Canonical formulation of IIB D-branes

International Nuclear Information System (INIS)

Kamimura, K.

1998-01-01

We find Wess-Zumino actions for kappa invariant type IIB D-branes in explicit forms. A simple and compact expression is obtained by the use of spinor variables which are defined as power series of differential forms. Using the Wess-Zumino actions we develop the canonical formulation and find the complete set of the constraint equations for generic type IIB Dp-branes. The conserved global supersymmetry charges are determined and the algebra containing the central charges can be obtained explicitly. (orig.)

Ultraviolet Detection of the Binary Companion to the Type IIb SN 2001ig

Science.gov (United States)

Ryder, Stuart D.; Van Dyk, Schuyler D.; Fox, Ori D.; Zapartas, Emmanouil; de Mink, Selma E.; Smith, Nathan; Brunsden, Emily; Azalee Bostroem, K.; Filippenko, Alexei V.; Shivvers, Isaac; Zheng, WeiKang

2018-03-01

We present HST/WFC3 ultraviolet imaging in the F275W and F336W bands of the Type IIb SN 2001ig at an age of more than 14 years. A clear point source is detected at the site of the explosion, with m F275W = 25.39 ± 0.10 and m F336W = 25.88 ± 0.13 mag. Despite weak constraints on both the distance to the host galaxy NGC 7424 and the line-of-sight reddening to the supernova, this source matches the characteristics of an early B-type main-sequence star with 19,000 GMOS optical spectrum at an age of 6 years reveals a narrow He II λ4686 emission line, indicative of continuing interaction with a dense circumstellar medium at large radii from the progenitor. We review our findings on SN 2001ig in the context of binary evolution channels for stripped-envelope supernovae. Owing to the uncrowded nature of its environment in the ultraviolet, this study of SN 2001ig represents one of the cleanest detections to date of a surviving binary companion to a Type IIb supernova.

On running couplings in gauge theories from type-IIB supergravity

CERN Document Server

Kehagias, A A

1999-01-01

We construct an explicit solution of type-IIB supergravity describing the strong coupling regime of a non-supersymmetric gauge theory. The latter has a running coupling with an ultraviolet stable fixed point corresponding to the N=4 SU(N) super-Yang-Mills theory at large N. The running coupling has a power law behaviour, argued to be universal, that is consistent with holography. Around the critical point, our solution defines an asymptotic expansion for the gauge coupling beta-function. We also calculate the first correction to the Coulombic quark-antiquark potential.

Vertex operators of ghost number three in Type IIB supergravity

International Nuclear Information System (INIS)

Mikhailov, Andrei

2016-01-01

We study the cohomology of the massless BRST complex of the Type IIB pure spinor superstring in flat space. In particular, we find that the cohomology at the ghost number three is nontrivial and transforms in the same representation of the supersymmetry algebra as the solutions of the linearized classical supergravity equations. Modulo some finite dimensional spaces, the ghost number three cohomology is the same as the ghost number two cohomology. We also comment on the difference between the naive and semi-relative cohomology, and the role of b-ghost.

Deep Photometry of GRB 041006 Afterglow: Hypernova Bump at Redshift z = 0.716

Science.gov (United States)

Stanek, K. Z.; Garnavich, P. M.; Nutzman, P. A.; Hartman, J. D.; Garg, A.; Adelberger, K.; Berlind, P.; Bonanos, A. Z.; Calkins, M. L.; Challis, P.; Gaudi, B. S.; Holman, M. J.; Kirshner, R. P.; McLeod, B. A.; Osip, D.; Pimenova, T.; Reiprich, T. H.; Romanishin, W.; Spahr, T.; Tegler, S. C.; Zhao, X.

2005-06-01

We present deep optical photometry of the afterglow of gamma-ray burst (GRB) 041006 and its associated hypernova obtained over 65 days after detection (55 R-band epochs on 10 different nights). Our early data (tVatican Advanced Technology Telescope, the Magellan 6.5 m Baade and Clay telescopes, and the Keck II 10 m telescope.

The N=1 effective actions of D-branes in Type IIA and IIB orientifolds

International Nuclear Information System (INIS)

Grimm, Thomas W.; Vieira Lopes, Daniel

2012-01-01

We discuss the four-dimensional N=1 effective actions of single space-time filling Dp-branes in general Type IIA and Type IIB Calabi-Yau orientifold compactifications. The effective actions depend on an infinite number of normal deformations and gauge connection modes. For D6-branes the N=1 Kähler potential, the gauge-coupling function, the superpotential and the D-terms are determined as functions of these fields. They can be expressed as integrals over chains which end on the D-brane cycle and a reference cycle. The infinite deformation space will reduce to a finite dimensional moduli space of special Lagrangian submanifolds upon imposing F- and D-term supersymmetry conditions. We show that the Type IIA moduli space geometry is captured by three real functionals encoding the deformations of special Lagrangian submanifolds, holomorphic three-forms and Kähler two-forms of Calabi-Yau manifolds. These elegantly combine in the N=1 Kähler potential, which reduces after applying mirror symmetry to the results previously determined for space-time filling D3-, D5- and D7-branes. We also propose general chain integral expressions for the Kähler potentials of Type IIB D-branes.

Universal properties of type IIB and F-theory flux compactifications at large complex structure

International Nuclear Information System (INIS)

Marsh, M.C. David; Sousa, Kepa

2016-01-01

We consider flux compactifications of type IIB string theory and F-theory in which the respective superpotentials at large complex structure are dominated by cubic or quartic terms in the complex structure moduli. In this limit, the low-energy effective theory exhibits universal properties that are insensitive to the details of the compactification manifold or the flux configuration. Focussing on the complex structure and axio-dilaton sector, we show that there are no vacua in this region and the spectrum of the Hessian matrix is highly peaked and consists only of three distinct eigenvalues (0, 2m 3/2 2 and 8m 3/2 2 ), independently of the number of moduli. We briefly comment on how the inclusion of Kähler moduli affect these findings. Our results generalise those of Brodie & Marsh http://dx.doi.org/10.1007/JHEP01(2016)037, in which these universal properties were found in a subspace of the large complex structure limit of type IIB compactifications.

