments. (authors)

  15. Comparison of two analysis methods for nuclear reaction measurements of {sup 12}C +{sup 12}C interactions at 95 MeV/u for hadron therapy

    Energy Technology Data Exchange (ETDEWEB)

    Dudouet, J. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Juliani, D. [Institut Pluridisciplinaire Hubert Curien Strasbourg (France); Labalme, M., E-mail: labalme@lpccaen.in2p3.fr [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Angélique, J.C. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Braunn, B. [CEA, Centre de Saclay, IRFU/SPhN, F-91191, Gif-sur-Yvette (France); Colin, J.; Cussol, D. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Finck, Ch. [Institut Pluridisciplinaire Hubert Curien Strasbourg (France); Fontbonne, J.M.; Guérin, H. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Henriquet, P.; Krimmer, J. [IPNL, Université de Lyon, F-69003 Lyon (France); Université Lyon 1 and CNRS/IN2P3, UMR 5822 F-69622 Villeurbanne (France); Rousseau, M. [Institut Pluridisciplinaire Hubert Curien Strasbourg (France); Saint-Laurent, M.G. [Grand Accélérateur National d' Ions Lourds (GANIL), CEA/DSM-CNRS/IN2P3 BP5027,F-14076 Caen cedex 5 (France)

    2013-07-01

    During therapeutic treatment with heavier ions like carbon, the beam undergoes nuclear fragmentation and secondary light charged particles, in particular protons and alpha particles, are produced. To estimate the dose deposited into the tumors and the surrounding healthy tissues, the accuracy must be higher than ±3% and±1 mm. Therefore, measurements are performed to determine the double differential cross-section for different reactions. In this paper, the analysis of data from {sup 12}C +{sup 12}C reactions at 95 MeV/u are presented. The emitted particles are detected with ΔE{sub thin}−ΔE{sub thick}−E telescopes made of a stack of two silicon detectors and a CsI crystal. Two different methods are used to identify the particles. One is based on graphical cuts onto the ΔE−E maps, the second is based on the so-called KaliVeda method using a functional description of ΔE versus E. The results of the two methods will be presented in this paper as well as the comparison between both.

  16. Rotationally resolved pulsed-field ionization photoelectron bands for O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=0-12) in the energy range of 17.0-18.2 eV

    Energy Technology Data Exchange (ETDEWEB)

    Song, Y. [Ames Laboratory, U.S. Department of Energy and Department of Chemistry, Iowa State University, Ames, Iowa 50011 (United States); Evans, M. [Ames Laboratory, U.S. Department of Energy and Department of Chemistry, Iowa State University, Ames, Iowa 50011 (United States); Ng, C. Y. [Ames Laboratory, U.S. Department of Energy and Department of Chemistry, Iowa State University, Ames, Iowa 50011 (United States); Hsu, C.-W. [Chemical Science Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Jarvis, G. K. [Chemical Science Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States)

    2000-01-15

    We have obtained rotationally resolved pulsed-field ionization photoelectron (PFI-PE) spectra for O{sub 2} in the energy range of 17.05-18.13 eV, covering the ionization transitions O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=0-12,N{sup +})(<-)O{sub 2}(X {sup 3}{sigma}{sub g}{sup -},v{sup ''}=0,N{sup ''}). Although these O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}) PFI-PE bands have significant overlaps with vibrational bands for O{sub 2}{sup +}(a {sup 4}{pi}{sub u}) and O{sub 2}{sup +}(X {sup 2}{pi}{sub g}), we have identified all the O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=0-12) bands by simulation of spectra obtained using supersonically cooled O{sub 2} samples with rotational temperatures {approx_equal}20 and 220 K. While these v{sup +}=0-12 PFI-PE bands represent the first rotationally resolved photoelectron data for O{sub 2}{sup +}(A {sup 2}{pi}{sub u}), the PFI-PE bands for O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=9 and 10) are the first rotationally resolved spectroscopic data for these levels. The simulation also allows the determination of accurate ionization energies, vibrational constants, and rotational constants for O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=0-12). The analysis of the PFI-PE spectra supports the conclusion of the previous emission study that the O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=9 and 10) states are strongly perturbed by a nearby electronic state. (c) 2000 American Institute of Physics.

  17. Geometric U-folds in four dimensions

    Science.gov (United States)

    Lazaroiu, C. I.; Shahbazi, C. S.

    2018-01-01

    We describe a general construction of geometric U-folds compatible with a non-trivial extension of the global formulation of four-dimensional extended supergravity on a differentiable spin manifold. The topology of geometric U-folds depends on certain flat fiber bundles which encode how supergravity fields are globally glued together. We show that smooth non-trivial U-folds of this type can exist only in theories where both the scalar and space-time manifolds have non-trivial fundamental group and in addition the scalar map of the solution is homotopically non-trivial. Consistency with string theory requires smooth geometric U-folds to be glued using subgroups of the effective discrete U-duality group, implying that the fundamental group of the scalar manifold of such solutions must be a subgroup of the latter. We construct simple examples of geometric U-folds in a generalization of the axion-dilaton model of \

  18. Thallium trinitrate-mediated ring contraction of 1,2-dihydronaphthalenes: the effect of electron-donating and electron-withdrawing groups

    International Nuclear Information System (INIS)

    Silva Junior, Luiz F.; Sousa, Raquel M.F.; Ferraz, Helena M.C.; Aguilar, Andrea M.

    2005-01-01

    The oxidation of a series of 1,2-dihydronaphthalenes substituted in the aromatic ring was investigated with thallium trinitrate (TTN) in methanol or in trimethylorthoformate (TMOF) as solvent. In all cases, indans are produced, although the yield varied from excellent to poor, depending on the structure of the substrate. The presence of an electron-donating group in the substrate favors the rearrangement, whereas significant amounts of glycolic derivatives, as well as naphthalenes, were obtained in the oxidation of 1,2-dihydronaphthalenes bearing electron-withdrawing groups, such as Br and NO 2 . Mechanisms for the formation of each of these products are proposed. (author)

  19. States characterized by the irreducible single row representations of the U(3) is contained in SO(3) and U(4) is contained in Dsup(3/2)[SO(3)] chains of groups

    International Nuclear Information System (INIS)

    Dumitrescu, T.S.

    1977-01-01

    A new method is applied in order to obtain the irreducible single row representations of the groups under study. For the case U(3) contained in SO(3) also an explicit realization is constructed. The method has the advantage of being simpler than the previously used ones. (author)

  20. Impact of National Physical Activity and Health Guidelines and Documents on Research on Teaching K-12 Physical Education in U.S.A.

    Science.gov (United States)

    Li, Weidong; Xiang, Ping; Gao, Zan; Shen, Bo; Yin, Zhihua; Kong, Qingtao

    2016-01-01

    Purpose: This study examined the impact of published national physical activity (PA) and health guidelines, documents, and initiatives on the evolution of research on teaching K-12 physical education (PE) in U.S.A. from 1996 to October 2013. Methods: A total of 262 peer-reviewed, data-based journal articles meeting our inclusion and exclusion…

  1. 12 CFR 217.1 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ...(t) of the Board's Regulation D—Reserve Requirements of Depository Institutions (12 CFR 20.4). [Reg... 217.1 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... Reserve Act (12 U.S.C. 371a, 461, 505), section 7 of the International Banking Act of 1978 (12 U.S.C. 3105...

  2. Irradiation behaviour of solid and hollow U{sub 3}Si fuel elements: results to 15,000 MWd/tonne U

    Energy Technology Data Exchange (ETDEWEB)

    Feraday, M A; Chalder, G H; Cotnam, K D

    1969-06-15

    U{sub 3}Si fuel elements clad in zirconium alloy sheaths have been irradiated to burnups close to 15,000 MWd/tonne U in pressurized water at 220{sup o}C, 98 bars. The results show that the external swelling can be controlled by incorporating free volume in the element. The dimensional stability of such elements is adequate to permit their use in power reactor fuel bundles. A diameter increase of 1.2% had occurred in an element initially containing 12.8% total free volume, after a burnup of 14,700 MWd/tonne U. There was no change in diameter between burnups of 5200 and 14,700 MWd/tonne U. Elements containing 3% total free volume had increased in diameter about 2.5% at 2000 MWd/tonne U compared to 0.2% at 9500 MWd/tonne U for elements containing 22% total free volume. The observed swelling in the U{sub 3}Si is discussed in terms of possible mechanisms. (author)

  3. Mianningite, (□,Pb,Ce,Na) (U"4"+,Mn,U"6"+) Fe"3"+_2(Ti,Fe"3"+)_1_8O_3_8, a new member of the crichtonite group from Maoniuping REE deposit, Mianning county, southwest Sichuan, China

    International Nuclear Information System (INIS)

    Ge, Xiangkun; Fan, Guang; Chen, Zhangru; Ai, Yujie; Li, Guowu

    2017-01-01

    Mianningite (IMA 2014-072), ideally (□,Pb,Ce,Na)(U"4"+,Mn,U"6"+) Fe"3"+_2(Ti,Fe"3"+)_1_8O_3_8, is a new member of the crichtonite group from the Maoniuping REE deposit, Mianning county, Sichuan province, China. It was found in fractures of lamprophyre veins and in the contact between lamprophyre and a later quartz-alkali feldspar syenite dyke with REE mineralization, and is named after its type locality. Associated minerals are microcline, albite, quartz, iron-rich phlogopite, augite, muscovite, calcite, baryte, fluorite, epidote, pyrite, magnetite, hematite, galena, hydroxylapatite, titanite, ilmenite, rutile, garnet-group minerals, zircon, allanite-(Ce), monazite-(Ce), bastnaesite-(Ce), parisite-(Ce), maoniupingite-(Ce), thorite, pyrochlore-group minerals and chlorite. Mianningite occurs as opaque subhedral to euhedral tabular crystals, up to 1-2 mm in size, black in color and streak, and with a submetallic luster. Mianningite is brittle, with a conchoidal fracture. Its average micro-indentation hardness is 83.8 kg/mm"2 (load 0.2 kg), which is equivalent to ∝6 on the Mohs hardness scale. Its measured and calculated densities are 4.62 (8) g/cm"3 and 4.77 g/cm"3, respectively. Under reflected light, mianningite is grayish white, with no internal reflections. It appears isotropic and exhibits neither bireflectance nor pleochroism. The empirical formula, calculated on the basis of 38 O atoms per formula unit (apfu), is [□_0_._3_2_2(Pb_0_._2_1_5Ba_0_._0_3_7Sr_0_._0_3_6Ca_0_._0_1_0)_Σ_0_._2_9_8(Ce_0_._1_2_8La_0_._0_7_7Nd_0_._0_1_2)_Σ_0_._2_1_7 (Na_0_._1_2_7K_0_._0_3_6)_Σ_0_._1_6_3]_Σ_0_1_._0_0_0(U"4"+_0_._4_4_7Mn_0_0_._2_9_3U"6 "+_0_._1_1_2Y_0_._0_9_1Zr_0_._0_2_3Th_0_._0_1_1)_Σ_0_._9_7_7(Fe"3"+_1_._2_2_4Fe"2"+_0_._2_4_3Mg_0_._0_2_3P_0_._0_0_8Si_0_._0_0_6 □_0_._4_9_6)_Σ_2_._0_0_0(Ti_1_2_._4_6_4Fe"3"+_5_._2_9_2V"5"+_0_._1_1_8Nb_0_._0_8_3Al_0_._0_2_6Cr"3"+_0_._0_1_7)_Σ_1_8_._0_0_0O_3_8. Mianningite is trigonal, belongs to the space group R anti 3, and has

  4. Religious Groups and Their Influence on Interstate Relations (The Case of U.S.-Israel Relations

    Directory of Open Access Journals (Sweden)

    Igor Istomin

    2014-01-01

    Full Text Available The impact of interest groups on foreign policy of the state up until today has not received substantial attention in the theory of international relations. In particular, activities of the entities shaped by the common religious affiliation of their members lack assessment in the academic literature. Meanwhile, their mobilization in the recent decades became significant aspect of political life both in developing and developed countries. The activity of religious groups in the United States forced deep transformation of the national political landscape, as they desire to affect not only internal debate, but external policies as well. Among other issues attention of such social and political bodies is also focused on the situation in the middle East. Their proactive standing facilitated advancement of the partnership between the United States and Israel, including growth of American diplomatic and military aid to Tel-Aviv. The supporters of such policy include not only small, but well organized Jewish community, but also representatives of the conservative Evangelical Protestants, which constitute the most numerous religious group in the U.S. Despite the fact that leaders of both group often use theological reasons to justify their support for Israel, the real motivation of the most regular members is primarily humanitarian and pragmatic. The diversity of the Pro-Israeli groups promotes bipartisan support of cooperation between the two countries, and enabled creation of both Democratic and Republican lobby on this issue. However the growing criticism of the current policy of Tel-Aviv on behalf of some of the adherents of American-Israeli cooperation leads to the erosion of impact of these groups.

  5. Risk Assessment Review Group report to the U.S. Nuclear Regulatory Commission

    International Nuclear Information System (INIS)

    Lewis, H.W.; Budnitz, R.J.; Kouts, H.J.C.; Loewenstein, W.B.; Rowe, W.D.; von Hippel, F.; Zachariasen, F.

    1978-09-01

    The Risk Assessment Review Group was organized by the U.S. Nuclear Regulatory Commission on July 1, 1977, with four elements to its charter: clarify the achievements and limitations of WASH-1400, the ''Rasmussen Report''; assess the peer comments thereon, and responses to those comments; study the present state of such risk assessment methodology; and recommend to the Commission how (and whether) such methodology can be used in the regulatory and licensing process. Areas of study include: risk assessment methodologies; statistical issues; completeness; the data base; and the WASH-1400 assessment of the damage to human health from radiation after a postulated accident. Specific items discussed include: Browns Ferry; common cause failure; human factors; format and scrutability; the peer review process; earthquakes; risk perception; allegations by UCS concerning WASH-1400 treatment of quality assurance and quality control; current role of probabilistic methods in the regulatory process; acts of violence; ATWS; influence of design defects in quality assurance failures; and calculation of population doses from given releases of radionuclides

  6. Prevalence of Dental Caries in 5 – 6 Years and 12 – 13 Years Age Group of School Children of Kathmandu Valley

    Directory of Open Access Journals (Sweden)

    B Subedi

    2011-12-01

    Full Text Available Introduction: Dental caries is one of the most common conditions affecting the general health of children. The present study was carried out among school children of Kathmandu valley to determine the prevalence of dental caries in two age groups. Methods: The study was conducted from December 2007 to May 2008. The age of the school children of the study was divided into two group: 5 - 6 years and 12 - 13 years. A stratifi ed cluster sampling with proportional allocation was used while grouping the subjects. The dental status examination was done with the help of trained dentists. Decayed, missed and fi lled teeth index and decayed, missed and fi lled surfaces index (dmft for primary dentition and DMFT for permanent dentition were used as the standard tools for the determination of prevalence. Results: A total of 638 students (325 of age group 12 - 13 years and 313 of age group 5 - 6 years from 30 different schools of the Kathmandu valley were included in the study. The caries status was found higher in the age group of 5 - 6 years than in the 12 - 13 years and it was found to be statistically signifi cant (p < 0.001. The dmfs and caries percentage of the age group 5 - 6 years and the DMFS and caries percent of the 12 - 13 years was found to be 3.79, 69 % and 1.6, 53.23 % respectively. The dmft/dmfs value was found to be signifi cant according to the districts in the 5 - 6 years age group whereas the DMFS was found statistically signifi cant among the sexes of the 12 - 13 years age group. Conclusions: The caries percentage was found to be above the recommended level of the World Health Organization. However, the DMFS and DMFT values were within the WHO level. Keywords: Children, dental caries, DMF index.

  7. U.S. International Trade: Trends and Forecasts

    Science.gov (United States)

    2008-11-26

    Agreements: Impact on U.S. Trade and Implications for U.S. Trade Policy, by William H. Cooper;CRS Report RL32371, Trade Remedies: A Primer, by Vivian C...initial public offering of the Blackstone Group, a U.S. private equity group. Morgan Stanley research estimates that such sovereign wealth funds could

  8. U(1) x U(1) x U(1) symmetry of the Kimura 3ST model and phylogenetic branching processes

    International Nuclear Information System (INIS)

    Bashford, J D; Jarvis, P D; Sumner, J G; Steel, M A

    2004-01-01

    An analysis of the Kimura 3ST model of DNA sequence evolution is given on the basis of its continuous Lie symmetries. The rate matrix commutes with a U(1) x U(1) x U(1) phase subgroup of the group GL(4) of 4 x 4 invertible complex matrices acting on a linear space spanned by the four nucleic acid base letters. The diagonal 'branching operator' representing speciation is defined, and shown to intertwine the U(1) x U(1) x U(1) action. Using the intertwining property, a general formula for the probability density on the leaves of a binary tree under the Kimura model is derived, which is shown to be equivalent to established phylogenetic spectral transform methods. (letter to the editor)

  9. 41 CFR 60-2.12 - Job group analysis.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Job group analysis. 60-2... group analysis. (a) Purpose: A job group analysis is a method of combining job titles within the... employed. (b) In the job group analysis, jobs at the establishment with similar content, wage rates, and...

  10. Classical local U(1 gauge invariance in Weyl 2-spinor lenguage and charge quantization from irreducible representations of the gauge group

    Directory of Open Access Journals (Sweden)

    J. Buitrago

    Full Text Available A new classical 2-spinor approach to U(1 gauge theory is presented in which the usual four-potential vector field is replaced by a symmetric second rank spinor. Following a lagrangian formulation, it is shown that the four-rank spinor representing the Maxwell field tensor has a U(1 local gauge invariance in terms of the electric and magnetic field strengths. When applied to the magnetic field of a monopole, this formulation, via the irreducible representation condition for the gauge group, leads to a quantization condition differing by a factor 2 of the one predicted by Dirac without relying on any kind of singular vector potentials. Finally, the U(1 invariant spinor equations, are applied to electron magnetic resonance which has many applications in the study of materials. Keywords: Weyl 2-spinor lenguage, Dirac equation, Gauge theories, Charge quantization

  11. Groundwater Protection Program Management Plan for the U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Elvado Environmental LLC; Environmental Compliance Department Environment, Safety, and Health Division Y-12 National Security Complex

    2004-03-31

    This document presents the Groundwater Protection Program (GWPP) management plan for the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12). The Y-12 GWPP functions as the primary point-of-contact for groundwater-related issues at Y-12, provides stewardship of the extensive network of groundwater monitoring wells at Y-12, and serves as a resource for technical expertise, support, and historical data for groundwater-related activities at Y-12. These organizational functions each serve the primary programmatic purpose of the GWPP, which is to ensure that groundwater monitoring activities within areas under Y-12 administrative control provide representative data in compliance with the multiple purposes of applicable state and federal regulations, DOE orders, and the corporate policies of BWXT Y-12, L.L.C. (hereafter referenced as BWXT), the Y-12 management and operations (M&O) contractor for DOE. This GWPP management plan addresses the requirements of DOE Order 450.1 (BWXT Y12 S/RID) regarding the implementation of a site-wide approach for groundwater protection at each DOE facility. Additionally, this plan is a ''living'' document that is reviewed annually, revised and reissued every three years, and is formatted to provide for updating individual sections independent of the rest of the document. Section 2 includes a short description of the groundwater system at Y-12, the history of groundwater monitoring at Y-12 and the corresponding evolution of the GWPP, and an overview of ongoing Y-12 groundwater monitoring activities. Section 3 describes the key elements of the GWPP management strategy. Organizational roles and responsibilities of GWPP personnel are outlined in Section 4. Section 5 presents an overview of the GWPP project plans for applicable programmatic elements. Section 6 lists the reports, plans, and documents that are referenced for technical and administrative details.

  12. Single electron detachment of carbon group and oxygen group elements incident on helium

    International Nuclear Information System (INIS)

    Huang Yongyi; Li Guangwu; Gao Yinghui; Yang Enbo; Gao Mei; Lu Fuquan; Zhang Xuemei

    2006-01-01

    The absolute single electron detachment (SED) cross sections of carbon group elements C - , Si - , Ge - in the energy range of 0.05-0.29 a.u. (5 keV-30 keV) and oxygen group elements O - and S - 0.08-0.27 a.u. (5 keV-30 keV), incident on helium are measured with growth rate method. In our energy region, the SED cross sections of C - , Si - , S - and Ge - increase with the projectiles velocity, at the same time, O - cross sections reach a conspicuous maximum at 0.18 a.u. Some abnormal behavior occurs in measurement of SED cross sections for the oxygen group collision with helium. Our results have been compared with a previous work

  13. Prognostic relevance of motor talent predictors in early adolescence: A group- and individual-based evaluation considering different levels of achievement in youth football.

    Science.gov (United States)

    Höner, Oliver; Votteler, Andreas

    2016-12-01

    In the debate about the usefulness of motor diagnostics in the talent identification process, the prognostic validity for tests conducted in early adolescence is of critical interest. Using a group- and individual-based statistical approach, this prospective cohort study evaluated a nationwide assessment of speed abilities and technical skills regarding its relevance for future achievement levels. The sample consisted of 22,843 U12-players belonging to the top 4% in German football. The U12-results in five tests served as predictors for players' selection levels in U16-U19 (youth national team, regional association, youth academy, not selected). Group-mean differences proved the prognostic relevance for all predictors. Low individual selection probabilities demonstrated limited predictive values, while excellent test results proved their particular prognostic relevance. Players scoring percentile ranks (PRs) ≥ 99 had a 12 times higher chance to become youth national team players than players scoring PR talents) but also led to lower sensitivity (loss of talents). Extending the current research, these different approaches revealed the ambiguity of the diagnostics' prognostic relevance, representing both the usefulness and several pitfalls of nationwide diagnostics. Therefore, the present diagnostics can support but not substitute for coaches' subjective decisions for talent identification, and multidisciplinary designs are required.

  14. Deformations of the Heme Group of Different Ferrocytochrome c Proteins Probed by Resonance Raman Spectroscopy

    International Nuclear Information System (INIS)

    Hagarman, Andrew; Schweitzer-Stenner, Reinhard; Wallace, Carmichael; Laberge, Monique

    2008-01-01

    We measured the low-frequency polarized resonance Raman spectra of horse heart, chicken, and yeast(C102T) ferrocytochromes c with Soret excitation. We examined the out-of-plane deformations of the heme groups by determining the relative intensities and depolarization ratios of a variety of out-of-plane and in-plane Raman active bands. Analysis of relative Raman intensities shows differences in non-planarity of the heme groups of yeast(C102T), horse heart and chicken cytochrome c. Cytochrome c has been shown to have a dominant ruffling (B 1u ) deformation by means of normal coordinate structural decomposition (NSD) analysis of the heme group in crystal structures. The presence and intensity of B 1u modes, γ 10 -γ 12 , support the indication of ruffling being the major contribution to the non-planar deformations in cytochrome c. Other types of non-planar deformations like doming (A 2U ) and waving (E g ) can be deduced from the Raman activity of γ 5 (A 2u ), γ 21 and γ 22 (E g ). The depolarization ratios of γ 5 , γ 10 , γ 11 and γ 12 are larger than 0.125, indicating the presence of other deformations such as saddling (B 2u ) and propellering (A 1u ), which is again in agreement with the crystal structures of horse heart and yeast ferrocytochrome c. An analysis of the intensities and depolarization ratios of out-of-plane modes revealed that ruffling is comparable in yeast and horse heart cytochrome c, saddling is larger and doming as well as propellering are lower in yeast cytochrome c. With respect to doming and ruffling our results contradict values obtained from the NSD analysis of the corresponding crystal structures. With respect to saddling, our data are in agreement with the crystal structure. The NSD analysis of heme structures resulting from MD simulations did not correlate very well with the spectroscopically obtained results concerning the ruffling and doming coordinate, whereas a qualitative agreement was again obtained for saddling.

  15. Atise: a miniature Fourier-transform spectro-imaging concept for surveying auroras and airglow monitoring from a 6/12u cubesat

    Science.gov (United States)

    Le Courer, E.; Barthelemy, M.; Vialatte, A.; Prugniaux, M.; Bourdarot, G.; Sequies, T.; Monsinjon, P.; Puget, R.; Guerineau, N.

    2017-09-01

    The nanosatellite ATISE is a mission dedicated to the observation of the emission spectra of the upper atmosphere (i.e. Airglow and Auroras) mainly related to both the solar UV flux and the precipitation of suprathermal particles coming from the solar wind through the magnetosphere. ATISE will measure specifically the auroral emissions, and the airglow (day- and night) in the spectral range between 380 and 900 nm at altitudes between 100 and 350 km. The exposure time will be 1 second in auroral region and 20 s at low latitude regions. The 5 year expected lifetime of this mission should cover almost a half of solar cycle (2 years nominal). This instrument concept is based on an innovative miniaturized Fourier-transform spectrometer (FTS) allowing simultaneous 1 Rayleigh sensitivity detection along six 1.5°x1° limb lines of sight. This 1-2kg payload instrument is hosted in a 12U cubeSat where 6U are allocated to the payload and 6U to the plateform subsystems. This represents a miniaturisation by a factor of 500 on weight and volume compared to previous Arizona-GLO instrument for equivalent performances in the visible. The instrument is based on microSPOC concept developed by ONERA and IPAG using one Fizeau interferometer per line of sight directly glued on top of the half of a very sensitive CMOS Pyxalis HDPYX detector. Three detectors are necessary with a total electrical consumption compatible with a 6U nanoSat. Each interferometer occupies a 1.4 M pixel part of detector, each is placed on an image of the entrance pupil corresponding to a unique direction of the six lines of sight, this in order to have a uniform illumination permitting good spectral Fourier reconstruction from fringes created between the Fizeau plate and the detector itself. Despite a limited 8x6 cm telescope, this configuration takes advantage of FTS multiplex effect and permits us to maximize the throughput and to integrate very faint emission lines over a wide field of view even if the 1

  16. Protective Effects of Mouse Bone Marrow Mesenchymal Stem Cell Soup on Staurosporine Induced Cell Death in PC12 and U87 Cell Lines

    Directory of Open Access Journals (Sweden)

    Hossein Zhaleh

    2016-11-01

    Full Text Available Mouse bone marrow mesenchymal stem cells (mBMSCs soup is promising tool for the treatment of neurodegenerative diseases. mBMSCs soup is easily obtained and is capable of transplantation without rejection. We investigated the effects of mBMSC soup on staurosporine-induced cell death in PC12 and U87 cells lines. The percentage of cell viability, cell death, NO concentration, total neurite length (TNL and fraction of cell differentiation (f% were assessed. Viability assay showed that mBM soup (24 and 48h in time dependent were increased cell viability (p<0.05 and also cell death assay showed that cell death in time dependent were decreased, respectively (p<0.05. TNL and fraction of cell differentiation significantly were increased compared with treatment1 (p<0.05. Our data showed that mBM Soup protects cells, increases cell viability, suppresses cell death and improvement the neurite elongation. We concluded that Mouse bone marrow mesenchymal stem cell soup plays an important protective role in staurosporine-induced cell death in PC12 and U87 cell lines.

  17. Validitas Utrecht-Management Of Identity Commitments Scale (U-MICS) Versi Indonesia: Struktur Faktor, Invariansi Pengukuran Gender, dan Usia

    OpenAIRE

    Muttaqin, Darmawan

    2017-01-01

    The purpose of this study was to examine the psychometric properties of Indonesian version of the U-MICS, a measure three identity dimensions. Participants were 910 adolescents (12-21 years old). The Confirmatory Factor Analyses and Multi-Group Analyses were used to examine the factor structure, gender, and age measurement invariance of Indonesian version of the U-MICS. We further tested the gender and age differences using Multivariate Analysis of Variance. The results indicated that the fac...

  18. A taxonomic revision of the Cymindis (Pinacodera limbata species group (Coleoptera, Carabidae, Lebiini, including description of a new species from Florida, U.S.A.

    Directory of Open Access Journals (Sweden)

    Wesley Hunting

    2013-01-01

    Full Text Available The Cymindis (Pinacodera limbata species group (Coleoptera, Carabidae, Lebiini is a precinctive New World taxon with ranges extended from portions of temperate southeastern Canada and the U.S.A. through the montane regions of Mexico, south to the Isthmus of Tehuantepec. The group is distinguishable from all other members of the subgenus Pinacodera by males possessing a distinctive sclerite (endophallic plate at the apex of the endophallus. In the past, a lack of material and misunderstandings of range of variation within species have contributed to confusion about how many species there really are.This revision of the limbata species group includes a classification, a key to groups within the subgenus Pinacodera and species within the limbata group, descriptions of species, re-rankings and new synonymies. In total 10 taxa are treated, with 6 new synonyms proposed, 1 new combination introduced and 1 new species described: Cymindis (Pinacodera rufostigma (type locality: Archbold Biological Station, Highlands County, Florida, U.S.A.. Each taxon is characterized in terms of structural features of adults, habitat, geographical distribution, and chorological affinities. Available ecological information and treatments of variation are included.

  19. 19 CFR 12.18 - Labels.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Labels. 12.18 Section 12.18 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Viruses, Serums, and Toxins for Treatment of Domestic Animals § 12.18 Labels. Each...

  20. Pusaudžu trauksmes, pašcieņas un viņu māšu audzināšanas stilu saistība.

    OpenAIRE

    Valere, Linda

    2007-01-01

    Bakalaura darba tēma ir „Pusaudžu trauksmes, pašcieņas un viņu māšu audzināšanas stilu saistība”. Pusaudžu trauksme ir ļoti aktuāla problēma. Trauksmes traucējumu izplatība pusaudžiem svārstās no 12% līdz 17,3 % (Vasey & Ollendick, 2000 kā minēts Fraire, 2006), un tie rada lielu risku atkārtotiem trauksmes traucējumiem jau pieaugušā vecumā (Pine, Cohen, Gurley, Brook & Ma, 1998). Pētījuma mērķis ir noskaidrot, vai pastāv saistība starp pusaudžu trauksmi, pašcieņu un viņu māšu audzināšanas sti...

  1. UPIN Group File

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Group Unique Physician Identifier Number (UPIN) File is the business entity file that contains the group practice UPIN and descriptive information. It does NOT...

  2. Mean diffusivity discriminates between prostate cancer with grade group 1&2 and grade groups equal to or greater than 3

    International Nuclear Information System (INIS)

    Nezzo, M.; Di Trani, M.G.; Caporale, A.; Miano, R.; Mauriello, A.; Bove, P.; Capuani, S.; Manenti, G.

    2016-01-01

    Purpose: To test the potential ability of mean diffusivity (MD) and fractional anisotropy (FA) in discriminating between PCa of grade group (GG) 1&2, and GGs ≥ 3. Material and methods: Diffusion Tensor Imaging (DTI) experiments at 3T in a cohort of 38 patients with PCa (fifty lesions in total) were performed, by using different diffusion weights (b values) up to 2500 s/mm 2 . Gleason score (GS) and GG data were correlated with DTI parameters (MD and FA) estimated in PCa. The relation between DTI measures and GS was tested by the linear correlation analysis (Pearson's coefficient). One-way analysis of variance to check the statistical significance of the difference between GG 1&2 and GGs 3, 4, 5, ≥3 was used. Results were reported for each of the three b-values ranges: 0–800 s/mm 2 , 0–1500 s/mm 2 , 0–2500 s/mm 2 . Results: A negative correlation was found between MD and GS. The highest linear correlation was observed when the fit was performed with data acquired in the b-values range 0–2500 s/mm 2 . MD values were significantly different between GG 1&2 and GG = 3 and between GG 1&2 and GG ≥3. Moreover this difference is better defined when high b values (higher than b = 800 s/mm 2 ) are used. The specificity, sensitivity and accuracy in the discrimination between GG 1&2 and GG = 3 were: 90%, 66.7% and 82.4%, respectively when MD was estimated in the b-values range 0–2500 s/mm 2 while these values were 85%, 58.3% and 78.4% when MD was estimated in the b-values range 0–800 s/mm 2 . Conversely FA did not discriminate between GG 1&2 and GG ≥3, at any investigated b-values range. Conclusion: This study suggests that MD estimation in PCa, obtained from DTI acquired at high b-values, can contribute to the diagnosis and grading of prostate cancer while FA is not a useful parameter for this purpose.

  3. Mean diffusivity discriminates between prostate cancer with grade group 1&2 and grade groups equal to or greater than 3

    Energy Technology Data Exchange (ETDEWEB)

    Nezzo, M., E-mail: marco.nezzo@gmail.com [Department of Diagnostic and Interventional Radiology, Molecular Imaging and Radiotherapy, PTV Foundation, “Tor Vergata” University of Rome, Viale Oxford 81, 00133 Rome (Italy); Di Trani, M.G. [Physics Department, Sapienza University of Rome, Piazzale Aldo Moro 5, Rome (Italy); Caporale, A. [Department of Anatomical, Histological, Forensic and Locomotor System Science, Morfogenesis and Tissue Homeostasis, Sapienza University of Rome (Italy); CNR ISC, UOS Roma Sapienza, Physics Department Sapienza University of Rome (Italy); Miano, R. [Urology Unit, Department of Experimental Medicine and Surgery, PTV Foundation, “Tor Vergata” University of Rome, Viale Oxford 81, 00133 Rome (Italy); Mauriello, A. [Anatomic Pathology, Department of Biomedicine and Prevention, PTV Foundation, “Tor Vergata” University of Rome, Viale Oxford 81, 00133 Rome (Italy); Bove, P. [Urology Unit, Department of Experimental Medicine and Surgery, PTV Foundation, “Tor Vergata” University of Rome, Viale Oxford 81, 00133 Rome (Italy); Capuani, S. [CNR ISC, UOS Roma Sapienza, Physics Department Sapienza University of Rome (Italy); Manenti, G. [Department of Diagnostic and Interventional Radiology, Molecular Imaging and Radiotherapy, PTV Foundation, “Tor Vergata” University of Rome, Viale Oxford 81, 00133 Rome (Italy)

    2016-10-15

    Purpose: To test the potential ability of mean diffusivity (MD) and fractional anisotropy (FA) in discriminating between PCa of grade group (GG) 1&2, and GGs ≥ 3. Material and methods: Diffusion Tensor Imaging (DTI) experiments at 3T in a cohort of 38 patients with PCa (fifty lesions in total) were performed, by using different diffusion weights (b values) up to 2500 s/mm{sup 2}. Gleason score (GS) and GG data were correlated with DTI parameters (MD and FA) estimated in PCa. The relation between DTI measures and GS was tested by the linear correlation analysis (Pearson's coefficient). One-way analysis of variance to check the statistical significance of the difference between GG 1&2 and GGs 3, 4, 5, ≥3 was used. Results were reported for each of the three b-values ranges: 0–800 s/mm{sup 2}, 0–1500 s/mm{sup 2}, 0–2500 s/mm{sup 2}. Results: A negative correlation was found between MD and GS. The highest linear correlation was observed when the fit was performed with data acquired in the b-values range 0–2500 s/mm{sup 2}. MD values were significantly different between GG 1&2 and GG = 3 and between GG 1&2 and GG ≥3. Moreover this difference is better defined when high b values (higher than b = 800 s/mm{sup 2}) are used. The specificity, sensitivity and accuracy in the discrimination between GG 1&2 and GG = 3 were: 90%, 66.7% and 82.4%, respectively when MD was estimated in the b-values range 0–2500 s/mm{sup 2} while these values were 85%, 58.3% and 78.4% when MD was estimated in the b-values range 0–800 s/mm{sup 2}. Conversely FA did not discriminate between GG 1&2 and GG ≥3, at any investigated b-values range. Conclusion: This study suggests that MD estimation in PCa, obtained from DTI acquired at high b-values, can contribute to the diagnosis and grading of prostate cancer while FA is not a useful parameter for this purpose.

  4. Racial-ethnic variation in U.S. mental health service use among Latino and Asian non-U.S. citizens.

    Science.gov (United States)

    Lee, Sungkyu; Laiewski, Laurel; Choi, Sunha

    2014-01-01

    This study examined the factors associated with service utilization for mental health conditions among Latino and Asian non-U.S. citizens in the United States by service type and race. Data were obtained from the National Latino and Asian American Study (NLAAS). The sample for this study was 849 Latino and 595 Asian non-U.S. citizens between ages 18 and 64 (N=1,444). Mental health services obtained through three types of service providers were examined: specialty mental health services, general medical services, and other services. Guided by the modified Andersen health behavioral model, analyses involved logistic regression models conducted with penalized maximum likelihood estimation. Although having a psychiatric disorder increased mental health service use in both groups, only 32% of Latino and 52% of Asian non-U.S. citizens with psychiatric needs reported using mental health services during the past 12 months. Overall, noncitizen Latinos and Asians were more likely to use mental health services from general health care providers and other providers than from specialty mental health providers. Several significant predisposing, enabling, and need factors, such as age, health insurance, and having psychiatric conditions, also interacted with race. Findings of the study suggest that there are ethnoracial variations in mental health service use between Latino and Asian non-U.S. citizens. Mental health professionals should consider developing tailored mental health interventions that account for cultural variations to enhance access to services for these vulnerable subgroups of Latinos and Asians. Further research should examine ethnic disparities in mental health service use among various non-U.S. citizen racial-ethnic subgroups.

  5. Translation and Validation of the Multidimensional Dyspnea-12 Questionnaire.

    Science.gov (United States)

    Amado Diago, Carlos Antonio; Puente Maestu, Luis; Abascal Bolado, Beatriz; Agüero Calvo, Juan; Hernando Hernando, Mercedes; Puente Bats, Irene; Agüero Balbín, Ramón

    2018-02-01

    Dyspnea is a multidimensional symptom, but this multidimensionality is not considered in most dyspnea questionnaires. The Dyspnea-12 takes a multidimensional approach to the assessment of dyspnea, specifically the sensory and the affective response. The objective of this study was to translate into Spanish and validate the Dyspnea-12 questionnaire. The original English version of the Dyspnea-12 questionnaire was translated into Spanish and backtranslated to analyze its equivalence. Comprehension of the text was verified by analyzing the responses of 10 patients. Reliability and validation of the questionnaire were studied in an independent group of COPD patients attending the pulmonology clinics of Hospital Universitario Marqués de Valdecilla, diagnosed and categorized according to GOLD guidelines. The mean age of the group (n=51) was 65 years and mean FEV1 was 50%. All patients understood all questions of the translated version of Dyspnea-12. Internal consistency of the questionnaire was α=0.937 and intraclass correlation coefficient was=.969; P<.001. Statistically significant correlations were found with HADS (anxiety r=.608 and depression r=.615), mMRC dyspnea (r=.592), 6MWT (r=-0.445), FEV1 (r=-0.312), all dimensions of CRQ-SAS (dyspnea r=-0.626; fatigue r=-0.718; emotional function r=-0.663; mastery r=-0.740), CAT (r=0.669), and baseline dyspnea index (r=-0.615). Dyspnea-12 scores were 10.32 points higher in symptomatic GOLD groups (B and D) (P<.001). The Spanish version of Dyspnea-12 is a valid and reliable instrument to study the multidimensional nature of dyspnea. Copyright © 2017 SEPAR. Publicado por Elsevier España, S.L.U. All rights reserved.

  6. New U-Pb age constraints on the upper Banxi Group and synchrony of the Sturtian glaciation in South China

    Directory of Open Access Journals (Sweden)

    Gaoyuan Song

    2017-09-01

    Full Text Available The Nanhua basin in South China hosts well-preserved middle–late Neoproterozoic sedimentary and volcanic rocks that are critical for studying the basin evolution, the breakup of the supercontinent Rodinia, the nature and dynamics of the “snowball” Earth and diversification of metazoans. Establishing a stratigraphic framework is crucial for better understanding the interactions between tectonic, paleoclimatic and biotic events recorded in the Nanhua basin, but existing stratigraphic correlations remain debated, particularly for pre-Ediacaran strata. Here we report new Laser Ablation Inductively Coupled Plasma Mass Spectrometry (LA-ICPMS U-Pb zircon ages from the middle and topmost Wuqiangxi Formation (the upper stratigraphic unit of the Banxi Group in Siduping, Hunan Province, South China. Two samples show similar age distribution, with two major peaks at ca. 820 Ma and 780 Ma and one minor peak at ca. 910 Ma, suggesting that the Wuqiangxi sandstone was mainly sourced from Neoproterozoic rocks. Two major age peaks correspond to two phases of magmatic events associated with the rifting of the Nanhua basin, and the minor peak at ca. 910 Ma may correspond to the Shuangxiwu volcanic arc magmatism, which represents pre-collision/amalgamation subduction on the southeastern margin of the Yangtze Block. The youngest zircon group from the topmost Wuqiangxi Formation has a weighted mean age of 714.6 ± 5.2 Ma, which is likely close to the depositional age of the uppermost Banxi Group. This age, along with the ages reported from other sections, constrains that the Banxi Group was deposited between ca. 820 Ma and ca. 715 Ma. The age of 714.6 ± 5.2 Ma from the top of the Wuqiangxi Formation is indistinguishable with the SIMS U-Pb age of 715.9 ± 2.8 Ma from the upper Gongdong Formation in the Sibao village section of northern Guangxi, South China. It is also, within uncertainties, overlapped with two TIMS U-Pb ages from pre

  7. U.S. EPA, Pesticide Product Label, HORNET, 12/05/1995

    Science.gov (United States)

    2011-04-21

    ... 0dr):!~~t \\)tlt~ (1) i)rtnt~u COt:-)' 01 your linc!J i_,[int-~l! l~':~t:l~.L:': !(fl'-,ct-:'rl'.j r-hi_~ Lco;/ nC~J·,l('; t-'rior t( ... (t'l(asir.I'. it i 0 r S II i i- J~! ent • ...