Generalized IIB supergravity from exceptional field theory

Energy Technology Data Exchange (ETDEWEB)

Baguet, Arnaud; Magro, Marc; Samtleben, Henning [Laboratoire de Physique, Université Claude Bernard Lyon 1, Ens de Lyon, CNRS,F-69342 Lyon (France)

2017-03-20

The background underlying the η-deformed AdS{sub 5}×S{sup 5} sigma-model is known to satisfy a generalization of the IIB supergravity equations. Their solutions are related by T-duality to solutions of type IIA supergravity with non-isometric linear dilaton. We show how the generalized IIB supergravity equations can be naturally obtained from exceptional field theory. Within this manifestly duality covariant formulation of maximal supergravity, the generalized IIB supergravity equations emerge upon imposing on the fields a simple Scherk-Schwarz ansatz which respects the section constraint.

Moduli stabilization in type IIB orientifolds

International Nuclear Information System (INIS)

Schulgin, W.

2007-01-01

This thesis deals with the stabilization of the moduli fields in the compactifications of the type IIB string theory on orientifolds. A concrete procedure for the construction of solutions, in which all moduli fields are fixed, yields the KKLT scenario. We study, on which models the scenario can be applied, if approximations of the original KKLT work are abandoned. We find that in a series of models, namely such without complex-structure moduli the construction of the consistent solutions in the framework of the KKLT scenario is not possible. The nonperturbative effects, like D3 instantons and gaugino condensates are a further component of the KKLT scenario. They lead to the stabilization of the Kaehler moduli. We present criteria for the generation of the superpotential due to the D3 instantons at a Calaby-Yau manifold in presence of fluxes. Furthermore we show that although the presence of the nonperturbative superpotential in the equations of motions is correlated with the switching on of all ISD and IASD fluxes, the deciding criterium for the generation of the nonperturbative superpotential depends only on the fluxes of the type (2,1). Thereafter we discuss two models, in which we stabilize all moduli fields. Thereby it deals with Calabi-Yau orientifolds which have been obtained by a blow-up procedure from the Z 6-II and Z 2 x Z 4 orientifolds

Experimental data report for transient flow calibration facility tests IIB101, IIB102 and IIB201

International Nuclear Information System (INIS)

Wambach, J.L.

1980-01-01

Thermal-hydraulic response data are presented for the transient performance tests of a pitot tube rake (IIB201) and a modular drag disc-turbine transducer (DTT) rake (IIB101, IIB102). The tests were conducted in a system which provided full scale simulation of the pressure vessel and broken loop hot leg piping of the Loss of Fluid Test Facility (LOFT). A load cell system was used to provide a reference mass flow rate measurement

Nonperturbative type IIB model building in the F-theory framework

Energy Technology Data Exchange (ETDEWEB)

Jurke, Benjamin Helmut Friedrich

2011-02-28

This dissertation is concerned with the topic of non-perturbative string theory, which is generally considered to be the most promising approach to a consistent description of quantum gravity. The five known 10-dimensional perturbative string theories are all interconnected by numerous dualities, such that an underlying non-perturbative 11-dimensional theory, called M-theory, is postulated. Due to several technical obstacles, little is known about the fundamental objects in this theory. There exists an alternative non-perturbative description to type IIB string theory, namely F-theory. Here the SL(2;Z) self-duality of IIB theory is geometrized in the form of an elliptic fibration over the space-time. Moreover, higher-dimensional objects like 7-branes are included via singularities into the geometric picture. This formally elegant description, however, requires significant technical effort for the construction of suitable compactification geometries, as many different aspects necessarily have to be dealt with at the same time. On the other hand, the generation of essential GUT building blocks like certain Yukawa couplings or spinor representations is easier compared to perturbative string theory. The goal of this study is therefore to formulate a unified theory within the framework of F-theory, that satisfies basic phenomenological constraints. Within this thesis, at first E3-brane instantons in type IIB string theory - 4-dimensional objects that are entirely wrapped around the invisible dimensions of space-time - are matched with M5-branes in F-theory. Such objects are of great importance in the generation of critical Yukawa couplings or the stabilization of the free parameters of a theory. Certain properties of M5-branes then allow to derive a new criterion for E3-branes to contribute to the superpotential. In the aftermath of this analysis, several compactification geometries are constructed and checked for basic properties that are relevant for semi

Nonperturbative type IIB model building in the F-theory framework

International Nuclear Information System (INIS)

Jurke, Benjamin Helmut Friedrich

2011-01-01

This dissertation is concerned with the topic of non-perturbative string theory, which is generally considered to be the most promising approach to a consistent description of quantum gravity. The five known 10-dimensional perturbative string theories are all interconnected by numerous dualities, such that an underlying non-perturbative 11-dimensional theory, called M-theory, is postulated. Due to several technical obstacles, little is known about the fundamental objects in this theory. There exists an alternative non-perturbative description to type IIB string theory, namely F-theory. Here the SL(2;Z) self-duality of IIB theory is geometrized in the form of an elliptic fibration over the space-time. Moreover, higher-dimensional objects like 7-branes are included via singularities into the geometric picture. This formally elegant description, however, requires significant technical effort for the construction of suitable compactification geometries, as many different aspects necessarily have to be dealt with at the same time. On the other hand, the generation of essential GUT building blocks like certain Yukawa couplings or spinor representations is easier compared to perturbative string theory. The goal of this study is therefore to formulate a unified theory within the framework of F-theory, that satisfies basic phenomenological constraints. Within this thesis, at first E3-brane instantons in type IIB string theory - 4-dimensional objects that are entirely wrapped around the invisible dimensions of space-time - are matched with M5-branes in F-theory. Such objects are of great importance in the generation of critical Yukawa couplings or the stabilization of the free parameters of a theory. Certain properties of M5-branes then allow to derive a new criterion for E3-branes to contribute to the superpotential. In the aftermath of this analysis, several compactification geometries are constructed and checked for basic properties that are relevant for semi

Type IIB orientifolds, D-brane instantons and the large volume scenario

Energy Technology Data Exchange (ETDEWEB)

Plauschinn, Erik

2009-07-28

This thesis is concerned with a branch of research in String Theory called String Phenomenology which aims for a better understanding of the connection between String Theory and Particle Physics. In particular, in this work we cover three topics which are important in order to establish this connection. The first topic is about String Theory model building in the context of so-called type IIB orientifolds with orientifold three- and seven-planes. After giving a brief overview, we work out in detail an important consistency condition for String Theory constructions, the so-called tadpole cancellation condition, and we verify explicitly that chiral anomalies are cancelled via the generalised Green-Schwarz mechanism. The second topic is concerned with so-called D-brane instantons which are nonperturbative effects in type II String Theory constructions. We recall the instanton calculus for such configurations, we derive the so-called A eck-Dine-Seiberg superpotential in String Theory and we develop an important constraint, a chiral zero-mode constraint, for instanton contributions in the presence of a realistic Particle Physics sector. The third topic is about moduli stabilisation in type IIB string compactifications. More concretely, we review the so-called KKLT as well as Large Volume Scenario, and we construct and study a model for the latter scenario where the constraint mentioned above has been taken into account explicitly. Although the three topics studied in this thesis are slightly different in nature, there is nevertheless a complex interplay between them with many interrelations. In order to uncover these connections, a detailed study of each individual subject has been performed which has led to new results such as the chiral zero-mode constraint. (orig.)

Type IIB orientifolds, D-brane instantons and the large volume scenario

International Nuclear Information System (INIS)

Plauschinn, Erik

2009-01-01

This thesis is concerned with a branch of research in String Theory called String Phenomenology which aims for a better understanding of the connection between String Theory and Particle Physics. In particular, in this work we cover three topics which are important in order to establish this connection. The first topic is about String Theory model building in the context of so-called type IIB orientifolds with orientifold three- and seven-planes. After giving a brief overview, we work out in detail an important consistency condition for String Theory constructions, the so-called tadpole cancellation condition, and we verify explicitly that chiral anomalies are cancelled via the generalised Green-Schwarz mechanism. The second topic is concerned with so-called D-brane instantons which are nonperturbative effects in type II String Theory constructions. We recall the instanton calculus for such configurations, we derive the so-called A eck-Dine-Seiberg superpotential in String Theory and we develop an important constraint, a chiral zero-mode constraint, for instanton contributions in the presence of a realistic Particle Physics sector. The third topic is about moduli stabilisation in type IIB string compactifications. More concretely, we review the so-called KKLT as well as Large Volume Scenario, and we construct and study a model for the latter scenario where the constraint mentioned above has been taken into account explicitly. Although the three topics studied in this thesis are slightly different in nature, there is nevertheless a complex interplay between them with many interrelations. In order to uncover these connections, a detailed study of each individual subject has been performed which has led to new results such as the chiral zero-mode constraint. (orig.)

On Type IIB moduli stabilization and N=4,8 supergravities

Energy Technology Data Exchange (ETDEWEB)

Aldazabal, Gerardo [Centro Atomico Bariloche, Instituto Balseiro (CNEA-UNC) and CONICET, 8400 S.C. de Bariloche (Argentina); Marques, Diego [Institut de Physique Theorique, CEA/ Saclay, 91191 Gif-sur-Yvette Cedex (France); Nunez, Carmen, E-mail: carmen@iafe.uba.a [Instituto de Astronomia y Fisica del Espacio (CONICET-UBA) and Departamento de Fisica, FCEN, Universidad de Buenos Aires, C.C. 67 - Suc. 28, 1428 Buenos Aires (Argentina); Rosabal, Jose A. [Centro Atomico Bariloche, Instituto Balseiro (CNEA-UNC) and CONICET, 8400 S.C. de Bariloche (Argentina)

2011-08-01

We analyze D=4 compactifications of Type IIB theory with generic, geometric and non-geometric, dual fluxes turned on. In particular, we study N=1 toroidal orbifold compactifications that admit an embedding of the untwisted sector into gauged N=4,8 supergravities. Truncations, spontaneous breaking of supersymmetry and the inclusion of sources are discussed. The algebraic identities satisfied by the supergravity gaugings are used to implement the full set of consistency constraints on the background fluxes. This allows to perform a generic study of N=1 vacua and identify large regions of the parameter space that do not admit complete moduli stabilization. Illustrative examples of AdS and Minkowski vacua are presented.

String necklaces and primordial black holes from type IIB strings

International Nuclear Information System (INIS)

Lake, Matthew; Thomas, Steve; Ward, John

2009-01-01

We consider a model of static cosmic string loops in type IIB string theory, where the strings wrap cycles within the internal space. The strings are not topologically stabilised, however the presence of a lifting potential traps the windings giving rise to kinky cycloops. We find that PBH formation occurs at early times in a small window, whilst at late times we observe the formation of dark matter relics in the scaling regime. This is in stark contrast to previous predictions based on field theoretic models. We also consider the PBH contribution to the mass density of the universe, and use the experimental data to impose bounds on the string theory parameters.

AdS3 xw (S3 x S3 x S1) solutions of type IIB string theory

International Nuclear Information System (INIS)

Donos, Aristomenis; Gauntlett, Jerome P.; Imperial College, London; Sparks, James

2008-10-01

We analyse a recently constructed class of local solutions of type IIB supergravity that consist of a warped product of AdS 3 with a sevendimensional internal space. In one duality frame the only other nonvanishing fields are the NS three-form and the dilaton. We analyse in detail how these local solutions can be extended to globally well-defined solutions of type IIB string theory, with the internal space having topology S 3 x S 3 x S 1 and with properly quantised three-form flux. We show that many of the dual (0,2) SCFTs are exactly marginal deformations of the (0,2) SCFTs whose holographic duals are warped products of AdS 3 with seven-dimensional manifolds of topology S 3 x S 2 x T 2 . (orig.)