  8. Randomized Comparative Study of the U- and H-Type Approaches of the TVT-Secur Procedure for the Treatment of Female Stress Urinary Incontinence: One-Year Follow-Up

    Science.gov (United States)

    Kim, Jung Jun; Lee, Young-Suk

    2010-01-01

    Purpose We compared outcomes of the U- and H-type approaches of the tension-free vaginal tape (TVT)-Secur procedure for the treatment of female stress urinary incontinence (SUI). Materials and Methods From March 2007 to July 2008, 115 women with SUI underwent TVT-Secur by a single surgeon. Patients were randomly assigned to either the U- or the H-type approach. After 12 months, postoperative changes in the Sandvik questionnaire, incontinence quality of life questionnaire (I-QoL), Bristol female lower urinary tract symptoms-scored form (BFLUTS-SF), and postoperative patient satisfaction were evaluated. Cure was regarded as no leakage on the Sandvik questionnaire. Complications were also evaluated. Results Of 115 women, 53 were treated with the U approach, and 62 women were treated with the H approach. At 12 months, 88.7% of those treated with the U approach and 87.1% of those treated with the H approach were cured (p=0.796). The I-QoL and filling, incontinence, sexual function, and QoL sum (BFLUTS-SF) scores were improved with both approaches, and there were no significant differences in the degree of improvement between approaches. Approximately 83.7% and 82.9% of the women treated with the U and H approaches, respectively, were satisfied with the outcome (p=0.858). There were 3 cases of intra-operative vaginal wall perforation in the H-type group. Immediate postoperative retention was observed in 2 women in the U-type group and 1 woman in the H-type group. One woman in the U-type group underwent tape releasing and cutting procedures for persistent large post-void residuals. Conclusions The U- and the H-type approaches of the TVT-Secur procedure provided comparable effectiveness for the treatment of female SUI. PMID:20428427

  9. [Baicalein promotes the apoptosis of HeLa cells by inhibiting ERK1/2 expression].

    Science.gov (United States)

    Wang, Yongzhou; Xia, Jiyi; Tang, Xiaoping; Tang, Li; Mao, Xiguang; Zhang, Yujiao; Yu, Xiaolan

    2016-11-01

    Objective To investigate the effects of baicalein and U0126 treatment on the apoptosis of human cervical carcinoma HeLa cells and the potential mechanism. Methods HeLa cells were subjected to (1, 2, 5, 10, 20, 50, 100, 200, 300) μmol/L baicalein or (1, 2, 5, 10, 20, 30) μmol/L U0126 treatment for 24 hours. The optimal concentrations of baicalein and U0126 for HeLa inhibition was determined by a cell counting Kit-8 assay. HeLa cells were then treated with these inhibitory concentrations for 24 hours separately or in combination. The cell cycle and the degree of apoptosis were analyzed by flow cytometry. The cell apoptosis index was evaluated by the TUNEL assay. The expressions of extracellular signal-regulated kinase 1/2 (ERK1/2), Bax, and Bcl-2 at the mRNA and protein levels were examined by real-time PCR and Western blotting, respectively. Results Optimal inhibitory concentrations of baicalein and U0126 for HeLa cells were 200 μmol/L and 10 μmol/L, respectively. Compared with the control group, baicalein treatment increased the growth rate of cells in the G0/G1 phase but decreased the S phase. Combination treatment of 200 μmol/L baicalein and 10 μmol/L U0126 for 24 hours further reduced the S phase growth rate. Treatment with 10 μmol/L U0126 or 200 μmol/L baicalein for 24 hours induced cell apoptosis, and the combination treatment induced more apoptosis. Treatment by baicalein alone or in combination with U0126 for 24 hours significantly decreased ERK1/2 and Bcl-2 mRNA expressions, and upregulated Bax mRNA expression. It also downregulated ERK1/2 phosphorylation and Bcl-2 protein expression, while increasing Bax protein expression. Conclusion Both baicalein and U012 appear to inhibit proliferation, induce apoptosis, and increase the growth rate in the G0/G1 phase but reduce the S phase of HeLa cells. This effect is enhanced when they are used synergistically.

  10. Being scientifical: Popularity, purpose and promotion of amateur research and investigation groups in the U.S

    Science.gov (United States)

    Hill, Sharon A.

    21st century television and the Internet are awash in content regarding amateur paranormal investigators and research groups. These groups proliferated after reality investigation programs appeared on television. Exactly how many groups are active in the U.S. at any time is not known. The Internet provides an ideal means for people with niche interests to find each other and organize activities. This study collected information from 1000 websites of amateur research and investigation groups (ARIGs) to determine their location, area of inquiry, methodology and, particularly, to determine if they state that they use science as part of their mission, methods or goals. 57.3% of the ARIGs examined specifically noted or suggested use of science as part of the groups' approach to investigation and research. Even when not explicit, ARIGs often used science-like language, symbols and methods to describe their groups' views or activities. Yet, non-scientific and subjective methods were described as employed in conjunction with objective methods. Furthermore, what were considered scientific processes by ARIGs did not match with established methods and the ethos of the scientific research community or scientific processes of investigation. ARIGs failed to display fundamental understanding regarding objectivity, methodological naturalism, peer review, critical thought and theoretical plausibility. The processes of science appear to be mimicked to present a serious and credible reputation to the non-scientific public. These processes are also actively promoted in the media and directly to the local public as "scientific". These results highlight the gap between the scientific community and the lay public regarding the understanding of what it means to do science and what criteria are necessary to establish reliable knowledge about the world.

  11. A convenient approach to 10-12 g/ g ICP-MS limits for Th and U in aurubis electrolytic NA-ESN brand copper

    Science.gov (United States)

    Leonard, Douglas S.

    2014-06-01

    Inductively-coupled-plasma mass spectroscopy is a powerful technique for measuring trace levels of radioactive contaminants, specifically Th and U, in materials for use in construction of low-background rare-event detectors such as double beta decay and dark matter detectors. I describe here a technique for measuring Th and U contamination in copper by using direct acid digestion and dilution without further chemical processing, achieving results comparable to those achieved in previous work [1, 2] which utilized more complex chemical pre-concentration techniques. A convenient research-oriented analysis environment is described as well. Results are presented for measurements of three samples from the production line of electrolytically-purified, LME (London Metal Exchange) grade A, NA-ESN Aurubis copper. Purified samples showed levels consistent with zero contamination for both elements, while weak, but inconclusive, indications of contamination were present for the unpurified anode copper. The best limits achieved are near 1•10-12 g/ g (95% CL) for both Th and U measured for copper from the cathode of the purification process.

  12. Resveratrol represses YKL-40 expression in human glioma U87 cells

    International Nuclear Information System (INIS)

    Zhang, Wei; Tamiya, Takashi; Murao, Koji; Zhang, Xiang; Matsumoto, Kensuke; Diah, Suwarni; Okada, Masaki; Miyake, Keisuke; Kawai, Nobuyuki; Fei, Zhou

    2010-01-01

    Glioblastoma multiforme (GBM) is the most malignant intracranial tumour that develops in both adults and children. Microarray gene analyses have confirmed that the human YKL-40 gene is one of the most over-expressed genes in these tumours but not in normal brain tissue. Clinical studies have shown that serum YKL-40 levels are positively correlated with tumour burden in addition to being an independent prognostic factor of a short relapse-free interval as well as short overall survival in patients with various cancers. Our previous study revealed that YKL-40 was closely correlated with the pathological grades of human primary astrocytomas and played a crucial role in glioma cell proliferation. Hence, YKL-40 could be an attractive target in the design of anti-cancer therapies. Cell viability and invasion assays were performed to detect the cell proliferation and invasive ability of U87 cells induced by resveratrol (3, 5, 4'-trihydroxystilbene; Res) or YKL-40 small-interfering RNAs (siRNAs). In addition, the luciferase assay, real-time RT-PCR, western blotting, and ELISA were used to measure YKL-40 promoter activity, mRNA, and protein expression, respectively. The expressions of phosphor-ERK1/2 and ERK1/2 were determined by western blotting. Res inhibited U87 cell proliferation and invasion in vitro and repressed YKL-40 in U87 cells by decreasing the activity of its promoter and reducing mRNA transcription and protein expression in vitro. YKL-40 siRNA treatment also impaired the invasiveness of U87 cells. When U87 cells were cultured with 20 μM PD98059 (an ERK1/2 inhibitor) alone, with 20 μM PD98059 and 100 μM Res, or with 100 μM Res alone for 48 h, YKL-40 protein expression decreased most significantly in the Res-treated group. PD98059 partially reversed the decrease of YKL-40 protein expression induced by Res. Furthermore, phosphor-ERK1/2 expression was reduced by Res treatment in a time-dependent manner. We demonstrated for the first time that Res

  13. 10 CFR 12.103 - Proceedings covered.

    Science.gov (United States)

    2010-01-01

    ... under the Program Fraud Civil Remedies Act (31 U.S.C. 3801-12); (2) Any appeal of a decision made... contract appeals as provided in section 8 of that Act (41 U.S.C. 607); and (3) Adversary adjudications...” under 5 U.S.C. 504(b)(1)(C). (b) The Commission's failure to identify a type of proceeding as an...

  14. Enzymatic reduction of U(VI) in groundwaters; Reduction enzymatique de U(VI) dans des eaux souterraines

    Energy Technology Data Exchange (ETDEWEB)

    Addelouas, A.; Gong, W. [Center for Radioactive Waste Management, Advanced Materials Laboratory, 1001 University, Albuquerque (United States); Lutze, W.; Nuttall, E. [New Mexico Univ., Albuquerque, NM (United States). Dept. of Chemical and Nuclear Engineering; Fritz, B.; Crovisier, J.L. [Centre National de la Recherche Scientifique (CNRS), 67 - Strasbourg (France). Centre de Sedimentologie et Geochimie de la Surface

    1999-03-01

    The use of enzymatic reduction of U(VI) in remediation of groundwater contaminated with U(VI) is receiving considerable attention. Certain strains of bacteria can combine the oxidation of an organic compound to the reduction of U(VI) to U(IV), which precipitates as uraninite. In the present study, we tested the reduction of U(VI) in groundwaters with various origins and compositions. In all groundwaters u(VI) was reduced by sulfate reducing bacteria that had been activated by ethanol and tri-metaphosphate. The reduction rate of U(VI) depends on sulfate concentration in water and the abundance of bacteria in the system. This work shows that bacteria capable of U(VI) reduction are ubiquitous in nature, and suggests the possibility of a large application of the enzymatic reduction of U(VI) for in situ clean up of groundwaters contaminated with uranium. (authors) 12 refs.

  15. Eocene Yegua Formation (Claiborne group) and Jackson group lignite deposits of Texas

    Science.gov (United States)

    Hook, Robert W.; Warwick, Peter D.; Swanson, Sharon M.; Hackley, Paul C.; Warwick, Peter D.; Karlsen, Alexander K.; Merrill, Matthew D.; Valentine, Brett J.

    2011-01-01

    The lignite deposits within the upper Eocene Yegua Formation (Claiborne Group) and the overlying Jackson Group are among the coal resources that were not quantitatively assessed as part of the U.S. Geological Survey's (USGS) National Coal Resource Assessment (NCRA) program in the Gulf Coastal Plain coal province. In the past, these lignite-bearing stratigraphic units often have been evaluated together because of their geographic and stratigraphic proximity (Fisher, 1963; Kaiser, 1974; Kaiser et al., 1980; Jackson and Garner, 1982; Kaiser, 1996) (Figures 1, 2). The term “Yegua-Jackson trend“ is used informally herein for the lignite-bearing outcrops of these Late Eocene deposits in Texas. Lignite beds in the Yegua-Jackson trend generally are higher both in ash yield and sulfur content than those of the underlying Wilcox Group (Figure 2). Recent studies (Senkayi et al., 1987; Ruppert et al., 1994; Warwick et al., 1996, 1997) have shown that some lignite beds within the Yegua-Jackson trend contain partings of volcanic ash and host elevated levels of trace elements that have been identified as potentially hazardous air pollutants (HAPs) in the United States Clean Air Amendments of 1990. Lignite beds within the Yegua Formation are thin (less than or equal to 6 ft) and laterally discontinuous in comparison with most Wilcox Group deposits (Ayers, 1989a); in contrast, the Jackson Group lignite beds range up to 12 ft in total thickness and are relatively continuous laterally, extending nearly 32 mi along strike.

  16. GROUPING WEB ACCESS SEQUENCES uSING SEQUENCE ALIGNMENT METHOD

    OpenAIRE

    BHUPENDRA S CHORDIA; KRISHNAKANT P ADHIYA

    2011-01-01

    In web usage mining grouping of web access sequences can be used to determine the behavior or intent of a set of users. Grouping websessions is how to measure the similarity between web sessions. There are many shortcomings in traditional measurement methods. The taskof grouping web sessions based on similarity and consists of maximizing the intra-group similarity while minimizing the inter-groupsimilarity is done using sequence alignment method. This paper introduces a new method to group we...

  17. 238U (n,f) measurements below 30 keV

    International Nuclear Information System (INIS)

    Slovacek, R.E.; Cramer, D.S.; Bean, E.B.; Hockenbury, R.W.; Valentine, J.R.; Block, R.C.

    1975-01-01

    The 238 U (n,f) cross section has been measured from 3 eV to about 30 keV with the lead slowing down spectrometer at the RPI Linac. Four fission ionization chambers containing a total of about 0.8 gm of 238 U (4.1 ppm 235 U) were used for the measurements. The fission widths of the 6.67, 20.9, and the 36.8 eV resonances were measured as (10 +- 1), (58 +- 9), and (12 +- 2) nanoelectron-volts respectively. The fission cross section integrated over the two subthreshold groups at 720 and 1210 eV and the average fission cross section from 10 to 30 keV are in agreement with a previous time of flight measurement. The fission width at 6.67 eV is 20 times smaller than an upper limit set by the only reported measurement in this energy region; the fission widths obtained in the present investigation are consistent with the (30 +- 50) nanoelectronvolt average width previously obtained for the resonances between 37 and 327 eV in a time of flight measurement using a nuclear device. From the measured fission widths, the 238 U thermal fission cross section was determined to be 2.7 +- 0.3 μ barns. The resonance fission integral was also obtained from the data as 1.33 +- 0.15 mbarns for 238 U. (4 figures, 4 tables) (U.S.)

  18. General U(1)xU(1) F-theory Compactifications and Beyond: Geometry of unHiggsings and novel Matter Structure

    CERN Document Server

    Cvetic, Mirjam; Piragua, Hernan; Taylor, Washington

    2015-01-01

    We construct the general form of an F-theory compactification with two U(1) factors based on a general elliptically fibered Calabi-Yau manifold with Mordell-Weil group of rank two. This construction produces broad classes of models with diverse matter spectra, including many that are not realized in earlier F-theory constructions with U(1)xU(1) gauge symmetry. Generic U(1)xU(1) models can be related to a Higgsed non-Abelian model with gauge group SU(2)xSU(2)xSU(3), SU(2)^3xSU(3), or a subgroup thereof. The nonlocal horizontal divisors of the Mordell-Weil group are replaced with local vertical divisors associated with the Cartan generators of non-Abelian gauge groups from Kodaira singularities. We give a global resolution of codimension two singularities of the Abelian model; we identify the full anomaly free matter content, and match it to the unHiggsed non-Abelian model. The non-Abelian Weierstrass model exhibits a new algebraic description of the singularities in the fibration that results in the first expl...

  19. Report of the 12A Working Group on Determination of Critical Ice Shapes for the Certification to Aircraft

    National Research Council Canada - National Science Library

    2000-01-01

    .... Accordingly, the 12A Working Group, on critical ice shapes used in icing certification, was formed under the joint leadership of the FAA and the National Aeronautics and Space Administration (NASA) in November 1997...

  20. Contents and daily intakes of gamma-ray emitting nuclides, 90Sr, and 238U using market-basket studies in japan

    International Nuclear Information System (INIS)

    Sugiyama, Hideo; Terada, Hiroshi; Takahashi, Mitsuko; Iijima, Ikuyo; Isomura, Kimio

    2007-01-01

    To investigate the contents of radionuclides in foods marketed in Japan and their daily intakes and exposure doses in adults, we performed market-basket studies concerning radionuclide intakes. The study period was 2003-2005, and the studies were performed in 13 cities in Japan. Foods including drinking water were divided into 14 food groups, and samples were prepared by common cooking procedures. γ-ray emitting nuclides (an artificial radionuclide, radioactive Cs, and natural radionuclides, 40 K and U series such as 214 Bi, and 212 Pb, and Th series) were measured in each food group, and artificial radionuclides, 90 Sr and 238 U, were measured in a mixed sample of 13 food groups excluding drinking water. The daily intakes in adults were calculated from the concentrations of the radionuclides and mean daily consumption of foods and drinking water. The daily 137 Cs and 40 K intakes (mBq/person · day) in the 13 cities were 12.5- 90 Sr intake from the food groups excluding drinking water was 20.8-53.6, with a mean of 39.2 (mBq/person · day) (deviation of the mean: 23%). Similarly, the daily 238 U intake was 5.9-31.1, with a mean of 12.6 (mBq/person · day) (deviation: 60%), showing a more than 5-fold difference between the minimum and maximum values, and there were regional differences. Since the contents of the U series, such as 214 Bi and 212 Pb, and Th series were lower than the lower detection limits in many samples, their daily intakes were not calculated. Regarding the daily intake of 137 Cs from each food group, the intakes from fish and shellfish, milk, meat/eggs, and mushrooms/seaweed tended to be higher. The daily 40 K intake from each food group varied among the areas, but the total intake from the 14 food groups was similar in all 13 cities. 40 K from these foods accounted for most of the annual effective dose (μSv/person · year) of γ-ray emitting nuclides, and the doses of 40 K, 90 Sr, and 238 U were 130-217, 0.21-0.55, and 0.10-0.51, respectively

  1. 19 CFR 12.32 - Honeybees and honeybee semen.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Honeybees and honeybee semen. 12.32 Section 12.32... semen. (a) Honeybees from any country may be imported into the U.S. by the Department of Agriculture for.... (b) Honeybee semen may be imported into the U.S. only from countries determined by the Secretary of...

  2. Multiplicity dependence of matrix-induced frequency shifts for atomic transitions of the group 12 metals in rare gas solids

    International Nuclear Information System (INIS)

    Laursen, S.L.; Cartland, H.E.

    1991-01-01

    Atomic resonances of the group 12 metal atoms, Hg, Cd, and Zn, undergo frequency shifts from the gas phase atomic line when trapped in rare gas matrices of Ar, Kr, and Xe at 12 K. As expected, the shifts are approximately linear in polarizability of the rare gas, but the slope of this line depends on whether the transition in question is 1 P 1 left-arrow 1 S 0 or 3 P 1 left-arrow 1 S 0 . Thus the matrix-induced frequency shift is dependent on the singlet or triplet nature of the excited state as well as on the matrix material. This dependence on multiplicity is discussed in terms of interactions between the excited-state atomic orbitals and the matrix. The results are compared to matrix studies of other metals and to related gas-phase work on diatomic van der Waals complexes of group 12 metals with rare gases

  3. 19 CFR 103.12 - Exemptions.

    Science.gov (United States)

    2010-04-01

    ... AVAILABILITY OF INFORMATION Production of Documents/Disclosure of Information Under the FOIA § 103.12 Exemptions. Pursuant to 5 U.S.C. 552(b), the disclosure requirements of 5 U.S.C. 552(a) are not applicable to... if such disclosure could reasonably be expected to risk circumvention of the law; or (6) Could...

  4. NYC Reservoirs Watershed Areas (HUC 12)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This NYC Reservoirs Watershed Areas (HUC 12) GIS layer was derived from the 12-Digit National Watershed Boundary Database (WBD) at 1:24,000 for EPA Region 2 and...

  5. Subtle interactions and electron transfer between U{sup III}, Np{sup III}, or Pu{sup III} and uranyl mediated by the oxo group

    Energy Technology Data Exchange (ETDEWEB)

    Arnold, Polly L.; Zegke, Markus; Hollis, Emmalina; Pecharman, Anne-Frederique; Love, Jason B. [EaStCHEM School of Chemistry, University of Edinburgh (United Kingdom); Dutkiewicz, Michal S. [EaStCHEM School of Chemistry, University of Edinburgh (United Kingdom); European Commission, Directorate for Nuclear Safety and Security, Joint Research Centre, Karlsruhe (Germany); Walter, Olaf; Apostolidis, Christos; Magnani, Nicola; Griveau, Jean-Christophe; Colineau, Eric; Caciuffo, Roberto [European Commission, Directorate for Nuclear Safety and Security, Joint Research Centre, Karlsruhe (Germany); Zhang, Xiaobin; Schreckenbach, Georg [Department of Chemistry, University of Manitoba, Winnipeg, MB (Canada)

    2016-10-04

    A dramatic difference in the ability of the reducing An{sup III} center in AnCp{sub 3} (An=U, Np, Pu; Cp=C{sub 5}H{sub 5}) to oxo-bind and reduce the uranyl(VI) dication in the complex [(UO{sub 2})(THF)(H{sub 2}L)] (L=''Pacman'' Schiff-base polypyrrolic macrocycle), is found and explained. These are the first selective functionalizations of the uranyl oxo by another actinide cation. At-first contradictory electronic structural data are explained by combining theory and experiment. Complete one-electron transfer from Cp{sub 3}U forms the U{sup IV}-uranyl(V) compound that behaves as a U{sup V}-localized single molecule magnet below 4 K. The extent of reduction by the Cp{sub 3}Np group upon oxo-coordination is much less, with a Np{sup III}-uranyl(VI) dative bond assigned. Solution NMR and NIR spectroscopy suggest Np{sup IV}U{sup V} but single-crystal X-ray diffraction and SQUID magnetometry suggest a Np{sup III}-U{sup VI} assignment. DFT-calculated Hirshfeld charge and spin density analyses suggest half an electron has transferred, and these explain the strongly shifted NMR spectra by spin density contributions at the hydrogen nuclei. The Pu{sup III}-U{sup VI} interaction is too weak to be observed in THF solvent, in agreement with calculated predictions. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Boxing injuries presenting to U.S. emergency departments, 1990-2008.

    Science.gov (United States)

    Potter, Matthew R; Snyder, Ashley J; Smith, Gary A

    2011-04-01

    Boxing injuries can have serious consequences. To examine the epidemiology of boxing injuries in the U.S. with attention to head injuries and children. National estimates of boxing injuries were calculated using data from the National Electronic Injury Surveillance System. Injury rates per 1000 participants for the year 2003 were calculated using boxing participation data. Data analysis was conducted in 2009-2010. An estimated 165,602 individuals (95% CI=134891, 196313) sustained boxing injuries that resulted in a visit to a U.S. hospital emergency department from 1990 through 2008. An average of 8716 (95% CI=7078, 10354) injuries occurred annually, and there was a statistically significant increase in the annual number of injuries during the 19-year study period (slope=610, pboxing injuries. The percentage of injuries that were concussions/closed head injuries in the group aged 12-17 years (8.9%) was similar to that in the group aged 18-24 years (8.1%) and the group aged 25-34 years (8.5%). These findings, based on a nationally representative sample, indicate that injuries related to boxing are increasing in number. Increased efforts are needed to prevent boxing injuries. Copyright © 2011 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.

  7. Environmental Working Group Joint U.S.-Russian Arctic Sea Ice Atlas

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Note: The Russian chart component of this product has been replaced and updated by Sea Ice Charts of the Russian Arctic in Gridded Format, 1933-2006 and the U.S...

  8. 12 CFR 1510.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Definitions. 1510.2 Section 1510.2 Banks and Banking DEPARTMENT OF THE TREASURY RESOLUTION FUNDING CORPORATION RESOLUTION FUNDING CORPORATION... context requires otherwise: Act means the Federal Home Loan Bank Act (12 U.S.C. 1421 et seq...

  9. 19 CFR 12.31 - Plant pests.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Plant pests. 12.31 Section 12.31 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Wild Animals, Birds, and Insects § 12.31 Plant pests. The importation in a...

  10. Some remarks on Feynman rules for non-commutative gauge theories based on groups G≠U(N)

    International Nuclear Information System (INIS)

    Dorn, Harald; Sieg, Christoph

    2002-01-01

    We study for subgroups G is a subset of U(N) partial summations of the θ-expanded perturbation theory. On diagrammatic level a summation procedure is established, which in the U(N) case delivers the full star-product induced rules. Thereby we uncover a cancellation mechanism between certain diagrams, which is crucial in the U(N) case, but set out of work for G is a subset of U(N). In addition, an explicit proof is given that for G is a subset of U(N), G≠U(M), M< N there is no partial summation of the θ-expanded rules resulting in new Feynman rules using the U(N) star-product vertices and besides suitable modified propagators at most a finite number of additional building blocks. Finally, we show that certain SO(N) Feynman rules conjectured in the literature cannot be derived from the enveloping algebra approach. (author)

  11. [Overexpressed miRNA-134b inhibits proliferation and invasion of CD133+ U87 glioma stem cells].

    Science.gov (United States)

    Liu, Yifeng; Zhang, Baochao; Wen, Changming; Wen, Gongling; Zhou, Guoping; Zhang, Jingwei; He, Haifa; Wang, Ning; Li, Wei

    2017-05-01

    Objective To investigate the role of microRNA-134b (miR-134b) in the tumorigenesis of glioma stem cells (GSCs) and the possible molecular mechanism. Methods Real-time quantitative PCR (qRT-PCR) was used to evalate the expression of miR-134b in CD133 + and CD133 - U87 GSCs. A lentiviral vector overexpressing miR-134b in U87 GSCs was constructed, and the effect of miR-134b overexpression on matrix metalloproteinase-2 (MMP-2), MMP-9 and MMP-12 expressions at both mRNA and protein levels were detected by qRT-PCR and Western blotting, respectively. Transwell TM assay was performed to determine the effect of miR-134b overexpression on GSCs invasion ability. Tumor xenograft models in nude mice were established to evaluate the effect of miR-134b overexpression on tumorgenesis in vivo. Results The qRT-PCR showed that, compared with CD133 - cells, miR-134b was significantly down-regulated in CD133 + cells. Cell line over-expressing miR-134b was successfully established, and miR-134b was up-regulated significantly compared with empty vector control. Overexpression of miR-134b remarkably inhibited the invasion of U87 GSCs and the expression of MMP-12. However, overexpression of miR-134b did not affect MMP-2 and MMP-9 expressions. miR-134b also suppressed U87 GSCs xenograft growth in vivo. Tumor volume in tumor xenograft model group was significantly lower than that in control group, and tumor weight decreased by 42% in the former group. Conclusion Overexpression of miR-134b inhibits the growth and invasion of CD133 + GSCs.

  12. Exploring precarious employment and women's health within the context of U.S. microenterprise using focus groups.

    Science.gov (United States)

    Salt, Rebekah; Lee, Jongwon

    2014-01-01

    Nursing has been a leader in exploring social determinants of health within the context of U.S. microenterprise and women's health. The purpose of this study was to explore precarious employment within the context of microenterprise and women's health using focus groups with clientele from New Mexico (NM). The specific aims were to identify (1) the health concerns of low-income women who utilized resources from Women's Economic Self-Sufficiency Team (WESST), and (2) the meaning of precarious employment in low-income women's lives. Fourteen women, ranging in age from 21-65 years, who were affiliated with regional WESST sites around NM participated in focus groups and completed a demographic questionnaire. Focus group data were analyzed using content analysis. The degree of interrater agreement was determined by calculating the Cohen's kappa, percentage agreement, and prevalence-adjusted and bias-adjusted kappa (PABAK). Two broad themes emerged from these data: (1) Working for Yourself and (2) Strategies. Although the women identified concerns about participation in microenterprise, flexibility, freedom, and feeling purposeful were motivators to pursue a small business. The kappa statistics on the five transcripts revealed poor inter-rater agreement, yet PABAK, which is a more sophisticated inter-rater reliability index, indicated that inter-rater agreement between the two raters was satisfactory. Despite the challenges associated with microenterprise in the US, women found value in working for themselves. © 2014 Wiley Periodicals, Inc.

  13. The ERK1/2 Inhibitor U0126 Attenuates Diabetes-Induced Upregulation of MMP-9 and Biomarkers of Inflammation in the Retina

    Directory of Open Access Journals (Sweden)

    Ghulam Mohammad

    2013-01-01

    Full Text Available This study was conducted to determine the expression of matrix metalloproteinase-9 (MMP-9 and tissue inhibitor of metalloproteinase-1 (TIMP-1 in a time-dependent manner and the effect of extracellular-signal-regulated kinases-1/2 (ERK1/2 inhibition on the expressions of MMP-9, TIMP-1, and inflammatory biomarkers in the retinas of diabetic rats. The expression of MMP-9 was quantified by zymography, and the mRNA level of MMP-9 and TIMP-1 was quantified by RT-PCR. The expression of inducible nitric oxide synthase (iNOS, interleukin-6 (IL-6, and tumor necrosis factor-alpha (TNF-α was examined by Western blot analysis. MMP-9 expression was significantly higher in diabetic rat retinas compared to controls at all time points.TIMP-1 expression was nonsignificantly upregulated at 1week of diabetes and was significantly downregulated at 4 and 12 weeks of diabetes. Intravitreal administration of the ERK1/2 inhibitor U0126 prior to induction of diabetes decreased ERK1/2 activation, attenuated diabetes-induced upregulation of MMP-9, iNOS, IL-6, and TNF-α and upregulated TIMP-1 expression. In MMP-9 knockout mice, diabetes had no effect on retinal iNOS expression and its level remained unchanged. These data provide evidence that ERK1/2 signaling pathway is involved in MMP-9, iNOS, IL-6, and TNF-α induction in diabetic retinas and suggest that ERK1/2 can be a novel therapeutic target in diabetic retinopathy.

  14. Calendar Year 2008 Groundwater Monitoring Report, U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Elvado Environmental LLC

    2009-12-01

    This report contains the groundwater and surface water monitoring data that were obtained during calendar year (CY) 2008 at the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) on the DOE Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The CY 2008 monitoring data were obtained from wells, springs, and surface water sampling locations in three hydrogeologic regimes at Y-12 (Figure A.1). The Bear Creek Hydrogeologic Regime (Bear Creek Regime) encompasses a section of Bear Creek Valley (BCV) between the west end of Y-12 and the west end of the Bear Creek Watershed (directions are in reference to the Y-12 grid system). The Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime) encompasses the Y-12 industrial facilities and support structures in BCV. The Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime) encompasses a section of Chestnut Ridge directly south of Y-12. Section 2 of this report provides background information pertinent to groundwater and surface water quality monitoring in each hydrogeologic regime, including the topography and bedrock geology, surface water drainage, groundwater system, and extent of groundwater contamination. The CY 2008 groundwater and surface water monitoring data in this report were obtained from sampling and analysis activities implemented under the Y-12 Groundwater Protection Program (GWPP) managed by Babcock & Wilcox Technical Services Y-12, LLC (B&W Y-12) and from sampling and analysis activities implemented under several monitoring programs managed by Bechtel Jacobs Company LLC (BJC). Cooperative implementation of the monitoring programs directed by the Y-12 GWPP and BJC (i.e., coordinating sample collection and sharing data) ensures that the CY 2008 monitoring results fulfill requirements of all the applicable monitoring drivers with no duplication of sampling and analysis efforts. Section 3 of this report contains a summary of information regarding the

  15. Interaction of 84 MeV/u 12C with 208Pb target investigated with CR-39 plastic track detector

    International Nuclear Information System (INIS)

    Grabez, B.

    1984-01-01

    The interaction of the 84 MeV/u 12 C ions with 208 Pb target was investigated using CR-39 plastic track detector. The first part of the work was dedicated to the examination of the methodology of the recently presented CR-39 detector and its calibration. Measurements have been done on tracks of various ions in the broad atomic number region from Z = 2 to Z = 92. The possibility of the identification of low energy fragments produced in nuclear interactions by measurements on the finished tracks was studied. Our results show that very good charge resolution can be achieved through determination of the mean etch rate ratio and the range of low energy ions. In the second part of the work it was shown that the main reaction channels in the interaction of 84 MeV/u C with Pb target are spallation, fission and fragmentation. The contribution of the multifragmentation is less than 1% of the total reaction cross section. From our results follows that the most probable reaction channels after collision with small impact parameter are fragmentation and deep spallation. The spallation and fission come after more peripheral collisions. (orig./HSI)

  16. [Association between MAOA-u VNTR polymorphism and its interaction with stressful life events and major depressive disorder in adolescents].

    Science.gov (United States)

    Ma, Jing; Yu, Shun-Ying; Liang, Shan; Ding, Jun; Feng, Zhe; Yang, Fan; Gao, Wei-Jia; Lin, Jia-Ni; Huang, Chun-Xiang; Liu, Xue-Jun; Su, Lin-Yan

    2013-07-01

    To investigate whether the genetic polymorphism, upstream variable number of tandem repeats (uVNTR), in the monoamine oxidase A (MAOA) gene, is associated with major depressive disorder (MDD) in adolescents and to test whether there is gene-environment interaction between MAOA-uVNTR polymorphism and stressful life events (SLEs). A total of 394 Chinese Han subjects, including 187 adolescent patients with MDD and 207 normal students as a control group, were included in the study. Genotyping was performed by SNaP-shot assay. SLEs in the previous 12 months were evaluated. The groups were compared in terms of the frequency distributions of MAOA-uVNTR genotypes and alleles using statistical software. The binary logistic regression model of gene-environment interaction was established to analyze the association of the gene-environment interaction between MAOA-u VNTR genotypes and SLEs with adolescent MDD. The distribution profiles of MAOA-u VNTR genotypes and alleles were not related to the onset of MDD, severity of depression, comorbid anxiety and suicidal ideation/behavior/attempt in adolescents. The gene-environment interaction between MAOA-u VNTR genotypes and SLEs was not associated with MDD in male or female adolescents. It is not proven that MAOA-u VNTR polymorphism is associated with adolescent MDD. There is also no gene-environment interaction between MAOA-u VNTR polymorphism and SLEs that is associated with adolescent MDD.

  17. Investigations of chemical reactions between U-Zr alloy and FBR cladding materials

    International Nuclear Information System (INIS)

    Ishii, Tetsuya; Ukai, Shigeharu

    2005-07-01

    U-Pu-Zr alloys are candidate materials for commercial FBR fuel. However, informations about chemical reactions with cladding materials developed by JNC for commercial FBR have not been well obtained. In this work, the reaction zones formed in four diffusion couples U-10wt.%Zr/PNC-FMS, U-10wt.%Zr/9Cr-ODS, U-10wt.%Zr/12Cr-ODS, and U-10wt.%Zr/Fe at about 1013K have been examined and following results were obtained. 1) At about 1013K, in the U-10wt.%Zr/Fe couple, the liquid phase zones were obtained. In the other couples U-10wt.%Zr/PNC-FMS, U-10wt.%Zr/9Cr-ODS and U-10wt.%Zr/12Cr-ODS, no liquid phase zones were obtained. The obtained chemical reaction zones in the later 3 couples were similar to the reported ones obtained in U-Zr/Fe couples without liquid phase formation. In comparison with the reaction zones obtained in the U-10wt.%Zr/Fe couple, the reaction zones inside cladding materials obtained in the PNC-FMS, 9Cr-ODS, and 12Cr-ODS couples were thin. 2) From the investigations of relationship between the obtained depths of the chemical reaction zones inside cladding materials and composition of the cladding materials, it was considered that the depth of chemical reaction zone would depend on the Cr content of the cladding materials and the depth would decrease with increasing Cr content, resulting in prevention of liquid phase formation. 3) From the investigations of the mechanisms of chemical reactions between U-Pu-Zr/cladding materials, it was considered that the same effect of Cr obtained in the U-Zr/cladding materials would be expected in U-Pu-Zr/cladding materials. Those seemed to indicate that the threshold temperatures of liquid phase formation for U-Pu-Zr/PNC-FMS, U-Pu-Zr/9Cr-ODS, and U-Pu-Zr/12Cr-ODS might be higher than that for U-Pu-Zr/Fe. (author)

  18. 12 CFR 412.1 - Authority.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Authority. 412.1 Section 412.1 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ACCEPTANCE OF PAYMENT FROM A NON-FEDERAL SOURCE FOR TRAVEL EXPENSES § 412.1 Authority. This part is issued under the authority of 5 U.S.C. 553, 5 U.S.C. 5701-5709 and...

  19. Eisenstein series for infinite-dimensional U-duality groups

    Science.gov (United States)

    Fleig, Philipp; Kleinschmidt, Axel

    2012-06-01

    We consider Eisenstein series appearing as coefficients of curvature corrections in the low-energy expansion of type II string theory four-graviton scattering amplitudes. We define these Eisenstein series over all groups in the E n series of string duality groups, and in particular for the infinite-dimensional Kac-Moody groups E 9, E 10 and E 11. We show that, remarkably, the so-called constant term of Kac-Moody-Eisenstein series contains only a finite number of terms for particular choices of a parameter appearing in the definition of the series. This resonates with the idea that the constant term of the Eisenstein series encodes perturbative string corrections in BPS-protected sectors allowing only a finite number of corrections. We underpin our findings with an extensive discussion of physical degeneration limits in D < 3 space-time dimensions.

  20. Comparing Acceptance and Commitment Group Therapy and 12-Steps Narcotics Anonymous in Addict’s Rehabilitation Process: A Randomized Controlled Trial

    Directory of Open Access Journals (Sweden)

    Manoochehr Azkhosh

    2016-12-01

    Full Text Available Objective: Substance abuse is a socio-psychological disorder. The aim of this study was to compare the effectiveness of acceptance and commitment therapy with 12-steps Narcotics Anonymous on psychological well-being of opiate dependent individuals in addiction treatment centers in Shiraz, Iran.Method: This was a randomized controlled trial. Data were collected at entry into the study and at post-test and follow-up visits. The participants were selected from opiate addicted individuals who referred to addiction treatment centers in Shiraz. Sixty individuals were evaluated according to inclusion/ exclusion criteria and were divided into three equal groups randomly (20 participants per group. One group received acceptance and commitment group therapy (Twelve 90-minute sessions and the other group was provided with the 12-steps Narcotics Anonymous program and the control group received the usual methadone maintenance treatment. During the treatment process, seven participants dropped out. Data were collected using the psychological well-being questionnaire and AAQ questionnaire in the three groups at pre-test, post-test and follow-up visits. Data were analyzed using repeated measure analysis of variance.Results: Repeated measure analysis of variance revealed that the mean difference between the three groups was significant (P<0.05 and that acceptance and commitment therapy group showed improvement relative to the NA and control groups on psychological well-being and psychological flexibility.Conclusion: The results of this study revealed that acceptance and commitment therapy can be helpful in enhancing positive emotions and increasing psychological well-being of addicts who seek treatment.

  1. The Hispanic Americans Baseline Alcohol Survey (HABLAS): the association between acculturation, birthplace and alcohol consumption across Hispanic national groups.

    Science.gov (United States)

    Vaeth, Patrice A C; Caetano, Raul; Rodriguez, Lori A

    2012-09-01

    Acculturation to U.S. society has been associated with an increase in drinking and binge drinking among Hispanics. This paper examines the association between acculturation and three drinking-related outcomes: average number of drinks consumed, binge drinking, and drinking 12 drinks or more in a single day in four major Hispanic national groups. The 2006 Hispanic Americans Baseline Alcohol Survey used a multistage cluster sample design to interview 5224 adult Hispanics (18+ years) in five selected U.S. metropolitan areas: Miami, New York, Philadelphia, Houston, and Los Angeles. The four national groups interviewed were: Puerto Ricans, Cuban Americans, Mexican Americans, and South/Central Americans. The survey response rate was 76%. Data on drinking behavior were collected and the analyses include bivariate and multivariate regression techniques. Multivariate analysis did not show an association between acculturation and volume of drinking, binge drinking, or drinking 12 or more drinks in a single day among men. Acculturation stress, however, was associated with drinking 12 or more in a day among men. Among women, high acculturation was associated with a higher volume of drinking, and it also interacted with national group to increase the likelihood of binge drinking. Acculturation does not have a homogeneous effect on drinking across gender and Hispanic national groups. The results confirm that acculturation has a more consistent association with increased drinking and binge drinking among women than among men. The effect of acculturation is therefore gender-specific. This heterogeneity across Hispanic national groups must be considered in future research, treatment, and prevention efforts. Copyright © 2012 Elsevier Ltd. All rights reserved.