On a supersymmetric completion of the R4 term in IIB supergravity

International Nuclear Information System (INIS)

Haro, Sebastian de; Sinkovics, Annamaria; Skenderis, Kostas

2003-01-01

We analyze the possibility of constructing a supersymmetric invariant that contains the R 4 term among its components as a superpotential term in type IIB on-shell superspace. We consider a scalar superpotential, i.e. an arbitrary holomorphic function of a chiral scalar superfield. In general, type IIB superspace does not allow for the existence of chiral superfields, but the obstruction vanishes for a specific superfield, the dilaton superfield. This superfield contains all fields of type IIB supergravity among its components, and its existence is implied by the solution of the Bianchi identities. The construction requires the existence of an appropriate chiral measure, and we find an obstruction to the existence of such a measure. The obstruction is closely related to the obstruction for the existence of chiral superfields and is non-linear in the fields. These results imply that the type IIB superinvariant related to the R 4 term is not associated with a scalar chiral superpotential

Flipped SU(5) from D-branes with type IIB fluxes

Energy Technology Data Exchange (ETDEWEB)

Chen Chingming [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)]. E-mail: cchen@physics.tamu.edu; Mayes, V.E. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)]. E-mail: eric@physics.tamu.edu; Nanopoulos, D.V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States) and Astroparticle Physics Group, Houston Advanced Research Center (HARC), Mitchell Campus, Woodlands, TX 77381 (United States) and Academy of Athens, Division of Natural Sciences, 28 Panepistimiou Avenue, Athens 10679 (Greece)]. E-mail: dimitri@physics.tamu.edu

2006-02-16

We construct flipped SU(5) GUT models as type IIB flux vacua on Z{sub 2}xZ{sub 2} orientifolds. Turning on supergravity self-dual NSNS and RR three-form fluxes fixes the toroidal complex structure moduli and the dilaton. We give a specific example of a three-generation flipped SU(5) model with a complete Higgs sector where supersymmetry is softly broken by the supergravity fluxes in the closed string sector. All of the required Yukawa couplings are present if global U(1) factors resulting from a generalized Green-Schwarz mechanism are broken spontaneously or by world-sheet instantons. In addition, the model contains extra chiral and vector-like matter, potentially of mass O(M{sub string}) via trilinear superpotential couplings.

Aspects of Moduli Stabilization in Type IIB String Theory

Directory of Open Access Journals (Sweden)

Shaaban Khalil

2016-01-01

Full Text Available We review moduli stabilization in type IIB string theory compactification with fluxes. We focus on KKLT and Large Volume Scenario (LVS. We show that the predicted soft SUSY breaking terms in KKLT model are not phenomenological viable. In LVS, the following result for scalar mass, gaugino mass, and trilinear term is obtained: m0=m1/2=-A0=m3/2, which may account for Higgs mass limit if m3/2~O(1.5 TeV. However, in this case, the relic abundance of the lightest neutralino cannot be consistent with the measured limits. We also study the cosmological consequences of moduli stabilization in both models. In particular, the associated inflation models such as racetrack inflation and Kähler inflation are analyzed. Finally, the problem of moduli destabilization and the effect of string moduli backreaction on the inflation models are discussed.

Trivalent Chromium Process (TCP) as a Sealer for MIL-A-8625F Type II, IIB, and IC Anodic Coatings

National Research Council Canada - National Science Library

Matzdorf, Craig; Beck, Erin; Hilgeman, Amy; Prado, Ruben

2008-01-01

This report documents evaluations of trivalent chromium compositions (TCP) as sealers for MIL-A-8625F Type II, IIB, and IC anodic coatings conducted from March 2001 through December 2007 by Materials Engineering...

Duality covariant type IIB supersymmetry and nonperturbative consequences

CERN Document Server

Bars, Itzhak

1997-01-01

Type-IIB supersymmetric theories have an SL(2,Z) invariance, known as U-duality, which controls the non-perturbative behavior of the theory. Under SL(2,Z) the supercharges are doublets, implying that the bosonic charges would be singlets or triplets. However, among the bosonic charges there are doublet strings and doublet fivebranes which are in conflict with the doublet property of the supercharges. It is shown that the conflict is resolved by structure constants that depend on moduli, such as the tau parameter, which transform under the same SL(2,Z). The resulting superalgebra encodes the non-perturbative duality properties of the theory and is valid for any value of the string coupling constant. The usefulness of the formalism is illustrated by applying it to purely algebraic computations of the tension of (p,q) strings, and the mass and entropy of extremal blackholes constructed from D-1-branes and D-5-branes. In the latter case the non-perturbative coupling dependence of the BPS mass and metric is comput...

Simultaneous bilateral Mason type IIb radial head fractures in a young female: Was an increased carrying angle the cause?

LENUS (Irish Health Repository)

2015-01-01

Radial head fracture is the most common type of elbow fracture in adults. It results from a fall on an outstretched hand. However, simultaneous bilateral radial head fractures are extremely rare. We report a case of simultaneous bilateral mason type IIb radial head fractures in a young female, which was treated nonoperatively with excellent results

Precision holography for N={2}^{\\ast } on S 4 from type IIB supergravity

Science.gov (United States)

Bobev, Nikolay; Gautason, Friðrik Freyr; van Muiden, Jesse

2018-04-01

We find a new supersymmetric solution of type IIB supergravity which is holographically dual to the planar limit of the four-dimensional N={2}^{\\ast } supersymmetric Yang-Mills theory on S 4. We study a probe fundamental string in this background which is dual to a supersymmetric Wilson loop in the N={2}^{\\ast } theory. Using holography we calculate the expectation value of this line operator to leading order in the 't Hooft coupling. The result is a non-trivial function of the mass parameter of the N={2}^{\\ast } theory that precisely matches the result from supersymmetric localization.

Supernova 2010as: the lowest-velocity member of a family of flat-velocity type IIb supernovae

Energy Technology Data Exchange (ETDEWEB)

Folatelli, Gastón; Bersten, Melina C.; Nomoto, Ken' ichi [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo, Kashiwa, Chiba 277-8583 (Japan); Kuncarayakti, Hanindyo; Hamuy, Mario [Departamento de Astronomía, Universidad de Chile, Casilla 36-D, Santiago (Chile); Olivares Estay, Felipe; Pignata, Giuliano [Departamento de Ciencias Fisicas, Universidad Andres Bello, Avda. Republica 252, Santiago (Chile); Anderson, Joseph P. [European Southern Observatory, Alonso de Cordova 3107, Vitacura, Santiago (Chile); Holmbo, Simon; Stritzinger, Maximilian [Department of Physics and Astronomy, Aarhus University, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Maeda, Keiichi [Department of Astronomy, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Morrell, Nidia; Contreras, Carlos; Phillips, Mark M. [Las Campanas Observatory, Carnegie Observatories, Casilla 601, La Serena (Chile); Förster, Francisco [Center for Mathematical Modelling, Universidad de Chile, Avenida Blanco Encalada 2120 Piso 7, Santiago (Chile); Prieto, José Luis [Department of Astrophysical Sciences, Princeton University, 4 Ivy Lane, Peyton Hall, Princeton, NJ 08544 (United States); Valenti, Stefano [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Goleta, CA 93117 (United States); Afonso, Paulo; Altenmüller, Konrad; Elliott, Jonny, E-mail: gaston.folatelli@ipmu.jp [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstraße 1, D-85740 Garching (Germany); and others

2014-09-01

We present extensive optical and near-infrared photometric and spectroscopic observations of the stripped-envelope supernova SN 2010as. Spectroscopic peculiarities such as initially weak helium features and low expansion velocities with a nearly flat evolution place this object in the small family of events previously identified as transitional Type Ib/c supernovae (SNe). There is ubiquitous evidence of hydrogen, albeit weak, in this family of SNe, indicating that they are in fact a peculiar kind of Type IIb SNe that we name 'flat-velocity' Type IIb. The flat-velocity evolution—which occurs at different levels between 6000 and 8000 km s{sup –1} for different SNe—suggests the presence of a dense shell in the ejecta. Despite the spectroscopic similarities, these objects show surprisingly diverse luminosities. We discuss the possible physical or geometrical unification picture for such diversity. Using archival Hubble Space Telescope images, we associate SN 2010as with a massive cluster and derive a progenitor age of ≈6 Myr, assuming a single star-formation burst, which is compatible with a Wolf-Rayet progenitor. Our hydrodynamical modeling, on the contrary, indicates that the pre-explosion mass was relatively low, ≈4 M {sub ☉}. The seeming contradiction between a young age and low pre-SN mass may be solved by a massive interacting binary progenitor.

Superdualities, brane tensions and massive IIA/IIB duality

International Nuclear Information System (INIS)

Lavrinenko, I.V.; Lue, H.; Pope, C.N.; Stelle, K.S.

1999-01-01

The gauge transformations of p-form fields in supergravity theories acquire a non-commuting character when one introduces potentials both for the theory's original field strengths and for their duals. This has previously been shown in the 'doubled' formalism for maximal supergravities, where a generalised duality relation between original and dual field strengths replaces the equations of motion. In the doubled formalism, the gauge transformations generate a superalgebra, and the corresponding symmetries have accordingly been called 'superdualities'. The corresponding Noether charges form a representation of the cohomology ring on the space-time manifold. In this paper, we show that the gauge symmetry superalgebra implies certain non-trivial relations among the various p-brane tensions, which can straightforwardly be read off from the superalgebra commutation relations. This provides an elegant derivation of the brane-tension relations purely within a given theory, without the need to make use of duality relations between different theories, such as the type IIA/IIB T-duality, although the results are consistent with such dualities. We present the complete set of brane-tension relations in M-theory, in the type IIA and type IIB theories, and in all the lower-dimensional maximal supergravities. We also construct a doubled formalism for massive type IIA supergravity, and this enables us to obtain the brane-tension relations involving the D8-brane, purely within the framework of the massive IIA theory. We also obtain explicit transformations for the nine-dimensional T-duality between the massive type IIA theory and the Scherk-Schwarz reduced type IIB theory

Applications of the D-instanton calculus in type IIB orientifold compactifications

Energy Technology Data Exchange (ETDEWEB)

Moster, Sebastian

2010-06-22

In this thesis string compactifications are studied in the formalism of the large-volume type IIB string theory. This class of compactifications possesses an in various regards phenomenologically interesting effective low-energy field theory. Theme of this thesis is the further development of these models motivated by recent knowledges in the D-brane instanton calculus of the string theory. After a short, general introduction in the string theory and especially in type IIB orbifolds and their consistency conditions the large-volume models are extensively presented and the hitherto knowledges on their phenomenology - like scale hierarchies, gauge couplings, supersymmetry breaking, and cosmological questions - discussed. An essential part in the construction of the large-volume models is the stabilizing of moduli fields by means of nonperturbative contribution to the superpotential in the effective low-energy field theory, which are caused by D-brane instantons or gaugino condensates. With recent knowledges in the D-brane instanton calculus it is shown that the moduli stabilization with the hitherto applied mechanism is not compatible with the existence of chiral fermions, as they occur in the standard model of elementary particle physics. A modified mechanism is proposed, in which the moduli fields are stabilized by additions of D-terms. Then by so-called ''polyinstanton corrections'' for the gauge-kinetic function a new large-volume scenario is constructed, in which the string scale without fine tuning lies not in an as in these model usual intermediate range of about 10{sup 11} GeV, but at 10{sup 16} GeV. By this this construction becomes interesting also for grand unified theories with SU(5) or SO(10) gauge groups. This is demonstrated on explicit models. Finally supersymmetry breaking is treated in large-volume scenarios. By the new mechanism for the moduli stabilization it is suggested that the supersymmetry breaking is caused by a

The type IIb supernova 2013df and its cool supergiant progenitor

Energy Technology Data Exchange (ETDEWEB)

Van Dyk, Schuyler D. [Spitzer Science Center/Caltech, Mail Code 220-6, Pasadena, CA 91125 (United States); Zheng, WeiKang; Fox, Ori D.; Clubb, Kelsey I.; Filippenko, Alexei V.; Kelly, Patrick L. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Cenko, S. Bradley [Astrophysics Science Division, NASA Goddard Space Flight Center, Mail Code 661, Greenbelt, MD 20771 (United States); Foley, Ryan J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Miller, Adam A. [Jet Propulsion Laboratory, MS 169-506, Pasadena, CA 91109 (United States); Smith, Nathan [Steward Observatory, University of Arizona, Tucson, AZ 85720 (United States); Lee, William H. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Apdo. Postal 70-264, Cd. Universitaria, México DF 04510 (Mexico); Ben-Ami, Sagi; Gal-Yam, Avishay, E-mail: vandyk@ipac.caltech.edu [Benoziyo Center for Astrophysics, The Weizmann Institute of Science, Rehovot 76100 (Israel)