  2. Y-12 Groundwater Protection Program Monitoring Optimization Plan for Groundwater Monitoring Wells at the U.S. Department of Energy Y-12 National Security Complex

    International Nuclear Information System (INIS)

    2006-01-01

    This document is the monitoring optimization plan for groundwater monitoring wells associated with the U.S. Department of Energy (DOE) Y-12 National Security Complex (Y-12) in Oak Ridge, Tennessee (Figure A.1). The plan describes the technical approach that will be implemented under the Y-12 Groundwater Protection Program (GWPP) to focus available resources on the monitoring wells at Y-12 that provide the most useful hydrologic and water-quality monitoring data. The technical approach is based on the GWPP status designation for each well (Section 2.0). Under this approach, wells granted ''active'' status are used by the GWPP for hydrologic monitoring and/or groundwater quality sampling (Section 3.0), whereas wells granted ''inactive'' status are not used for either purpose. The status designation also defines the frequency at which the GWPP will inspect applicable wells, the scope of these well inspections, and extent of any maintenance actions initiated by the GWPP (Section 3.0). Details regarding the ancillary activities associated with implementation of this plan (e.g., well inspection) are deferred to the referenced GWPP plans and procedures (Section 4.0). This plan applies to groundwater wells associated with Y-12 and related waste management areas and facilities located within three hydrogeologic regimes (Figure A.1): the Bear Creek Hydrogeologic Regime (Bear Creek Regime), the Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime), and the Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime). The Bear Creek Regime encompasses a section of Bear Creek Valley (BCV) immediately west of Y-12. The East Fork Regime encompasses most of the Y-12 process, operations, and support facilities in BCV and, for the purposes of this plan, includes a section of Union Valley east of the DOE Oak Ridge Reservation (ORR) boundary along Scarboro Road. The Chestnut Ridge Regime encompasses a section of Chestnut Ridge directly south of Y-12 that is bound on the

  3. Natural and anthropogenic {sup 236}U in environmental samples

    Energy Technology Data Exchange (ETDEWEB)

    Steier, Peter [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)], E-mail: peter.steier@univie.ac.at; Bichler, Max [Atominstitut der Osterreichischen Universitaeten, Technische Universitaet Wien, Stadionallee 2, Wien A-1020 (Austria); Keith Fifield, L. [Department of Nuclear Physics, RSPhysSE, Australian National University, Canberra, ACT 0200 (Australia); Golser, Robin; Kutschera, Walter; Priller, Alfred [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Quinto, Francesca [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Richter, Stephan [Euopean Commission, Directorate-General Joint Research Centre, Institute for Reference Materials and Measurements (IRMM), Retieseweg 111, B-2440 Geel (Belgium); Srncik, Michaela [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Terrasi, Philippo [Dipartimento di Scienze Ambientali, Seconda Universita di Napoli, via Vivaldi 43, Caserta 81100 (Italy); Wacker, Lukas [Institute for Particle Physics, HPK H25, Schafmattstrasse 20, CH-8093 Zuerich (Switzerland); Wallner, Anton [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria); Wallner, Gabriele [Institut fuer Anorganische Chemie, Universitaet Wien, Waehringer Strasse 42, A-1090 Wien (Austria); Wilcken, Klaus M. [Scottish Universities Environmental Research Centre, Scottish Enterprise Technology Park, East Kilbride G75 OQF (United Kingdom); Maria Wild, Eva [VERA Laboratory, Fakultaet fuer Physik - Isotopenforschung, Universitaet Wien, Waehringer Strasse 17, A-1090 Wien (Austria)

    2008-05-15

    The interaction of thermal neutrons with {sup 235}U results in fission with a probability of {approx}85% and in the formation of {sup 236}U (t{sub 1/2} = 2.3 x 10{sup 7} yr) with a probability of {approx}15%. While anthropogenic {sup 236}U is, therefore, present in spent nuclear fuel at levels of {sup 236}U/U up to 10{sup -2}, the expected natural ratios in the pre-anthropogenic environment range from 10{sup -14} to 10{sup -10}. At VERA, systematic investigations suggest a detection limit below {sup 236}U/U = 5 x 10{sup -12} for samples of 0.5 mg U, while chemistry blanks of {approx}2 x 10{sup 7} atoms {sup 236}U per sample limit the sensitivity for smaller samples. We have found natural isotopic ratios in uranium reagents separated before the onset of human nuclear activities, in uranium ores from various origins and in water from a subsurface well in Bad Gastein, Austria. Anthropogenic contamination was clearly visible in soil and rivulet samples from Salzburg, Austria, whereas river sediments from Garigliano river (Southern Italy) were close to the detection limit. Finally, our natural in-house standard Vienna-KkU was calibrated against a certified reference material (IRMM REIMEP-18 A)

  4. Harnessing Technology to Improve K-12 Education. Discussion Paper 2012-05

    Science.gov (United States)

    Chatterji, Aaron; Jones, Benjamin

    2012-01-01

    Technological progress has consistently driven remarkable advances in the U.S. economy, yet K-12 education sees little technological change compared to other sectors, even as U.S. K-12 students increasingly lag behind students in other nations. This proposal considers how we can take a signature American strength--innovation--and apply it to K-12

  5. Measurement of the 230U half-life

    International Nuclear Information System (INIS)

    Pommé, S.; Altzitzoglou, T.; Van Ammel, R.; Suliman, G.; Marouli, M.; Jobbágy, V.; Paepen, J.; Stroh, H.; Apostolidis, C.; Abbas, K.; Morgenstern, A.

    2012-01-01

    The 230 U half-life was determined by measuring the decay curve of 230 U sources by various nuclear detection techniques: α-particle counting at a defined small solid angle; 4πα+β counting with a windowless CsI sandwich spectrometer, a liquid scintillation counter and a pressurised proportional counter; gamma-ray spectrometry with a HPGe detector and nearly-2π α-particle counting with an ion-implanted silicon detector. Depending on the technique, the decay was followed for 100–200 d, which is 5–10 times the 230 U half-life. The measurement results of the various techniques were in good mutual agreement. The mean value, T 1/2 ( 230 U)=20.23 (2) d, is lower than the literature value which is based on one measurement in 1948 and resulted in a half-life value of 20.8 d without statement of uncertainty. A correction for the ingrowth of the long-lived 210 Pb and its daughter products may have been overlooked in the past. - Highlights: ► Half-life of 230 U determined by various nuclear detection techniques. ► Result T 1/2 ( 230 U)=20.23 (2) d is lower than the literature value. ► 230 U/ 226 Th decay series has potential use in alpha-immunotherapy.

  6. Applications of Group Theory: Infrared and Raman Spectra of the Isomers of 1,2-Dichloroethylene: A Physical Experiment

    Science.gov (United States)

    Craig, Norman C.; Lacuesta, Nanette N.

    2004-01-01

    A study of the vibrational spectroscopy of the cis and trans isomers of 1,2-dichloroethylene provides an excellent opportunity to learn the applications group theory in laboratories. The necessity of using infrared (IR) spectroscopy and Raman spectroscopy in making full vibrational assignments is illustrated.

  7. Groundwater Protection Program Management Plan For The U.S. Department Of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Elvado Environmental, LLC

    2009-09-01

    This document presents the Groundwater Protection Program (GWPP) management plan for the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12). The Y-12 GWPP functions as the primary point-of-contact for groundwater-related issues at Y-12, provides stewardship of the extensive network of groundwater monitoring wells at Y-12, and serves as a resource for technical expertise, support, and historical data for groundwater-related activities at Y-12. These organizational functions each serve the primary programmatic purpose of the GWPP, which is to ensure that groundwater monitoring activities within areas under Y-12 administrative control provide representative data in compliance with the multiple purposes of applicable state and federal regulations, DOE orders, and the corporate policies of Babcock & Wilcox Technical Services Y-12 LLC (hereafter referenced as B&W Y-12), the Y-12 management and operations (M&O) contractor for DOE. B&W Y-12 is a new corporate name, assumed in January 2007, for the company formerly known as BWXT Y-12, L.L.C., hereafter referenced as BWXT. This GWPP management plan addresses the requirements of DOE Order 450.1A Environmental Protection Program (hereafter referenced as DOE O 450.1A), which emphasize a site-wide approach for groundwater protection at each DOE facility through implementation of groundwater surveillance monitoring. Additionally, this plan addresses the relevant and applicable GWPP elements and goals described in the DOE O 450.1A technical guidance documents issued in June 2004 (DOE 2004) and May 2005 (DOE 2005). This GWPP management plan is a 'living' document that is reviewed annually, revised and reissued every three years, and is formatted to provide for updating individual sections independent of the rest of the document. Section 2 includes a short description of the groundwater system at Y-12, the history of groundwater monitoring at Y-12 and the corresponding evolution of the GWPP

  8. U.S.-EU Cooperation Against Terrorism

    Science.gov (United States)

    2014-12-01

    of Colombia (FARC), some Palestinian groups (including Hamas’ military and political wings in 2001 and 2003 respectively), and Hezbollah’s military...a “European TFTP” would be aimed at enabling the EU to extract SWIFT data on European soil and send the targeted results onward to U.S. authorities...whether U.S. laws provide adequate protection for PNR data saved in cloud systems operating on U.S. soil . U.S.-EU Data Privacy and Protection

  9. Dielectron production in {sup 12}C+{sup 12}C collisions at 1 GeV per nucleon; Dielektronenproduktion in {sup 12}C+{sup 12}C Kollisionen bei 1 GeV pro Nukleon

    Energy Technology Data Exchange (ETDEWEB)

    Pachmayer, Yvonne C.

    2008-08-22

    This thesis contains the experimental results on dielectron production in {sup 12}C+{sup 12}C collisions at 1 GeV/u recorded with HADES. Within this work, the analysis is demonstrated, showing that leptons are efficiently reconstructed and hadrons very well discriminated. The described pair analysis shows that the combinatorial background is successfully reduced and the amount of true electron-positron pairs is not decreased. After subtracting the combinatorial background, the efficiency-corrected and normalized invariant-mass, transverse momentum and rapidity distributions of the dileptons are investigated. In the invariant-mass region 0.2-0.6 GeV/c{sup 2} the measured pair yield shows a strong excess above the contribution expected from hadron decays after freeze-out according to predictions. Together with the results obtained in {sup 12}C+{sup 12}C at 2 GeV/u it becomes evident that the overshoot of the data increases with decreasing beam energy. A detailed analysis shows that the beam energy dependence of the excess yield, i.e. the pair yield above the known eta contribution, integrated over the 0.15-0.5 GeV/c{sup 2} mass range, scales like pion production. (orig.)

  10. Aspartic acid complexation of Am(III) and U(VI)

    International Nuclear Information System (INIS)

    Saito, A.; Choppin, G.R.

    1984-01-01

    Stability constants of Am(III) and U(VI) with L-aspartic acid have been determined at pH 8.00 by means of the solvent extraction technique. It was found that Am(III) forms 1:1 and 1:2 complexes while U(VI) formed only the 1:1 complex under these conditions. The stability constants were: Am +3 : I = 0.10 M; log β 1 = 4.81 +- 0.03, log β 2 = 6.75 +- 0.03 I = 0.70 M; log β 1 = 4.53 +- 0.08 log β 2 = 6.65 +- 0.06 UO +2 2 : I = 0.70 M; log β 1 = 3.32 +- 0.04. Comparison of these stability constants with corresponding values of some dicarboxylate ligands suggests that at pH 8 the binding of Am +3 and UO +2 2 involves both carboxylates. In the Am-aspartate complex, the data indicate the possibility of weak interaction between the Am +3 and the amino group. (orig.)

  11. Attitudes to deceased organ donation and registration as a donor among minority ethnic groups in North America and the U.K.: a synthesis of quantitative and qualitative research.

    Science.gov (United States)

    Morgan, Myfanwy; Kenten, Charlotte; Deedat, Sarah

    2013-01-01

    A systematic review and synthesis of quantitative and qualitative research were undertaken to examine attitudes to deceased donation and registration as an organ donor among ethnic minorities in the U.K. and North America. A systematic search and assessments of relevance and quality were conducted. Parallel syntheses were then undertaken of 14 quantitative and 12 qualitative papers followed by their integration. The synthesis was organised around five barriers that emerged as key issues: (1) knowledge regarding deceased donation and registration as a donor; (2) discussion of donation/registration with family members; (3) faith and cultural beliefs; (4) bodily concerns including disfigurement and intactness; and (5) trust in doctors and the health care system. In all countries, knowledge of organ donation and registration remained low despite public campaigns, with African-Americans and Black African and Black Caribbean populations in the U.K. often regarding organ donation as a 'white' issue. Each of the four attitudinal barriers was also more prevalent among ethnic minorities compared with the majority population. However, the significance of trust and uncertainties regarding religion/faith differed between groups, reflecting salient aspects of ethnic identity and experiences. Differences were also identified within ethnic groups associated with age and generation, although respect for the views of elders often influenced younger peoples' willingness to donate. There is a need for a more nuanced understanding of ethnicity and of variations in attitudes associated with country of origin, age/generation, socio-economic status and area of residence, to inform public campaigns and promote sensitive discussions with bereaved ethnic minority families. The traditional focus on knowledge and attitudes also requires to be complemented by a greater emphasis on organisational and service-related barriers and changes required to enhance ethnic minorities' access to

  12. Dicty_cDB: Contig-U13974-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13974-1 no gap 1782 1 1265322 1267105 PLUS 29 32 U13974 0 0 0 1 2 0 22 0 4 0 0 0 0 0 Show Contig...-U13974-1 Contig ID Contig-U13974-1 Contig update 2002.12.18 Contig sequence >Contig-U13974-1 (Contig...-U13974-1Q) /CSM_Contig/Contig-U13974-1Q.Seq.d AAGAGTTAAAACAAAAATAAAAAAATAAAATAAAAAAAAAAAATTAA...TAAAACAAATAA ACATTAAAATGATATTTAGGTTTTAAATTTAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig...TTRKIYVYDNQNFFPIDNQGFD VDPAKRIYLNEKKTYHNYHFCMKMNTVFTYKGYEVFNFRGDDDVWVFINNKLVIDLGGLH SPIGTSVDTMTLGLTIG

  13. Dicty_cDB: Contig-U11342-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11342-1 gap included 2051 2 611517 609465 MINUS 4 7 U11342 0 2 1 1 0 0 0 0 0 0 0 0 0 0 Show Contig...-U11342-1 Contig ID Contig-U11342-1 Contig update 2002.12.18 Contig sequence >Contig-U11342-1 (Contig...-U11342-1Q) /CSM_Contig/Contig-U11342-1Q.Seq.d GTCAACATTAACATCATCATCATCATCATCACCATCTAGTAATAA...GAATTTGGTAATTTTAAAATCACTNATTAATATATTAAACAAAATTA TAAAAATAAAA Gap gap included Contig...EFFFIDRKSLLVNFP RGSICAQILKLIGNLYGSNDIIFKINTNNVSFFDGTIGANNSTNNSNSNQPMTPQQVVIK YLNPTARWKRREISNFEYLMTLNTIAGRTYN

  14. Dicty_cDB: Contig-U11195-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN

  15. Dicty_cDB: Contig-U12357-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12357-1 gap included 1333 1 2827305 2828232 PLUS 5 6 U12357 0 1 1 2 0 0 1 0 0 0 0 0 0 0 Show Contig...-U12357-1 Contig ID Contig-U12357-1 Contig update 2002.12.18 Contig sequence >Contig-U12357-1 (Contig-U12357-1Q) /CSM_Contig/Contig-U12357...ATAAAATAAAATTTATTAATTTTCCAACT Gap gap included Contig length 1333 Chromosome numb...RYXEKKKXXXXDSXNXXXXXPXX XXLXXXXPXX--- ---QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTL...-QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTLYYSINLSYASLNPISKAIFNRGLNIKRTYYPVSNSNDVIY

  16. Dicty_cDB: Contig-U10996-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG

  17. Dicty_cDB: Contig-U12049-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12049-1 gap included 2563 4 3071598 3069091 MINUS 9 17 U12049 0 0 0 0 2 0 0... 1 4 1 1 0 0 0 Show Contig-U12049-1 Contig ID Contig-U12049-1 Contig update 2002.12.18 Contig sequence >Contig-U12049-1 (Contig...-U12049-1Q) /CSM_Contig/Contig-U12049-1Q.Seq.d TAATGAAGGTAGTAATAATAATATAGTTGAAGCATCAAAAGA...TATCATTTAAACTGAAAAAAGTC CAAAAGATTTATGCAATGATTGCTGCGAATATGCTGCAACTTGTTCTCAT TAAAAATAAACAAAAAAATAATA Gap gap included Contig...disngqcvyseiidcgsssienss nqesssdidittastlgstiastigstigltstttttttsqttgtpttppqtvseipisl astistspvsdegtiastiatt

  18. Structure and Lamb shift of 2s1/2-2p3/2 levels in lithiumlike U89+ through neonlike U82+

    International Nuclear Information System (INIS)

    Beiersdorfer, P.; Knapp, D.; Marrs, R.E.; Elliott, S.R.; Chen, M.H.

    1993-01-01

    The first Doppler-shift-free crystal-spectrometer measurement of stationary highly stripped uranium ions from a high-energy electron beam ion trap is presented. Thirteen 2s 1/2- 2p 3/2 transitions in eight ionization states bteween Li-like U 89+ and Ne-like U 82+ are identified and measured with an accuracy as high as 37 ppm, providing benchmarks for testing relativistic correlation and quantum electrodynamic effects in highly charged multielectron ions. A value of 47.39±0.35 eV is found for the 2s 1/2 Lamb shift in Li-like U 89+ , in excellent agreement with theory

  19. Structure and lamb shift of 2s1/2-2p3/2 levels in lithiumlike U89+ through neonlike U82+

    International Nuclear Information System (INIS)

    Beiersdorfer, P.; Knapp, D.; Marrs, R.E.; Elliott, S.; Chen, M.H.

    1993-01-01

    The first Doppler-shift-free crystal- spectrometer measurements from stationary highly stripped uranium ions are presented. Eleven 2s 1/2 -2p 3/2 transitions in eight ionization stages between Li-like U 89+ and Ne-like U 82+ are identified and measured with an accuracy as high as 45 ppm, providing benchmarks for testing relativistic correlation and quantum electrodynamical effects in highly charged multi-electron ions. A value of 47.38 ± 0.35 eV is found for the 2s 1/2 Lamb shift in Li-like U 89+ , in excellent agreement with the theoretical value of 47.58 eV

  20. 19 CFR 12.109 - Seizure and forfeiture.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Seizure and forfeiture. 12.109 Section 12.109 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE... § 12.109 Seizure and forfeiture. (a) Whenever any pre-Columbian monumental or architectural sculpture...

  1. Erythrocyte-bound apolipoprotein B in relation to atherosclerosis, serum lipids and ABO blood group.

    Directory of Open Access Journals (Sweden)

    Boudewijn Klop

    Full Text Available INTRODUCTION: Erythrocytes carry apolipoprotein B on their membrane, but the determining factors of erythrocyte-bound apolipoprotein B (ery-apoB are unknown. We aimed to explore the determinants of ery-apoB to gain more insight into potential mechanisms. METHODS: Subjects with and without CVD were included (N = 398. Ery-apoB was measured on fresh whole blood samples using flow cytometry. Subjects with ery-apoB levels ≤ 0.20 a.u. were considered deficient. Carotid intima media thickness (CIMT was determined as a measure of (subclinical atherosclerosis. RESULTS: Mean ery-apoB value was 23.2% lower in subjects with increased CIMT (0.80 ± 0.09 mm, N = 140 compared to subjects with a normal CIMT (0.57 ± 0.08 mm, N = 258 (P = 0.007, adjusted P<0.001. CIMT and ery-apoB were inversely correlated (Spearman's r: -0.116, P = 0.021. A total of 55 subjects (13.6% were considered ery-apoB deficient, which was associated with a medical history of CVD (OR: 1.86, 95% CI 1.04-3.33; adjusted OR: 1.55; 95% CI 0.85-2.82. Discontinuation of statins in 54 subjects did not influence ery-apoB values despite a 58.4% increase in serum apolipoprotein B. Subjects with blood group O had significantly higher ery-apoB values (1.56 ± 0.94 a.u. when compared to subjects with blood group A (0.89 ± 1.15 a.u, blood group B (0.73 ± 0.1.12 a.u. or blood group AB (0.69 ± 0.69 a.u. (P-ANOVA = 0.002. CONCLUSION: Absence or very low values of ery-apoB are associated with clinical and subclinical atherosclerosis. While serum apolipoprotein B is not associated with ery-apoB, the ABO blood group seems to be a significant determinant.

  2. Study of fragmentation cross-sections for 12C+12C reaction at 95 MeV/u and 400 MeV/u for hadron-therapy

    International Nuclear Information System (INIS)

    Juliani, Didier

    2013-01-01

    The hadron-therapy is a radiotherapy method using ions (carbon ions here) instead of the more conventional X-rays for cancer treatment. Deep radioresistant tumour areas, as brain carcinoma for example, can be treated thanks to the specific dose deposition at the end of the ion path. This is an additional method to older classic ones (surgery, X-rays, chemotherapy). Two hadron-therapy centres for treatment and research are planned in France from 2018 (ARCHADE) in order to benefit from the newest progress and to keep improving this method. Carbon ions energy loss in the matter follows the Bethe-Bloch law. The maximum of energy depth is located in a limited area called 'Bragg peak'. By adjusting the beam position and energy, the whole volume of the tumor can be irradiated. Nevertheless, nuclear reactions of carbon ion in tissues generate the production of lighter fragments (H, He, Li etc.) that deposit their energy beyond the Bragg peak. Models implemented in hadron-therapy simulation codes (FLUKA, GEANT4 etc.) cannot reproduce angular distributions of the lighter fragments and energy distributions at the same time. These poor estimations affect the treatment planning systems accuracy that are clinically used. Indeed, a bad estimation of fragmentation process induces a bias in the dose calculation concerning healthy cells beyond the Bragg peak. In order to better constraint models, two experiments based on fragmentation cross-sections measurements have been performed. The first one in may 2011 with a beam at 95 MeV/u (GANIL) in collaboration with the LPC Caen and the second one in august 2011 with a beam at 400 MeV/u (GSI) with the FIRST collaboration. E600 experiment is devoted to the study of carbon ions fragmentation at 95 MeV/u in several thin targets (Au, C, , Ti etc.) corresponding to the basic building blocks of human body. Five telescopes are designed for the fragments detection. Each one is a three-stage detector (2 silicon detectors and one CsI scintillator

  3. Endomorphisms of the Cuntz algebras and the Thompson groups

    DEFF Research Database (Denmark)

    Barlak, Selcuk; Hong, Jeong Hee; Szymanski, Wojciech

    2017-01-01

    We investigate the relationship between endomorphisms of the Cuntz algebra O_2 and endomorphisms of the Thompson groups F, T and V represented inside the unitary group of O_2. For an endomorphism λ_u of O_2, we show that λ_u(V) is contained in V if and only if uεV. If λ_u is an automorphism of O_2...... then uεV is equivalent to the containment of λ_u(F) in V. Our investigations are facilitated by introduction of the concept of modestly scaling endomorphism of O_n, whose properties and examples are investigated....

  4. 12 CFR 3.1 - Authority.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Authority. 3.1 Section 3.1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY MINIMUM CAPITAL RATIOS; ISSUANCE OF DIRECTIVES Authority and Definitions § 3.1 Authority. This part is issued under the authority of 12 U.S.C. 1 et seq...

  5. Dicty_cDB: Contig-U12399-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL

  6. Dicty_cDB: Contig-U11404-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11404-1 gap included 1618 6 1729583 1727965 MINUS 11 19 U11404 0 6 1 1 0 2 ...0 1 0 0 0 0 0 0 Show Contig-U11404-1 Contig ID Contig-U11404-1 Contig update 2002.12.18 Contig sequence >Contig-U11404-1 (Contig...-U11404-1Q) /CSM_Contig/Contig-U11404-1Q.Seq.d ATTTTAAGAGTTTTAATTTTAATAACTATACTTTTAATAAA...TTTTTCTTTTGAACCAGAAAAAAAAA Gap gap included Contig length 1618 Chromosome number ...AGARMLASLATDKLSNVIYLDVSENDFGDEGVSVICDGFVGNSTIKKLILNGNFKQ SK--- ---YEKITIGLDSVFKDLILEESQAQNEASGATPIPDSPVPTRSP

  7. Dicty_cDB: Contig-U14772-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14772-1 no gap 665 1 1988279 1987624 MINUS 1 1 U14772 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14772-1 Contig ID Contig-U14772-1 Contig update 2002.12.18 Contig sequence >Contig-U14772-1 (Contig...-U14772-1Q) /CSM_Contig/Contig-U14772-1Q.Seq.d AAAAACAATAACCATCGTTTTTTATTTTTATTTTCAAAATATGGATTTAA...AAATTAATGAAGAAAAAA AAGTAANNNNNNNNN Gap no gap Contig length 665 Chromosome number...DADTTISFLSSQNLSQLSIIKNLVNGKTIG DKKVIVDFYDFKKVIPTPTPIPTPTPPTKTQEESNKKIKLTNEKPKEKKP

  8. Dicty_cDB: Contig-U13202-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13202-1 no gap 1083 4 1301578 1302630 PLUS 41 45 U13202 8 0 13 0 0 2 16 0 2 0 0 0 0 0 Show Contig...-U13202-1 Contig ID Contig-U13202-1 Contig update 2002.12.18 Contig sequence >Contig-U13202-1 (Contig...-U13202-1Q) /CSM_Contig/Contig-U13202-1Q.Seq.d ACTGTTGGCCTACTGGGATTTTCTGCAGTAATAATAAAATCAAATA...TTTGTAATTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig len...kvgqfirvprgaqpaqtskftlmih*gvkshffsmlqpnwpncttigpvq nqarcgsllgfwvlqnqlltvlcihnnekcsikfygygyl**nlitvvkvvmpslhg

  9. The Islamic State and U.S. Policy

    Science.gov (United States)

    2017-02-02

    comprised of radicalized indigenous Bedouin Arabs, foreign fighters, and Palestinian militants. On social media , the group has displayed various...this statement, the group has since referred to itself simply as “the Islamic State,” although U.S. government officials, some international media ...interest, including Nigeria, Libya, Egypt, Jordan, Israel, Turkey, Yemen , Saudi Arabia, Somalia, Afghanistan, Pakistan, India, Russia, and Indonesia. U.S

  10. TIGER/Line Shapefile, 2017, nation, U.S., Current Tribal Block Group National

    Data.gov (United States)

    US Census Bureau, Department of Commerce — The TIGER/Line shapefiles and related database files (.dbf) are an extract of selected geographic and cartographic information from the U.S. Census Bureau's Master...

  11. TIGER/Line Shapefile, 2015, nation, U.S., Current Tribal Block Group National

    Data.gov (United States)

    US Census Bureau, Department of Commerce — The TIGER/Line shapefiles and related database files (.dbf) are an extract of selected geographic and cartographic information from the U.S. Census Bureau's Master...

  12. TIGER/Line Shapefile, 2016, nation, U.S., Current Tribal Block Group National

    Data.gov (United States)

    US Census Bureau, Department of Commerce — The TIGER/Line shapefiles and related database files (.dbf) are an extract of selected geographic and cartographic information from the U.S. Census Bureau's Master...

  13. Consistency of histopathological reporting of breast lesions detected by screening: findings of the U.K. National External Quality Assessment (EQA) Scheme. U. K. National Coordinating Group for Breast Screening Pathology.

    Science.gov (United States)

    Sloane, J P; Ellman, R; Anderson, T J; Brown, C L; Coyne, J; Dallimore, N S; Davies, J D; Eakins, D; Ellis, I O; Elston, C W

    1994-01-01

    The aim of the scheme was to determine consistency of histopathological reporting in the United Kingdom National Breast Screening Programme. This external quality assessment scheme involved 51 sets of 12 slides which were circulated to 186-251 pathologists at intervals of 6 months for 3 years. Participants recorded their diagnoses on standard reporting forms, which were submitted to the U.K. National Cancer Screening Evaluation Unit for analysis. A high level of consistency was achieved in diagnosing major categories of breast disease including invasive carcinoma and the important borderline lesions, radial scar and ductal carcinoma in situ (DCIS), the latter exceeding a national target set prior to the onset of the scheme. Atypical hyperplasia (AH) was reported with much less consistency although, where it was the majority opinion, over 86% of diagnoses were of benign disorders and only 14% were of DCIS. Inconsistency was encountered in subtyping and measuring DCIS, the former apparently due to current uncertainties about classification and the latter to poor circumscription, variation in size in different sections and merging with zones of AH. Reporting prognostic features of invasive carcinomas was variable. Measurement of size was achieved with adequate consistency except in a small number of very poorly circumscribed tumours. Grading and subtyping were inconsistent although the latter was not specifically tested and will be the subject of future study. Members of the National Coordinating Group achieved greater uniformity than the remainder of the participants in all diagnostic categories, but both groups experienced similar types of problem. Our findings suggest that participation in the scheme improves diagnostic consistency. In conclusion, consistency in diagnosing invasive carcinoma and radial scar is excellent, and good in DCIS, but improvements are desirable in diagnosing atypical hyperplasia, classifying DCIS and reporting certain prognostic features of

  14. US patriotism and ideologies of group dominance: a tale of asymmetry.

    Science.gov (United States)

    Peña, Yesilernis; Sidanius, Jim

    2002-12-01

    Using a random sample (N = 405) of White and Latino Americans from Los Angeles County, the authors explored whether there is an asymmetrical relationship between U.S. patriotism and two different dimensions of social dominance orientation: group antiegalitarianism and group dominance. Although there was no evidence of asymmetry in the relationship between U.S. patriotism and group antiegalitarianism, there was evidence of consistent asymmetry in the relationship between U.S. patriotism and group dominance. Among Whites (the dominant North American ethnic group) and depending on demographic variables such as age, education, income, and gender, the greater the respondents' tendency to subordinate "inferior groups," the greater their level of U.S. patriotism. In contrast, among Latino Americans (the major subordinate group in Southern California), the opposite trend was found. Here, higher levels of group dominance orientation were associated with lower levels of U.S. patriotism. The theoretical implications of these findings are discussed.

  15. Agresīvu datorspēļu spēlēšana saistībā ar pusaudžu un jauniešu agresiju

    OpenAIRE

    Vītols, Krists

    2012-01-01

    Bakalaura darba mērķis bija noskaidrot, vai pastāv nozīmīgas saistības starp agresīvu datorspēļu spēlēšanu, datorspēļu spēlēšanas biežumu un agresijas izpausmju līmeni pusaudžu un jauniešu vidū. Pētījumā tika aptaujāti 50 Latvijas skolu skolēni, vecumā no 12-16 gadiem. Pētījuma izlases tika viedotas pēc brīvprātības principa, pētījuma aptaujas tika izdalītas skolēnu klasēs. Pētījuma metodē tika izmantotas divas aptaujas: 1. “Datorspēļu aptauja” (Video Game Questionnaire, Anderson & ...

  16. Fragmentation of 400 MeV/u {sup 12}C on a thin graphite target

    Energy Technology Data Exchange (ETDEWEB)

    Schuy, Christoph

    2015-07-01

    Detailed understanding of high energetic heavy ions interacting with matter is of great interest in basic research and applied physics especially in radiotherapy and space radioprotection. Radiotherapy with carbon ions showed great success especially in the treatment of deep seated tumors due to the favorable depth-dose profile and increased biological effectiveness compared to photons or protons. Due to nuclear interactions between the primary beam and the patient's body, usually only 50% of the carbon ions will reach the target location. Thus, a detailed knowledge of the changes in the radiation field is required for delivering a successful treatment. The radiation environment in space is composed of high energy charged particles and can lead to serious health risks for astronauts. The assessment and mitigation of radioinduced health complications cannot be accomplished without a good understanding of the interaction of the mixed radiation field with e.g. the hull of the spaceship or lunar soil. In this work the fragmentation of 400 MeV/u {sup 12}C on a thin graphite target was investigated. The resulting angular yield distributions and differential energy spectra of charged and uncharged particles are presented and compared to two different Monte Carlo codes (PHITS and GEANT4).

  17. Drinking, Alcohol Use Disorder, and Treatment Access and Utilization Among U.S. Racial/Ethnic Groups.

    Science.gov (United States)

    Vaeth, Patrice A C; Wang-Schweig, Meme; Caetano, Raul

    2017-01-01

    Data from approximately 140 articles and reports published since 2000 on drinking, alcohol use disorder (AUD), correlates of drinking and AUD, and treatment needs, access, and utilization were critically examined and summarized. Epidemiological evidence demonstrates alcohol-related disparities across U.S. racial/ethnic groups. American Indians/Alaska Natives generally drink more and are disproportionately affected by alcohol problems, having some of the highest rates for AUD. In contrast, Asian Americans are less affected. Differences across Whites, Blacks, and Hispanics are more nuanced. The diversity in drinking and problem rates that is observed across groups also exists within groups, particularly among Hispanics, Asian Americans, and American Indians/Alaska Natives. Research findings also suggest that acculturation to the United States and nativity affect drinking. Recent studies on ethnic drinking cultures uncover the possible influence that native countries' cultural norms around consumption still have on immigrants' alcohol use. The reasons for racial/ethnic disparities in drinking and AUD are complex and are associated with historically rooted patterns of racial discrimination and persistent socioeconomic disadvantage. This disadvantage is present at both individual and environmental levels. Finally, these data indicate that admission to alcohol treatment is also complex and is dependent on the presence and severity of alcohol problems but also on a variety of other factors. These include individuals' sociodemographic characteristics, the availability of appropriate services, factors that may trigger coercion into treatment by family, friends, employers, and the legal system, and the overall organization of the treatment system. More research is needed to understand facilitators and barriers to treatment to improve access to services and support. Additional directions for future research are discussed. Copyright © 2016 by the Research Society on

  18. The Weyl group of the Cuntz algebra

    DEFF Research Database (Denmark)

    Conti, Roberto; Hong, Jeong Hee; Szymanski, Wojciech

    2012-01-01

    The Weyl group of the Cuntz algebra O_n is investigated. This is (isomorphic to) the group of polynomial automorphisms lambda_u of O_n, namely those induced by unitaries u that can be written as finite sums of words in the canonical generating isometries S_i and their adjoints. A necessary...

  19. A Higgs at 125.1 GeV and baryon mass spectra derived from a Common U(3) Lie group framework

    DEFF Research Database (Denmark)

    Trinhammer, Ole; Bohr, Henrik; Jensen, Mogens O Stibius

    2015-01-01

    Baryons are described by a Hamiltonian on an intrinsic U(3) Lie group configuration space with electroweak degrees of freedom originating in specific Bloch wave factors. By opening the Bloch degrees of freedom pairwise via a U(2) Higgs mechanism, the strong and electroweak energy scales become...... related to yield the Higgs mass 125.085+/-0.017 GeV and the usual gauge boson masses. From the same Hamiltonian we derive both the relative neutron to proton mass ratio and the N and Delta mass spectra. All compare rather well with the experimental values. We predict neutral flavour baryon singlets...... to be sought for in negative pions scattering on protons or in photoproduction on neutrons and in invariant mass like Σ+c(2455)D- from various decays above the open charm threshold, e.g. at 4499, 4652 and 4723 MeV. The fundamental predictions are based on just one length scale and the fine structure coupling...

  20. Dielectron production in 12C+12C collisions at 1 GeV per nucleon

    International Nuclear Information System (INIS)

    Pachmayer, Yvonne C.

    2008-01-01

    This thesis contains the experimental results on dielectron production in 12 C+ 12 C collisions at 1 GeV/u recorded with HADES. Within this work, the analysis is demonstrated, showing that leptons are efficiently reconstructed and hadrons very well discriminated. The described pair analysis shows that the combinatorial background is successfully reduced and the amount of true electron-positron pairs is not decreased. After subtracting the combinatorial background, the efficiency-corrected and normalized invariant-mass, transverse momentum and rapidity distributions of the dileptons are investigated. In the invariant-mass region 0.2-0.6 GeV/c 2 the measured pair yield shows a strong excess above the contribution expected from hadron decays after freeze-out according to predictions. Together with the results obtained in 12 C+ 12 C at 2 GeV/u it becomes evident that the overshoot of the data increases with decreasing beam energy. A detailed analysis shows that the beam energy dependence of the excess yield, i.e. the pair yield above the known eta contribution, integrated over the 0.15-0.5 GeV/c 2 mass range, scales like pion production. (orig.)

  1. Useful to Usable (U2U): Transforming climate information into usable tools to support Midwestern agricultural production

    Science.gov (United States)

    Prokopy, L. S.; Widhalm, M.

    2014-12-01

    There is a close connection between weather and climate patterns and successful agricultural production. Therefore, incorporating climate information into farm management is likely to reduce the risk of economic losses and increase profitability. While weather and climate information is becoming ever more abundant and accessible, the use of such information in the agricultural community remains limited. Useful to Usable (U2U): Transforming Climate Variability and Change Information for Cereal Crop Producers is a USDA-NIFA funded research and extension project focused on improving the use of climate information for agricultural production in the Midwestern United States by developing user-driven decision tools and training resources. The U2U team is a diverse and uniquely qualified group of climatologists, crop modelers, agronomists, and social scientists from 9 Midwestern universities and two NOAA Regional Climate Centers. Together, we strive to help producers make better long-term plans on what, when and where to plant and also how to manage crops for maximum yields and minimum environmental damage. To ensure relevance and usability of U2U products, our social science team is using a number of techniques including surveys and focus groups to integrate stakeholder interests, needs, and concerns into all aspects of U2U research. It is through this coupling of physical and social science disciplines that we strive to transform existing climate information into actionable knowledge.

  2. The State of Wiki Usage in U.S. K-12 Schools: Leveraging Web 2.0 Data Warehouses to Assess Quality and Equity in Online Learning Environments

    Science.gov (United States)

    Reich, Justin; Murnane, Richard; Willett, John

    2012-01-01

    To document wiki usage in U.S. K-12 settings, this study examined a representative sample drawn from a population of nearly 180,000 wikis. The authors measured the opportunities wikis provide for students to develop 21st-century skills such as expert thinking, complex communication, and new media literacy. The authors found four types of wiki…

  3. Dicty_cDB: Contig-U13326-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13326-1 no gap 240 6 1728259 1728019 MINUS 1 1 U13326 0 0 0 0 0 1 0 0 0 0 0 0 0 0 Show Contig...-U13326-1 Contig ID Contig-U13326-1 Contig update 2002.12.18 Contig sequence >Contig-U13326-1 (Contig...-U13326-1Q) /CSM_Contig/Contig-U13326-1Q.Seq.d AATGACTCAACAAATCTTGGAGAGTATGCAAAATACTTTCCAATCTATGG...CCTCGTTAAAGGTGCTGGTGC TGAATTAAGTTCTCGTGCTCATGAGTGTTTCATTAGTGCCTTGGATATTG CCTCTGATTATACCTACGAGAAAATTACCATTGGCTTGGA Gap no gap Contig...FQSMDGPTIKRLATTIQYGSKDVDEQQIHSTLVKGAGAELSSRAHECF ISALDIASDYTYEKITIGL Translated Amino Acid sequence (All Fra

  4. Dicty_cDB: Contig-U13455-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13455-1 no gap 750 2 945431 946181 PLUS 2 2 U13455 0 0 0 0 0 0 1 0 0 1 0 0 0 0 Show Contig...-U13455-1 Contig ID Contig-U13455-1 Contig update 2002.12.18 Contig sequence >Contig-U13455-1 (Contig...-U13455-1Q) /CSM_Contig/Contig-U13455-1Q.Seq.d TAATTCCAACAACATCAACAAATTCAACAACAATTACAAATGCAACAACA TA...CAATAATAATAATAATAACAATAACAATAATAATAA Gap no gap Contig length 750 Chromosome number (1..6, M) 2 Chromosome l...KMLEYIQKNPSATRPSCIQVVQQPSSKVVWKNRRLDTPFKVKVDLKAASAMA GTNLTTASVITIGIVTDHKGKLQIDSVENFTEAFNGQGLAVFQGLKMTKGTWGKE

  5. Dicty_cDB: Contig-U14400-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14400-1 no gap 1939 4 4053811 4055750 PLUS 5 7 U14400 0 0 2 0 0 1 0 0 1 1 0 0 0 0 Show Contig...-U14400-1 Contig ID Contig-U14400-1 Contig update 2002.12.18 Contig sequence >Contig-U14400-1 (Contig...-U14400-1Q) /CSM_Contig/Contig-U14400-1Q.Seq.d CATTACCAATAAATTTATCTGCTTCAACACCTATACCAATGACATCACCA...AGGTTTATAAAATATATTGAATCAATTTTTGATTAAA Gap no gap Contig length 1939 Chromosome number (1..6, M) 4 Chromosome...HQQQQSKTVTSSTTSTETTTTVESSTTSTTITTSTSTPIPTTITTTPTTPI NSDNSWTFTSFSPKVFKEIRRYYGVDEEFLKSQENSSGIVKFLEVQTIGRSGSFFY

  6. Dicty_cDB: Contig-U10709-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT

  7. Dicty_cDB: Contig-U10837-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI

  8. Dicty_cDB: Contig-U12765-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA

  9. Dicty_cDB: Contig-U14236-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14236-1 no gap 660 2 5626866 5627517 PLUS 1 1 U14236 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U14236-1 Contig ID Contig-U14236-1 Contig update 2002.12.18 Contig sequence >Contig-U14236-1 (Contig...-U14236-1Q) /CSM_Contig/Contig-U14236-1Q.Seq.d NNNNNNNNNNGAAAATCAAAAATTAAAAAGTAACATTACTCTATTATATG ...CAATCACTCCAATTAAA CCATAGTTTT Gap no gap Contig length 660 Chromosome number (1..6...MGSEKSPFNLKQYPSLVKIDDVS QCPKYKCLKRKSLNEWTIGLNIPAFCRESRYDCSLCYKYIECSFSDEF*tnlsalfv

  10. 12 CFR 345.23 - Investment test.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Investment test. 345.23 Section 345.23 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY... minority depository institution or women's depository institution (as these terms are defined in 12 U.S.C...