2014-02-01

We have obtained early-time photometry and spectroscopy of supernova (SN) 2013df in NGC 4414. The SN is clearly of Type IIb, with notable similarities to SN 1993J. From its luminosity at secondary maximum light, it appears that less {sup 56}Ni (≲ 0.06 M {sub ☉}) was synthesized in the SN 2013df explosion than was the case for the SNe IIb 1993J, 2008ax, and 2011dh. Based on a comparison of the light curves, the SN 2013df progenitor must have been more extended in radius prior to explosion than the progenitor of SN 1993J. The total extinction for SN 2013df is estimated to be A{sub V} = 0.30 mag. The metallicity at the SN location is likely to be solar. We have conducted Hubble Space Telescope (HST) Target of Opportunity observations of the SN with the Wide Field Camera 3, and from a precise comparison of these new observations to archival HST observations of the host galaxy obtained 14 yr prior to explosion, we have identified the progenitor of SN 2013df to be a yellow supergiant, somewhat hotter than a red supergiant progenitor for a normal Type II-Plateau SN. From its observed spectral energy distribution, assuming that the light is dominated by one star, the progenitor had effective temperature T {sub eff} = 4250 ± 100 K and a bolometric luminosity L {sub bol} = 10{sup 4.94±0.06} L {sub ☉}. This leads to an effective radius R {sub eff} = 545 ± 65 R {sub ☉}. The star likely had an initial mass in the range of 13-17 M {sub ☉}; however, if it was a member of an interacting binary system, detailed modeling of the system is required to estimate this mass more accurately. The progenitor star of SN 2013df appears to have been relatively similar to the progenitor of SN 1993J.

Applications of the D-instanton calculus in type IIB orientifold compactifications

International Nuclear Information System (INIS)

Moster, Sebastian

2010-01-01

In this thesis string compactifications are studied in the formalism of the large-volume type IIB string theory. This class of compactifications possesses an in various regards phenomenologically interesting effective low-energy field theory. Theme of this thesis is the further development of these models motivated by recent knowledges in the D-brane instanton calculus of the string theory. After a short, general introduction in the string theory and especially in type IIB orbifolds and their consistency conditions the large-volume models are extensively presented and the hitherto knowledges on their phenomenology - like scale hierarchies, gauge couplings, supersymmetry breaking, and cosmological questions - discussed. An essential part in the construction of the large-volume models is the stabilizing of moduli fields by means of nonperturbative contribution to the superpotential in the effective low-energy field theory, which are caused by D-brane instantons or gaugino condensates. With recent knowledges in the D-brane instanton calculus it is shown that the moduli stabilization with the hitherto applied mechanism is not compatible with the existence of chiral fermions, as they occur in the standard model of elementary particle physics. A modified mechanism is proposed, in which the moduli fields are stabilized by additions of D-terms. Then by so-called ''polyinstanton corrections'' for the gauge-kinetic function a new large-volume scenario is constructed, in which the string scale without fine tuning lies not in an as in these model usual intermediate range of about 10 11 GeV, but at 10 16 GeV. By this this construction becomes interesting also for grand unified theories with SU(5) or SO(10) gauge groups. This is demonstrated on explicit models. Finally supersymmetry breaking is treated in large-volume scenarios. By the new mechanism for the moduli stabilization it is suggested that the supersymmetry breaking is caused by a completely from the MSSM

Evolution of an electron-positron plasma produced by induced gravitational collapse in binary-driven hypernovae

Directory of Open Access Journals (Sweden)

Melon Fuksman J. D.

2018-01-01

Full Text Available The binary-driven hypernova (BdHN model has been introduced in the past years, to explain a subfamily of gamma-ray bursts (GRBs with energies Eiso ≥ 1052 erg associated with type Ic supernovae. Such BdHNe have as progenitor a tight binary system composed of a carbon-oxigen (CO core and a neutron star undergoing an induced gravitational collapse to a black hole, triggered by the CO core explosion as a supernova (SN. This collapse produces an optically-thick e+e- plasma, which expands and impacts onto the SN ejecta. This process is here considered as a candidate for the production of X-ray flares, which are frequently observed following the prompt emission of GRBs. In this work we follow the evolution of the e+e- plasma as it interacts with the SN ejecta, by solving the equations of relativistic hydrodynamics numerically. Our results are compatible with the Lorentz factors estimated for the sources that produce the flares, of typically Γ ≲ 4.

The type IIB string axiverse and its low-energy phenomenology

International Nuclear Information System (INIS)

Cicoli, Michele; Goodsell, Mark D.; Ringwald, Andreas

2012-06-01

We study closed string axions in type IIB orientifold compactifications. We show that for natural values of the background fluxes the moduli stabilisation mechanism of the LARGE Volume Scenario (LVS) gives rise to an axiverse characterised by the presence of a QCD axion plus many light axion-like particles whose masses are logarithmically hierarchical. We study the phenomenological features of the LVS axiverse, deriving the masses of the axions and their couplings to matter and gauge fields. We also determine when closed string axions can solve the strong CP problem, and analyse the first explicit examples of semi-realistic models with stable moduli and a QCD axion candidate which is not eaten by an anomalous Abelian gauge boson. We discuss the impact of the choice of inflationary scenario on the LVS axiverse, and summarise the astrophysical, cosmological and experimental constraints upon it. Moreover, we show how models can be constructed with additional light axion-like particles that could explain some intriguing astrophysical anomalies, and could be searched for in the next generation of axion helioscopes and light-shining-through-a-wall experiments.

The type IIB string axiverse and its low-energy phenomenology

Energy Technology Data Exchange (ETDEWEB)

Cicoli, Michele [Abdus Salam International Centre for Theoretical Physics, Trieste (Italy); INFN, Sezione di Trieste (Italy); Goodsell, Mark D. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Ringwald, Andreas [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

2012-06-15

We study closed string axions in type IIB orientifold compactifications. We show that for natural values of the background fluxes the moduli stabilisation mechanism of the LARGE Volume Scenario (LVS) gives rise to an axiverse characterised by the presence of a QCD axion plus many light axion-like particles whose masses are logarithmically hierarchical. We study the phenomenological features of the LVS axiverse, deriving the masses of the axions and their couplings to matter and gauge fields. We also determine when closed string axions can solve the strong CP problem, and analyse the first explicit examples of semi-realistic models with stable moduli and a QCD axion candidate which is not eaten by an anomalous Abelian gauge boson. We discuss the impact of the choice of inflationary scenario on the LVS axiverse, and summarise the astrophysical, cosmological and experimental constraints upon it. Moreover, we show how models can be constructed with additional light axion-like particles that could explain some intriguing astrophysical anomalies, and could be searched for in the next generation of axion helioscopes and light-shining-through-a-wall experiments.

Synthesis and characterization of p-type boron-doped IIb diamond large single crystals

International Nuclear Information System (INIS)

Li Shang-Sheng; Li Xiao-Lei; Su Tai-Chao; Jia Xiao-Peng; Ma Hong-An; Huang Guo-Feng; Li Yong

2011-01-01

High-quality p-type boron-doped IIb diamond large single crystals are successfully synthesized by the temperature gradient method in a china-type cubic anvil high-pressure apparatus at about 5.5 GPa and 1600 K. The morphologies and surface textures of the synthetic diamond crystals with different boron additive quantities are characterized by using an optical microscope and a scanning electron microscope respectively. The impurities of nitrogen and boron in diamonds are detected by micro Fourier transform infrared technique. The electrical properties including resistivities, Hall coefficients, Hall mobilities and carrier densities of the synthesized samples are measured by a four-point probe and the Hall effect method. The results show that large p-type boron-doped diamond single crystals with few nitrogen impurities have been synthesized. With the increase of quantity of additive boron, some high-index crystal faces such as {113} gradually disappear, and some stripes and triangle pits occur on the crystal surface. This work is helpful for the further research and application of boron-doped semiconductor diamond. (cross-disciplinary physics and related areas of science and technology)

Late-time spectral line formation in Type IIb supernovae, with application to SN 1993J, SN 2008ax, and SN 2011dh

Science.gov (United States)

Jerkstrand, A.; Ergon, M.; Smartt, S. J.; Fransson, C.; Sollerman, J.; Taubenberger, S.; Bersten, M.; Spyromilio, J.

2015-01-01

We investigate line formation processes in Type IIb supernovae (SNe) from 100 to 500 days post-explosion using spectral synthesis calculations. The modelling identifies the nuclear burning layers and physical mechanisms that produce the major emission lines, and the diagnostic potential of these. We compare the model calculations with data on the three best observed Type IIb SNe to-date - SN 1993J, SN 2008ax, and SN 2011dh. Oxygen nucleosynthesis depends sensitively on the main-sequence mass of the star and modelling of the [O I] λλ6300, 6364 lines constrains the progenitors of these three SNe to the MZAMS = 12-16 M⊙ range (ejected oxygen masses 0.3-0.9 M⊙), with SN 2011dh towards the lower end and SN 1993J towards the upper end of the range. The high ejecta masses from MZAMS ≳ 17 M⊙ progenitors give rise to brighter nebular phase emission lines than observed. Nucleosynthesis analysis thus supports a scenario of low-to-moderate mass progenitors for Type IIb SNe, and by implication an origin in binary systems. We demonstrate how oxygen and magnesium recombination lines may be combined to diagnose the magnesium mass in the SN ejecta. For SN 2011dh, a magnesium mass of 0.02-0.14 M⊙ is derived, which gives a Mg/O production ratio consistent with the solar value. Nitrogen left in the He envelope from CNO burning gives strong [N II] λλ6548, 6583 emission lines that dominate over Hα emission in our models. The hydrogen envelopes of Type IIb SNe are too small and dilute to produce any noticeable Hα emission or absorption after ~150 days, and nebular phase emission seen around 6550 Å is in many cases likely caused by [N II] λλ6548, 6583. Finally, the influence of radiative transport on the emergent line profiles is investigated. Significant line blocking in the metal core remains for several hundred days, which affects the emergent spectrum. These radiative transfer effects lead to early-time blueshifts of the emission line peaks, which gradually

Duality covariant type-IIB supersymmetry and nonperturbative consequences

International Nuclear Information System (INIS)

Bars, I.

1997-01-01

Type-IIB supersymmetric theories have an SL(2,Z) invariance, known as U duality, which controls the nonperturbative behavior of the theory. Under SL(2,Z) the supercharges are doublets, implying that the bosonic charges would be singlets or triplets. However, among the bosonic charges there are doublet strings and doublet five-branes which are in conflict with the doublet property of the supercharges. It is shown that the conflict is resolved by structure constants that depend on moduli, such as the tau parameter, which transform under the same SL(2,Z). The resulting superalgebra encodes the nonperturbative duality properties of the theory and is valid for any value of the string coupling constant. The usefulness of the formalism is illustrated by applying it to purely algebraic computations of the tension of (p,q) strings, and the mass and entropy of extremal black holes constructed from D-1-branes and D-5-branes. In the latter case the nonperturbative coupling dependence of the BPS mass and renormalization is computed for the first time in this paper. It is further argued that the moduli dependence of the superalgebra provides hints for four more dimensions beyond ten, such that the superalgebra is embedded in a fundamental theory which would be covariant under SO(11,3). An outline is given for a matrix theory in 14 dimensions that would be consistent with M(atrix) theory as well as with the above observations. copyright 1997 The American Physical Society

VLBI OBSERVATIONS OF THE NEARBY TYPE IIb SUPERNOVA 2011dh

International Nuclear Information System (INIS)

Bietenholz, M. F.; Brunthaler, A.; Soderberg, A. M.; Zauderer, B.; Krauss, M.; Chomiuk, L.; Rupen, M. P.; Bartel, N.