  11. 12 CFR 24.1 - Authority, purpose, and OMB control number.

    Science.gov (United States)

    2010-01-01

    ... the Currency (OCC) issues this part pursuant to its authority under 12 U.S.C. 24(Eleventh), 93a, and 481. (b) Purpose. This part implements 12 U.S.C. 24 (Eleventh). It is the OCC's policy to encourage a....1 Section 24.1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY COMMUNITY...

  12. Dicty_cDB: Contig-U13065-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13065-1 no gap 718 1 3561021 3561729 PLUS 1 1 U13065 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U13065-1 Contig ID Contig-U13065-1 Contig update 2002.12.18 Contig sequence >Contig-U13065-1 (Contig...-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d NNNNNNNNNNCAATCAAAGCAATCAATGGTAAATTAACTTTGTTACCATT ...TGATTCAACTCTCTCTG TTTCAAATTTACAACTTGCTTTAGATGAATCCTTTGAAGTTGATTTTGTA TTATATTAAAAATTATCA Gap no gap Contig...kny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig

  13. Dicty_cDB: Contig-U14745-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14745-1 no gap 1780 6 3063854 3065579 PLUS 2 4 U14745 1 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14745-1 Contig ID Contig-U14745-1 Contig update 2002.12.18 Contig sequence >Contig-U14745-1 (Contig...-U14745-1Q) /CSM_Contig/Contig-U14745-1Q.Seq.d GCGTCCGGACAATTTCAATAAAACAAATTTAAAAATAAATAATTTTTAAT...AATAAAATA ATTTAAATAAAAAAATATTTATTTTATTTTAAGATTAACAAAATAAAATA ATTTAAATAAAAAAATATTTATTTTAAAGA Gap no gap Contig...k*kniyfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14745-1 (Contig-U14745-1Q) /CSM_Contig/Contig

  14. Dicty_cDB: Contig-U13737-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13737-1 no gap 672 6 1762420 1761754 MINUS 1 1 U13737 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13737-1 Contig ID Contig-U13737-1 Contig update 2002.12.18 Contig sequence >Contig-U13737-1 (Contig...-U13737-1Q) /CSM_Contig/Contig-U13737-1Q.Seq.d NNNNNNNNNNAAAATTAGAAAATGGTACAATTGTTTTTAGAGATATTTCA...AGAATAGAAGGAAAATAT AGATCAATGGGGTGGCACAACA Gap no gap Contig length 672 Chromosome...gwhn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13737-1 (Contig-U13737-1Q) /CSM_Contig/Contig

  15. A Life-Cycle Model of Human Social Groups Produces a U-Shaped Distribution in Group Size.

    Directory of Open Access Journals (Sweden)

    Gul Deniz Salali

    Full Text Available One of the central puzzles in the study of sociocultural evolution is how and why transitions from small-scale human groups to large-scale, hierarchically more complex ones occurred. Here we develop a spatially explicit agent-based model as a first step towards understanding the ecological dynamics of small and large-scale human groups. By analogy with the interactions between single-celled and multicellular organisms, we build a theory of group lifecycles as an emergent property of single cell demographic and expansion behaviours. We find that once the transition from small-scale to large-scale groups occurs, a few large-scale groups continue expanding while small-scale groups gradually become scarcer, and large-scale groups become larger in size and fewer in number over time. Demographic and expansion behaviours of groups are largely influenced by the distribution and availability of resources. Our results conform to a pattern of human political change in which religions and nation states come to be represented by a few large units and many smaller ones. Future enhancements of the model should include decision-making rules and probabilities of fragmentation for large-scale societies. We suggest that the synthesis of population ecology and social evolution will generate increasingly plausible models of human group dynamics.

  16. 12 CFR 31.1 - Authority.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Authority. 31.1 Section 31.1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY EXTENSIONS OF CREDIT TO INSIDERS AND TRANSACTIONS WITH AFFILIATES § 31.1 Authority. This part is issued by the Comptroller of the Currency pursuant to 12 U.S.C. 93a...

  17. Operational, professional, and business characteristics of radiology groups in the United States.

    Science.gov (United States)

    Sunshine, J H; Bansal, S

    1992-05-01

    To learn the main operational, professional, and business characteristics of U.S. radiology group practices, researchers at the American College of Radiology surveyed these groups. Major findings included the following: Approximately 30% of groups provide only diagnostic radiologic services, a similar percentage provides only radiation therapy for oncologic patients, and the remainder provides both types of services. Forty-one percent of groups practice only in hospitals, 11% practice only in an office, and 48% practice in both settings. Diagnostic-only practices average 10,000-12,000 procedures per full-time equivalent radiologist per year. Groups typically require new members to be part of the group for almost 3 years before they become full partners. Formal call schedules are nearly universal among radiology groups. Groups are becoming increasingly involved with health maintenance organizations and other "alternative delivery systems," but fee-for-service remains by far the dominant source of groups' revenue. Most studied characteristics of groups are changing relatively slowly, and trends are generally toward increasing formalization of arrangements.

  18. Formation of the U.S. Air Force Aviator Post Traumatic Stress Disorder Study Group

    Science.gov (United States)

    2016-11-15

    Wood, III, John Heaton, Mark Hubner, Nicole Rhodes 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION... Questionnaire -9 PIQ performance intelligence quotient PTSD post-traumatic stress disorder RPA remotely piloted aircraft USAF U.S. Air Force VIQ verbal intelligence quotient ...Human Performance Wing U.S. Air Force School of Aerospace Medicine Aerospace Medicine Department 2510 Fifth St., Bldg. 840 Wright-Patterson AFB, OH

  19. U.S. Department of Energy Hydrogen and Fuel Cells Program 2015 Annual Merit Review and Peer Evaluation Report: June 8-12, 2015, Arlington, Virginia

    Energy Technology Data Exchange (ETDEWEB)

    Popovich, Neil

    2015-10-01

    The fiscal year 2015 U.S. Department of Energy (DOE) Hydrogen and Fuel Cells Program Annual Merit Review and Peer Evaluation Meeting (AMR), in conjunction with DOE's Vehicle Technologies Office AMR, was held from June 8-12, 2015, in Arlington, Virginia. This report is a summary of comments by AMR peer reviewers about the hydrogen and fuel cell projects funded by DOE's Office of Energy Efficiency and Renewable Energy.

  20. 28 CFR 80.12 - Accounting requirements.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Accounting requirements. 80.12 Section 80... PROCEDURE § 80.12 Accounting requirements. Neither the submission of a request for an FCPA Opinion, its... comply with the accounting requirements of 15 U.S.C. 78m(b)(2) and (3). ...

  1. 12 CFR 561.19 - Financial institution.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Financial institution. 561.19 Section 561.19... AFFECTING ALL SAVINGS ASSOCIATIONS § 561.19 Financial institution. The term financial institution has the same meaning as the term depository institution set forth in 12 U.S.C. 1813(c)(1). ...

  2. Dicty_cDB: Contig-U13254-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13254-1 no gap 575 5 203798 203233 MINUS 1 1 U13254 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U13254-1 Contig ID Contig-U13254-1 Contig update 2002.12.18 Contig sequence >Contig-U13254-1 (Contig...-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d AAATAATTTATTTAATTTTAAAATTAATAGATAAAAAGATGGAAATGATA A...CATTTTAACATTATTGGATAAT GTCAATGATTGGCCAANNNNNNNNN Gap no gap Contig length 575 Chromosome number (1..6, M) 5 ...2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13254-1 (Contig-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d

  3. Dicty_cDB: Contig-U13891-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13891-1 no gap 1355 6 799802 798446 MINUS 4 4 U13891 0 0 0 0 1 1 1 0 0 0 1 0 0 0 Show Contig...-U13891-1 Contig ID Contig-U13891-1 Contig update 2002.12.18 Contig sequence >Contig-U13891-1 (Contig...-U13891-1Q) /CSM_Contig/Contig-U13891-1Q.Seq.d TTTTAAAATATTTCAAAATTAGCGAGCACGCATTCGCATATAAATATATT ...ACAAATAAAAAAAAAAAATAAAAAAAATA ATTTA Gap no gap Contig length 1355 Chromosome numb...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13891-1 (Contig-U13891-1Q) /CSM_Contig/Contig-U138

  4. Dicty_cDB: Contig-U12545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

  5. Dicty_cDB: Contig-U10823-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10823-1 gap included 1750 1 3559501 3561234 PLUS 85 124 U10823 0 5 0 30 1 0... 0 20 0 29 0 0 0 0 Show Contig-U10823-1 Contig ID Contig-U10823-1 Contig update 2002.12.18 Contig sequence >Contig-U10823-1 (Contig...-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d ACTGTTGGCCTACTGGTATTTTTGGTAGTGTGTTAAAA...CAACAAATAAAATTAAAATTA GTTATATTTTTTTTAAATTAAAAAAAAAAATAAAAAAAATAAATTATTTA TTAAATTTTT Gap gap included Contig ...4. 6.10 Homology vs CSM-cDNA Query= Contig-U10823-1 (Contig-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d (1

  6. Dicty_cDB: Contig-U15828-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15828-1 gap included 1593 1 4184040 4182448 MINUS 12 19 U15828 0 0 6 0 0 0 ...0 0 2 0 4 0 0 0 Show Contig-U15828-1 Contig ID Contig-U15828-1 Contig update 2004. 6.11 Contig sequence >Contig-U15828-1 (Contig...-U15828-1Q) /CSM_Contig/Contig-U15828-1Q.Seq.d ATAAAAAAAATTAAAAAATTAAAAAAGTTATCCACCCAAGT...ACA AATATTATAACTGGTACTGCTACTGTTTCAATCCCTCAAAAAAATTTAAT TTATATTTTACCAAATTCAAATACAATTAATCAATCAACAATTACAATTA CAA Gap gap included Contig...SFNPANSDFSFSYNINTTITQPTQIYLNQDIYYPNGFTTNIITGTATVSIPQ KNLIYILPNSNTINQSTITIT own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig

  7. Dicty_cDB: Contig-U11883-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11883-1 gap included 599 2 1457179 1457762 PLUS 1 2 U11883 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U11883-1 Contig ID Contig-U11883-1 Contig update 2002.12.18 Contig sequence >Contig-U11883-1 (Contig...-U11883-1Q) /CSM_Contig/Contig-U11883-1Q.Seq.d TACAAAATTTATATATATATATAATATTTTTAAATAATTATATTT...ATTTAGATGTATTTGGTATTCAAACATTA ACCGAACAACAAGCCTCTACAAAATTATTAACTTTTGTCATTTCAAAATC AGGTGAAAA Gap gap included Contig...ffkixn*kikkgfhvkxksflwfkxxx--- ---xxxx******************yprkyiniti*rn*kdil*ii*rne*rergtksc* nifs*kestpl*fnsxfktniilfstvfnttnvstig

  8. Dicty_cDB: Contig-U13680-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13680-1 no gap 822 5 2371965 2372786 PLUS 2 2 U13680 0 2 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13680-1 Contig ID Contig-U13680-1 Contig update 2002.12.18 Contig sequence >Contig-U13680-1 (Contig...-U13680-1Q) /CSM_Contig/Contig-U13680-1Q.Seq.d AAAAAGATTCTCAAGGAATTCACCGTGTTTATACTTCTTATGGTAGAACT ...GGGAATCAATGATTTAAATATCTACCAAATTCAAAAGG AAGGTGATGTCGAGTCACATTCATTACAATCACCATCGAAATTATTATTT CATGGTTCAAGAGCATCGAATT Gap no gap Contig...**sirtinkdig*kslc*snhsidk*ffsynh*twy*ntigclingt s*kw*tcfeknqylfewynqsiisrvgeikfrifhnyst*tw*rfrcclkeyh*kfgsie

  9. Dicty_cDB: Contig-U12043-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12043-1 gap included 1898 6 2694437 2692539 MINUS 7 13 U12043 0 6 0 0 0 0 0... 1 0 0 0 0 0 0 Show Contig-U12043-1 Contig ID Contig-U12043-1 Contig update 2002.12.18 Contig sequence >Contig-U12043-1 (Contig...-U12043-1Q) /CSM_Contig/Contig-U12043-1Q.Seq.d GAAACCATTCGTTTAAAGAAATGAAATATTTATATATATTAA...ATAAA AATAAATT Gap gap included Contig length 1898 Chromosome number (1..6, M) 6 Chromosome length 3595308 S...VPDIVSGILASKYASITLLNSGEM DLTNGITIGLLENSTSDQLFQINPILNTSLTNILVGQRFSIPFEISIKDSTISNQL

  10. Efficacy of 3,4,3-LI(1,2-HOPO) for decorporation of Pu,Am and U from rats injected intramuscularly with high-fired particles of MOX

    International Nuclear Information System (INIS)

    Paquet, F.; Chazel, V.; Houpert, P.; Guilmette, R.; Muggenburg, B.

    2003-01-01

    This study aimed to assess the efficacy of 3,4,3-LI(1,2-HOPO) for reducing uranium, plutonium and americium in rats after intramuscular injection of (U-Pu)O 2 particles (MOX). Sixteen rats were contaminated by intramuscular injection of a 1 mg MOX suspension and then treated daily for 7 d with LIHOPO (30 or 200 μmol kg -1 ) or DTPA (30 μmol kg -1 ). LIHOPO was inefficient for removing Pu, Am and U from the wound site. However, it reduced Pu retention in carcass and liver by factors of 2 and 6 respectively, and Am retention in carcass and liver by factors of 10 and 30. In contrast, the effect of LIHOPO on U was to decrease the retention in kidneys by a factor of 75. These results confirm that LIHOPO is a good candidate for use after contamination with MOX, in combination with localised wound lavage or surgical treatment aimed at removing most of the contaminant at the wound site. (author)

  11. Eclipses of cataclysmic variables. II. U Geminorum

    International Nuclear Information System (INIS)

    Zhang, E.H.; Robinson, E.L.

    1987-01-01

    U Gem is an eclipsing dwarf nova with an orbital period of 4 h 15 m. High-speed, multicolor photometric observations of U Gem in its quiescent state were obtained. A program was used that synthesizes the light curves of cataclysmic variables to derive the properties of U Gem from its eclipses. Using radial velocity curves published by Wade (1981) and by Stover (1981), it was found that i = 69.7 + or - 0.7 deg, M1 = 1.12 + or - 0.13 solar masses, and M2 = 0.53 + or - 0.06 solar mass. The radial temperature distribution across the accretion disk in U Gem shows that the disk is a hollow ring around the white dwarf with R(out) = 0.30 + or - 0.04 and R(in) = 0.12 + or - 0.05 a, where a is the separation of the two stars. The temperature of the ring is 4800 + or - 300 K. The model also reproduces the published infrared light curves and ultraviolet spectral distributions of U Gem. A mass transfer rate of 7.8 x 10 to the -10th solar mass/yr is derived. The structure of the ring around the white dwarf is consistent with the current theories of accretion disk instabilities in dwarf novae. 39 references

  12. Smile characterization by U.S. white, U.S. Asian Indian, and Indian populations.

    Science.gov (United States)

    Sharma, Neeru; Rosenstiel, Stephen F; Fields, Henry W; Beck, F Mike

    2012-05-01

    With growing demand for high esthetic standards, dentists must understand patient perception and incorporate their preferences into treatment. However, little is known about how cultural and ethnic differences influence esthetic perception. The purpose of this study was to determine whether differences in ethnic background, including the possibility of assimilation, affected a layperson's perception of esthetic and smile characteristics. A survey was developed containing images that were digitally manipulated into a series of barely perceptible steps, changing 1 smile parameter to form a strip of images that displayed that parameter over a wide range. Data were collected with a customized program which randomly displayed a single image and allowed the subject to use the mouse to adjust an on-screen slider according to displayed instructions, that is, "Please move the slider to select the image you find to be most ideal"; or "Please move the slider to select the first image that you find unattractive." A convenience sample (n=288) comprised of U.S. whites, U.S. Asian Indians, and Indians living in India was surveyed. This sample provided a power of .86 to detect a difference of ±1.5 mm. Subjects evaluated images showing the smile arc, buccal corridor, gingival display, vertical overlap, lateral incisal step, maxillary midline to midface, and maxillary to mandibular midline. Rater reliability was assessed with the Fleiss-Cohen weighted Kappa (Kw) statistic and corresponding 95% confidence interval after each question was repeated in a random sequence. Choice differences due to ethnicity were assessed with a multiple randomization test and the adjusted P value with the step-down Bonferrroni method of Holm (α=.05). The Kw for the 17 variables in all 3 groups ranged from 0.11 for ideal vertical overlap to 0.64 for ideal buccal corridor space. Overall reliability was fair to moderate. Differences attributed to ethnicity were demonstrated between the Asian Indians and U

  13. Physics Implications of Flat Directions in Free Fermionic Superstring Models; 2, Renormalization Group Analysis

    CERN Document Server

    Cleaver, G.; Espinosa, J.R.; Everett, L.L.; Langacker, P.; Wang, J.

    1999-01-01

    We continue the investigation of the physics implications of a class of flat directions for a prototype quasi-realistic free fermionic string model (CHL5), building upon the results of the previous paper in which the complete mass spectrum and effective trilinear couplings of the observable sector were calculated to all orders in the superpotential. We introduce soft supersymmetry breaking mass parameters into the model, and investigate the gauge symmetry breaking patterns and the renormalization group analysis for two representative flat directions, which leave an additional $U(1)'$ as well as the SM gauge group unbroken at the string scale. We study symmetry breaking patterns that lead to a phenomenologically acceptable $Z-Z'$ hierarchy, $M_{Z^{'}} \\sim {\\cal O}(1~{\\rm TeV})$ and $ 10^{12}~{\\rm GeV}$ for electroweak and intermediate scale $U(1)^{'}$ symmetry breaking, respectively, and the associated mass spectra after electroweak symmetry breaking. The fermion mass spectrum exhibits unrealistic features, i...

  14. Y-12 Groundwater Protection Program Monitoring Optimization Plan for Groundwater Monitoring Wells at the U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    None

    2003-09-30

    This document is the monitoring optimization plan for groundwater monitoring wells associated with the U.S. Department of Energy (DOE) Y-12 National Security Complex (Y-12) in Oak Ridge, Tennessee (Figure 1). The plan describes the technical approach that will be implemented under the Y-12 Groundwater Protection Program (GWPP) to focus available resources on the monitoring wells at Y-12 which provide the most useful hydrologic and water-quality monitoring data. The technical approach is based on the GWPP status designation for each well (Section 2.0). Under this approach, wells granted ''active'' status are used by the GWPP for hydrologic monitoring and/or groundwater sampling (Section 3.0), whereas well granted ''inactive'' status are not used for either purpose. The status designation also determines the frequency at which the GWPP will inspect applicable wells, the scope of these well inspections, and extent of any maintenance actions initiated by the GWPP (Section 4.0). Details regarding the ancillary activities associated with implementation of this plan (e.g., well inspection) are deferred to the referenced GWPP plans and procedures (Section 5.0). This plan applies to groundwater monitoring wells associated with Y-12 and related waste management facilities located within three hydrogeologic regimes (Figure 1): the Bear Creek Hydrogeologic Regime (Bear Creek Regime), the Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime), and the Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime). The Bear Creek Regime encompasses a section of Bear Creek Valley (BCV) immediately west of Y-12. The East Fork Regime encompasses most of the Y-12 process, operations, and support facilities in BCV and, for the purposes of this plan, includes a section of Union Valley east of the DOE Oak Ridge Reservation (ORR) boundary along Scarboro Road. The Chestnut Ridge Regime is directly south of Y-12 and encompasses a section of Chestnut Ridge that is bound to the

  15. The SHRIMP zircon U-Pb dating of felsic volcanic rocks and its geological significance from yutian group in southern jiangxi

    International Nuclear Information System (INIS)

    Ji Chunyu; Wu Jianhua

    2010-01-01

    Past researches have showed that the Rb-Sr isochron ages of felsic end member for r hyolite-basalt b imodal volcanic rocks of Yutian Group in the Changpu and Longnan Basin in Southern Jiangxi Province are 175 ∼ 148 Ma, not only does its amplitude change more significantly, but it does not match with the Rb-Sr isochron ages (179 ∼ 173 Ma) of basic end member. As a result, I choose a method of zircon U-Pb dating with a higher accuracy, to obtain the rhyolite in the bottom of bimodal volcanic rocks in the Changpu Basin and the dacite in the top of of bimodal volcanic rocks in the Longnan Basin, whose zircon SHIRMP U-Pb age are respectively (195.2 ± 2.8) Ma and (191 ± 1.7) Ma. What's more, they are both almost the same in the error limit. It shows that the bimodal volcanic rocks in these both two basins are the product of the same session of magma movement. Simultaneously, it explains they form in a flash during the eruption intervals. According to the the newest International Stratigraphic Chart (Gradsrein et al. , 2004), in terms of geological age, the bimodal volcanic rocks in Changpu Basin and Longnan Basin, belonging to the early Early Jurassic. The zircon SHIRMP U-Pb age are distinctly older than the whole-rock Rb-Sr isochron age, it is probably because of the deviation of the dating method for the wholerock Rb-Sr isochron age. The zircon SHIRMP U-Pb age of bimodal volcanic rocks are 191 ∼ 195 Ma in Southern Jiangxi Province, which indicates that there had been an extensional environment. And after the bimodal volcanic activity, The zircon SHIRMP U-Pb age of felsic volcanic rocks are 145 ∼ 130 Ma. Both of the ages shows a as long as 45 Ma quiet period between 190 Ma and 145 Ma. It is unreasonable possible to interpreted by the single pattern of pacific plate subducting to eurasian plate. (authors)

  16. Corrective Action Investigation Plan for Corrective Action Unit 551: Area 12 Muckpiles, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    Boehlecke, Robert F.

    2004-01-01

    This Corrective Action Investigation Plan (CAIP) contains project-specific information including facility descriptions, environmental sample collection objectives, and criteria for conducting site investigation activities at Corrective Action Unit (CAU) 551, Area 12 muckpiles, Nevada Test Site (NTS), Nevada. This CAIP has been developed in accordance with the 'Federal Facility Agreement and Consent Order' (FFACO) (1996) that was agreed to by the State of Nevada, the U.S. Department of Energy (DOE), and the U.S. Department of Defense. Corrective Action Unit 551 is located in Area 12 of the NTS, which is approximately 110 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1). Area 12 is approximately 40 miles beyond the main gate to the NTS. Corrective Action Unit 551 is comprised of the four Corrective Action Sites (CASs) shown on Figure 1-1 and listed below: (1) 12-01-09, Aboveground Storage Tank and Stain; (2) 12-06-05, Muckpile; (3) 12-06-07, Muckpile; and (4) 12-06-08, Muckpile. Corrective Action Site 12-01-09 is located in Area 12 and consists of an above ground storage tank (AST) and associated stain. Corrective Action Site 12-06-05 is located in Area 12 and consists of a muckpile associated with the U12 B-Tunnel. Corrective Action Site 12-06-07 is located in Area 12 and consists of a muckpile associated with the U12 C-, D-, and F-Tunnels. Corrective Action Site 12-06-08 is located in Area 12 and consists of a muckpile associated with the U12 B-Tunnel. In keeping with common convention, the U12B-, C-, D-, and F-Tunnels will be referred to as the B-, C-, D-, and F-Tunnels. The corrective action investigation (CAI) will include field inspections, radiological surveys, and sampling of media, where appropriate. Data will also be obtained to support waste management decisions

  17. 19 CFR 12.99 - Procedures for permitted entry.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Procedures for permitted entry. 12.99 Section 12.99 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Switchblade Knives § 12.99 Procedures for permitted entry...

  18. Double-strand break induction and DNA damage response after {sup 12}C ion and photon radiation in U87 glioblastoma cells; Doppelstrangbruch-Induktion und DNA-Schadensantwort nach {sup 12}C-Ionen- und Photonenstrahlung in U87 Glioblastomzellen

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Perez, Ramon

    2015-04-22

    Heavy ion radiation has greater biological effectiveness than the same physical dose of photon radiation. In this work the underlying reasons in the DNA damage response were analyzed in U87 glioblastoma cells. DNA double-strand breaks (DSBs) are the decicive lesions for the effectiveness of ionizing radiation. Their induction and repair was measured in the context of the cell cycle based on the DSB marker γH2AX (the phosphorylated form of the histone variant H2AX). Further, radiation-specific differences in choice of the DSB repair pathway was analyzed, as well as the consequences of repair failure. The results showed that in contrast to photons, {sup 12}C ion radiation produces more severe DSBs that are repaired delayed and with slower kinetics. Accordingly, stronger and longer lasting cell cycle delays, predominantly at the G2/M border, and a higher rate of apoptosis was detected for {sup 12}C ion radiation. Autophagy, an alternative mechanism of programmed cell death, was not relevant for neither of the two types of radiation. The effect of {sup 12}C ion radiation was less dependent on the cell cycle stage than for photon radiation. This became particularly evident in the DSB repair velocities during S- and G2-phase. After {sup 12}C ion radiation, cells were more dependent on homologous recombination repair (HRR) compared to photon radiation. The reason therefore that in contrast to photons, {sup 12}C ion radiation induced graver DSBs that were repaired slower and more dependent on HRR, was most probably enhanced clustering of DSBs due to the higher ionization density of {sup 12}C ion radiation. Microscopic inspection of immunofluorently stained γH2AX revealed that {sup 12}C ion radiation induced bigger DSB repair foci containing more γH2AX molecules (higher fluorescence intensity), although their initial number was smaller. Besides the foci, a weaker pan-nuclear γH2AX staining was observed that increased in a dose-dependent manner and was more pronounced

  19. 12 CFR 944.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... chapter. CRA means the Community Reinvestment Act of 1977, as amended (12 U.S.C. 2901, et seq.). CRA evaluation means the public disclosure portion of the CRA performance evaluation provided by a member's...

  20. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2013. Scientific Opinion on Flavouring Group Evaluation 12, Revision 4 (FGE.12Rev4): primary saturated or unsaturated alicyclic alcohols, aldehydes, acids and esters from chemical groups 1 and 7

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Frandsen, Henrik Lauritz

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate 12 flavouring substances in Flavouring Group Evaluation 12, Revision 4 (FGE.12Rev4), including two additional substances, using the Procedure in Commission...... (the Procedure) that integrates information on structure–activity relationships, intake from current uses and the toxicological threshold of concern and available data on metabolism and toxicity. The Panel concluded that none of the 12 substances [FL-nos: 02.134, 02.186, 02.216, 02.217, 05.157, 05.......182, 05.183, 05.198, 08.135, 09.342, 09.670 and 09.829] gives rise to safety concerns at their levels of dietary intake, estimated on the basis of the maximised survey-derived daily intake approach. Besides the safety assessment of these flavouring substances, the specifications for the materials...

  1. Non-standard quantum groups and superization

    Energy Technology Data Exchange (ETDEWEB)

    Majid, S. [Cambridge Univ. (United Kingdom). Dept. of Applied Mathematics and Theoretical Physics (DAMTP); Rodriguez-Plaza, M.J. [Nationaal Inst. voor Kernfysica en Hoge-Energiefysica (NIKHEF), Amsterdam (Netherlands). Sectie H

    1995-12-31

    We obtain the universal R-matrix of the non-standard quantum group associated to the Alexander-Conway knot polynomial. We show further that this nonstandard quantum group is related to the super-quantum group U{sub q}gl(1 vertical stroke 1) by a general process of superization, which we describe. We also study a twisted variant of this non-standard quantum group and obtain, as a result, a twisted version uf U{sub q}gl(1 vertical stroke 1) as a q-supersymmetry of the exterior differential calculus of any quantum plane of Hecke type, acting by mixing the bosonic x{sub i} co-ordinates and the forms dx{sub i}. (orig.).

  2. Representation properties, Racah sum rule, and Biedenharn - Elliott identity for Uq(osp(1|2))

    International Nuclear Information System (INIS)

    Minnaert, P.; Mozrzymas, M.

    1998-01-01

    It is shown that the universal R matrix in the tensor product of two irreducible representation spaces of the quantum superalgebra U q (osp(1|2)) can be expressed by Clebsch - Gordan coefficients. The Racah sum rule satisfied by U q (osp(1|2)) Racah coefficients and 6-j symbols is derived from the properties of the universal R matrix in the tensor product of three representation spaces. Considering the tensor product of four irreducible representations, it is shown that Biedenharn - Elliott identity holds for U q (osp(1|2)) Racah coefficients and 6-j symbols. A recursion relation for U q (osp(1|2)) 6-j symbols is derived from the Biedenharn endash Elliott identity. copyright 1998 American Institute of Physics

  3. Chemistry of group 9 dimetallaborane analogues of octaborane(12).

    Science.gov (United States)

    Barik, Subrat Kumar; Roy, Dipak Kumar; Ghosh, Sundargopal

    2015-01-14

    We report the synthesis, isolation and structural characterization of several moderately air stable nido-metallaboranes that represent boron rich open cage systems. The reaction of [Cp*CoCl]2, (Cp* = η(5)-C5Me5), with [BH3·thf] in toluene at ice cold temperature, followed by thermolysis in boiling toluene produced [(Cp*Co)B9H13], 1 [(Cp*Co)2B8H12], 2 and [(Cp*Co)2B6H10] 3. Building upon our earlier reactivity studies on rhodaboranes, we continue to explore the reactivity of dicobalt analogues of octaborane(12) cluster 3 with [Fe2(CO)9] and [Ru3(CO)12] at ambient conditions that yielded novel fused clusters [Fe2(CO)6(Cp*Co)2B6H10], 4 and [Ru4(CO)11(Cp*Co)2B3H3], 5 respectively. In an attempt to synthesize a heterometallic metallaborane compound we performed the reaction of [(Cp*Rh)2B6H10], 6 with [Cp*IrH4] that yielded a Ir-Ir double bonded compound [(Cp*Ir)2H3][B(OH)4], 7. All the new compounds have been characterized by IR, (1)H, (11)B, (13)C NMR spectroscopy, and the molecular structures were unambiguously established by X-ray diffraction analysis.

  4. 75 FR 39209 - U.S.-China Environmental Industries Forum

    Science.gov (United States)

    2010-07-08

    ... policies or conditions that impede U.S. environmental technology exports to China, with emphasis on those... DEPARTMENT OF COMMERCE International Trade Administration U.S.-China Environmental Industries... Group of the U.S.-China Joint Commission on Commerce and Trade (JCCT) in its formulation of a U.S.-China...

  5. Comparison of base composition analysis and Sanger sequencing of mitochondrial DNA for four U.S. population groups.

    Science.gov (United States)

    Kiesler, Kevin M; Coble, Michael D; Hall, Thomas A; Vallone, Peter M

    2014-01-01

    A set of 711 samples from four U.S. population groups was analyzed using a novel mass spectrometry based method for mitochondrial DNA (mtDNA) base composition profiling. Comparison of the mass spectrometry results with Sanger sequencing derived data yielded a concordance rate of 99.97%. Length heteroplasmy was identified in 46% of samples and point heteroplasmy was observed in 6.6% of samples in the combined mass spectral and Sanger data set. Using discrimination capacity as a metric, Sanger sequencing of the full control region had the highest discriminatory power, followed by the mass spectrometry base composition method, which was more discriminating than Sanger sequencing of just the hypervariable regions. This trend is in agreement with the number of nucleotides covered by each of the three assays. Published by Elsevier Ireland Ltd.

  6. EnviroAtlas - HU12_polygon

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data set is a complete digital hydrologic unit boundary layer to the Subwatershed (12-digit) 6th level for the entire United States. This data set consists of...

  7. 75 FR 22674 - U.S. Department of State Advisory Committee on Private International Law Study Group Notice of...

    Science.gov (United States)

    2010-04-29

    ... below for the report of the final session of the Working Group, February 8-12, 2010, in New York (A/CN.9/689), as well as the draft text of the IP supplement to the Guide (A/CN.9/700 and Add. 1-7) that will... Smeltzer or Niesha Toms at 202-776-8420 to receive the conference call-in number and the relevant...

  8. FDTD Analysis of U-Slot Rectangular Patch Antenna

    Science.gov (United States)

    Luk, K. M.; Tong, K. F.; Shum, S. M.; Lee, K. F.; Lee, R. Q.

    1997-01-01

    The U-slot rectangular patch antenna (Figure I) has been found experimentally to provide impedance and gain bandwidths of about 300 without the need of stacked or coplanar parasitic elements [1,2]. In this paper, simulation results of the U-slot patch using FDTD analysis are presented. Comparison with measured results are given.

  9. Calendar Year 2007 Groundwater Monitoring Report, U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Elvado Environmental LLC

    2008-12-01

    This report contains the groundwater and surface water monitoring data that were obtained during calendar year (CY) 2007 at the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) on the DOE Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The CY 2007 monitoring data were obtained from wells, springs, and surface water sampling locations in three hydrogeologic regimes at Y-12 (Figure A.1). The Bear Creek Hydrogeologic Regime (Bear Creek Regime) encompasses a section of Bear Creek Valley (BCV) between the west end of Y-12 and the west end of the Bear Creek Watershed (directions are in reference to the Y-12 grid system). The Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime) encompasses the Y-12 industrial facilities and support structures in BCV. The Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime) encompasses a section of Chestnut Ridge directly south of Y-12. Section 2 of this report provides background information pertinent to groundwater and surface water quality monitoring in each hydrogeologic regime, including the topography and bedrock geology, surface water drainage, groundwater system, and extent of groundwater contamination. The CY 2007 groundwater and surface water monitoring data in this report were obtained from sampling and analysis activities implemented under the Y-12 Groundwater Protection Program (GWPP) managed by BWXT Y-12, L.L.C. (BWXT), and from sampling and analysis activities implemented under several monitoring programs managed by Bechtel Jacobs Company LLC (BJC). In December 2007, the BWXT corporate name was changed to Babcock & Wilcox Technical Services Y-12, LLC (B&W Y-12), which is applied to personnel and organizations throughout CY 2007 for this report. Cooperative implementation of the monitoring programs directed by the Y-12 GWPP and BJC (i.e., coordinating sample collection and sharing data) ensures that the CY 2007 monitoring results fulfill requirements of

  10. 75 FR 67695 - U.S. Strategic Command Strategic Advisory Group Closed Meeting

    Science.gov (United States)

    2010-11-03

    ..., intelligence, and policy-related issues to the Commander, U.S. Strategic Command, during the development of the... Stockpile Assessment, Weapons of Mass Destruction, Intelligence Operations, Cyber Operations, Global Strike... these statements must be submitted no later than five business days prior to the meeting in question...

  11. Dicty_cDB: Contig-U13894-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13894-1 no gap 1550 2 2081463 2079913 MINUS 30 31 U13894 1 0 15 0 9 1 1 0 1 1 1 0 0 0 Show Contig...-U13894-1 Contig ID Contig-U13894-1 Contig update 2002.12.18 Contig sequence >Contig-U13894-1 (Contig...-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d CTTTTTGATTGTATAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAA...TAAATTAAATAATTAAAAAAAACAAAAAAATTAAGTGAAAATCAAAAAA Gap no gap Contig length 1550 Chromosome number (1..6, M) ...V*kkkkikk*k*sk*fklnn*kkqkn*vkikk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13894-1 (Contig

  12. END STAGE RENAL DISEASE IN PATIENTS WITH WILMS TUMOR: RESULTS FROM THE NATIONAL WILMS TUMOR STUDY GROUP AND THE U.S. RENAL DATA SYSTEM

    OpenAIRE

    Breslow, Norman E.; Grigoriev, Yevgeny A.; Peterson, Susan M.; Collins, Allan J.; Ritchey, Michael L.; Green, Daniel M.

    2005-01-01

    Purpose: To accurately assess the full spectrum of end stage renal disease (ESRD) in Wilms tumor survivors by combining the unique resources of the National Wilms Tumor Study Group (NWTSG) and the U.S. Renal Data System (USRDS), and to confirm preliminary reports of an increased incidence of ESRD in those with the Wilms tumor-aniridia (WAGR) syndrome.

  13. Y-12 Groundwater Protection Program Calendar Year 2000 Groundwater Monitoring Data Evaluation Report for the Bear Creek Hydrogeologic Regime at the U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    None

    2001-09-01

    This report presents an evaluation of the groundwater and surface water monitoring data obtained during calendar year (CY) 2000 in the Bear Creek Hydrogeologic Regime (Bear Creek Regime). The Bear Creek Regime encompasses many confirmed and potential sources of groundwater and surface water contamination associated with the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) in Oak Ridge, Tennessee (Figure A.1). Prepared by the Y-12 Groundwater Protection Program (GWPP), this report addresses applicable provisions of DOE Order 5400.1 (General Environmental Protection Program) that require: (1) an evaluation of the quantity and quality of groundwater and surface water in areas that are, or could be, affected by Y-12 operations, (2) an evaluation of groundwater and surface water quality in areas where contaminants from Y-12 operations are most likely to migrate beyond the DOE Oak Ridge Reservation (ORR) property line, and (3) an evaluation of long-term trends in groundwater quality at Y-12. The following sections of this report contain relevant background information (Section 2.0); describe the results of the respective data evaluations required under DOE Order 5400.1 (Section 3.0); summarize significant findings of each evaluation (Section 4.0); and list the technical reports and regulatory documents cited for more detailed information (Section 5.0). Illustrations (maps and trend graphs) are presented in Appendix A. Brief data summary tables referenced in each section are contained within the sections. Supplemental information and extensive data tables are provided in Appendix B.

  14. Dicty_cDB: Contig-U12086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

  15. Social conformity and propagation of information in collective U-turns of fish schools.

    Science.gov (United States)

    Lecheval, Valentin; Jiang, Li; Tichit, Pierre; Sire, Clément; Hemelrijk, Charlotte K; Theraulaz, Guy

    2018-04-25

    Moving animal groups such as schools of fishes or flocks of birds often undergo sudden collective changes of their travelling direction as a consequence of stochastic fluctuations in heading of the individuals. However, the mechanisms by which these behavioural fluctuations arise at the individual level and propagate within a group are still unclear. In this study, we combine an experimental and theoretical approach to investigate spontaneous collective U-turns in groups of rummy-nose tetra ( Hemigrammus rhodostomus ) swimming in a ring-shaped tank. U-turns imply that fish switch their heading between the clockwise and anticlockwise direction. We reconstruct trajectories of individuals moving alone and in groups of different sizes. We show that the group decreases its swimming speed before a collective U-turn. This is in agreement with previous theoretical predictions showing that speed decrease facilitates an amplification of fluctuations in heading in the group, which can trigger U-turns. These collective U-turns are mostly initiated by individuals at the front of the group. Once an individual has initiated a U-turn, the new direction propagates through the group from front to back without amplification or dampening, resembling the dynamics of falling dominoes. The mean time between collective U-turns sharply increases as the size of the group increases. We develop an Ising spin model integrating anisotropic and asymmetrical interactions between fish and their tendency to follow the majority of their neighbours nonlinearly (social conformity). The model quantitatively reproduces key features of the dynamics and the frequency of collective U-turns observed in experiments. © 2018 The Author(s).

  16. Main aspects in licensing of a type B(U) package design for the transport of 12.95 PBq of cobalt 60; Aspectos relevantes del licenciamiento en Argentina de un modelo de bulto tipo B(U) para transporte de 12,95 PBq de cobalto 60

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Vietri, J R; Novo, R G; Bianchi, A J

    1996-12-31

    This paper points out the relevant technical issues related to the licensing process, of a type B(U) package design, with cylindrical form and 9.3 ton mass, approved by the Argentine Competent Authority for the transport of 12.95 PBq of cobalt 60 as special form radioactive material. It is briefly described the heat transfer analysis, the structural performance under impulsive loads and the shielding calculation under both normal and accidental conditions of transport, as well as the comparative analysis of the results obtained from design, pre-operational tests and independent evaluation performed by the Argentine Competent Authority to verify the compliance with the Regulations for the Safe Transport of Radioactive Material of the International Atomic Energy Agency. (author). 14 refs., 1 fig., tabs.

  17. 12 CFR 221.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... of any activity for profit or the management or preservation of property. Indirectly secured. (1... continuously invested in exempted securities (as defined in 15 U.S.C. 78c(a)(12)); or (iii) A company which...

  18. 12 CFR 215.11 - Civil penalties.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Civil penalties. 215.11 Section 215.11 Banks... OFFICERS, DIRECTORS, AND PRINCIPAL SHAREHOLDERS OF MEMBER BANKS (REGULATION O) § 215.11 Civil penalties... subject to civil penalties as specified in section 29 of the Federal Reserve Act (12 U.S.C. 504). [Reg. O...

  19. 39 CFR 233.12 - Civil penalties.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Civil penalties. 233.12 Section 233.12 Postal... Civil penalties. False representation and lottery orders— (a) Issuance. Pursuant to 39 U.S.C. 3005, the... be liable to the United States for a civil penalty in an amount not to exceed $11,000 for each day...

  20. Angular distributions of target fragments from the reactions of 292 MeV - 25.2 GeV 12C with 197Au and 238U

    International Nuclear Information System (INIS)

    Morita, Y.

    1983-01-01

    The angular distributions of the 197 Au target fragments were all forwardly peaked. Extensively forward peaked angular distributions were observed at the non-relativistic projectile energies (292 MeV, 1.0 GeV). No obvious differences were observed in the angular distributions at the different relativistic projectile energies of 3.0 GeV, 12.0 GeV and 25.2 GeV. The characteristic angular distribution pattern from the relativistic projectile energy experiments was also observed in the non-relativistic energy experiments. Maximum degree of forward-peaking in the angular distributions at each projectile energy was observed at the product mass number (A) around 190 from the 292 MeV projectile energy, at A = 180 from 1.0 GeV and at A =175 from 3.0 GeV and 12.0 GeV. In general, two different types of angular distributions were observed in the relativistic projectile energy experiments with the 238 U target. Isotropic angular distributions were observed for the fission product nuclides. The angular distributions of the fission products at the intermediate (292 MeV) energy showed slightly forward peaked angular distributions. Because of the long projectile-target interaction time in the primary nuclear reaction, larger momentum was transferred from the projectile to the target nucleus. Steep forward-peaked angular distributions were also observed with the 238 U target

  1. Externally triggered renewed bubble nucleation in basaltic magma: the 12 October 2008 eruption at Halema‘uma‘u Overlook vent, Kīlauea, Hawai‘i, USA

    Science.gov (United States)

    Carey, Rebecca J.; Manga, Michael; Degruyter, Wim; Swanson, Donald; Houghton, Bruce F.; Orr, Tim R.; Patrick, Matthew R.

    2012-01-01

    From October 2008 until present, dozens of small impulsive explosive eruptions occurred from the Overlook vent on the southeast side of Halema‘uma‘u Crater, at Kīlauea volcano, USA. These eruptions were triggered by rockfalls from the walls of the volcanic vent and conduit onto the top of the lava column. Here we use microtextural observations and data from clasts erupted during the well-characterized 12 October 2008 explosive eruption at Halema‘uma‘u to extend existing models of eruption triggering. We present a potential mechanism for this eruption by combining microtextural observations with existing geophysical and visual data sets. We measure the size and number density of bubbles preserved in juvenile ejecta using 2D images and X-ray microtomography. Our data suggest that accumulations of large bubbles with diameters of >50μm to at least millimeters existed at shallow levels within the conduit prior to the 12 October 2008 explosion. Furthermore, a high number density of small bubbles nucleation of bubbles. Visual observations, combined with preexisting geophysical data, suggest that the impact of rockfalls onto the magma free surface induces pressure changes over short timescales that (1) nucleated new additional bubbles in the shallow conduit leading to high number densities of small bubbles and (2) expanded the preexisting bubbles driving upward acceleration. The trigger of eruption and bubble nucleation is thus external to the degassing system.

  2. Dicty_cDB: Contig-U12073-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig

  3. 19 CFR 12.97 - Importations contrary to law.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Importations contrary to law. 12.97 Section 12.97... TREASURY SPECIAL CLASSES OF MERCHANDISE Switchblade Knives § 12.97 Importations contrary to law. Importations of switchblade knives, except as permitted by 15 U.S.C. 1244, are importations contrary to law and...

  4. 19 CFR 12.104e - Seizure and forfeiture.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Seizure and forfeiture. 12.104e Section 12.104e Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Cultural Property § 12.104e Seizure and forfeiture. (a) Whenever...

  5. Grouping like catchments: A novel means to compare 40+ watersheds in the Northeastern U.S.

    Science.gov (United States)

    Shaw, S. B.; Walter, M.; Marjerison, R. D.

    2008-12-01

    One difficulty in understanding the effect of multi-scale patterns in watersheds comes from finding a concise way to identify and compare features across many basins. Comparing raw data (i.e. discharge time series) requires one to account for highly variable climate drivers while extracting meaningful metrics from the data series. Comparing model parameters imposes model assumptions that may obscure fundamental differences, potentially making it an exercise in comparing calibration factors. As a possible middle ground, we have found that the probability of a given basin-wide runoff response can be predicted by combining rainfall frequency with 1. a curve establishing a relationship between basin storage and base flow and 2. the baseflow flow-duration curve. In addition to providing a means to predict runoff, these curves succinctly present empirical runoff-response information, allowing ready graphical comparison of multiple watersheds. From 40+ watersheds throughout the Northeastern U.S., we demonstrate the potential to group watersheds and identify critical hydrologic features, providing particular insight into the influence of land use patterns as well as basin scale.

  6. Punishment Learning in U.S. Veterans With Posttraumatic Stress Disorder.

    Science.gov (United States)

    Sawyer, Alice T; Liverant, Gabrielle I; Jun, Janie J; Lee, Daniel J; Cohen, Andrew L; Dutra, Sunny J; Pizzagalli, Diego A; Sloan, Denise M

    2016-08-01

    Learning processes have been implicated in the development and course of posttraumatic stress disorder (PTSD); however, little is currently known about punishment-based learning in PTSD. The current study investigated impairments in punishment-based learning in U.S. veterans. We expected that veterans with PTSD would demonstrate greater punishment-based learning compared to a non-PTSD control group. We compared a PTSD group with and without co-occurring depression (n = 27) to a control group (with and without trauma exposure) without PTSD or depression (n = 29). Participants completed a computerized probabilistic punishment-based learning task. Compared to the non-PTSD control group, veterans with PTSD showed significantly greater punishment-based learning. Specifically, there was a significant Block × Group interaction, F(1, 54) = 4.12, p = .047, η(2) = .07. Veterans with PTSD demonstrated greater change in response bias for responding toward a less frequently punished stimulus across blocks. The observed hypersensitivity to punishment in individuals with PTSD may contribute to avoidant responses that are not specific to trauma cues. Copyright © 2016 International Society for Traumatic Stress Studies No claim to original US government works.

  7. Probable superbursts in 4U 0614+091 and 4U 1608-522

    Science.gov (United States)

    Kuulkers, E.

    2005-05-01

    Inspection of the RXTE/ASM database of 4U 0614+091 reveals a recent flare which occurred on March 12, 2005. The 1.5-12 keV flux increased by a factor of 5-6 up to 0.3 Crab within ~7.5 hours. About 1.5 hours later the flux had dropped to 0.17 Crab; ~9.5 hours later it had reached the pre-flare flux level again. The exponential decay time of the flare is about 2.2 hours. During the peak of the flare the X-ray emission significantly hardens with respect to the pre- and post-flare level.

  8. Calendar Year 2010 Groundwater Monitoring Report, U.S. Department Of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Elvado Environmental LLC

    2011-12-01

    This report contains the groundwater and surface water monitoring data that were obtained during calendar year (CY) 2010 at the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) on the DOE Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The CY 2010 monitoring data were obtained from wells, springs, and surface water sampling locations in three hydrogeologic regimes at Y-12 (Figure A.1). The Bear Creek Hydrogeologic Regime (Bear Creek Regime) encompasses a section of Bear Creek Valley (BCV) between the west end of Y-12 and the west end of the Bear Creek Watershed (directions are in reference to the Y-12 grid system). The Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime) encompasses the Y-12 industrial facilities and support structures in BCV. The Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime) encompasses a section of Chestnut Ridge directly south of Y-12. Section 2 of this report provides background information pertinent to groundwater and surface water quality monitoring in each hydrogeologic regime, including the topography and bedrock geology, surface water drainage, groundwater system, and extent of groundwater contamination. The CY 2010 groundwater and surface water monitoring data in this report were obtained from sampling and analysis activities implemented under the Y-12 Groundwater Protection Program (GWPP) managed by Babcock & Wilcox Technical Services Y-12, LLC (B&W Y-12) and from sampling and analysis activities implemented under several monitoring programs managed by Bechtel Jacobs Company LLC (BJC). Cooperative implementation of the monitoring programs directed by the Y-12 GWPP and BJC (i.e., coordinating sample collection and sharing data) ensures that the CY 2010 monitoring results fulfill requirements of all the applicable monitoring drivers with no duplication of sampling and analysis efforts. Section 3 of this report contains a summary of information regarding the

  9. Calendar Year 2011 Groundwater Monitoring Report, U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Elvado Environmental LLC,

    2012-12-01

    This report contains the groundwater and surface water monitoring data that were obtained during calendar year (CY) 2011 at the U.S. Department of Energy (DOE) Y-12 National Security Complex (Y-12) on the DOE Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The CY 2011 monitoring data were obtained from wells, springs, and surface water sampling locations in three hydrogeologic regimes at Y-12. The Bear Creek Hydrogeologic Regime (Bear Creek Regime) encompasses a section of Bear Creek Valley (BCV) between the west end of Y-12 and the west end of the Bear Creek Watershed (directions are in reference to the Y-12 grid system). The Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime) encompasses the Y-12 industrial facilities and support structures in BCV. The Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime) encompasses a section of Chestnut Ridge directly south of Y-12. This report provides background information pertinent to groundwater and surface water quality monitoring in each hydrogeologic regime, including the topography and bedrock geology, surface water drainage, groundwater system, and known extent of groundwater contamination. The CY 2011 groundwater and surface water monitoring data in this report were obtained from sampling and analysis activities implemented under the Y-12 Groundwater Protection Program (GWPP) managed by Babcock & Wilcox Technical Services Y-12, LLC (B&W Y-12) and from sampling and analysis activities implemented under several monitoring programs managed by the DOE Environmental Management (EM) contractor responsible for environmental cleanup on the ORR. In August 2011, URS | CH2M Oak Ridge LLC (UCOR) replaced Bechtel Jacobs Company LLC (BJC) as the DOE EM contractor. For this report, BJC/UCOR will be referenced as the managing contractor for CY 2011. Cooperative implementation of the monitoring programs directed by the Y-12 GWPP and BJC/UCOR (i.e., coordinating sample collection and sharing data) ensures

  10. Generation of multigroup cross-sections from micro-group ones in code system SUHAM-U used for VVER-1000 reactor core calculations with MOX loading

    Energy Technology Data Exchange (ETDEWEB)

    Boyarinov, V.F.; Davidenko, V.D.; Polismakov, A.A.; Tsybulsky, V.F. [RRC Kurchatov Institute, Moscow (Russian Federation)

    2005-07-01

    At the present time, the new code system SUHAM-U for calculation of the neutron-physical processes in nuclear reactor core with triangular and square lattices based both on the modern micro-group (about 7000 groups) cross-sections library of code system UNK and on solving the multigroup (up to 89 groups) neutron transport equation by Surface Harmonics Method is elaborated. In this paper the procedure for generation of multigroup cross-sections from micro-group ones for calculation of VVER-1000 reactor core with MOX loading is described. The validation has consisted in computing VVER-1000 fuel assemblies with uranium and MOX fuel and has shown enough high accuracy under corresponding selection of the number and boundaries of the energy groups. This work has been fulfilled in the frame of ISTC project 'System Analyses of Nuclear Safety for VVER Reactors with MOX Fuels'.

  11. Eating disorder symptoms among undergraduate and graduate students at 12 U.S. colleges and universities.

    Science.gov (United States)

    Lipson, S K; Sonneville, K R

    2017-01-01

    We sought to estimate the prevalence of eating disorder symptoms in a large sample of U.S. college students and variations therein across student characteristics. Participants were 9713 students from 12 colleges and universities participating in the Healthy Bodies Study. We used gender-stratified logistic regression to estimate bivariate correlates of elevated eating disorder symptoms, past-month objective binge eating, and past-month compensatory behaviors across student characteristics including age, degree-level, sexual orientation, race/ethnicity, first-generation status, citizenship, academic and extracurricular characteristics, and weight status. Eating disorder outcomes were based on the Eating Disorder Examination Questionnaire. We observed higher prevalence of objective binge eating among females relative to males (49% versus 30%, pobesity. When compared to individuals with a healthy weight, those with overweight had greater eating disorder risk (males OR=3.5; females OR=2.0), binge eating (males OR=2.1; females OR=1.9), and use of compensatory behaviors (males OR=1.5; females OR=1.3). This study suggests smaller gender difference in prevalence of eating disorder symptoms than previously reported and identifies students with overweight/obesity as salient targets for campus-based eating disorder screening and early intervention efforts. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. 7 CFR 29.2275 - Group.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Group. 29.2275 Section 29.2275 Agriculture Regulations... INSPECTION Standards Official Standard Grades for Virginia Fire-Cured Tobacco (u.s. Type 21) § 29.2275 Group... usually related to stalk position, body, or the general quality of the tobacco. Groups in this type are...

  13. ERK1/2 signalling pathway is involved in CD147-mediated gastric cancer cell line SGC7901 proliferation and invasion.

    Science.gov (United States)

    Chen, Liping; Pan, Yuqin; Gu, Ling; Nie, Zhenlin; He, Bangshun; Song, Guoqi; Li, Rui; Xu, Yeqiong; Gao, Tianyi; Wang, Shukui

    2013-08-01

    This study aimed to investigate the role of CD147 in the progression of gastric cancer and the signalling pathway involved in CD147-mediated gastric cancer cell line SGC7901 proliferation and invasion. Short hairpin RNA (shRNA) expression vectors targeting CD147 were constructed to silence CD147, and the expression of CD147 was monitored by quantitative realtime reverse transcriptase polymerase chain reaction and Western blot and further confirmed by immunohistochemistry in vivo. Cell proliferation was determined by Cell Counting Kit-8 assay, the activities of matrix metalloproteinase (MMP)-2 and MMP-9 were determined by gelatin zymography, and the invasion of SGC7901 was determined by invasion assay. The phosphorylation and non-phosphorylation of the mitogen-activated protein kinases, extracellular signal-regulated kinase1/2 (ERK1/2), P38 and c-Jun NH2-terminal kinase were examined by Western blot. Additionally, the ERK1/2 inhibitor U0126 were used to confirm the signalling pathway involved in CD147-mediated SGC7901 progression. The BALB/c nude mice were used to study tumour progression in vivo. The results revealed that CD147 silencing inhibited the proliferation and invasion of SGC7901 cells, and down-regulated the activities of MMP-2 and MMP-9 and the phosphorylation of the ERK1/2 in SGC7901 cells. ERK1/2 inhibitor U0126 decreased the proliferation, and invasion of SGC7901 cells, and down-regulated the MMP-2 and MMP-9 activities. In a nude mouse model of subcutaneous xenografts, the tumour volume was significantly smaller in the SGC7901/shRNA group compared to the SGC7901 and SGC7901/snc-RNA group. Immunohistochemistry analysis showed that CD147 and p-ERK1/2 protein expressions were down-regulated in the SGC7901/shRNA2 group compared to the SGC7901 and SGC7901/snc-RNA group. These results suggest that ERK1/2 pathway involves in CD147-mediated gastric cancer growth and invasion. These findings further highlight the importance of CD147 in cancer progression

  14. Refining the chronostratigraphy of the Karoo Basin, South Africa: magnetostratigraphic constraints support an early Permian age for the Ecca Group

    Science.gov (United States)

    Belica, Mercedes E.; Tohver, Eric; Poyatos-Moré, Miquel; Flint, Stephen; Parra-Avila, Luis A.; Lanci, Luca; Denyszyn, Steven; Pisarevsky, Sergei A.

    2017-12-01

    The Beaufort Group of the Karoo Basin, South Africa provides an important chrono- and biostratigraphic record of vertebrate turnovers that have been attributed to the end-Permian mass extinction events at ca. 252 and 260 Ma. However, an unresolved controversy exists over the age of the Beaufort Group due to a large data set of published U-Pb SHRIMP (Sensitive High Resolution Ion Microprobe) zircon results that indicate a ca. 274-250 Ma age range for deposition of the underlying Ecca Group. This age range requires the application of a highly diachronous sedimentation model to the Karoo Basin stratigraphy and is not supported by published palaeontologic and palynologic data. This study tested the strength of these U-Pb isotopic data sets using a magnetostratigraphic approach. Here, we present a composite ∼1500 m section through a large part of the Ecca Group from the Tanqua depocentre, located in the southwestern segment of the Karoo Basin. After the removal of two normal polarity overprints, a likely primary magnetic signal was isolated at temperatures above 450 °C. This section is restricted to a reverse polarity, indicating that it formed during the Kiaman Reverse Superchron (ca. 318-265 Ma), a distinctive magnetostratigraphic marker for early-middle Permian rocks. The Ecca Group has a corresponding palaeomagnetic pole at 40.8°S, 77.4°E (A95 = 5.5°). U-Pb SHRIMP ages on zircons are presented here for comparison with prior isotopic studies of the Ecca Group. A weighted mean U-Pb age of 269.5 ± 1.2 Ma was determined from a volcanic ash bed located in the uppermost Tierberg Formation sampled from the O + R1 research core. The age is interpreted here as a minimum constraint due to a proposed Pb-loss event that has likely influenced a number of published results. A comparison with the Geomagnetic Polarity Time Scale as well as published U-Pb TIMS ages from the overlying Beaufort Group supports a ca. 290-265 Ma age for deposition of the Ecca Group.

  15. Dicty_cDB: Contig-U12316-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12316-1 gap included 1238 4 1925901 1927143 PLUS 5 6 U12316 0 4 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12316-1 Contig ID Contig-U12316-1 Contig update 2002.12.18 Contig sequence >Contig-U12316-1 (Contig-U12316-1Q) /CSM_Contig/Contig-U12316...GAGTTGAAGATTTAGTTTTATCAGNANGAANAAATAAGAT Gap gap included Contig length 1238 Chromosome number (1..6, M) 4 C...,915,1174 Translated Amino Acid sequence lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig...lip*r*rtrkttn*kiknny*itketkiqs*t*rvmmmi*vedlvls xxxnk Frame B: lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig

  16. Dicty_cDB: Contig-U12682-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12682-1 no gap 1408 4 4961739 4963050 PLUS 47 48 U12682 0 0 0 5 0 0 2 30 0 10 0 0 0 0 Show Contig...-U12682-1 Contig ID Contig-U12682-1 Contig update 2002.12.18 Contig sequence >Contig-U12682-1 (Contig...-U12682-1Q) /CSM_Contig/Contig-U12682-1Q.Seq.d AAACACATCATCCCGTTCGATCTGATAAGTAAATCGACCTCAGGCC...ATGA AACTACTG Gap no gap Contig length 1408 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start po... kwniikwysyinwykswyn**fihsiklqwsy*qcke*si*yiir*ny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

  17. Excess of {sup 236}U in the northwest Mediterranean Sea

    Energy Technology Data Exchange (ETDEWEB)

    Chamizo, E., E-mail: echamizo@us.es [Centro Nacional de Aceleradores, Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía, Thomas Alva Edison 7, 41092 Seville (Spain); López-Lora, M., E-mail: mlopezlora@us.es [Centro Nacional de Aceleradores, Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía, Thomas Alva Edison 7, 41092 Seville (Spain); Bressac, M., E-mail: matthieu.bressac@utas.edu.au [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco); Institute for Marine and Antarctic Studies, University of Tasmania, Hobart, TAS (Australia); Levy, I., E-mail: I.N.Levy@iaea.org [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco); Pham, M.K., E-mail: M.Pham@iaea.org [IAEA-Environment Laboratories, Monte Carlo 98000 (Monaco)

    2016-09-15

    In this work, we present first {sup 236}U results in the northwestern Mediterranean. {sup 236}U is studied in a seawater column sampled at DYFAMED (Dynamics of Atmospheric Fluxes in the Mediterranean Sea) station (Ligurian Sea, 43°25′N, 07°52′E). The obtained {sup 236}U/{sup 238}U atom ratios in the dissolved phase, ranging from about 2 × 10{sup −9} at 100 m depth to about 1.5 × 10{sup −9} at 2350 m depth, indicate that anthropogenic {sup 236}U dominates the whole seawater column. The corresponding deep-water column inventory (12.6 ng/m{sup 2} or 32.1 × 10{sup 12} atoms/m{sup 2}) exceeds by a factor of 2.5 the expected one for global fallout at similar latitudes (5 ng/m{sup 2} or 13 × 10{sup 12} atoms/m{sup 2}), evidencing the influence of local or regional {sup 236}U sources in the western Mediterranean basin. On the other hand, the input of {sup 236}U associated to Saharan dust outbreaks is evaluated. An additional {sup 236}U annual deposition of about 0.2 pg/m{sup 2} based on the study of atmospheric particles collected in Monaco during different Saharan dust intrusions is estimated. The obtained results in the corresponding suspended solids collected at DYFAMED station indicate that about 64% of that {sup 236}U stays in solution in seawater. Overall, this source accounts for about 0.1% of the {sup 236}U inventory excess observed at DYFAMED station. The influence of the so-called Chernobyl fallout and the radioactive effluents produced by the different nuclear installations allocated to the Mediterranean basin, might explain the inventory gap, however, further studies are necessary to come to a conclusion about its origin. - Highlights: • First {sup 236}U results in the northwest Mediterranean Sea are reported. • Anthropogenic {sup 236}U dominates the whole seawater column at DYFAMED station. • {sup 236}U deep-water column inventory exceeds by a factor of 2.5 the global fallout one. • Saharan dust intrusions are responsible for an annual

  18. 7 CFR 1485.12 - Participation eligibility.

    Science.gov (United States)

    2010-01-01

    ...) To participate in the MAP, an entity: (1) Shall be: (i) A nonprofit U.S agricultural trade organization; (ii) A nonprofit state regional trade group; (iii) A U.S. agricultural cooperative; or (iv) A... OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS COOPERATIVE AGREEMENTS FOR THE DEVELOPMENT OF...

  19. Metabolism of L-leucine-U-14C in young rats fed excess glycine diets

    International Nuclear Information System (INIS)

    Takeuchi, Hisanao; Tadauchi, Nobuo; Muramatsu, Keiichiro

    1975-01-01

    As reported previously, while the growth-depressing effect of excess glycine was prevented by supplementing L-arginine and L-methionine, the degradation of glycine-U-(SUP 14)C into expired carbon dioxide was not accelerated by the supplement of both amino acids. However, it was found that the incorporation of the isotope into the lipids of livers and carcasses increased in the rats fed the excess glycine diet containing both amino acids. The lipid synthesis utilizing excess glycine may be accelerated by adding both amino acids to the 10% casein diet containing excess glycine. In the present experiment, the metabolic fate of L-leucine-U-(SUP 14)C was studied with the rats fed the excess glycine diet with or without L-arginine and L-methionine. 10% casein (10C), 10% casein diet containing 7% glycine (10C7G), or 10C7G Supplemented with 1.4% L-arginine-HCL and 0.9% L-methionine (10C7GArgMet) was fed to each rat, and the diet suspension containing 4 sup(μ)Ci of L-leucine-U-(SUP 14)C per 100 g of body weight was fed forcibly after 12 hr fast. The radioactivity in expired carbon dioxide, TCA soluble fraction, protein, glycogen, lipids and urine, and the concentration of free amino acids in blood plasma, livers and urine were measured. The body weight gain and food intake of the 10C7G group were much smaller than those of the other groups. The recovery of (SUP 14)C-radioactivity in expired carbon dioxide was much lower in the 10C7GArgMet group than that of the other groups. (Kako, I.)

  20. U.S. Burning Plasma Organization Activities

    International Nuclear Information System (INIS)

    Fonck, Raymond J.

    2009-01-01

    The national U.S. Burning Plasma Organization (USBPO) was formed to provide an umbrella structure in the U.S. fusion science research community. Its main purpose is the coordination of research activities in the U.S. program relevant to burning plasma science and preparations for participation in the international ITER experiment. This grant provided support for the continuing development and operations of the USBPO in its first years of existence. A central feature of the USBPO is the requirement for broad community participation in and governance of this effort. We concentrated on five central areas of activity of the USBPO during this grant period. These included: (1) activities of the Director and support staff in continuing management and development of the USBPO activity; (2) activation of the advisory Council; (3) formation and initial research activities of the research community Topical Groups; (4) formation of Task Groups to perform specific burning plasma related research and development activities; (5) integration of the USBPO community with the ITER Project Office as needed to support ITER development in the U.S.

  1. 7 CFR 29.2526 - Group.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Group. 29.2526 Section 29.2526 Agriculture Regulations...-Cured Tobacco (u.s. Types 22, 23, and Foreign Type 96) § 29.2526 Group. A division of a type covering..., or the general quality of the tobacco. Groups in these types are Wrappers (A), Heavy Leaf (B), Thin...

  2. Bosonic construction of the Lie algebras of some non-compact groups appearing in supergravity theories and their oscillator-like unitary representations

    International Nuclear Information System (INIS)

    Guenaydin, M.; Saclioglu, C.

    1981-06-01

    We give a construction of the Lie algebras of the non-compact groups appearing in four dimensional supergravity theories in terms of boson operators. Our construction parallels very closely their emergence in supergravity and is an extension of the well-known construction of the Lie algebras of the non-compact groups Sp(2n,IR) and SO(2n) from boson operators transforming like a fundamental representation of their maximal compact subgroup U(n). However this extension is non-trivial only for n >= 4 and stops at n = 8 leading to the Lie algebras of SU(4) x SU(1,1), SU(5,1), SO(12) and Esub(7(7)). We then give a general construction of an infinite class of unitary irreducible representations of the respective non-compact groups (except for Esub(7(7)) and SO(12) obtained from the extended construction). We illustrate our construction with the examples of SU(5,1) and SO(12). (orig.)

  3. MMP-9, uPA and uPAR proteins expression and its prognostic significance in esophageal squamous cell carcinoma treated by radiotherapy

    International Nuclear Information System (INIS)

    Zhu Shuchai; Wang Yafei; Su Jingwei; Wang Yuxiang; Shen Wenbin; Li Juan

    2008-01-01

    Objective: To explore the the prognostic significance of MMP-9, uPA and uPAR protein expression and its relationship with clinical-pathologic factors in esophageal squamous cell carcinoma treated by radiotherapy. Methods: MMP-9, uPA and uPAR protein expression was measured in 59 esophageal carcinomas and 41 peri-carcinoma tissues with immunohistochemistry. The relationship between the protein expression and the clinical-pathological parameters was analyzed, and the prognostic factors in esophageal squamous cell carcinoma treated by radiotherapy alone was evaluated. Results: The rates of positive expression of MMP-9, uPA and uPAR were 85%, 76% and 78% in esophageal carcinoma and 39%, 49% and 44% in peri-carcinoma tissues (χ 2 =22.54, 8.04 and 12.18; P=0.000,0.005 and 0.000). The rates of positive expression of MMP-9 was 79% and 100% when the depth of tumor invasion was ≤2 cm and >2 cm(P= 0.048), respectively. The expression of uPA was significantly correlated with the status of fat interspace between the esophageal lesion and the vertebra in CT scanning image. When the fat interspace existed and disappeared, the rates of strong positive expression was 44% and 70%, respectively (χ 2 =4.21, P=0.040). The positive expression rate of uPA was significantly correlated with distant metastasis, which was 100% in patients with distant metastasis and 68.89% in those without distant metastasis(χ 2 =4.12, P=0.042). The positive expression rate of MMP-9, uPA and uPAR did not affect the prognosis and the short-term result of esophageal carcinoma treated by radiotherapy alone. Conclusions: The protein expression of MMP-9, uPA and uPAR may correlate with local infiltration and distant metastasis in esophageal squamous cell carcinoma. Protein expression may not influence the prognosis of esophageal carcinoma treated by radio therapy, though long time followed-up is still needed. (authors)

  4. The U.S. Constitution Power Grab Game. Grade 12--Principles of American Democracy Lesson. Schools of California Online Resources for Education (SCORE): Connecting California's Classrooms to the World.

    Science.gov (United States)

    Carlson, Don M.

    This activity for students in grade 12 aims to increase their knowledge of the U.S. Constitution and its fundamental ideas: checks and balances, separation of powers, Bill of Rights, and the amendments. Students judge the constitutional powers of each brand of government by participating in the power game. The activity explains how the game is…

  5. Large dimuon asymmetry in B{sub s}-B-bar{sub s} mixing from unparticle induced {Gamma}{sub s}{sup 12}

    Energy Technology Data Exchange (ETDEWEB)

    Ren Bo [INPAC, Department of Physics, Shanghai Jiao Tong University, Shanghai (China); He Xiaogang, E-mail: hexg@phys.ntu.edu.t [INPAC, Department of Physics, Shanghai Jiao Tong University, Shanghai (China); Department of Physics and Center for Theoretical Sciences, National Taiwan University, Taipei, Taiwan (China); Xie Peichu [INPAC, Department of Physics, Shanghai Jiao Tong University, Shanghai (China)

    2011-04-11

    Exchange of unparticle stuff of dimension d{sub U} with FCNC interaction can induce M{sup 12,u} and {Gamma}{sup 12,u} causing meson and antimeson mixing with the relation {Gamma}{sup 12,u}/M{sup 12,u}=2tan({pi}d{sub U}). We show that this type of unparticle contribution can provide the much needed large {Gamma}{sub s}{sup 12} to explain the recently observed anomalously large dimuon asymmetry in B{sub s}-B-bar{sub s} system reported by D0 Collaboration. The same interaction can also accommodate large mixing induced CP violation in B{sub s{yields}}J/{psi}{phi} indicated by CDF and D0 data. Experimental data can provide constraints on the unparticle dimension and scale.

  6. Progress on Nuclear Data Covariances: AFCI-1.2 Covariance Library

    International Nuclear Information System (INIS)

    Oblozinsky, P.; Oblozinsky, P.; Mattoon, C.M.; Herman, M.; Mughabghab, S.F.; Pigni, M.T.; Talou, P.; Hale, G.M.; Kahler, A.C.; Kawano, T.; Little, R.C.; Young, P.G

    2009-01-01

    Improved neutron cross section covariances were produced for 110 materials including 12 light nuclei (coolants and moderators), 78 structural materials and fission products, and 20 actinides. Improved covariances were organized into AFCI-1.2 covariance library in 33-energy groups, from 10 -5 eV to 19.6 MeV. BNL contributed improved covariance data for the following materials: 23 Na and 55 Mn where more detailed evaluation was done; improvements in major structural materials 52 Cr, 56 Fe and 58 Ni; improved estimates for remaining structural materials and fission products; improved covariances for 14 minor actinides, and estimates of mubar covariances for 23 Na and 56 Fe. LANL contributed improved covariance data for 235 U and 239 Pu including prompt neutron fission spectra and completely new evaluation for 240 Pu. New R-matrix evaluation for 16 O including mubar covariances is under completion. BNL assembled the library and performed basic testing using improved procedures including inspection of uncertainty and correlation plots for each material. The AFCI-1.2 library was released to ANL and INL in August 2009.

  7. 12 CFR 7.1003 - Money lent at banking offices or at other than banking offices.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Money lent at banking offices or at other than banking offices. 7.1003 Section 7.1003 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE... without violating 12 U.S.C. 36, 12 U.S.C. 81 and 12 CFR 5.30, provided that a third party is used to...

  8. Geochemical control on the reduction of U(VI) to mononuclear U(IV) species in lacustrine sediments

    Science.gov (United States)

    Stetten, L.; Mangeret, A.; Brest, J.; Seder-Colomina, M.; Le Pape, P.; Ikogou, M.; Zeyen, N.; Thouvenot, A.; Julien, A.; Alcalde, G.; Reyss, J. L.; Bombled, B.; Rabouille, C.; Olivi, L.; Proux, O.; Cazala, C.; Morin, G.

    2018-02-01

    Contaminated systems in which uranium (U) concentrations slightly exceed the geochemical background are of particular interest to identify natural processes governing U trapping and accumulation in Earth's surface environments. For this purpose, we examined the role of early diagenesis on the evolution of U speciation and mobility in sediments from an artificial lake located downstream from a former mining site. Sediment and pore water chemistry together with U and Fe solid state speciation were analyzed in sediment cores sampled down to 50 cm depth at four locations in the lake. These organic-rich sediments (∼12% organic C) exhibited U concentrations in the 40-80 mg kg-1 range. The sediment columns were anoxic 2-3 mm below the sediment-water interface and pore waters pH was circumneutral. Pore water chemistry profiles showed that organic carbon mineralization was associated with Fe and Mn reduction and was correlated with a decrease in dissolved U concentration with depth. Immobilization of U in the sediment was correlated with the reduction of U(VI) to U(IV) at depth, as shown by U LIII-edge XANES spectroscopic analysis. XANES and EXAFS spectroscopy at the Fe K-edge showed the reduction of structural Fe(III) to Fe(II) in phyllosilicate minerals with depth, coincident with U(VI) to U(IV) reduction. Thermodynamic modeling suggests that Fe(II) could act as a major reducing agent for U(VI) during early diagenesis of these sediments, leading to complete U reduction below ∼30 cm depth. Shell-by-shell and Cauchy-Wavelet analysis of U LIII-EXAFS spectra indicates that U(VI) and U(IV) are mainly present as mononuclear species bound to C, P or Si ligands. Chemical extractions confirmed that ∼60-80% of U was present as non-crystalline species, which emphasizes that such species should be considered when evaluating the fate of U in lacustrine environments and the efficiency of sediment remediation strategies.

  9. Characteristics and assimilation of Chinese immigrants in the U.S. labour market.

    Science.gov (United States)

    Chen, S J

    1998-01-01

    "Using U.S. Public Use Samples, this article examines differences in the quality and assimilation rate of different Chinese immigrant groups (immigrants from Hong Kong, Taiwan and Mainland China) in the U.S. labour market. The descriptive statistics show great differences among Chinese immigrants from the three areas in their ages, wage rates, years of schooling and industrial and occupational distributions. This article also finds that the three Chinese immigrant groups have much more dispersed wage distributions than U.S.-born workers have. The three Chinese immigrant groups also experienced substantial assimilation into the U.S. labour market during the 1980s." (EXCERPT)

  10. Studies of U in the blood of two population samples

    International Nuclear Information System (INIS)

    Segovia, N.; Olguin, M.E.; Romero, M.

    1986-01-01

    The present work, attempts to establish the statistical distribution of blood uranium in a population of the same community, similar in age and in living patterns. U traces were evaluated by a fission track technique both in whole blood and plasma samples. Dried samples were compressed into pellets and irradiated in a nuclear reactor using the external detector method. For U quantification, standard U samples were used. A comparative sampling of U content in blood samples from a group of radiation exposed workers and another of leukemia patients was also carried out. Results from the sampling groups are reported and discussed. (author)

  11. Simultaneous radioassay of folate and vitamin B12

    International Nuclear Information System (INIS)

    1981-01-01

    An improved simultaneous radioassay for folate and vitamin B 12 in biological specimens is described. A sample containing folate and vitamin B 12 is contacted with 125 I-folate and 57 Co-vitamin B 12 and their respective specific binders. After separation of the bound and free portions, the radioactivity in the portions is counted and the amounts of folate and vitamin B 12 then determined from standard curves. (U.K.)

  12. 12 CFR 5.36 - Other equity investments.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Other equity investments. 5.36 Section 5.36... PROCEDURES FOR CORPORATE ACTIVITIES Expansion of Activities § 5.36 Other equity investments. (a) Authority... types of equity investments pursuant to 12 U.S.C. 24(Seventh) and other statutes. These investments are...

  13. Environmental groups in politics

    International Nuclear Information System (INIS)

    Lowe, P.; Goyder, J.

    1983-01-01

    The subject is covered in chapters, entitled: introduction; (Part I) the environmental movement (environmental groups and the attentive public; the episodic development of the environmental movement; the underlying values of environmentalism; the roots of environmental concern; the social limits to growth; elite manipulation of values); the organisation of environmental groups; environmental groups in national politics; environmental groups in local politics; (Part II) the Henley Society; Friends of the Earth; the National Trust; the Royal Society for Nature Conservation; the European Environmental Bureau. (U.K.)

  14. Study of 236U/238U ratio at CIRCE using a 16-strip silicon detector with a TOF system

    Science.gov (United States)

    De Cesare, M.; De Cesare, N.; D'Onofrio, A.; Gialanella, L.; Terrasi, F.

    2015-04-01

    Accelerator Mass Spectrometry (AMS) is presently the most sensitive technique for the measurement of long-lived actinides, e.g. 236U and xPu isotopes. A new actinide AMS system, based on a 3-MV pelletron tandem accelerator, is operated at the Center for Isotopic Research on Cultural and Environmental Heritage (CIRCE) in Caserta, Italy. In this paper we report on the procedure adopted to increase the 236U abundance sensitivity as low as possible. The energy and position determinations of the 236U ions, using a 16-strip silicon detector have been obtained. A 236U/238U isotopic ratio background level of about 2.9×10-11 was obtained, summing over all the strips, using a Time of Flight-Energy (TOF-E) system with a 16-strip silicon detector (4.9×10-12 just with one strip).

  15. Sun safety in construction: a U.K. intervention study.

    Science.gov (United States)

    Houdmont, J; Madgwick, P; Randall, R

    2016-01-01

    Interventions to promote sun safety in the U.K. construction sector are warranted given the high incidence of skin cancer attributable to sun exposure relative to other occupational groups. To evaluate change in sun safety knowledge and practices among construction workers in response to an educational intervention. A baseline questionnaire was administered, followed by a bespoke sector-specific DVD-based intervention. At 12-month follow-up, participants completed a further questionnaire. Analyses were conducted on a sample of 120 workers (intervention group, n = 70; comparison group, n = 50). At follow-up, the proportion of intervention group participants that reported correct sun safety knowledge was not significantly greater than at baseline. However, the intervention group demonstrated significant positive change on 9 out of 10 behavioural measures, the greatest change being use of a shade/cover when working in the sun followed by regularly checking skin for moles or unusual changes. Exposure to this intervention was linked to some specific positive changes in construction workers' self-reported sun safety practices. These findings highlight the potential for educational interventions to contribute to tackling skin cancer in the UK construction sector. The findings support the development of bespoke educational interventions for other high-risk outdoor worker groups. © The Author 2015. Published by Oxford University Press on behalf of the Society of Occupational Medicine. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  16. Colorectal cancer screening among Latinos from U.S. cities along the Texas-Mexico border.

    Science.gov (United States)

    Fernandez, Maria E; Wippold, Rosario; Torres-Vigil, Isabel; Byrd, Theresa; Freeberg, Diamond; Bains, Yadvindera; Guajardo, Jessica; Coughlin, Steven S; Vernon, Sally W

    2008-03-01

    Colorectal cancer (CRC) screening rates are comparatively low for U.S. Hispanics. To learn more about the factors influencing CRC screening among Hispanics living along the U.S.-Mexico border, 12 focus groups were conducted with Hispanic men and women aged 50 years and older in three Texas counties; Cameron County (Brownsville), Webb County (Laredo), and El Paso County, (El Paso). The focus group guide contained questions about health care behavior, knowledge about CRC, experiences with cancer, and factors that influence CRC screening. A total of 92 individuals participated with the majority aged 50-69 (75%). Twenty percent were born in the United States and 51% had lived in the United States for more than 20 years. Participants had low levels of education, income, and insurance coverage. The analysis revealed several overarching and contextual themes relating to knowledge, attitudes, beliefs, and emotions about cancer and CRC screening. A prevalent theme that emerged from all groups was frustration and a lack of confidence in the U.S. healthcare system. Few participants had been advised by their providers to obtain CRC screening. Lack of patient knowledge about colorectal cancer and screening appeared to be a critical factor influencing screening. Themes about death and pain due to cancer were prevalent as were cultural factors such as machismo and embarrassment. System level barriers such as cost, medical insurance and transportation also impacted screening. These findings suggest that strategies are needed to educate Hispanic residents of border communities about CRC and to motivate them to undergo CRC screening.

  17. 19 CFR 12.62 - Enforcement; duties of Customs officers.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Enforcement; duties of Customs officers. 12.62 Section 12.62 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY...; duties of Customs officers. (a) In accordance with the authority contained in sections 10 and 12 of the...

  18. Spectroscopic Studies on Complex Formation of U(VI)-thiosalicylate

    Energy Technology Data Exchange (ETDEWEB)

    Cha, Wan Sik; Cho, Hye Ryun; Park, Kyoung Kyun; Jung, Euo Chang [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2011-05-15

    The dynamic interaction between radionuclides and organic ligands is largely dependent on the composition of functional groups in a ligand chemical structure. Therefore, the structural mimics of natural ligands possessing specific functional groups, such as hydroxy, phenol, carboxyl, thiol and amine groups, have been studied to understand their influence on the migration of radionuclides including actinide species under geological groundwater conditions. In previous studies, we demonstrated that the fraction of hydrolyzed U(VI) species occurring in weak acidic solutions (pH {approx}4.5) is significantly influenced by the presence of salicylate (Sal) ligand due to the simultaneous participation of both phenol and carboxyl groups in the formation of U(VI)-complexes. Thiosalicylic acid (TSalH{sub 2}) is a good model compound for studying the effects of both carboxyl and thiol (-SH) groups. The fraction of di-anionic ligand form (TSal{sup 2-}) is higher at near neutral pH due to the lower pKa ({approx} 8) of the thiol group than the case of salicylic acid (pKa, {approx}13 for salicylic -OH), despite the structural similarity. In addition, the redox capability of the thiol group is expected to influence the reducible radiouclides and the chemical structures of natural ligands by creating cross-linkage (-S-S-) upon oxidation. The goal of the present study is to investigate aqueous U(VI)-TSal complexation equilibrium via laser-based spectroscopic techniques including time resolved laser-induced fluorescence spectroscopy (TRLFS). In this preliminary work, we report the results of spectroscopic studies using conventional UVVis absorbance and fluorescence (FL) measurement methods. The photo-stability of U(VI)-TSal complex or ligand itself upon exposure to a series of laser pulses is estimated by monitoring the change in their absorption bands. Additionally, TSal FL-quenching effect by U(VI) ions is discussed in comparison with that of Sal FL-quenching

  19. U.S. regulatory requirements for nuclear plant license renewal: The B and W Owners Group License Renewal Program

    International Nuclear Information System (INIS)

    Staudinger, Deborah K.

    2004-01-01

    This paper discusses the current U.S. Regulatory Requirements for License Renewal and describes the Babcock and Wilcox Owners Group (B and WOG) Generic License Renewal Program (GLRP). The B and W owners, recognizing the need to obtain the maximum life for their nuclear generating units, embarked on a program to renew the licenses of the seven reactors in accordance with the requirements of the Atomic Energy Act of 1954 and further defined by Title 10 of the Code of Federal Regulation Part 54 (10 CFR 54). These reactors, owned by five separate utilities, are Pressurized Water Reactors (PWR) ranging in net rated capacity from approximately 800 to 900 MW. The plants, predominately constructed in the 70s, have USNRC Operating Licenses that expire between 2013 to 2017. (author)

  20. On uncertainties and fluctuations of averaged neutron cross sections in unresolved resonance energy region for 235U, 238U, 239Pu

    International Nuclear Information System (INIS)

    Van'kov, A.A.; Blokhin, A.I.; Manokhin, V.N.; Kravchenko, I.V.

    1985-01-01

    This paper analyses the reasons for the differences which exist between group-averaged evaluated cross-section data from different evaluated data files for U235, U238 and Pu239 in the unresolved resonance energy region. (author)

  1. Antibiogram pattern of oral microflora in periodontic children of age group 6 to 12 years: a clinicomicrobiological study.

    Science.gov (United States)

    Fysal, N; Jose, Santhosh; Kulshrestha, Reena; Arora, Dimple; Hafiz, Ka Abdul; Vasudevan, Sanjay

    2013-07-01

    The study was carried out to see the diversity of oral microflora and its antibiotic sensitivity test in children of age group 6 to 12 years was carried. Total 50 patients of age group 6 to 12 years were analyzed for their oral microflora and then checked for the antibiotic susceptibility test. The samples that were collected were incubated at 37°C for 48 hours. Once dispersed samples were taken and Gram staining was done, also they were spread on to a number of freshly prepared agar plates and incubated to allow cells to form microbial colony. The result showed microflora common in all types, Gram-positive facultative anaerobic rods and cocci. In normal children Gram-positive facultative anaerobic and fermenting cocci were predominant where as in children with caries growth of microbiota that were Gram-negative and positive, capnophilic, motile and anaerobic rods and cocci belonging to members of genera S. mutans and A. actinomycetemcomitans was seen. By the present study it has been concluded that the number of bacteria determined by microscopic counts was twice as high in caries patients as in healthy sites, and also recommended that amoxicillin, ampicillin and amikacin are the most effective antibacterial drugs for the treatment of dental caries.

  2. U.S. GERMAN BILATERAL WORKING GROUP: AN INTERNATIONAL COLLABORATION IN REVITALIZING CONTAMINATED LAND

    Science.gov (United States)

    The U.S. Environmental Protection Agency (EPA) and the German Federal Ministry of Education and Research (BMBF) entered into a Bilateral partnership in 1990 to study each country's efforts in developing and demonstrating innovative tools, techniques and approaches in areas relate...

  3. Ce(III), Th(IV) and U(VI) chelates of alizarin viridine, alizarin heliotrope and alizarin maroon

    International Nuclear Information System (INIS)

    Idriss, K.A.; Issa, I.M.; Seleim, M.M.

    1977-01-01

    The complexes of 7,8-dihydroxy-1,4-di(2'-sulpho-4' methylanilino)-anthraquinone (alizarin viridine); 1,4-dihydroxy-2(2'-sulpho-4'-methylanilino)anthraquinone (alizarin heliotrope) and 3-amino-1,2-dihydroxyanthraquinone (alizarin maroon) with Ce(III), and U(VI) have been investigated using spectrophotometric and conductometric methods. The study revealed the formation of complexes having the metal: ligand ratios 1:1 and 1:2. The mean values of logβ (β being stability constant) for the different complexes are determined. The structure of the ligands in the solid chelates were studied by i.r. spectrophotmetry which showed that chelate formation takes place through the C=O and neighbouring OH group and leads to proton displacement. (author)

  4. 12 CFR 509.200 - Scope.

    Science.gov (United States)

    2010-01-01

    ... part shall apply to any proceedings under section 10(a)(2)(D) of the HOLA (12 U.S.C. 1467a(a)(2)(D)) to determine for purposes of section 10 of the HOLA, other than subsections (c), (d), (f), (h)(2), (m), (n), (q...

  5. 12 CFR 1206.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Banking FEDERAL HOUSING FINANCE AGENCY ORGANIZATION AND OPERATIONS ASSESSMENTS § 1206.2 Definitions. As used in this part: Act means the Federal Housing Finance Regulatory Reform Act of 2008. Adequately capitalized means the adequately capitalized capital classification under 12 U.S.C. 1364 and related...

  6. Comparison of U-Pu-Mo, U-Pu-Nb, U-Pu-Ti and U-Pu-Zr alloys; Comparaison des alliages U-Pu-Mo, U-Pu-Nb, U-Pu-Ti, U-Pu-Zr

    Energy Technology Data Exchange (ETDEWEB)

    Boucher, R; Barthelemy, P [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1964-07-01

    The data concerning the U-Pu, U-Pu-Mo and U-Pu-Nb are recalled. The results obtained with U-Pu-Ti and U-Pu-Zr alloys containing 15-20 per cent Pu and 10 wt. per cent ternary element are reported. The transformation temperatures, the expansion coefficients, the nature of phases, the thermal cycling behaviour have been determined. A list of the principal properties of these different alloys is presented and the possibilities of their use as fast reactor's fuel element are considered. The U-Pu-Ti alloys seem to be quite promising: easiness of fabrication, large thermal stability, excellent behaviour in air, small quantity of zeta phase, temperature of solidus superior to 1100 deg. C. (authors) [French] On rappelle brievement les connaissances acquises sur les alliages U-Pu, U-Pu-Mo et U-Pu-Nb. On presente les resultats obtenus avec les alliages U-Pu-Ti et U-Pu-Zr pour des teneurs de 15 a 20 pour cent de plutonium et 10 pour cent en poids d'element ternaire. On a determine les temperatures de transformation, les coefficients de dilatation, la nature des phases, la conductibilite thermique a 20 deg. C, la tenue au cyclage thermique et diverses autres proprietes. Un tableau resume les principales proprietes des divers alliages. On considere les possibilites d'emploi de ces alliages comme combustibles de reacteur rapide. Les alliages U-Pu-Ti paraissent particulierement interessants: facilite d'elaboration, stabilite thermique etendue, tenue dans l'air excellente, faible quantite de la phase U-Pu zeta, temperature de fusion commencante superieure a 1100 deg. C. (auteurs)

  7. 12 CFR 8.1 - Scope and application.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope and application. 8.1 Section 8.1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY ASSESSMENT OF FEES § 8.1 Scope and application. The assessments contained in this part are made pursuant to the authority contained in 12 U.S.C...

  8. Tank 241-U-103, grab samples 3U-99-1, 3u-99-2 and 3U-99-3

    Energy Technology Data Exchange (ETDEWEB)

    STEEN, F.H.

    1999-08-25

    This document is the final report for tank 241-U-103 grab samples. Three grab samples were collected from riser 13 on March 12, 1999 and received by the 222-S laboratory on March 15, 1999. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP.

  9. A q-deformation of the parastatistics and an alternative to the Chevalley description of Uq[osp(2n+1/2m)

    International Nuclear Information System (INIS)

    Palev, T.D.

    1997-08-01

    The paper contains essentially two new results. Physically, a deformation of the parastatistics in a sense of quantum groups is carried out. Mathematically, an alternative to the Chevalley description of the quantum orthosymplectic superalgebra U q [osp(2n + 1/2m)] in terms of m pairs of deformed parabosons and n pairs of deformed parafermions is outlined. (author). 35 refs

  10. Study of 236U/238U ratio at CIRCE using a 16-strip silicon detector with a TOF system

    Directory of Open Access Journals (Sweden)

    De Cesare M.

    2015-01-01

    Full Text Available Accelerator Mass Spectrometry (AMS is presently the most sensitive technique for the measurement of long-lived actinides, e.g. 236U and xPu isotopes. A new actinide AMS system, based on a 3-MV pelletron tandem accelerator, is operated at the Center for Isotopic Research on Cultural and Environmental Heritage (CIRCE in Caserta, Italy. In this paper we report on the procedure adopted to increase the 236U abundance sensitivity as low as possible. The energy and position determinations of the 236U ions, using a 16-strip silicon detector have been obtained. A 236U/238U isotopic ratio background level of about 2.9×10−11 was obtained, summing over all the strips, using a Time of Flight-Energy (TOF-E system with a 16-strip silicon detector (4.9×10−12 just with one strip.

  11. A reduction of the globalization and U(1)-covering

    International Nuclear Information System (INIS)

    Tran Dao Dong.

    1993-03-01

    We suggest a reduction of the globalization and multidimensional quantization to the case of reductive Lie groups by lifting to U(1)-covering. our construction is connected with M. Duflo's third method for algebraic groups. From a reductive datum of the given real algebraic Lie group we firstly construct geometric complexes with respect to U(1)-covering by using the unipotent positive distributions. Then we describe in terms of local cohomology the maximal globalization of Harish-Chandra modules which correspond to the geometric complexes. (author). 9 refs

  12. On the Relative Signs of "ROT-Effects" in Ternary and Binary Fission of 233U and 235U Nuclei Induced by Polarized Cold Neutrons

    Science.gov (United States)

    Danilyan, G. V.

    2018-02-01

    Signs of the ROT-effects in ternary fission of 233U and 235U experimentally defined by PNPI group are the same, whereas in binary fission defined by ITEP group are opposite. This contradiction cannot be explained by the errors in the experiments of both groups, since such instrumental effects would be too large not to be noticed. Therefore, it is necessary to find the answer to this problem in the differences of the ternary and binary fission mechanisms.

  13. Algebraic manipulation of the states associated with the U(5)containsO(5)containsO(3) chain of groups: Orthonormalization and matrix elements

    International Nuclear Information System (INIS)

    Yannouleas, C.; Pacheco, J.M.

    1989-01-01

    A collection of procedures able to perform algebraic manipulations for the orthonormalization and for the calculation of matrix elements between the states associated with the U(5)containsO(5)containsO(3) chain of groups is presented. These procedures combine both the exact- and the bigfloat-arithmetic modes and thus return arbitrarily accurate results; this is particulary relevant to the Gram-Schmidt orthonormalization, where strong cancellations usually pose serious problems in all floating-point implementations. (orig.)

  14. Sexual risk attitudes and intentions of youth aged 12-14 years: survey comparisons of parent-teen prevention and control groups.

    Science.gov (United States)

    Lederman, Regina P; Chan, Wenyaw; Roberts-Gray, Cynthia

    2004-01-01

    In this study, the authors compared differences in sexual risk attitudes and intentions for three groups of youth (experimental program, n = 90; attention control, n = 80; and nonparticipant control, n = 634) aged 12-14 years. Two student groups participated with their parents in programs focused on strengthening family interaction and prevention of sexual risks, HIV, and adolescent pregnancy. Surveys assessed students' attitudes and intentions regarding early sexual and other health-risk behaviors, family interactions, and perceived parental disapproval of risk behaviors. The authors used general linear modeling to compare results. The experimental prevention program differentiated the total scores of the 3 groups (p < .05). A similar result was obtained for student intentions to avoid sex (p < .01). Pairwise comparisons showed the experimental program group scored higher than the nonparticipant group on total scores (p < .01) and on students' intention to avoid sex (p < .01). The results suggest this novel educational program involving both parents and students offers a promising approach to HIV and teen pregnancy prevention.

  15. Main aspects in licensing of a type B(U) package design for the transport of 12.95 PBq of cobalt 60

    International Nuclear Information System (INIS)

    Lopez Vietri, J.R.; Novo, R.G.; Bianchi, A.J.

    1995-01-01

    This paper points out the relevant technical issues related to the licensing process, of a type B(U) package design, with cylindrical form and 9.3 ton mass, approved by the Argentine Competent Authority for the transport of 12.95 PBq of cobalt 60 as special form radioactive material. It is briefly described the heat transfer analysis, the structural performance under impulsive loads and the shielding calculation under both normal and accidental conditions of transport, as well as the comparative analysis of the results obtained from design, pre-operational tests and independent evaluation performed by the Argentine Competent Authority to verify the compliance with the Regulations for the Safe Transport of Radioactive Material of the International Atomic Energy Agency. (author). 14 refs., 1 fig., tabs

  16. Differences Between Japanese and U.S. Children's Performance on "Zoo U": A Game-Based Social Skills Assessment.

    Science.gov (United States)

    Craig, Ashley B; DeRosier, Melissa E; Watanabe, Yayoi

    2015-08-01

    The purpose of this study was to test whether and how performance on a digital game-based social skills assessment tool, "Zoo U" (3C Institute, Durham, NC), differed for children in the United States and Japan across six core social skills. "Zoo U" was administered to 497 third and fourth grade children from the United States and Japan (46 percent Japanese) by teachers and researchers, respectively. U.S. children received the original version of "Zoo U," and Japanese children received a fully translated Japanese version of the program. Scoring of each of the six social skills is built into the "Zoo U" software, with specific scoring algorithms for each grade level that provide both a continuous scale score and cutoffs for three distinct performance categories: high, average, and low. A multivariate analysis of variance (MANOVA) was conducted to assess differences by cultural group on each of the six continuous social skill scores, controlling for gender and grade level. Results revealed significant differences on four of the six skills in expected directions. Chi-squared and odds ratios analyses were then conducted on the assignment of children into each of the performance categories by cultural group, revealing additional nuance to the cultural differences identified in the MANOVA consistent with existing literature. We were able to replicate known cultural differences between U.S. and Japanese children with a simple direct translation of a Web-based social skills assessment game, "Zoo U." Our results provide preliminary support for the potential of game-based assessment methods to provide efficient and valid social skill assessments to children around the world.

  17. Quality of life and disability 12 months after surgery vs. conservative management for unruptured brain arteriovenous malformations: Scottish population-based and Australian hospital-based studies.

    Science.gov (United States)

    O'Donnell, Joan Margaret; Al-Shahi Salman, Rustam; Manuguerra, Maurizio; Assaad, Nazih; Morgan, Michael Kerin

    2018-03-01

    Few data are available on disability and quality of life (QOL) after surgery versus conservative management for unruptured brain arteriovenous malformations (uAVMs). The aim of this study was to test the hypothesis that QOL and disability are worse after surgery ± preoperative embolisation for uAVM compared with conservative management. We included consecutive patients diagnosed with uAVM from a prospective population-based study in Scotland (1999-2003; 2006-2010) and a prospective hospital-based series in Australia (2011-2015). We assessed outcomes on the modified Rankin Scale (mRS) and the Short Form (SF)-36 at ~ 12 months after surgery or conservative treatment and compared these groups using continuous ordinal regression in the two cohorts separately. Surgery was performed for 29% of all uAVM cases diagnosed in Scotland and 84% of all uAVM referred in Australia. There was no statistically significant difference between surgery and conservative management at 12 months among 79 patients in Scotland (mean SF-36 Physical Component Score (PCS) 39 [SD 14] vs. 39 [SD 13]; mean SF-36 Mental Component Score (MCS) 38 [SD 14] vs. 39 [SD 14]; mRS > 1, 24 vs. 9%), nor among 37 patients in Australia (PCS 51 [SD 10] vs. 49 [SD 6]; MCS 48 [SD 12] vs. 49 [SD 10]; mRS > 1, 19 vs. 30%). In the Australian series, there was no statistically significant change in the MCS and PCS between baseline before surgery or conservative management and 12 months. We did not find a statistically significant difference between surgery ± preoperative embolisation and conservative management in disability or QOL at 12 months.

  18. Photoassociation spectroscopy of 87Rb2 (5s1/2+5p1/2)0u+ long-range molecular states: Coupling with the (5s1/2+5p3/2)0u+ series analyzed using the Lu-Fano approach

    International Nuclear Information System (INIS)

    Jelassi, H.; Viaris de Lesegno, B.; Pruvost, L.

    2006-01-01

    We report on photoassociation of cold 87 Rb atoms providing the spectroscopy of (5s 1/2 +5p 1/2 )0 u + long-range molecular states, in the energy range of [-12.5, -0.7 cm -1 ] below the dissociation limit. A Lu-Fano approach coupled to the LeRoy-Bernstein formula is used to analyze the data. The Lu-Fano graph exhibits the coupling of the molecular series with the (5s 1/2 +5p 3/2 )0 u + one, which is due to spin effects in the molecule. A two-channel model involving an improved LeRoy-Bernstein formula allows us to characterize the molecular series, to localize (5s 1/2 +5p 3/2 )0 u + levels, to evaluate the coupling, and to predict the energy and width of the first predissociated level of (5s 1/2 +5p 3/2 )0 u + series. An experimental spectrum confirms the prediction

  19. 7 CFR 29.2440 - (N Group).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false (N Group). 29.2440 Section 29.2440 Agriculture... INSPECTION Standards Grades § 29.2440 (N Group). Extremely common tobacco which does not meet the minimum specifications or which exceeds the tolerance of the lowest grade of any other group except scrap. U.S. grades...

  20. 19 CFR 12.101 - Seizure of prohibited switchblade knives.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Seizure of prohibited switchblade knives. 12.101...; DEPARTMENT OF THE TREASURY SPECIAL CLASSES OF MERCHANDISE Switchblade Knives § 12.101 Seizure of prohibited... accordance with § 12.100(a) shall be seized under 19 U.S.C. 1595a(c). (b) Notice of seizure. Notice of...

  1. ZZ CAD, 51 Neutron-Group, 25 Gamma-Group Albedo Data for 4 Materials from DOT Flux

    International Nuclear Information System (INIS)

    1992-01-01

    A - Description of problem or function: Format: BREESE tape-writing program, MORSE; Number of groups: 51 neutron, 25 gamma-ray group albedo data. Nuclides: 1) 12 inches of water. 2) 12 inches of ordinary concrete. 3) 9 inches of carbon steel (SA508). 4) 1/2 inches of steel over 12 inches of concrete. (O, Ca, Al, C, Si, H, K, Mg, Fe, Na, Mn); Origin: DOT angular flux tape. CAD is a set of 51 neutron, 25 gamma-ray group albedo data for the following four materials: 1) 12 inches of water. 2) 12 inches of ordinary concrete. 3) 9 inches of carbon steel (SA508). 4) 1/2 inches of steel over 12 inches of concrete. The differential angular albedos are a function of the five incident polar directions and 30 reflected directions. B - Method of solution: The data has been generated from a DOT angular flux tape using the code CARP (abstract PSR-0131). C - Restrictions on the complexity of the problem: Since the amount of data is so large, it is necessary to run CARP, using the group reduction option, in order to run a problem on most computers

  2. Unbounded representations of symmetry groups in gauge quantum field theory. Pt. 1

    International Nuclear Information System (INIS)

    Voelkel, A.H.

    1983-01-01

    Symmetry groups and especially the covariance (substitution rules) of the basic fields in a gauge quantum field theory of the Wightman-Garding type are investigated. By means of the continuity properties hidden in the substitution rules it is shown that every unbounded form-isometric representation U of a Lie group has a form-skew-symmetric differential deltaU with dense domain in the unphysical Hilbert space. Necessary and sufficient conditions for the existence of the closures of U and deltaU as well as for the isometry of U are derived. It is proved that a class of representations of the transition group enforces a relativistic confinement mechanism, by which some or all basic fields are confined but certain mixed products of them are not. (orig.)

  3. 12 CFR 9.1 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ... Comptroller of the Currency (OCC) issues this part pursuant to its authority under 12 U.S.C. 24 (Seventh), 92a, and 93a, and 15 U.S.C. 78q, 78q-1, and 78w. (b) Purpose. The purpose of this part is to set forth the... Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY FIDUCIARY ACTIVITIES OF...

  4. Use of electronic group method in assessing food safety training needs and delivery methods among international college students in the U.S.

    Science.gov (United States)

    Garden-Robinson, Julie; Eighmy, Myron A; Lyonga, Agnes Ngale

    2010-12-01

    The purpose of this study was to determine the types of unfamiliar foods international students in the U.S. encounter and to assess food safety information that international students would like to receive for mitigating risks associated with handling and preparing unfamiliar foods. The study identified preferred instructional delivery methods and media for receiving food safety training or information. An electronic group method was used for this study. The electronic group method was chosen to maximize group efficiency by allowing participants to share ideas simultaneously and anonymously with minimal use of time and resources.Types of different (unfamiliar) foods were grouped into major categories. Fast and ready-to-eat foods, and processed and frozen foods constituted a major change for some international students, who were accustomed to homemade and fresh foods in their countries. Participants were interested in receiving information about how to safely handle and prepare unfamiliar foods in their new environment. Preferred methods for receiving food safety information included written materials, online publications, presentations, and materials provided during student orientation. Food packages, websites, and television programs were other preferred methods of receiving food safety information. Copyright © 2010 Elsevier Ltd. All rights reserved.

  5. 12 CFR 225.1 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ...) of the Federal Deposit Insurance Act (12 U.S.C. 1818(b)); section 914 of the Financial Institutions..., title 12, chapter II, part 225. (b) Purpose. The principal purposes of this part are to: (1) Regulate the acquisition of control of banks by companies and individuals; (2) Define and regulate the...

  6. “Democratic Government”, Interest Groups and American Trade Politics

    Directory of Open Access Journals (Sweden)

    Zhanyu Dong

    2013-01-01

    Full Text Available The study of American trade politics is of great significance when interpreting U.S.A. trade policies and understanding China-U.S.A. trade relations. In order to explain the mechanism of American trade politics, this paper constructs a new analytical framework of “democratic government-interest groups”, which argues that U.S.A. trade policies are not only the choices made by the democratic government between state interests and political private benefits, but also the outcomes of interaction between the U.S.A. government and interest groups. The case study of the U.S.A. trade policies toward China since the new century also demonstrates how the interaction between the government and interest groups ultimately shapes trade policies. Therefore, we need to understand the logic of American trade politics, generate more mutual benefits for our two countries, and work together to promote the bilateral free trade as well as the bilateral relations between China and the U.S.A.

  7. U-Method” TVT-Secur Slings: Are they obstructive?

    Science.gov (United States)

    Richard, Patrick; Gagnon, Louis-Olivier; Tu, Le Mai

    2012-01-01

    Introduction: The TVT-Secur, a single incision sling, was introduced in 2006. It is implanted using either the “hammock” or the “U-method” technique. With the latter, the sling is tightened to create a “pillowing effect” on the urethra until a negative stress test is obtained. Short-term results seem promising. However, no study has ever reported on the voiding pattern 12 months after its implantation. Our objective was to assess whether the “U-method” technique creates an obstructive voiding pattern on pressure-flow study (PFS) 12 months after the surgery. Methods: In this retrospective study, we reviewed the charts of 33 women who underwent the “U-method” TVT-Secur. Patients were evaluated before and 12 months postoperatively with regard to different urodynamic studies (UDS). The incontinence status was also assessed 12 months after surgery. Results: At 12 months after the operation, 12.5% (4/32) of the patients reported an improvement of their stress urinary incontinence, while 78.1% (25/32) reported being cured from it. The objective cure rate was 63% (19/30). One patient had a suspected bladder outlet obstruction (BOO) based on PFS. Maximal flow rate (Qmax) was significantly lower 12 months after surgery (26.0 mL/s [range: 19.0–36.5] vs. 21.5 mL/s [range: 16.0–32.3]). However, median voided volume was lower on the postoperative uroflowmetry (446 mL [range: 348–605] vs. 320 mL [range: 243–502]). Furthermore, none of the patients complained of voiding symptoms after surgery. Conclusions: Although one patient had findings compatible with BOO, none complained of voiding symptoms. TVT-Secur may result in a lower Qmax. However, this finding may be due to a lower voiding volume on the postoperative UDS. PMID:22511425

  8. Some thoughts to realignment of PortalU

    International Nuclear Information System (INIS)

    Konstantinidis, Stefanie; Kruse, Fred

    2013-01-01

    Environmental information is the basis for improving the environmental situation in the EU. The challenge poses the tailoring of information to a defined group of interest and not only the technical possibility to retrieve the environmental information. Even though, the technical infrastructure for retrieving public environmental information is the first step. Hence, the clear understanding of the needs of the general public is essential for a successful environmental information portal for the interest group ''general public''. What does this mean referring to the German Environmental Information Portal PortalU? Since the launch of PortalU the focus of the portal is set on making available official environmental information especially on German Federal Republic and Federal States level. Currently, information from web pages represents the greatest amount of information. In contrast, information from environmental data catalogs and further data bases represent a smaller amount of information within PortalU. But quantity itself does not tell anything about the demand of a target group. The experience of the last years has shown that environmental interested citizens use mainly general search engines like Google to find information from public environmental web pages. Thus it would be worth thinking about a realignment of PortalU. The idea of a prospective alignment of PortalU is to concentrate on important environmental information, which is not easily found via Google and other general search engines. This information is mainly provided via environmental data catalogs and possibly further data bases. Some thoughts about the potential form and design of a respectively aligned environmental portal are discussed in the paper. (orig.)

  9. Dicty_cDB: FC-AI12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  10. U.S.-Japan Quake Prediction Research

    Science.gov (United States)

    Kisslinger, Carl; Mikumo, Takeshi; Kanamori, Hiroo

    For the seventh time since 1964, a seminar on earthquake prediction has been convened under the U.S.-Japan Cooperation in Science Program. The purpose of the seminar was to provide an opportunity for researchers from the two countries to share recent progress and future plans in the continuing effort to develop the scientific basis for predicting earthquakes and practical means for implementing prediction technology as it emerges. Thirty-six contributors, 15 from Japan and 21 from the U.S., met in Morro Bay, Calif.September 12-14. The following day they traveled to nearby sections of the San Andreas fault, including the site of the Parkfield prediction experiment. The conveners of the seminar were Hiroo Kanamori, Seismological Laboratory, California Institute of Technology (Caltech), for the U.S., and Takeshi Mikumo, Disaster Prevention Research Institute, Kyoto University, for Japan . Funding for the participants came from the U.S. National Science Foundation and the Japan Society forthe Promotion of Science, supplemented by other agencies in both countries.

  11. Study of the variation with the energy of the fission cross-sections of {sup 233}U, {sup 235}U, {sup 239}Pu for the fast neutrons; Etude de la variation avec l'energie des sections efficaces de fission de {sup 233}U, {sup 235}U, {sup 239}Pu pour les neutrons rapides

    Energy Technology Data Exchange (ETDEWEB)

    Szteinsznaider, D; Naggiar, V; Netter, F [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1955-07-01

    This measurements have been done while taking the value of the fission cross-sections of {sup 238}U as reference. The neutrons are produced by the reaction {sup 7}Li(p,n) in the Van de Graaff generator of Saclay. The explored domain spreads from some tenths to 2000 keV. We find: for {sup 239}Pu: {sigma}{sub f} = 2,04 {+-} 0,12 barns, cross-section constant between 150 and 2000 keV, for {sup 235}U: {sigma}{sub f} = 1,15 {+-} 0,15 barns, cross-section constant between 700 and 1000 keV, for {sup 233}U: {sigma}{sub f} = 1,92 {+-} 0,25 barns, for neutrons of 850 keV. (authors) [French] Ces mesures ont ete effectuees en prenant la valeur de la section efficace de fission de {sup 238}U comme reference. Les neutrons sont produits par la reaction {sup 7}Li(p,n) au generateur Van de Graaff de Saclay. Le domaine explore s'etend de quelques dizaines de kev a 2000 kev. Nous trouvons: pour {sup 239}Pu: {sigma}{sub f} = 2,04 {+-} 0,12 barns, section efficace constante entre 150 et 2000 kev. pour {sup 235}U: {sigma}{sub f} = 1,15 {+-} 0,15 barns, section efficace constante entre 700 et 1000 kev. pour {sup 233}U: {sigma}{sub f} = 1,92 {+-} 0,25 barns, pour des neutrons de 850 kev. (auteurs)

  12. Calendar Year 2009 Groundwater Monitoring Report, U.S. Department of Energy, Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Elvado Environmental LLC

    2010-12-01

    This report contains the groundwater and surface water monitoring data that were obtained during calendar year (CY) 2009 at the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) on the DOE Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The CY 2009 monitoring data were obtained from wells, springs, and surface water sampling locations in three hydrogeologic regimes at Y-12. The Bear Creek Hydrogeologic Regime (Bear Creek Regime) encompasses a section of Bear Creek Valley (BCV) between the west end of Y-12 and the west end of the Bear Creek Watershed (directions are in reference to the Y-12 grid system). The Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime) encompasses the Y-12 industrial facilities and support structures in BCV. The Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime) encompasses a section of Chestnut Ridge directly south of Y-12. Section 2 of this report provides background information pertinent to groundwater and surface water quality monitoring in each hydrogeologic regime, including the topography and bedrock geology, surface water drainage, groundwater system, and extent of groundwater contamination. The CY 2009 groundwater and surface water monitoring data in this report were obtained from sampling and analysis activities implemented under the Y-12 Groundwater Protection Program (GWPP) managed by Babcock & Wilcox Technical Services Y-12, LLC (B&W Y-12) and from sampling and analysis activities implemented under several monitoring programs managed by Bechtel Jacobs Company LLC (BJC). Cooperative implementation of the monitoring programs directed by the Y-12 GWPP and BJC (i.e., coordinating sample collection and sharing data) ensures that the CY 2009 monitoring results fulfill requirements of all the applicable monitoring drivers with no duplication of sampling and analysis efforts. Section 3 of this report contains a summary of information regarding the groundwater and

  13. Calendar Year 2009 Groundwater Monitoring Report, U.S. Department of Energy, Y-12 National Security Complex, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    2010-01-01

    This report contains the groundwater and surface water monitoring data that were obtained during calendar year (CY) 2009 at the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) on the DOE Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The CY 2009 monitoring data were obtained from wells, springs, and surface water sampling locations in three hydrogeologic regimes at Y-12. The Bear Creek Hydrogeologic Regime (Bear Creek Regime) encompasses a section of Bear Creek Valley (BCV) between the west end of Y-12 and the west end of the Bear Creek Watershed (directions are in reference to the Y-12 grid system). The Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime) encompasses the Y-12 industrial facilities and support structures in BCV. The Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime) encompasses a section of Chestnut Ridge directly south of Y-12. Section 2 of this report provides background information pertinent to groundwater and surface water quality monitoring in each hydrogeologic regime, including the topography and bedrock geology, surface water drainage, groundwater system, and extent of groundwater contamination. The CY 2009 groundwater and surface water monitoring data in this report were obtained from sampling and analysis activities implemented under the Y-12 Groundwater Protection Program (GWPP) managed by Babcock and Wilcox Technical Services Y-12, LLC (B and W Y-12) and from sampling and analysis activities implemented under several monitoring programs managed by Bechtel Jacobs Company LLC (BJC). Cooperative implementation of the monitoring programs directed by the Y-12 GWPP and BJC (i.e., coordinating sample collection and sharing data) ensures that the CY 2009 monitoring results fulfill requirements of all the applicable monitoring drivers with no duplication of sampling and analysis efforts. Section 3 of this report contains a summary of information regarding the

  14. {sup 238}U and {sup 232}Th concentrations in various foodstuffs in Morocco and resulting radiation doses to the members of the public; Concentrations en {sup 238}U et {sup 232}Th dans differents aliments au Maroc et doses de radiations en resultant pour les membres du public

    Energy Technology Data Exchange (ETDEWEB)

    Misdaq, M.A.; Elamyn, H.; Erramli, H. [Cadi Ayyad Univ., Nuclear Physics and Techniques Lab., Faculty of Sciences Semlalia, Marrakech (Morocco)

    2008-04-15

    Uranium ({sup 238}U) and thorium ({sup 232}Th) concentrations were measured in different foods widely consumed in Morocco by using C.R.-39 and L.R.-115 type II solid state nuclear track detectors (S.S.N.T.D.). Data obtained were compared to those obtained by using isotope dilution mass spectrometry (I.D.M.S.). Total daily intakes of {sup 238}U and {sup 232}Th for a typical food basket were estimated to be 1.3 {+-} 0.1 mBq d{sup -1} and 0.98 {+-} 0.08 mBq d{sup -1}, 1.4 {+-} 0.1 mBq d{sup -1} and 1.06 {+-} 0.08 mBq d{sup -1}, 1.7 {+-} 0.1 mBq d{sup -1} and 1.26 {+-} 0.08 mBq d{sup -1} and 2.0 {+-} 0.1 mBq d{sup -1} and 1.5 {+-} 0.1 Bq d{sup -1} for the 2-7 years, 7-12 years, 12-17 years and adult's age groups, respectively. Alpha-activities due to annual {sup 238}U and {sup 232}Th intakes from the ingestion of the studied foodstuffs were determined in different organs and tissues of the human body of members of the public by using the ICRP gastrointestinal tract and systemic part models for these radionuclides. Committed equivalent doses due to annual intakes of {sup 238}U and {sup 232}Th were evaluated in the human body organs and tissues for different age groups of the Moroccan population by exploiting data obtained for alpha-doses deposited by 1 Bq of {sup 238}U and 1 Bq of {sup 232}Th in the considered human organs and tissues. The influence of the mass of the target tissue and activities due to {sup 238}U and {sup 232}Th on the committed equivalent doses due to annual intakes of these radionuclides in the organs and tissues of the human body was studied. (authors)

  15. Comparative study of intravenous urographic bolus (I.U.B.) and intravenous urographic infusion (I.U.I.) in dogs

    International Nuclear Information System (INIS)

    Thibaut L, Julio; Ditzel, G.; Vargas, L; Born, R; Deppe G, Rodolfo

    1996-01-01

    Two urographic methods were compared: the intravenous urographic bolus (i.u.b.) and the intravenous urographic infusion (i.u.i.). In both methods, two groups of seven healthy adult dogs of both sexes, weighing7.0 to 16.5 kg were used and were anaesthesized with 2% thiopentone sodium in doses of 20 mg/kg via cephalica. In the i.u.b., meglumine diatrizoate (Hypaque-M, 60%) was injected via saphena with a concentration of 282 mg of iodine per mi in doses of 564 mg of iodine per kg. In the i.u.i., meglumine diatrizoate was injected via saphena by drip infusion with a concentration of 200 mg of iodine per mi in doses of 500 mg of iodine per kg. Three series of two X-rays each were taken in ventrodorsal projection 1, 4 and 8 min and left lateral recumbency 30 sec after administering the contrast medium. The X-ray plates obtained were analyzed and compared intra and inter group considering the advance speed of the contrast medium, the radiographic density and outline, and kidney size. The advance speed of the contrast medium was higher in the i.u.i., reaching the kidney, ureter and bladder 1 min after administration in both projections; in ventrodorsal projections in the i.u.b. only the kidneys were reached while in the left lateral recumbency, the kidney and ureters were reached [es

  16. Flipped SU(5) times U(1) in superconformal models

    Energy Technology Data Exchange (ETDEWEB)

    Bailin, D.; Katechou, E.K. (Sussex Univ., Brighton (United Kingdom). School of Mathematical and Physical Sciences); Love, A. (London Univ. (United Kingdom))

    1992-01-10

    This paper reports that flipped SU(5) {times} U(1) models are constructed in the framework of tensoring of N = 2 superconformal minimal models quotiented by discrete symmetries. Spontaneous breaking of flipped SU(5) {times} U(1) and extra U(1) factors in the gauge group along F-flat directions of the effective potential is studied.

  17. Geologic framework for the assessment of undiscovered oil and gas resources in sandstone reservoirs of the Upper Jurassic-Lower Cretaceous Cotton Valley Group, U.S. Gulf of Mexico region

    Science.gov (United States)

    Eoff, Jennifer D.; Dubiel, Russell F.; Pearson, Ofori N.; Whidden, Katherine J.

    2015-01-01

    The U.S. Geological Survey (USGS) is assessing the undiscovered oil and gas resources in sandstone reservoirs of the Upper Jurassic–Lower Cretaceous Cotton Valley Group in onshore areas and State waters of the U.S. Gulf of Mexico region. The assessment is based on geologic elements of a total petroleum system. Four assessment units (AUs) are defined based on characterization of hydrocarbon source and reservoir rocks, seals, traps, and the geohistory of the hydrocarbon products. Strata in each AU share similar stratigraphic, structural, and hydrocarbon-charge histories.

  18. Sexual behavior in pregnancy: comparing between sexual education group and nonsexual education group.

    Science.gov (United States)

    Wannakosit, Salakjit; Phupong, Vorapong

    2010-10-01

    Sexuality usually decreases during pregnancy. To evaluate sexual behavior during pregnancy, comparing two groups. One had sexual education and the other had none. After randomizing two groups of pregnant women, they completed self-administered questionnaires regarding attitudes and sexual behavior before and during pregnancy. Sexual education was provided in one group and a second self-administered questionnaire was completed 12 weeks later. Responses were summarized using descriptive statistics. Comparison of change of sexual behavior between two groups was analyzed using chi-square and student t-tests. The change in frequency of coitus during pregnancy was compared between the sexual education group and the noneducation group. There was no statistically difference in changes of sexual behavior between the two groups. There was a reduction in frequency of coitus (90.6% vs. 94.9%, P>0.05) between the nonsexual education group and the sexual education group and no statistically significant change in mean reduction of sexual desire (8.9 vs. 4.4, P>0.05), sexual arousal (14.3 vs. 13.1, P>0.05), satisfaction from coitus (15.4 vs. 7.2, P>0.05), and orgasm from coitus (12.3 vs. 12.3, P>0.05). The change of sexual behavior during pregnancy in the sexual education group was not different from that in the nonsexual education group. © 2010 International Society for Sexual Medicine.

  19. U.S. nuclear industry

    International Nuclear Information System (INIS)

    Sherman, R.

    1979-01-01

    At present, 72 power reactors are in the condition of being able to operate in U.S., and the total installation capacity has reached 55 million kW, which is equivalent to about 9.5% of the total power generation capacity in U.S. The nuclear power stations produced 12.5% of the total electricity consumption in 1978. Especially in the north eastern part of the U.S., the nuclear power generation occupied 42% of the total power generation at the time of recent peak load, and 47 million barrels of crude oil and 517 million dollars of foreign currency were able to be saved. Moreover, 96 plants amounting to 105 million kW are under construction, and 30 plants of 35 million kW were ordered. Electric power companies, nuclear reactor makers, nuclear fuel and other related industries believe the merits of nuclear power generation and expect that it will flourish if a certain problem is solved. Especially serious problem to which the U.S. nuclear industry is facing now is the problem of uncertainty. Many orders of nuclear power plants have been canceled, and the constructions have been postponed. The capability of the U.S. nuclear industry to construct more than the required facilities, and its extent and the necessary conditions have been investigated by the Atomic Industrial Forum. The important national and international problems of atomic energy are discussed. (Kako, I.)

  20. 12 CFR 34.24 - Nonfederally chartered commercial banks.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Nonfederally chartered commercial banks. 34.24... LENDING AND APPRAISALS Adjustable-Rate Mortgages § 34.24 Nonfederally chartered commercial banks. Pursuant to 12 U.S.C. 3803(a), a State chartered commercial bank may make ARM loans in accordance with the...

  1. Reconstructing Eolian Delivery to the Ulleung Basin (IODP Site U1430) Over the Past 12 Myr

    Science.gov (United States)

    Anderson, C. H.; Dunlea, A. G.; Murray, R. W.; Tada, R.; Alvarez Zarikian, C. A.

    2017-12-01

    Spring storms associated with the seasonal phases of the East Asian Monsoon (EAM), transport dust seaward and influence marine sedimentation in adjacent ocean regions. Here, we aim to track changes in the intensity of the EAM since the late Miocene by examining the relative proportions and sources of eolian inputs in marine sediment records. We use bulk sediment recovered from Site U1430 in the Ulleung Basin during Integrated Ocean Drilling Program Expedition 346 in 2013 to examine changes in the EAM over the past 12 Myr. Sediment recovered at this site is clayey silt, nannofossil and diatom oozes, claystone, and basal glauonitic sandstone. We analyze major, trace, and rare earth element concentrations for 72 bulk sediment samples analyzed by ICP-ES and ICP-MS, and interpret this dataset using a variety of multivariate statistical partitioning techniques (Q-mode Factor Analyses (QFA), Multiple Linear Regressions) to investigate sediment provenance. Sedimentologic observations and elemental concentrations indicate the presence of biogenic siliceous and carbonaceous components mixed with aluminosilicates. For example, Si/Al (g/g) reaches local maxima at 3 Ma and 10 Ma in several diatom rich sections, and Ca/Al (g/g) exhibits a peak at 0.58 Ma. Other downhole element ratios exhibit subtle variations, including Ti/Al of 0.05 +/- 0.004 g/g, Sc/Al 2 +/- 0.2 ug/g, and Rb/Al 17 +/- 1.5 ug/g. When plotted in ternary diagrams, samples exhibit offset arrays (La-Th-Sc) or multiple clusters (Zr-Nb-Sc) from an Upper Continental Crust and Mid-Ocean Ridge Basalt mixing line. In Th-Cr-Nb, the data exhibit a V-shaped array. The range of geochemical variability suggests that multiple sources of terrigenous matter and/or volcanic ash are being delivered to the site. The multivariate statistics also indicate the mixing of multiple aluminosilicate sources. Focusing on a suite of seven elements (Al, Ti, Sc, Cr, Rb, Th, La), preliminary QFA suggest that five factors are required to

  2. Calendar Year 2006 Groundwater Monitoring Report, U.S Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    N/A

    2007-09-01

    This report contains the groundwater and surface water monitoring data that were obtained during calendar year (CY) 2006 at the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) on the DOE Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The CY 2006 monitoring data were obtained from wells, springs, and surface water sampling locations in three hydrogeologic regimes at Y-12 (Figure A.1). The Bear Creek Hydrogeologic Regime (Bear Creek Regime) encompasses a section of Bear Creek Valley (BCV) between the west end of Y-12 and the west end of the Bear Creek Watershed (directions are in reference to the Y-12 grid system). The Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime) encompasses the Y-12 industrial facilities and support structures in BCV. The Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime) encompasses a section of Chestnut Ridge directly south of Y-12. Section 2 of this report provides background information pertinent to groundwater and surface water quality monitoring in each hydrogeologic regime, including the topography and bedrock geology, surface water drainage, groundwater system, and extent of groundwater contamination. The CY 2006 groundwater and surface water monitoring data in this report were obtained from sampling and analysis activities implemented under the Y-12 Groundwater Protection Program (GWPP) managed by BWXT Y-12, L.L.C. (BWXT), and from sampling and analysis activities implemented under several monitoring programs managed by Bechtel Jacobs Company LLC (BJC). Cooperative implementation of the monitoring programs directed by the Y-12 GWPP and BJC (i.e., preparing SAPs, coordinating sample collection, and sharing data) ensures that the CY 2006 monitoring results fulfill requirements of all the applicable monitoring drivers with no duplication of sampling and analysis efforts. Section 3 of this report contains a summary of information regarding the groundwater and

  3. Optimization of photometric determination of U with arsenazo III for direct determination of U in steels, soils and waters

    International Nuclear Information System (INIS)

    Kosturiak, A.; Talanova, A.; Rurikova, D.; Kalavska, D.

    1984-01-01

    Conditions were optimized for the reaction of U(VI) with arsenazo III. Recommended as the optimal medium for photometric determination of uranium in the concentration range 0.5 to 50 μg U/ml was the glycine buffer with pH 1.2 to 2.2. The results of the suggested method have better reproducibility than those of the mineral acid procedure used so far. Complexone III should be added to mask the other cations accompanying uranium in steels, waters and rocks. (author)

  4. Calendar Year 2005 Groundwater Monitoring Report, U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    None

    2006-09-01

    This report contains the groundwater and surface water monitoring data that were obtained during calendar year (CY) 2005 at the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) on the DOE Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The CY 2005 monitoring data were obtained from groundwater and surface water sampling locations in three hydrogeologic regimes at Y-12 (Figure A.1). The Bear Creek Hydrogeologic Regime (Bear Creek Regime) encompasses a section of Bear Creek Valley (BCV) between the west end of Y-12 and the west end of the Bear Creek Watershed (directions are in reference to the Y-12 grid system). The Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime) encompasses the Y-12 industrial facilities and support structures in BCV. The Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime) encompasses a section of Chestnut Ridge south of Y-12. The CY 2005 monitoring data were obtained under the Y-12 Groundwater Protection Program (GWPP) managed by BWXT Y-12, L.L.C. (BWXT) and several monitoring programs managed by Bechtel Jacobs Company LLC (BJC). Data contained in this report meet applicable requirements of DOE Order 450.1 (Environmental Protection Program) regarding evaluation of groundwater and surface water quality in areas: (1) which are, or could be, affected by operations at Y-12 (surveillance monitoring); and (2) where contaminants from Y-12 are most likely to migrate beyond the boundaries of the ORR (exit pathway/perimeter monitoring). However, detailed analysis, evaluation, and interpretation of the CY 2005 monitoring data is deferred to the ''Y-12 Groundwater Protection Program Groundwater Monitoring Data Compendium'' (BWXT 2006). For each monitoring well, spring, and surface water sampling station included in this report, the GWPP Compendium provides: (1) pertinent well installation and construction information; (2) a complete sampling history, including

  5. Calendar Year 2004 Groundwater Monitoring Report, U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    N/A

    2005-09-01

    This report contains the groundwater and surface water monitoring data that were obtained during calendar year (CY) 2004 at the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) on the DOE Oak Ridge Reservation (ORR) in Oak Ridge, Tennessee. The CY 2004 monitoring data were obtained from groundwater and surface water sampling locations in three hydrogeologic regimes at Y-12 (Figure A.1). The Bear Creek Hydrogeologic Regime (Bear Creek Regime) encompasses a section of Bear Creek Valley (BCV) between the west end of Y-12 and the west end of the Bear Creek Watershed (directions are in reference to the Y-12 grid system). The Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime) encompasses the Y-12 industrial facilities and support structures in BCV. The Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime) encompasses a section of Chestnut Ridge south of Y-12. The CY 2004 monitoring data were obtained under the Y-12 Groundwater Protection Program (GWPP) managed by BWXT Y-12, L.L.C. (BWXT) and several monitoring programs managed by Bechtel Jacobs Company LLC (BJC). Data contained in this report meet applicable requirements of DOE Order 450.1 (Environmental Protection Program) regarding evaluation of groundwater and surface water quality in areas: (1) which are, or could be, affected by operations at Y-12 (surveillance monitoring); and (2) where contaminants from Y-12 are most likely to migrate beyond the boundaries of the ORR (exit pathway/perimeter monitoring). However, detailed analysis, evaluation, and interpretation of the CY 2004 monitoring data is deferred to the Y-12 Groundwater Protection Program Groundwater Monitoring Data Compendium (BWXT 2005). For each monitoring well, spring, and surface water sampling station included in this report, the GWPP Compendium provides: (1) pertinent well installation and construction information; (2) a complete sampling history, including sampling methods and

  6. Comparative Study of Probiotic Ice Cream and Probiotic Drink on Salivary Streptococcus mutans Levels in 6-12 Years Age Group Children.

    Science.gov (United States)

    Mahantesha, Taranatha; Reddy, K M Parveen; Kumar, N H Praveen; Nara, Asha; Ashwin, Devasya; Buddiga, Vinutna

    2015-09-01

    Dental caries is one of the most common health problems in the world. Probiotics are one the various preventive methods to reduce dental caries. The aim of this study is to compare the effectiveness of probiotic ice cream and drink on salivary Streptococcus mutans levels in children of 6-12 years age group. A three phase study was carried out in children (n = 50) of 6-12 years age with zero decayed missing filled teeth (dmft)/DMFT. They were randomly divided into two equal groups. Saliva samples were collected before the consumptions of probiotic ice cream and probiotic drink. Colony count obtained was recorded as baseline data. For both groups probiotic ice cream and drink was given randomly for 7 days and a washout period of 90 days were given and then the saliva samples were collected and colony counting was done. Statistical analysis was performed using Student's paired t-test and multiple comparisons by Tukey's honest significant difference test which showed, there is a significant reduction in salivary S. mutans level in both groups after 7 days period. However, after washout period only probiotic ice cream showed reduction whereas drink did not. Also, there was no significant difference between probiotic ice cream and drink. Probiotic organisms definitely have a role in reducing the salivary S. mutans level and ice cream would be a better choice than drink. However, the prolonged use of the agents and their effects on caries is still to be determined.

  7. Forward J /ψ production in U + U collisions at √{sN N}=193 GeV

    Science.gov (United States)

    Adare, A.; Aidala, C.; Ajitanand, N. N.; Akiba, Y.; Akimoto, R.; Alexander, J.; Alfred, M.; Aoki, K.; Apadula, N.; Asano, H.; Atomssa, E. T.; Awes, T. C.; Azmoun, B.; Babintsev, V.; Bai, M.; Bai, X.; Bandara, N. S.; Bannier, B.; Barish, K. N.; Bathe, S.; Baublis, V.; Baumann, C.; Baumgart, S.; Bazilevsky, A.; Beaumier, M.; Beckman, S.; Belmont, R.; Berdnikov, A.; Berdnikov, Y.; Black, D.; Blau, D. S.; Bok, J. S.; Boyle, K.; Brooks, M. L.; Bryslawskyj, J.; Buesching, H.; Bumazhnov, V.; Butsyk, S.; Campbell, S.; Chen, C.-H.; Chi, C. Y.; Chiu, M.; Choi, I. J.; Choi, J. B.; Choi, S.; Christiansen, P.; Chujo, T.; Cianciolo, V.; Citron, Z.; Cole, B. A.; Cronin, N.; Crossette, N.; Csanád, M.; Csörgő, T.; Danley, T. W.; Datta, A.; Daugherity, M. S.; David, G.; Deblasio, K.; Dehmelt, K.; Denisov, A.; Deshpande, A.; Desmond, E. J.; Ding, L.; Dion, A.; Diss, P. B.; Do, J. H.; D'Orazio, L.; Drapier, O.; Drees, A.; Drees, K. A.; Durham, J. M.; Durum, A.; Engelmore, T.; Enokizono, A.; Esumi, S.; Eyser, K. O.; Fadem, B.; Feege, N.; Fields, D. E.; Finger, M.; Finger, M.; Fleuret, F.; Fokin, S. L.; Frantz, J. E.; Franz, A.; Frawley, A. D.; Fukao, Y.; Fusayasu, T.; Gainey, K.; Gal, C.; Gallus, P.; Garg, P.; Garishvili, A.; Garishvili, I.; Ge, H.; Giordano, F.; Glenn, A.; Gong, X.; Gonin, M.; Goto, Y.; Granier de Cassagnac, R.; Grau, N.; Greene, S. V.; Grosse Perdekamp, M.; Gu, Y.; Gunji, T.; Guragain, H.; Hachiya, T.; Haggerty, J. S.; Hahn, K. I.; Hamagaki, H.; Hamilton, H. F.; Han, S. Y.; Hanks, J.; Hasegawa, S.; Haseler, T. O. S.; Hashimoto, K.; Hayano, R.; He, X.; Hemmick, T. K.; Hester, T.; Hill, J. C.; Hollis, R. S.; Homma, K.; Hong, B.; Hoshino, T.; Hotvedt, N.; Huang, J.; Huang, S.; Ichihara, T.; Ikeda, Y.; Imai, K.; Imazu, Y.; Inaba, M.; Iordanova, A.; Isenhower, D.; Isinhue, A.; Ivanishchev, D.; Jacak, B. V.; Jeon, S. J.; Jezghani, M.; Jia, J.; Jiang, X.; Johnson, B. M.; Joo, K. S.; Jouan, D.; Jumper, D. S.; Kamin, J.; Kanda, S.; Kang, B. H.; Kang, J. H.; Kang, J. S.; Kapustinsky, J.; Kawall, D.; Kazantsev, A. V.; Key, J. A.; Khachatryan, V.; Khandai, P. K.; Khanzadeev, A.; Kijima, K. M.; Kim, C.; Kim, D. J.; Kim, E.-J.; Kim, G. W.; Kim, M.; Kim, Y.-J.; Kim, Y. K.; Kimelman, B.; Kistenev, E.; Kitamura, R.; Klatsky, J.; Kleinjan, D.; Kline, P.; Koblesky, T.; Kofarago, M.; Komkov, B.; Koster, J.; Kotchetkov, D.; Kotov, D.; Krizek, F.; Kurita, K.; Kurosawa, M.; Kwon, Y.; Lacey, R.; Lai, Y. S.; Lajoie, J. G.; Lebedev, A.; Lee, D. M.; Lee, G. H.; Lee, J.; Lee, K. B.; Lee, K. S.; Lee, S.; Lee, S. H.; Leitch, M. J.; Leitgab, M.; Lewis, B.; Li, X.; Lim, S. H.; Liu, M. X.; Lynch, D.; Maguire, C. F.; Makdisi, Y. I.; Makek, M.; Manion, A.; Manko, V. I.; Mannel, E.; Maruyama, T.; McCumber, M.; McGaughey, P. L.; McGlinchey, D.; McKinney, C.; Meles, A.; Mendoza, M.; Meredith, B.; Miake, Y.; Mibe, T.; Mignerey, A. C.; Milov, A.; Mishra, D. K.; Mitchell, J. T.; Miyasaka, S.; Mizuno, S.; Mohanty, A. K.; Mohapatra, S.; Montuenga, P.; Moon, T.; Morrison, D. P.; Moskowitz, M.; Moukhanova, T. V.; Murakami, T.; Murata, J.; Mwai, A.; Nagae, T.; Nagamiya, S.; Nagashima, K.; Nagle, J. L.; Nagy, M. I.; Nakagawa, I.; Nakagomi, H.; Nakamiya, Y.; Nakamura, K. R.; Nakamura, T.; Nakano, K.; Nattrass, C.; Netrakanti, P. K.; Nihashi, M.; Niida, T.; Nishimura, S.; Nouicer, R.; Novák, T.; Novitzky, N.; Nyanin, A. S.; O'Brien, E.; Ogilvie, C. A.; Oide, H.; Okada, K.; Orjuela Koop, J. D.; Osborn, J. D.; Oskarsson, A.; Ozawa, K.; Pak, R.; Pantuev, V.; Papavassiliou, V.; Park, I. H.; Park, J. S.; Park, S.; Park, S. K.; Pate, S. F.; Patel, L.; Patel, M.; Peng, J.-C.; Perepelitsa, D. V.; Perera, G. D. N.; Peressounko, D. Yu.; Perry, J.; Petti, R.; Pinkenburg, C.; Pinson, R.; Pisani, R. P.; Purschke, M. L.; Qu, H.; Rak, J.; Ramson, B. J.; Ravinovich, I.; Read, K. F.; Reynolds, D.; Riabov, V.; Riabov, Y.; Richardson, E.; Rinn, T.; Riveli, N.; Roach, D.; Rolnick, S. D.; Rosati, M.; Rowan, Z.; Rubin, J. G.; Ryu, M. S.; Sahlmueller, B.; Saito, N.; Sakaguchi, T.; Sako, H.; Samsonov, V.; Sarsour, M.; Sato, S.; Sawada, S.; Schaefer, B.; Schmoll, B. K.; Sedgwick, K.; Seele, J.; Seidl, R.; Sekiguchi, Y.; Sen, A.; Seto, R.; Sett, P.; Sexton, A.; Sharma, D.; Shaver, A.; Shein, I.; Shibata, T.-A.; Shigaki, K.; Shimomura, M.; Shoji, K.; Shukla, P.; Sickles, A.; Silva, C. L.; Silvermyr, D.; Singh, B. K.; Singh, C. P.; Singh, V.; Skolnik, M.; Slunečka, M.; Snowball, M.; Solano, S.; Soltz, R. A.; Sondheim, W. E.; Sorensen, S. P.; Sourikova, I. V.; Stankus, P. W.; Steinberg, P.; Stenlund, E.; Stepanov, M.; Ster, A.; Stoll, S. P.; Stone, M. R.; Sugitate, T.; Sukhanov, A.; Sumita, T.; Sun, J.; Sziklai, J.; Takahara, A.; Taketani, A.; Tanaka, Y.; Tanida, K.; Tannenbaum, M. J.; Tarafdar, S.; Taranenko, A.; Tennant, E.; Tieulent, R.; Timilsina, A.; Todoroki, T.; Tomášek, M.; Torii, H.; Towell, C. L.; Towell, R.; Towell, R. S.; Tserruya, I.; van Hecke, H. W.; Vargyas, M.; Vazquez-Zambrano, E.; Veicht, A.; Velkovska, J.; Vértesi, R.; Virius, M.; Vrba, V.; Vznuzdaev, E.; Wang, X. R.; Watanabe, D.; Watanabe, K.; Watanabe, Y.; Watanabe, Y. S.; Wei, F.; Whitaker, S.; White, A. S.; Wolin, S.; Woody, C. L.; Wysocki, M.; Xia, B.; Xue, L.; Yalcin, S.; Yamaguchi, Y. L.; Yanovich, A.; Yokkaichi, S.; Yoo, J. H.; Yoon, I.; You, Z.; Younus, I.; Yu, H.; Yushmanov, I. E.; Zajc, W. A.; Zelenski, A.; Zhou, S.; Zou, L.; Phenix Collaboration

    2016-03-01

    The invariant yields, d N /d y , for J /ψ production at forward rapidity (1.2 <|y |<2.2 ) in U +U collisions at √{sNN}=193 GeV have been measured as a function of collision centrality. The invariant yields and nuclear-modification factor RA A are presented and compared with those from Au +Au collisions in the same rapidity range. Additionally, the direct ratio of the invariant yields from U +U and Au +Au collisions within the same centrality class is presented, and used to investigate the role of c c ¯ coalescence. Two different parametrizations of the deformed Woods-Saxon distribution were used in Glauber calculations to determine the values of the number of nucleon-nucleon collisions in each centrality class, Ncoll, and these were found to give significantly different Ncoll values. Results using Ncoll values from both deformed Woods-Saxon distributions are presented. The measured ratios show that the J /ψ suppression, relative to binary collision scaling, is similar in U +U and Au +Au for peripheral and midcentral collisions, but that J /ψ show less suppression for the most central U +U collisions. The results are consistent with a picture in which, for central collisions, increase in the J /ψ yield due to c c ¯ coalescence becomes more important than the decrease in yield due to increased energy density. For midcentral collisions, the conclusions about the balance between c c ¯ coalescence and suppression depend on which deformed Woods-Saxon distribution is used to determine Ncoll.

  8. Site status monitoring report for underground storage tanks 1219-U, 1222-U, 2082-U, and 2068-U at the Rust Garage Facility, Buildings 9720-15 and 9754-1, Oak Ridge Y-12 Plant, Oak Ridge, Tennessee, Facility ID No. 0-010117

    International Nuclear Information System (INIS)

    1994-10-01

    The purpose of this document is to provide hydrogeologic, geochemical, and vapor monitoring data required for site status monitoring of underground storage tanks (UST) 1219-U, 1222-U, 2082-U, and 2068-U at the Rust Garage Facility. Comprehensive monitoring was conducted at the site in May 1994 as part of a Monitoring Only program approved by Tennessee Department of Environment and Conservation (TDEC) based on review and approval of Site Ranking. This document presents the results of the first semiannual site status monitoring, which was conducted in September 1994. Site status monitoring and preparation of this report have been conducted in accordance with the requirements of the TDEC Rule 1200-1-15, the TDEC UST Reference Handbook, Second Edition, and direction from TDEC. This document is organized into three sections. Section 1 presents introductory information relative to the site including regulatory initiative and a site description. Section 2 includes the results of sampling of monitoring wells GW-508, GW-631, GW-632, and GW-634. Section 3 presents data from vapor monitoring conducted in subsurface utilities present at the site

  9. 19 CFR 172.12 - Petitions acted on at Customs Headquarters.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Petitions acted on at Customs Headquarters. 172.12 Section 172.12 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... Petitions § 172.12 Petitions acted on at Customs Headquarters. Upon receipt of a petition for relief filed...

  10. Concentration of acrylamide in a polyacrylamide gel affects VP4 gene coding assignment of group A equine rotavirus strains with P[12] specificity

    Science.gov (United States)

    2010-01-01

    Background It is universally acknowledged that genome segment 4 of group A rotavirus, the major etiologic agent of severe diarrhea in infants and neonatal farm animals, encodes outer capsid neutralization and protective antigen VP4. Results To determine which genome segment of three group A equine rotavirus strains (H-2, FI-14 and FI-23) with P[12] specificity encodes the VP4, we analyzed dsRNAs of strains H-2, FI-14 and FI-23 as well as their reassortants by polyacrylamide gel electrophoresis (PAGE) at varying concentrations of acrylamide. The relative position of the VP4 gene of the three equine P[12] strains varied (either genome segment 3 or 4) depending upon the concentration of acrylamide. The VP4 gene bearing P[3], P[4], P[6], P[7], P[8] or P[18] specificity did not exhibit this phenomenon when the PAGE running conditions were varied. Conclusions The concentration of acrylamide in a PAGE gel affected VP4 gene coding assignment of equine rotavirus strains bearing P[12] specificity. PMID:20573245

  11. 19 CFR 115.12 - Records maintained by Certifying Authority.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Records maintained by Certifying Authority. 115.12 Section 115.12 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS...

  12. Note on the two inequivalent spin 1/2 baryon field operators

    International Nuclear Information System (INIS)

    Christos, G.A.

    1985-01-01

    There are two inequivalent spin 1/2 local baryon field operators that can be constructed from 3 quarks. A priori the Jsup(P)=1/2 + baryons can couple to any linear combination of these operators. We show however that the coupling of the 1/2 + baryons to these operators is determined by the value of the SU(3) ratio of F to D type peudoscalar-baryon couplings. The experimental value of this ratio implies, for example, that the proton couples strongly to (usup(T)Cγ 5 d)u and weakly to (usup(T)Cd)γ 5 u. This is of interest in QCD sum rule applications. (orig.)

  13. 12 CFR 268.101 - General policy for equal opportunity.

    Science.gov (United States)

    2010-01-01

    ... Discrimination in Employment Act (ADEA) (29 U.S.C. 621 et seq.), the Equal Pay Act (29 U.S.C. 206(d)), or the... 12 Banks and Banking 3 2010-01-01 2010-01-01 false General policy for equal opportunity. 268.101... RESERVE SYSTEM RULES REGARDING EQUAL OPPORTUNITY Board Program To Promote Equal Opportunity § 268.101...

  14. An investigation on drug resistance of viridance group streptococci isolated from 3-12 years healthy individuals

    Directory of Open Access Journals (Sweden)

    Abasalt Borji

    2010-11-01

    Full Text Available Background: Nowadays, dental and oral infections are regarded as major threats to human health whose treatments are always prime concern of dental surgeons. Staphylococci, streptococci, actinomycetes and mycoplasma are the most common causative agents of such infections.The objective of this study was to investigate drug resistance of viridance group streptococci (VGS isolated from healthy children between 3-12 years old versus common antibiotics utilized in dentistry. The findings of this study can help dentists using the antibiotic of choice in remedial practices as well as assessment of sensitivity or resistance of VGS.Materials and Method: In this cross sectional study saliva samples from of 213 healthy children aged between 3-12 years from their buccal surface of posterior teeth were collected and after culture. species were isolated. Next, drug sensitivity test was carried out by disc diffusion technique to find out sensitivity or resistance of VGS to penicillin, erythromycin, vancomycin, clindamycin, cephotaxim and cephteriaxon.Result: Our findings revealed that resistance of VGS to antibiotics including: clindamycin, penicillin, cephteriaxon, erythromycin, vancomycin and cephotaxim was 59.6%, 52.6%, 30.5%, 12.2%, 10.8% and 1.5% and sensitivity of VGS to such antibiotics was 19.7%, 29.6%, 23%, 13.4%, 4.5% and 29.6% respectively.Conclusion: The results showed widespread resistance of VGS against chosen antibiotics, this indicates considerable use of antibiotics in this region.Controlled use and prescription of different antibiotics as well as increasing people knowledge about misuse of antibiotics in order to decrease the drug resistance is important

  15. Home Bias in U.S. Beer Consumption

    OpenAIRE

    Lopez, Rigoberto A.; Matschke, Xenia

    2007-01-01

    We apply the Berry, Levinsohn and Pakes (1995) market equilibrium model (BLP) to data from 30 brands of beers sold in 12 U.S. cities over 20 quarters (1988-92) to estimate the consumers taste for beer characteristics (price, alcohol content, and calories) as well as for the cultural region of origin (USA, Anglo-European, Germanic, and countries bordering the U.S.). Consumer heterogeneity is allowed with respect to age, income and gender. Overall we end up with 7,200 beer brand observations (3...

  16. Prothrombin fragment 1+2 in urine as a marker on coagulation activity in patients with suspected pulmonary embolism.

    Science.gov (United States)

    Wexels, Fredrik; Dahl, Ola E; Pripp, Are H; Seljeflot, Ingebjørg; Borris, Lars C; Haslund, Anniken; Gudmundsen, Tor E; Lauritzen, Trine; Lassen, Michael R

    2014-07-01

    We have recently reported that increased levels of urine prothrombin fragment 1+2 reflected radiologically verified deep vein thrombosis. In this study we evaluated whether urine prothrombin fragment 1+2 was associated with pulmonary embolism in non-selected patients. Patients with clinical suspected pulmonary embolism were interviewed on comorbidities and medications. Urine was collected from each patient before radiological examination and snap frozen until analysed on urine prothrombin fragment 1+2 with an ELISA kit. Imaging of the pulmonary arteries were conducted with contrast enhanced computer tomography. Pulmonary embolism was diagnosed in 44/197 patients. Non-significantly higher urine prothrombin fragment 1+2 levels were found in non-selected patients with pulmonary embolism vs. those without (p=0.324). Significantly higher urine prothrombin fragment 1+2 levels were found in the pulmonary embolism positive patients without comorbidities (n=13) compared to the control group (n=28) (p=0.009). The calculated sensitivity, specificity and negative predictive value using the lowest detectable urine prothrombin fragment 1+2 level was 82%, 34% and 87%, respectively. There was no significant urine prothrombin fragment 1+2 level difference in patients with and without pulmonary embolism. In non-comorbide pulmonary embolism positive patients the urine prothrombin fragment 1+2 levels were significantly higher compared to the control group. The negative predictive value found in this study indicates that uF1+2 has the potential to identify patients with a low risk of PE. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. Some thoughts to realignment of PortalU

    Energy Technology Data Exchange (ETDEWEB)

    Konstantinidis, Stefanie; Kruse, Fred [Lower Saxony Ministry of Environment and Climate Protection, Hannover (Germany). Coordination Centre PortalU

    2013-07-01

    Environmental information is the basis for improving the environmental situation in the EU. The challenge poses the tailoring of information to a defined group of interest and not only the technical possibility to retrieve the environmental information. Even though, the technical infrastructure for retrieving public environmental information is the first step. Hence, the clear understanding of the needs of the general public is essential for a successful environmental information portal for the interest group ''general public''. What does this mean referring to the German Environmental Information Portal PortalU? Since the launch of PortalU the focus of the portal is set on making available official environmental information especially on German Federal Republic and Federal States level. Currently, information from web pages represents the greatest amount of information. In contrast, information from environmental data catalogs and further data bases represent a smaller amount of information within PortalU. But quantity itself does not tell anything about the demand of a target group. The experience of the last years has shown that environmental interested citizens use mainly general search engines like Google to find information from public environmental web pages. Thus it would be worth thinking about a realignment of PortalU. The idea of a prospective alignment of PortalU is to concentrate on important environmental information, which is not easily found via Google and other general search engines. This information is mainly provided via environmental data catalogs and possibly further data bases. Some thoughts about the potential form and design of a respectively aligned environmental portal are discussed in the paper. (orig.)

  18. Medicaid Enrollment - New Adult Group

    Data.gov (United States)

    U.S. Department of Health & Human Services — Total Medicaid Enrollees - VIII Group Break Out Report Reported on the CMS-64 The enrollment information is a state-reported count of unduplicated individuals...

  19. The Effect of Early Diagenesis on the 238U/235U Ratio of Platform Carbonates.

    Science.gov (United States)

    Tissot, F.; Chen, C.; Go, B. M.; Naziemiec, M.; Healy, G.; Swart, P. K.; Dauphas, N.

    2017-12-01

    In the past 15 years, the so-called non-traditional stable isotopes systems (e.g., Mg, Fe, Mo, U) have emerged as powerful tracers of both high-T and low-T geochemical processes (e.g., [1]). Of particular interest for paleoredox studies is the ratio of "stable" isotopes of U (238U/235U), which has the potential to track the global extent of oceanic anoxia (e.g., [2, 3]). Indeed, in the modern ocean, U exists in two main oxidation states, soluble U6+ and insoluble U4+, and has a mean residence time of 400 kyr ([4]), much longer than the global ocean mixing time (1-2 kyr). As such the salinity-normalized ocean is homogeneous with regards to both U concentrations and isotopes (δ238USW = -0.392±0.005 ‰, [2]). The value of δ238USW at any given time is therefore the balance between U input to the ocean, mainly from rivers, and U removal, mostly into biogenic carbonates, anoxic/euxinic sediments and suboxic/hypoxic sediments (e.g., [2, 5]). Because the 238U/235U ratio of the past ocean cannot be measured directly, it has to be estimated from the measurement of the 238U/235U ratio of a sedimentary rock and assuming a constant fractionation factor. Carbonates appear as a promising record since they span most of Earth's history, and the δ238U values of modern primary carbonate precipitates and well-preserved fossil aragonitic coral up to 600 ka are indistinguishable from that of seawater (e.g., [2, 6, 7]). Yet, the effect of secondary processes on the δ238U values of non-coral carbonates, which represent the bulk of the rock record, has only been studied in a handful of shallow samples (down to 40cm, [6]) and remains poorly understood. To investigate the effect of early diagenesis on the 238U/235U ratio of carbonates on the 30kyr to 1Myr timescale, we measured δ13C, δ18O, and δ238U in samples from a 220m long drill core from the Bahamas carbonate platform. In order to separate lattice bound U from secondary U we developed a leaching protocol applicable to carbonate

  20. 12 CFR 1261.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Banking FEDERAL HOUSING FINANCE AGENCY FEDERAL HOME LOAN BANKS FEDERAL HOME LOAN BANK DIRECTORS Federal Home Loan Bank Boards of Directors: Eligibility and Elections § 1261.1 Definitions. As used in this Subpart A: Act means the Federal Home Loan Bank Act, as amended (12 U.S.C. 1421 through 1449). Bank...

  1. Isotope shift of 234U, 236U, 238U in U I

    International Nuclear Information System (INIS)

    Gagne, J.M.; Nguyen Van, S.; Saint-Dizier, J.P.; Pianarosa, P.

    1976-01-01

    New and very accurate data of isotope shifts and relative isotope shifts in 234 U, 236 U, 238 U are presented. The invariance of the relative isotope shift, for the transitions we have investigated, supports the hypothesis that the so called specific mass effect is negligible in uranium

  2. 16 CFR 1018.12 - Statutory advisory committees.

    Science.gov (United States)

    2010-01-01

    ... Federal Hazardous Substances Act, as amended (Pub. L. 95-631, 92 Stat. 3747, 15 U.S.C. 1275). [46 FR 63248... MANAGEMENT Establishment of Advisory Committees § 1018.12 Statutory advisory committees. The Commission has...

  3. Joint U. S. --U. S. S. R. test of U. S. MHD electrode systems in U. S. S. R. U-02 MHD facility (phase I). Final report

    Energy Technology Data Exchange (ETDEWEB)

    Hosler, W R [ed.

    1976-01-01

    The first (Phase I) joint U.S.-U.S.S.R. test of U.S. electrode materials was carried out in Moscow between September 25 and October 8, 1975 in the Soviet U-02 MHD facility. The test procedure followed closely a predetermined work plan designed to test five different zirconia based materials and the cathode and anode electrode wall modules under MHD operating conditions. The materials which were selected were 88Zr0/sub 2/-12Y/sub 2/0/sub 3/, 82Zr0/sub 2/-18Ce02, 50Zr0/sub 2/-50Ce0/sub 2/, 25Zr0/sub 2/-75Ce0/sub 2/ and 20Zr0/sub 2/-78Ce0/sub 2/-2Ta/sub 2/0/sub 5/. The electrode modules were constructed by Westinghouse Research and Development Laboratory. Each of the five electrode materials had four different current densities established between the anode and cathode during the experiment which lasted a total of 127 hours. There were four main phases in the test schedule: (1) start-up of the channel over a specific heating period. No seed (K/sub 2/C0/sub 3/) introduction - 18 hours. (2) Electrical tests at operating temperature to investigate electro-physical characteristics of the channel and electrodes - 6 hours. (3) Operating life test - 94 hours. (4) Shut-down of the channel over a specific cool down period - 9 hours. All except six electrode pairs performed satisfactorily during the entire test. These were the pairs which were designated to carry maximum or near maximum current density. Five pairs failed early in the life test and the sixth pair failed in the last several hours. Failure was not due to the electrode materials, however, but due to lead-out melting caused by joule heating in the platinum wires. The U-02 facility is described and the operational parameters are given for each phase of the test. The electrode and insulating walls are described and the appropriate parameters that are used to predict the performance of the module are given.

  4. 22 CFR 94.8 - Interagency coordinating group.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Interagency coordinating group. 94.8 Section 94... § 94.8 Interagency coordinating group. The U.S. Central Authority shall nominate federal employees and may, from time to time, nominate private citizens to serve on an interagency coordinating group to...

  5. 12 CFR 1510.1 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Authority, purpose, and scope. 1510.1 Section 1510.1 Banks and Banking DEPARTMENT OF THE TREASURY RESOLUTION FUNDING CORPORATION RESOLUTION FUNDING... section 21B(l) of the Federal Home Loan Bank Act (12 U.S.C. 1441b(l)). (b) Purpose and scope. The purpose...

  6. Spectral shift controlled reactors, denatured U-233/thorium cycle

    International Nuclear Information System (INIS)

    1978-05-01

    This paper presents technical and economic data on the SSCR which may be of use in the International Fuel Cycle Evaluation Program to intercompare alternative nuclear systems. Included in this paper are data on the denatured U-233/thorium cycle. This cycle shows a proliferation advantage over more classical thorium fuel cycle (e.g., highly-enriched U-235/thorium or plutonium/thorium) due to the elimination of chemically-separable, concentrated fissile material from unirradiated nuclear fuel. The U-233 is denatured by mixing with depleted uranium to a concentration no greater than 12 w/o. An exogenous source of U-233 is assumed in this paper, since U-233 does not occur in nature and only a limited supply has been produced to date for research and development work

  7. Y-12 old salvage yard scrap metal characterization study

    International Nuclear Information System (INIS)

    Anderson, L.M.; Melton, S.G.; Shaw, S.S.

    1993-11-01

    The purpose of the Y-12 Old Salvage Yard scrap metal Characterization Study is to make conservative estimates of the quantities of total uranium and the wt % 235 U contained in scrap metal. The original project scope included estimates of thorium, but due to the insignificant quantities found in the yards, thorium was excluded from further analysis. Metal in three of the four Y-12 scrap metal yards were characterized. The scrap metal yard east of the PIDAS fence is managed by the Environmental Restoration Program and therefore was not included in this study. For all Y-12 Plant scrap metal shipments, Waste Transportation, Storage, and Disposal (WTSD) personnel must complete a Request for Authorization to Ship Nuclear Materials, UCN-16409, which requires the grams of total uranium, the wt % 235 U, and the grams of 235 U contained in the shipment. This information is necessary to ensure compliance with Department of Transportation regulations, as well as to ensure that the receiving facility is adhering to its operating license. This characterization study was designed to provide a technical basis for determining these necessary radioactive quantities

  8. Experimental verification of reflector savings calculated by REDIR code using two-group method; Eksperimentalna provera dvogrupnog racunanja reflektorske ustede koriscenog u REDIR-u

    Energy Technology Data Exchange (ETDEWEB)

    Sotic, O; Martinc, R [Boris Kidric Institute of nuclear sciences Vinca, Belgrade (Yugoslavia)

    1968-12-15

    Radial buckling and reflector savings for heavy water reactor with 2% enriched uranium fuel were measured and calculated by the REDIR code. A comparison of the obtained values is presented in this paper dependent on the reactor lattice pitch and reflector thickness. Experimental results obtained for lattice pitch of 16 cm prove the validity of applying the REDIR code for power reactors. U radu je dato uporedjenje izmedju izmerenih i teorijski izracunatih vrednosti (prema programu REDIR) radijalnih baklinga i reflektorske ustede za teskovodni reaktorski sistem sa 2% obogacenim uranskim gorivom u zavisnosti od koraka resetke i debljine reflektora. Rezultati dobijeni eksperimentima pri koraku resetke od 16 cm potvdjuju ispravnost primene programa REDIR za energetske reaktore. (author)

  9. 19 CFR 181.12 - Maintenance and availability of records.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Maintenance and availability of records. 181.12 Section 181.12 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... or in automated record storage devices (for example, magnetic discs and tapes) if associated computer...

  10. Y-12 Groundwater Protection Program Calendar Year 2000 Groundwater Monitoring Data Evaluation Report for the Upper East Fork Poplar Creek Hydrogeologic Regime at the U.S. Department of Energy Y-12 National Security Complex, Oak Ridge, Tennessee; FINAL

    International Nuclear Information System (INIS)

    None

    2001-01-01

    This report presents an evaluation of the groundwater and surface water monitoring data obtained during calendar year (CY) 2000 in the Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime). The East Fork Regime encompasses many confirmed and potential sources of groundwater and surface water contamination associated with the U.S. Department of Energy (DOE) Y-12 National Security Complex (hereafter referenced as Y-12) in Oak Ridge, Tennessee. Prepared under the auspices of the Y-12 Groundwater Protection Program (GWPP), this report addresses applicable provisions of DOE Order 5400.1 (General Environmental Protection Program) that require: (1) an evaluation of the quantity and quality of groundwater and surface water in areas that are, or could be, affected by Y-12 operations, (2) an evaluation of groundwater and surface water quality in areas where contaminants from Y-12 operations are most likely to migrate beyond the DOE Oak Ridge Reservation (ORR) property line, and (3) an evaluation of long-term trends in groundwater quality at Y-12. The following sections of this report contain relevant background information (Section 2.0); describe the results of the respective data evaluations required under DOE Order 5400.1 (Section 3.0); summarize significant findings of each evaluation (Section 4.0); and list the technical reports and regulatory documents cited for more detailed information (Section 5.0). Illustrations (maps and trend graphs) are presented in Appendix A. Brief data summary tables referenced in each section are contained within the text; supplemental information and extensive data tables are provided in Appendix B

  11. Study of Nuclear Collisions of 86 MeV/a.m.u. $^{12}$C with Heavy Targets by Collection of the Heavy Recoil Nuclei

    CERN Multimedia

    2002-01-01

    The aim of this experiment is twofold:\\\\ \\\\ Firstly to test the possibilities of collection of the heavy recoil nuclei with the device presented schematically on the figure. The recoil nuclei escaping from the irradiated target are first thermalised in a gas (N^2). One then takes advantage of their remaining charge to collect them with an electric field on the surface of a solid state detector. Tests already performed with other beams give absolute efficiency around 5\\%. The best conditions of collections with very energetic |1|2C have first to be tested. Secondly to get some insight into nuclear reaction mechanisms induced by 86~MeV/a.m.u. |1|2C using the possibilities of this recoil chamber. Two kinds of mechanisms should occur in these interactions. If the incident energy is damped (deep inelastic reaction, fusion), the heavy nucleus will be highly excited and the residual nuclei will lie along the @G^n/@G^p~=~1~line. For heavy nuclei this line is located at about 25~mass units from the stability line. If ...

  12. Uranium isotopes in groundwaters from Tubarao Group, Parana Basin, Brazil

    International Nuclear Information System (INIS)

    Bonotto, D.M.; Caprioglio, L.

    1999-01-01

    The purpose of this work is to characterize the uranium isotopes 238-U and 234-U in some important deep tubular wells drilled at Tubarao Group, with the aim of verifying if the dissolution processes that are taking place within the aquifer can generate enhanced 234-U/238-U activity ratios like those found at the Botucatu-Piramboia aquifer. (author)

  13. 19 CFR 12.29 - Plumage and eggs of wild birds.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Plumage and eggs of wild birds. 12.29 Section 12... THE TREASURY SPECIAL CLASSES OF MERCHANDISE Wild Animals, Birds, and Insects § 12.29 Plumage and eggs of wild birds. (a) The provisions of Chapter 5, Additional U.S. Note 1, relating to the plumage of...

  14. 12 CFR 408.1 - Background.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Background. 408.1 Section 408.1 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES PROCEDURES FOR COMPLIANCE WITH THE NATIONAL ENVIRONMENTAL POLICY ACT General § 408.1 Background. (a) The National Environmental Policy Act (NEPA) of 1969 (42 U.S.C...

  15. 12 CFR 1231.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... to improve the financial condition of the regulated entity or is subject to a proceeding initiated by... financial condition of the regulated entity, unless otherwise informed in writing by the FHFA; or (2) Is... Enterprises Financial Safety and Soundness Act of 1992 (12 U.S.C. 4501 et seq.), as amended by the Federal...

  16. Neighborhood of 16S rRNA nucleotides U788/U789 in the 30S ribosomal subunit determined by site-directed crosslinking.

    OpenAIRE

    Mundus, D; Wollenzien, P

    1998-01-01

    Site-specific photo crosslinking has been used to investigate the RNA neighborhood of 16S rRNA positions U788/ U789 in Escherichia coli 30S subunits. For these studies, site-specific psoralen (SSP) which contains a sulfhydryl group on a 17 A side chain was first added to nucleotides U788/U789 using a complementary guide DNA by annealing and phototransfer. Modified RNA was purified from the DNA and unmodified RNA. For some experiments, the SSP, which normally crosslinks at an 8 A distance, was...

  17. Community of solution for the U.S. health care system: lessons from the U.S. educational system.

    Science.gov (United States)

    Devoe, Jennifer E; Gold, Rachel

    2013-01-01

    The Folsom Group asserts that radical changes are needed to fix the health care system in the United States. The U.S. education system is one potential model to emulate. Could a future health care system-level community of solution be modeled after the U.S. education system? Could community health care services be planned, organized, and delivered at the neighborhood level by district, similar to the structure for delivering public education? Could community health centers, governed by community boards, serve every neighborhood? This essay imagines how U.S. health care system reforms could be designed using our public school system as a roadmap. Our intention is to challenge readers to recognize the urgent need for radical reform in the U.S. health care system, to introduce one potential model for reform, and to encourage creative thinking about other system-level communities of solution that could lead to profound change and improvements in the U.S. health care system.

  18. RERTR-12 Insertion 1 Irradiation Summary Report

    International Nuclear Information System (INIS)

    Perez, D.M.; Lillo, M.A.; Chang, G.S.; Woolstenhulme, N.E.; Roth, G.A.; Wachs, D.M.

    2012-01-01

    The Reduced Enrichment for Research and Test Reactor (RERTR) experiment RERTR-12 was designed to provide comprehensive information on the performance of uranium-molybdenum (U-Mo) based monolithic fuels for research reactor applications. RERTR-12 insertion 1 includes the capsules irradiated during the first two irradiation cycles. These capsules include Z, X1, X2 and X3 capsules. The following report summarizes the life of the RERTR-12 insertion 1 experiment through end of irradiation, including as-run neutronic analysis results, thermal analysis results and hydraulic testing results.

  19. RERTR-12 Insertion 2 Irradiation Summary Report

    International Nuclear Information System (INIS)

    Perez, D.M.; Chang, G.S.; Wachs, D.M.; Roth, G.A.; Woolstenhulme, N.E.

    2012-01-01

    The Reduced Enrichment for Research and Test Reactor (RERTR) experiment RERTR-12 was designed to provide comprehensive information on the performance of uranium-molybdenum (U-Mo) based monolithic fuels for research reactor applications.1 RERTR-12 insertion 2 includes the capsules irradiated during the last three irradiation cycles. These capsules include Z, Y1, Y2 and Y3 type capsules. The following report summarizes the life of the RERTR-12 insertion 2 experiment through end of irradiation, including as-run neutronic analysis results, thermal analysis results and hydraulic testing results.

  20. New U.S. Foodborne Illness Estimate

    Centers for Disease Control (CDC) Podcasts

    2010-12-13

    This podcast discusses CDC's report on new estimates of illnesses due to eating contaminated food in the United States. Dr. Elaine Scallan, assistant professor at the University of Colorado and former lead of the CDCs FoodNet surveillance system, shares the details from the first new comprehensive estimates of foodborne illness in the U.S. since 1999.  Created: 12/13/2010 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID); National Center for Immunization and Respiratory Diseases (NCIRD).   Date Released: 12/15/2010.

  1. Urinary Prothrombin Fragment 1+2 in relation to Development of Non-Symptomatic and Symptomatic Venous Thromboembolic Events following Total Knee Replacement

    DEFF Research Database (Denmark)

    Borris, Lars Carl; Breindahl, Morten; Rud-Lassen, Michael

    2011-01-01

    Prothrombin fragment 1+2 is excreted in urine (uF1+2) as a result of in vivo thrombin generation and can be a marker of coagulation status after an operative procedure. This study compared uF1+2 levels in patients with symptomatic and non-symptomatic venous thromboembolism (VTE) after total knee...... replacement (TKR) and in event-free sex- and age-matched controls. Significantly higher median uF1+2 levels were seen in the VTE patients on days 1, 3, and the day of venography (mostly day 7) after TKR compared with controls. The uF1+2 levels tended to be high in some patients with symptomatic VTE; however...

  2. The Evaluation of Solid Phase Gastric Emptying in Patients with Behcet%u2019s Disease

    Directory of Open Access Journals (Sweden)

    Asena Cigdem Dogramaci

    2014-03-01

    Full Text Available Aim: Behcet%u2019s disease is a multisystemic disease that includes the mucocutaneous, ocular, cardiovascular, renal, pulmonary, joint and central nervous system involvement. Gastrointestinal system involvement is rare in Behcet%u2019s disease. Current study was planned to investigate the rate of gastric emptying in patients with Behcet%u2019s disease by using gastric emptying scintigraphy. Material and Method: In order to determine gastric emptying rate of solids, 14 patients with Behcet%u2019s disease and 14 healthy controls were studied scintigraphically. After an overnight fast, all subjects ingested a Tc- 99m DTPA labeled solid meal consisted of an egg and toasted white bread. Immediately after ingestion of the meal, subjects were positioned supine under the gamma camera and serial images were recorded continuously for 90 minutes. Half empyting time (t 1/2 and percentage of radioactive material remaining in the stomach at 60 min. were calculated. Results: The mean ages of Behcet%u2019s patients was 41.00±10.25 years and 40.57±10.05 years in control group. T ½ of Behcet%u2019s patients was found 85± 61 min. and 63±22 min. in control cases (p=0.122. Percentage of radioactive material remaining in the stomach at 60 min. was 69.3± 14.0 % and 54.6± 22.0 % in Behcet%u2019s patients and controls, respectively (p=0.035. Discussion: Although there was not a significant difference between half gastric emptying times, we determined that percentage of radioactive material remaining in the stomach at 60 min. was significantly greater in Behcet%u2019s patients than that in controls. As a result, gastric stasis could be seen in Behcet%u2019s patients due to multisystemic involvement.

  3. Fat Mass Follows a U-Shaped Distribution Based on Estradiol Levels in Postmenopausal Women

    Directory of Open Access Journals (Sweden)

    Georgia Colleluori

    2018-07-01

    Full Text Available ObjectiveEstradiol (E2 regulates adipose tissue resulting in increased fat mass (FM with declining E2. However, increased visceral fat and hyperestrogenemia are features of obese individuals. It is possible that adipocytes in obese individuals are less sensitive to E2 resulting in higher FM. Our objective is to identify the range of serum E2 for which postmenopausal women have the lowest FM and best body composition.MethodsCross-sectional data from 252 community-dwelling postmenopausal women, 42–90 years old. Subjects were stratified into categories of E2 (pg/ml: (1 ≤10.5; (2 10.6–13.9; (3 14.0–17.4; and (4 ≥17.5. Body composition by dual-energy X-ray absorptiometry. Serum E2 by radioimmunoassay. Between-group comparisons by analysis of covariance.ResultsE2 linearly increased with increasing body weight and body mass index (r = 0.15 and p = 0.01 for both, but not with total FM (kg or % FM (r = 0.07, p = 0.34 and r = −0.04, p = 0.56, respectively. However, total FM (kg followed a U-shaped distribution and was significantly lower in group 3 (27.6 ± 10.6, compared with groups 1: (34.6 ± 12.5, 2: (34.0 ± 12.4, and 4: (37.0 ± 10.6, p = 0.005. % FM was also lowest in group 3. While fat-free mass (FFM, kg increased with increasing E2 (p < 0.001, % FFM was highest in group 3.ConclusionIn our population of postmenopausal women, FM followed a U-shaped distribution according to E2 levels. E2 between 14.0 and 17.4 pg/ml is associated with the best body composition, i.e., lowest total and % FM and highest % FFM. Given the role of E2 in regulating body fat, high FM at the high end of the E2 spectrum may suggest reduced E2 sensitivity in adipocytes among obese postmenopausal women.Clinical TrialsClinicalTrials.gov identifier: NCT00146107.

  4. Vitamin B-12

    Science.gov (United States)

    Vitamin B-12 is a cofactor for 2 enzymes. In the cytoplasm, methionine synthase requires vitamin B-12 in the form of methylcobalamin and catalyzes the conversion of homocysteine to methionine by transfer of a methyl group from methyltetrahydrofolate.This enzyme links the methylation pathway through ...

  5. 12 CFR 5.47 - Subordinated debt as capital.

    Science.gov (United States)

    2010-01-01

    ... compliance concern, or raises a significant legal or policy issue. (ii) Tier 2 and Tier 3 capital. When the... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Subordinated debt as capital. 5.47 Section 5.47... capital. (a) Authority. 12 U.S.C. 93a. (b) Licensing requirements. A national bank does not need prior OCC...

  6. Cebollati group, Nico Perez terrane: Definition and age

    International Nuclear Information System (INIS)

    Gaucher, C; Chemale, F.; Bossi, J.; Castiglioni, E.; Castiglioni, E.

    2010-01-01

    The Cebollati Group (Nico Perez Terrane) is formally erected in this work to include a meta sedimentary succession informally known as L as Teta s Complex . It is shown that the stratigraphy of the unit can be reconstructed at a number of sections between Minas and Zapicìn, using sedimentary structures and stromatolites as geo petal indicators. The basement of the group is represented by metamorphic rocks and granitoids of the La China Complex, for which a new U-Pb zircon age of 3.029 ± 54 Ma is presented. The Cebollatií Group comprises, from base to top, three formations: the Arroyo Ma lo Formation (sandstones and petites), Cerro de Valuable Formation (dolostones, partly stromatolitic, and p elites) and the Cerro del Diamant e Formation (p elites, BIF, quartz-pebble conglomerates and sandstones). The mean thickness of the Cebollatií Group is ca. 2 km, being greatest in the south and diminishing to the north. Available ages for the unit suggested a Neoarchean depositional age of 2.75 Ga. However, in this work 12 Nd model ages are presented for sedimentary rocks of the Cebollatí Group, which are mostly younger than 2.75 Ga, the youngest being 1.64 Ga. These ages call into question the Neoarchean age accepted for the unit, suggesting a Meso proterozoic depositional age. The evidence supporting both views is discussed in view of the new data. The minimum age of the Cebollatí Group is 1.3 Ga on the basis of carbon isotope ratios of dolostones and deformational ages consistently around 1.25 Ga

  7. 12 CFR 362.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Governors of the Federal Reserve System (FRB), pursuant to section 7(j) of the Federal Deposit Insurance Act... FDIC's or FRB's regulations implementing section 7(j); (2) As a result of which a State bank eligible... requiring FRB approval under section 3 of the Bank Holding Company Act (12 U.S.C. 1842), other than a one...

  8. 12 CFR 411.105 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Definitions. 411.105 Section 411.105 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING General § 411.105 Definitions. For purposes of this part: (a) Agency, as defined in 5 U.S.C. 552(f), includes Federal executive...

  9. Electron transfer. 93. Further reactions of transition-metal-center oxidants with vitamin B12s (Cob(I)alamin)

    International Nuclear Information System (INIS)

    Pillai, G.C.; Ghosh, S.K.; Gould, E.S.

    1988-01-01

    Vitamin B 12s (cob(I)alamin) reduces europium(III), titanium(IV) (TiO(C 2 O 4 ) 2 2- ), and uranium(VI) in aqueous solution. These oxidants undergo one-electron changes, leading in each case to the cobalt product cob(II)alamin (B 12r ). The reduction of Eu 3+ , which is inhibited by TES buffer, but not by glycine, is outer sphere. Its limiting specific rate (1 x 10 2 M -1 s -1 ), incorporated in the Marcus treatment, yields a B 12s ,B 12r self-exchange rate of 10 4.8±0.5 M -1 s -1 . Reductions of TiO(C 2 O 4 ) 2 2- are accelerated by H + and by acetic acid. Kinetic patterns suggest three competing reaction paths involving varying degrees of protonation of the Ti(IV) center or its association with acetic acid. The very rapid reduction of U(VI) (k = 4 x 10 6 M -1 s -1 ) yields U(V) in several buffering media, even when B 12s is taken in excess. The much slower conversion of U(V) to U(IV), although thermodynamically favored, appears to be retarded by the extensive reorganization of the coordination sphere of oxo-bound U(V) that must accompany its acceptance of an additional electron. The observed specific rate for the B 12s -U(VI) reaction is in reasonable agreement, in the framework of the Marcus formalism, with reported values of the formal potential and the self-exchange rate for U(V,VI). 37 references, 4 tables

  10. The Influence of Uranium Content and PVA/U Ratio on Physical Propertiesof PVA-U Gel and Its Oxide

    International Nuclear Information System (INIS)

    Damunir; W, Bangun; Indra-Suryawan; Endang-Nawangsih

    2000-01-01

    The influence of uranium content and PVA/U ratio on physical propertiesof PVA-U gel and its oxide has been investigated. Fifty milliliters of uranylnitrate solution containing 100 g U/l was neutralized using 1M NH 4 0H. Thesolution was converted into PVA-U sol by adding 9.18 % PVA while mixed andheated at 80 o C for 20 minutes. In order to find spherical gel, the solsolution was dropped into a 5 M NH 4 0H solution at room temperature. Theshape formed of the gels small spherical, shape of the formed gels werefiltered, washed and heated at 120 o C. After that the gels were calcined at800 o C for 4 hours. The formed U 3 O 8 particles. Under a similar method, theinfluence of uranium content from 150-400 g/l and the influence of PVA/Uratio of 6.5-12.5 % in 100 g U/l were studied. Characterization of the resultwas obtained from physical properties of the gel and its oxide in the form ofdensity using pycnometer, surface area using surface areameter with N 2 asabsorbent and particle size/ shape using a loop and optical microscope. Theexperimental results showed that both uranium content and PVA/U ratioaffected the physical properties of the kernel properties. The best resultoccurred at uranium content of 100 g/l and PVA/U 9.18 %. The resulted gelwith solid content of 89.17 %, density of 3.36 g/l and size of 124 μm. Theresulted oxide U 3 0 8 had density of 7.98 g U/l, surface area of specific of0.449 m 2 /g and grain size of 810 μm. (author)

  11. Ion microprobe U-Pb dating of a dinosaur tooth

    International Nuclear Information System (INIS)

    Sano, Yuji; Terada, Kentaro; Ly, Chi V.; Park, Eun Ju

    2006-01-01

    Ion microprobe U-Pb dating of apatite is applied to a fossil tooth of a Allosaurid derived from the Hasandong Formation in the Gyeongsang basin, southeastern Korea. Twelve spots on a single fragment of the fossil dentine yield a Tera-Wasserburg concordia intercept age of 115±10 Ma (2σ, MSWD=0.59) on a 238 U/ 206 Pb- 207 Pb/ 206 Pb- 204 Pb/ 206 Pb diagram. The age provides a constraint on the depositional age of the fossil in its host Hassandong Formation as Early Aptian. The success of the ion microprobe dating depends on the heterogeneities of diagenetically incorporated U and Pb at the few hundred μm scale, the consequent variations in Pb isotopic compositions due to radioactive decay and the closed-system behavior of U and Pb. There are at least three end-members to explain the variations of minor chemical components such as FeO, SiO 2 and Al 2 O 3 , and trace elements as Th, U and rare earth elements (REE) in the sample by a simple mixing model. They are (1) very low minor and REE, very high common Pb with variable U abundances, (2) low common Pb, high minor, REE, and U abundances, and (3) low minor, common Pb, and U with intermediate REE abundances, even though groups (2) and (3) may consist of a larger group. Various contributions of the three (and/or two) end-members during diagenetic processes may cause the elemental fractionation of U and Pb in a fossil tooth. (author)

  12. Dicty_cDB: Contig-U15201-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-04 2 ( EX698640 ) GF_AW109651c08 AW1 Schistosoma mansoni cDNA clone... 44 2e-04 2 ( CD147...-0107T-L395-E12-U.B MG1-0107 Schistosoma manso... 44 2e-04 2 ( CD147233 ) ML1-0002T-M131-E11-U.G ML1-0002 Sc

  13. Y-12 Groundwater Protection Program Extent Of The Primary Groundwater Contaminants At The Y-12 National Security Complex

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2013-12-01

    This report presents data summary tables and maps used to define and illustrate the approximate lateral extent of groundwater contamination at the U.S. Department of Energy (DOE) Y-12 National Security Complex (Y-12) in Oak Ridge, Tennessee. The data tables and maps address the primary (i.e., most widespread and mobile) organic, inorganic, and radiological contaminants in the groundwater. The sampling locations, calculated contaminant concentrations, plume boundary values, and paired map format used to define, quantify, delineate, and illustrate the approximate extent of the primary organic, inorganic, and radiological contaminants in groundwater at Y-12 are described.

  14. New U.S. LHC Web site launched

    CERN Multimedia

    Katie Yurkewicz

    2007-01-01

    On September 12, the U.S. Department of Energy's Office of Science launched a new Web site, www.uslhc.us, to tell the story of the U.S. role in the LHC. The site provides general information for the public about the LHC and its six experiments, as well as detailed information about the participation of physicists, engineers and students from the United States. The U.S. site joins the UK's LHC site in providing information for a national audience, with sites from several more countries expected to launch within the next year. The US LHC site features news and information about the LHC, along with high-resolution images and resources for students and educators. The site also features blogs by four particle physicists, including ATLAS collaborators Monica Dunford from the University of Chicago and Peter Steinberg from Brookhaven National Laboratory. More than 1,300 scientists from over 90 U.S. institutions participate in the LHC and its experiments, representing universities and national laboratories from...

  15. Extraction of Th and U from Swiss granites

    International Nuclear Information System (INIS)

    Bajo, C.

    1980-12-01

    The extraction, at the laboratory level, of U and Th from Swiss granites is discussed. The Mittagfluh, Bergell and Rotondo granites and the Giuv syenite offered a wide range of U and Th concentrations; 7.7 to 20.0 ppm U and 25.5 to 67.0 ppm Th. U and Th were determined in the leach solutions by the fission track method and by spectrophotometry, respectively. Samples containing less than 0.3 μg U and 4 μg Th, could be measured with an accuracy of 10% for U and 5% for Th. Leach tests were performed during which the following parameters were varied: granite-type, grain size, acid-type, acid concentration, temperature and time. There were very great leaching differences between the granites studied. Temperature was the most important parameter. Sharp differences in extraction occurred between 20 0 C, 50 0 C and 80 0 C. At 80 0 C, more than 85% U and Th were extracted. The extraction curve (percent extracted as a function of time) of aliquots sampled after 1, 2, 4, 8, 12 and 24 hours showed a plateau after 8 hours. The half life of the reaction was between one and two hours. As a general rule, Th was better extracted than U. (Auth.)

  16. Intra-laboratory study to determine the reproducibility of LLNA:BrdU-ELISA for the prediction of the skin sensitizing potential of chemicals.

    Science.gov (United States)

    Chen, Wei; Xing, Caihong; Hou, Fenxia

    The Local Lymph Node Assay (LLNA) has been designated as the first-choice in vivo assay for identification the skin sensitization potential of new chemicals. The LLNA:BrdU-ELISA is a validated non-radioactive modification to the LLNA. An intra-laboratory reproducibility study for the LLNA:BrdU-ELISA was conducted to demonstrate its adequate performance in our laboratory. Ten independent LLNA:BrdU-ELISAs with the preferred positive controls (PCs), i.e., 25% hexyl cinnamic aldehyde (HCA) and 25% eugenol, were conducted within a period of less than one year. In addition, different concentrations of 2,4-dinitrochlorobenzene (DNCB, an extreme sensitizer) (0.01, 0.1 and 0.3%), HCA (10, 25 and 50%) and eugenol (10, 25 and 50%), were tested to determine the EC1.6 values. Special Pathogen Free female CBA/J mice of 8-10weeks old were randomly allocated to the groups, each group having 4 mice. 25μl of AOO (vehicle, acetone: olive oil=4:1, v/v) or HCA, eugenol, DNCB at the needed concentration was applied to the dorsum of each ear of the mice, daily for 3 consecutive days. A single intraperitoneal injection of 0.5ml of BrdU solution (10mg/ml) was given on day 5. On day 6, a pair of auricular lymph nodes from each mouse was excised, and BrdU ELISA analysis was conducted. The result for each group is expressed as the mean Stimulation Index (SI). The mean of the 10 mean SIs for 25% HCA (2.58±0.95) and 25% eugenol (3.51±1.25) was not significantly different to that from the Interagency Coordinating Committee on the Validation of Alternative Methods (ICCVAM) (i.e., the data on the formal validation study for the LLNA:BrdU-ELISA by the ICCVAM) (3.03±2.00 for 25% HCA, 6.13±6.06 for 25% eugenol) (P>0.05), with even smaller Coefficient of Variations (CV) (36.8% for 25% HCA, 35.6% for 25% eugenol) than that from the ICCVAM (66.0% for 25% HCA, 98.8% for 25% eugenol). In addition, the EC1.6 values for HCA, eugenol and DNCB (15.2, 12.5 and 0.25%, respectively) were consistent with

  17. 12 CFR 512.1 - Scope of part.

    Science.gov (United States)

    2010-01-01

    ...' Loan Act, as amended, 12 U.S.C. 1467a(g)(2) (“HOLA”) and to the conduct of formal examination proceedings with respect to savings associations and their affiliates under section 5(d)(1)(B) of the HOLA, as...

  18. The renewed spirit of Y-12

    International Nuclear Information System (INIS)

    Wall, David; Hassler, Morris; Parker, Elaine

    2005-01-01

    The Y-12 National Security Complex began operations in 1943 as a part of the Manhattan Project, the secret U.S. program that developed the first atomic weapon. With the end of the Cold War, the advent of the War on Terror, and the changing security needs of the US, Y-12 has begun to modernize and make changes to better meet the requirements of a smaller stockpile while supporting uranium supply needs and nuclear nonproliferation missions. Although we are proud of our place in history, after 60 years, we have begun to write a new chapter that will enable us to meet the new challenges facing the world today by strengthening our security posture and utilizing existing Y-12 expertise in nuclear nonproliferation initiatives. The modernization of Y-12 will enable us to be agile enough to adapt and respond to a much wider range of U.S. national security needs. As part of the National Nuclear Security Administration, nuclear nonproliferation has become one of the primary Y-12 missions. Some of the nuclear nonproliferation programs we support include the supply of low enriched uranium (LEU) to research and test reactors. The LEU provided to the research reactor community is derived from down blending highly enriched uranium (HEU) that is removed from dismantled nuclear weapons. Y-12 expertise has been used in numerous nonproliferation programs in Russia, the recent effort to remove material from Libya, and various activities supporting the new Global Threat Reduction Initiative (GTRI). The Y-12 National Security Complex stores significant quantities of HEU and therefore, has a security posture that must adapt to these new threats of global terrorism. This year, Y-12 has made real progress in modernizing its site so that it is better able to meet these new world challenges. Our modernization efforts will increase security, improve productivity, minimize health and safety risks and enable the Y-12 Site to continue to operate far into the future. This paper will summarize how

  19. Whole Foods Market Group, Inc. Nationwide RCRA Administrative Settlement

    Science.gov (United States)

    The U.S. Environmental Protection Agency (EPA) today announced an agreement with the grocery chain Whole Foods Market Group, Inc., to implement a state-of-the-art electronic system at its stores throughout the U.S. for identifying and classifying consumer

  20. Behaviour of Z phase in 9–12%Cr steels

    DEFF Research Database (Denmark)

    Danielsen, Hilmar Kjartansson; Hald, John

    2006-01-01

    The literature on the behaviour of modified Z phase Cr(V,Nb)N in creep resistant martensitic 9–12%Cr steels is briefly reviewed. Ten different 9–12%Cr steels were investigated after prolonged exposure at 600–660uC; the modified Z phase was found in all of them. In steels with high Cr content (11......–12%), Z phase precipitates much faster than in 9%Cr steels. Precipitation of Z phase is associated with dissolution of MX carbonitrides, and causes a breakdown in long term creep strength in 9–12%Cr steels. High Cr steels show creep instabilities accompanied with Z phase precipitation, whereas low Cr...... steels show good long term creep stability. A niobium free CrVN variant of the modified Z phase was observed for the first time during the course of this work. The solution temperature of the Cr(V,Nb)N and CrVN modified Z phases was found to be close to 800uC for 11–12%Cr steels, much lower than the 1200...

  1. A synthesis of the science on forests and carbon for U.S. Forests

    Science.gov (United States)

    Michael G. Ryan; Mark E. Harmon; Richard A. Birdsey; Christian P. Giardina; Linda S. Heath; Richard A. Houghton; Robert B. Jackson; Duncan C. McKinley; James F. Morrison; Brian C. Murray; Diane E. Pataki; Kenneth E. Skog

    2010-01-01

    Forests play an important role in the U.S. and global carbon cycle, and carbon sequestered by U.S. forest growth and harvested wood products currently offsets 12-19% of U.S. fossil fuel emissions. The cycle of forest growth, death, and regeneration and the use of wood removed from the forest complicate efforts to understand and measure forest carbon pools and flows....

  2. Gauged U(1) clockwork theory

    Science.gov (United States)

    Lee, Hyun Min

    2018-03-01

    We consider the gauged U (1) clockwork theory with a product of multiple gauge groups and discuss the continuum limit of the theory to a massless gauged U (1) with linear dilaton background in five dimensions. The localization of the lightest state of gauge fields on a site in the theory space naturally leads to exponentially small effective couplings of external matter fields localized away from the site. We discuss the implications of our general discussion with some examples, such as mediators of dark matter interactions, flavor-changing B-meson decays as well as D-term SUSY breaking.

  3. A study of collective coordinates and dynamical groups in nuclear theory

    International Nuclear Information System (INIS)

    Papadopolos, Z.

    1983-01-01

    Lie-algebraic techniques for the group action on manifolds given as a direct product of coset spaces and group manifolds are developed. The microscopic realisation of the Mass Quadrupole Collective Model (MQC) in the S0(3)xSO(n) and GLsub(+)(3, R)xSO(n) schemes is studied. The problem of the separation of the kinetic energy and the velocity field into a collective and an intrinsic part is analyzed. Different coordinate schemes in phase space for the U(n)-invariant collective motion and the U(3) dynamical group are introduced. In the GL(3,C)xU(n) scheme, the invariant volume element in the new coordinates and a completely orthonormal basis is constructed. (orig.) [de

  4. File list: Oth.Lar.05.daf-12.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Lar.05.daf-12.AllCell ce10 TFs and others daf-12 Larvae SRX146513,SRX065705,SRX...146512,SRX065706,SRX065713,SRX065714 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.Lar.05.daf-12.AllCell.bed ...

  5. File list: Oth.Lar.10.daf-12.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Lar.10.daf-12.AllCell ce10 TFs and others daf-12 Larvae SRX146513,SRX065706,SRX...065705,SRX146512,SRX065713,SRX065714 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.Lar.10.daf-12.AllCell.bed ...

  6. File list: Oth.Lar.50.daf-12.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Lar.50.daf-12.AllCell ce10 TFs and others daf-12 Larvae SRX065714,SRX065713,SRX...146512,SRX065705,SRX146513,SRX065706 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.Lar.50.daf-12.AllCell.bed ...

  7. File list: Oth.Lar.20.daf-12.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Lar.20.daf-12.AllCell ce10 TFs and others daf-12 Larvae SRX146513,SRX146512,SRX...065713,SRX065705,SRX065706,SRX065714 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.Lar.20.daf-12.AllCell.bed ...

  8. Perception of Racial Discrimination and Psychopathology Across Three U.S. Ethnic Minority Groups

    OpenAIRE

    Chou, Tina; Asnaani, Anu; Hofmann, Stefan G.

    2011-01-01

    To examine the association between the perception of racial discrimination and the lifetime prevalence rates of psychological disorders in the three most common ethnic minorities in the U.S., we analyzed data from a sample consisting of 793 Asian Americans, 951 Hispanic Americans, and 2,795 African Americans who received the Composite International Diagnostic Interview through the Collaborative Psychiatric Epidemiology Studies. The perception of racial discrimination was associated with the e...

  9. Girls arrested for murder: an empirical analysis of 32 years of U.S. data by offender age groups.

    Science.gov (United States)

    Heide, Kathleen M; Sellers, Brian G

    2014-01-01

    Most studies on juvenile homicide offenders (JHOs) have used small samples and have concentrated on adolescent male offenders. As a result, little is known about the population of female juveniles arrested for murder. This study utilized the Supplementary Homicide Report (SHR) database to investigate age differences between younger (aged 6-12 years) and older (aged 13-17 years) females arrested for murder in the United States from 1976 to 2007. As predicted, six variables used to test seven hypotheses with respect to younger and older female JHOs in single victim incidents were significant (victim age, victim gender, victim offender relationship, murder weapon, offender count, and homicide circumstance). Regression analysis revealed that younger girls were seven times more likely than older girls to kill children aged 0-12 years. Girls aged 6-12 years were five times more likely than their teen counterparts to be involved in conflict-related homicides as opposed to crime-related homicides. Although approximately the same percentages of younger and older girls killed infants under the age of 1, the victims were significantly different for the two offender age groups. This article concludes with a discussion of our findings and directions for future research. Copyright © 2014 John Wiley & Sons, Ltd.

  10. Y-12 Site Sustainability Plan

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, Charles G

    2012-12-01

    The accomplishments to date and the long-range planning of the Y-12 Energy Management and Sustainability and Stewardship programs support the U.S. Department of Energy (DOE) and the National Nuclear Security Administration (NNSA) vision for a commitment to energy effi ciency and sustainability and to achievement of the Guiding Principles. Specifi cally, the Y-12 vision is to support the Environment, Safety and Health Policy and the DOE Strategic Sustainability Performance Plan, while promoting overall sustainability and reduction of greenhouse gas emissions. The mission of the Y-12 Energy Management program is to incorporate energy-effi cient technologies site-wide and to position Y-12 to meet NNSA energy requirement needs through 2025 and beyond. The plan addresses greenhouse gases, buildings, fleet management, water use, pollution prevention, waste reduction, sustainable acquisition, electronic stewardship and data centers, site innovation and government-wide support.

  11. Normal edge-transitive and $ frac{1}{2}$-arc-transitive Cayley graphs on non-abelian groups of order $2pq$ , $p > q$ are primes

    Directory of Open Access Journals (Sweden)

    Ali Reza Ashrafi

    2016-09-01

    Full Text Available Darafsheh and Assari in [Normal edge-transitive Cayley graphs onnon-abelian groups of order 4p, where p is a prime number,Sci. China Math. {bf 56} (1 (2013 213$-$219.] classified the connected normal edge transitive and$frac{1}{2}-$arc-transitive Cayley graph of groups of order$4p$. In this paper we continue this work by classifying theconnected Cayley graph of groups of order $2pq$, $p > q$ areprimes. As a consequence it is proved that $Cay(G,S$ is a$frac{1}{2}-$edge-transitive Cayley graph of order $2pq$, $p> q$ if and only if $|S|$ is an even integer greater than 2, $S =T cup T^{-1}$ and $T subseteq { cba^{i} | 0 leq i leq p- 1}$ such that $T$ and $T^{-1}$ are orbits of $Aut(G,S$ andbegin{eqnarray*}G &=& langle a, b, c | a^p = b^q = c^2 = e, ac = ca, bc = cb, b^{-1}ab = a^r rangle,G &=& langle a, b, c | a^p = b^q = c^2 = e, c ac = a^{-1}, bc = cb, b^{-1}ab = a^r rangle,end{eqnarray*}where $r^q equiv 1 (mod p$.

  12. Myelodysplastic Syndrome, Unclassifiable (MDS-U) With 1% Blasts Is a Distinct Subgroup of MDS-U With a Poor Prognosis.

    Science.gov (United States)

    Margolskee, Elizabeth; Hasserjian, Robert P; Hassane, Duane; Tam, Wayne; Mathew, Susan; Ok, Chi Young; Wang, Sa A; Oak, Jean; Arber, Daniel A; Orazi, Attilio

    2017-07-01

    Three situations qualify as myelodysplastic syndrome, unclassifiable (MDS-U): (1) refractory cytopenia with dysplasia and 1% blasts in peripheral blood (BL), (2) pancytopenia with unilineage dysplasia (Pan), and (3) persistent cytopenia, less than 5% bone marrow blasts, and less than 10% dysplastic cells and presence of MDS-defining cytogenetic abnormalities (CG). We compared the clinicopathologic features and mutational profiles for these three groups. MDS-U cases were reviewed at four major academic institutions. Targeted next-generation sequencing for genes implicated in myeloid neoplasms was performed in a subset of cases. Twenty-seven patients were identified (six MDS-U BL, 13 MDS-U Pan, and eight MDS-U CG). Clonal cytogenetic abnormalities were found in six of six, seven of 13, and eight of eight cases in MDS-U BL, Pan, and CG, respectively (P > .05). Overall, four of six patients with MDS-U BL progressed to acute myeloid leukemia; no MDS-U Pan or CG patients did. The rates of progression-free survival and mortality (overall survival) were significantly higher in MDS-U BL compared with Pan and CG (P MDS-U BL is a distinct subset of MDS-U with a poor prognosis, while MDS-U Pan and CG are relatively indolent. Evaluation of peripheral blood smears in patients with MDS is essential for accurate classification and prognosis. © American Society for Clinical Pathology, 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com

  13. File list: Pol.Emb.05.AllAg.Mitotic_cycle_12 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Emb.05.AllAg.Mitotic_cycle_12 dm3 RNA polymerase Embryo Mitotic cycle 12 SRX750...068 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.Emb.05.AllAg.Mitotic_cycle_12.bed ...

  14. File list: Pol.Emb.50.AllAg.Mitotic_cycle_12 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Emb.50.AllAg.Mitotic_cycle_12 dm3 RNA polymerase Embryo Mitotic cycle 12 SRX750...068 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.Emb.50.AllAg.Mitotic_cycle_12.bed ...

  15. The ratio of lead-210 to polonium-210 in U.K. diet.

    Science.gov (United States)

    Smith-Briggs, J L; Bradley, E J; Potter, M D

    1986-10-01

    The levels of the natural radionuclides, 210Pb and 210Po, in U.K. diet have been measured previously. However, in the earlier measurements, the samples were sufficiently aged for 210Pb and 210Po to have attained secular equilibrium. In order to determine the extent of disequilibrium between these radionuclides in fresh food, measurements have been made on recently collected dietary samples. Disequilibrium has been observed in five food groups. The activity per unit mass of 210Pb was found to be greater than that of 210Po in bread, cereals, sugar and preserves, whereas the opposite was found to be true for eggs and beverages. When account is taken of consumption rates, however, the total intakes of 210Pb and 210Po from these food groups are approximately the same. The annual effective dose equivalents from the ingestion of 210Pb and 210Po have been re-estimated at 41 and 12 mu Sv, respectively.

  16. EnviroAtlas - Fresno, CA - Domestic Water Demand per Day by U.S. Census Block Group

    Data.gov (United States)

    U.S. Environmental Protection Agency — As included in this EnviroAtlas dataset, community level domestic water demand is calculated using locally available water use data per capita in gallons of water...

  17. EnviroAtlas - Phoenix, AZ - Domestic Water Demand per Day by U.S. Census Block Group

    Data.gov (United States)

    U.S. Environmental Protection Agency — As included in this EnviroAtlas dataset, community level domestic water demand is calculated using locally available water use data per capita in gallons of water...

  18. Hydrolysis of U(VI) and sodium uranates

    International Nuclear Information System (INIS)

    Pongi, N.-K.; Double, Gerard; Hurwic, Jozef

    1980-01-01

    The potentiometric titration curves of UO 2 (NO 3 ) 2 aqueous solutions by NaOH have been interpreted. The results we have got verify and complete those published before. From isohydric species (UO 2 ) 3 (OH) 7 - , with pH = 7,8 and the experimental molar value of the relation xsub(i) = Na/U = 2.33, the following ionic and molecular species in acid medium have been deduced: (UO 2 ) 2 (OH) 2 2+ , (UO 2 ) 3 (OH) 2 2+ , (UO 2 ) 3 (OH) 5 + and (UO 2 ) 3 (OH) 6 . The composition of the precipitates corresponding to the particular points of the potentiometric titration curves, by chemical, thermal decomposition analysis and by X-rays diffraction, have been carried out: (UO 2 ) 6 (OH) 12 .6H 2 O, Na 2 U 8 O 25 , Na 2 U 6 O 19 , Na 2 U 4 O 13 and Na 2 U 2 O 7 for xsub(i) = 1,67 and 2.00, 2.23, 2.33, 2.52, 3.00 and over, respectively. The uranyl hydroxide was obtained for first time from an aqueous solution [fr

  19. Comparison of U-Pu-Mo, U-Pu-Nb, U-Pu-Ti and U-Pu-Zr alloys

    International Nuclear Information System (INIS)

    Boucher, R.; Barthelemy, P.

    1964-01-01

    The data concerning the U-Pu, U-Pu-Mo and U-Pu-Nb are recalled. The results obtained with U-Pu-Ti and U-Pu-Zr alloys containing 15-20 per cent Pu and 10 wt. per cent ternary element are reported. The transformation temperatures, the expansion coefficients, the nature of phases, the thermal cycling behaviour have been determined. A list of the principal properties of these different alloys is presented and the possibilities of their use as fast reactor's fuel element are considered. The U-Pu-Ti alloys seem to be quite promising: easiness of fabrication, large thermal stability, excellent behaviour in air, small quantity of zeta phase, temperature of solidus superior to 1100 deg. C. (authors) [fr

  20. EnviroAtlas - Pittsburgh, PA - Domestic Water Use per Day by U.S. Census Block Group

    Data.gov (United States)

    U.S. Environmental Protection Agency — As included in this EnviroAtlas dataset, the community level domestic water use was calculated using locally available water use data per capita in gallons of water...