2012-01-01

We report on phase-referenced very long baseline interferometry radio observations of the Type IIb supernova 2011dh, at times t = 83 days and 179 days after the explosion and at frequencies, respectively, of 22.2 and 8.4 GHz. We detected SN 2011dh at both epochs. At the first epoch only an upper limit on SN 2011dh's angular size was obtained, but at the second epoch, we determine the angular radius of SN 2011dh's radio emission to be 0.25 ± 0.08 mas by fitting a spherical shell model directly to the visibility measurements. At a distance of 8.4 Mpc, this angular radius corresponds to a time-averaged (since t = 0) expansion velocity of the forward shock of 21, 000 ± 7000 km s –1 . Our measured values of the radius of the emission region are in excellent agreement with those derived from fitting synchrotron self-absorbed models to the radio spectral energy distribution, providing strong confirmation for the latter method of estimating the radius. We find that SN 2011dh's radius evolves in a power-law fashion, with R∝t 0.92±0.10 .

Cloning of zebrafish activin type IIB receptor (ActRIIB) cDNA and mRNA expression of ActRIIB in embryos and adult tissues.

Science.gov (United States)

Garg, R R; Bally-Cuif, L; Lee, S E; Gong, Z; Ni, X; Hew, C L; Peng, C

1999-07-20

A full-length cDNA encoding for activin type IIB receptor (ActRIIB) was cloned from zebrafish embryos. It encodes a protein with 509 amino acids consisting of a signal peptide, an extracellular ligand binding domain, a single transmembrane region, and an intracellular kinase domain with predicted serine/threonine specificity. The extracellular domain shows 74-91% sequence identity to human, bovine, mouse, rat, chicken, Xenopus and goldfish activin type IIB receptors, while the transmembrane region and the kinase domain show 67-78% and 82-88% identity to these known activin IIB receptors, respectively. In adult zebrafish, ActRIIB mRNA was detected by RT-PCR in the gonads, as well as in non-reproductive tissues, including the brain, heart and muscle. In situ hybridization on ovarian sections further localized ActRIIB mRNA to cytoplasm of oocytes at different stages of development. Using whole-mount in situ hybridization, ActRIIB mRNA was found to be expressed at all stages of embryogenesis examined, including the sphere, shield, tail bud, and 6-7 somite. These results provide the first evidence that ActRIIB mRNA is widely distributed in fish embryonic and adult tissues. Cloning of zebrafish ActRIIB demonstrates that this receptor is highly conserved during vertebrate evolution and provides a basis for further studies on the role of activin in reproduction and development in lower vertebrates.

String loop moduli stabilisation and cosmology in IIB flux compactifications

International Nuclear Information System (INIS)

Cicoli, M.

2010-01-01

We present a detailed review of the moduli stabilisation mechanism and possible cosmological implications of the LARGE Volume Scenario (LVS) that emerges naturally in the context of type IIB Calabi-Yau flux compactifications. After a quick overview of physics beyond the Standard Model, we present string theory as the most promising candidate for a consistent theory of quantum gravity. We then give a pedagogical introduction to type IIB compactifications on Calabi-Yau orientifolds where most of the moduli are stabilised by turning on background fluxes. However in order to fix the Kaehler moduli one needs to consider several corrections beyond the leading order approximations. After presenting a survey of all the existing solutions to this problem, we derive the topological conditions on an arbitrary Calabi-Yau to obtain the LVS since it requires no fine-tuning of the fluxes and provides a natural solution of the hierarchy problem. After performing a systematic study of the behaviour of string loop corrections for general type IIB compactifications, we show how they play a crucial role to achieve full Kaehler moduli stabilisation in the LVS. Before examining the possible cosmological implication of these scenarios, we present a broad overview of string cosmology. We then notice how, in the case of K3-fibrations, string loop corrections give rise naturally to an inflationary model which yields observable gravity waves. We finally study the finite-temperature behaviour of the LVS and discuss prospects for future work. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

On the non-existence of totally localised intersections of D3/D5 branes in type IIB SUGRA

Energy Technology Data Exchange (ETDEWEB)

Patino, Leonardo [Department of Mathematical Sciences, University of Durham, Durham, DH1 3LE (United Kingdom); Smith, Douglas [Department of Mathematical Sciences, University of Durham, Durham, DH1 3LE (United Kingdom)

2005-04-01

In the present paper we study the most general configuration of intersecting D3/D5 branes in type IIB supergravity satisfying Poincare invariance in the directions common to the branes and SO(3) symmetry in the totally perpendicular directions. The form of these configurations is greatly restricted by the Killing spinor equations and the equations of motion, which among other things, force the Ramond-Ramond scalar to be zero and do not permit the existence of totally localised intersections of this kind.

On the non-existence of totally localised intersections of D3/D5 branes in type IIB SUGRA

International Nuclear Information System (INIS)

Patino, Leonardo; Smith, Douglas

2005-01-01

In the present paper we study the most general configuration of intersecting D3/D5 branes in type IIB supergravity satisfying Poincare invariance in the directions common to the branes and SO(3) symmetry in the totally perpendicular directions. The form of these configurations is greatly restricted by the Killing spinor equations and the equations of motion, which among other things, force the Ramond-Ramond scalar to be zero and do not permit the existence of totally localised intersections of this kind

Treatment with soluble activin type IIB-receptor improves bone mass and strength in a mouse model of Duchenne muscular dystrophy.

Science.gov (United States)

Puolakkainen, Tero; Ma, Hongqian; Kainulainen, Heikki; Pasternack, Arja; Rantalainen, Timo; Ritvos, Olli; Heikinheimo, Kristiina; Hulmi, Juha J; Kiviranta, Riku

2017-01-19

Inhibition of activin/myostatin pathway has emerged as a novel approach to increase muscle mass and bone strength. Duchenne muscular dystrophy (DMD) is a neuromuscular disorder that leads to progressive muscle degeneration and also high incidence of fractures. The aim of our study was to test whether inhibition of activin receptor IIB ligands with or without exercise could improve bone strength in the mdx mouse model for DMD. Thirty-two mdx mice were divided to running and non-running groups and to receive either PBS control or soluble activin type IIB-receptor (ActRIIB-Fc) once weekly for 7 weeks. Treatment of mdx mice with ActRIIB-Fc resulted in significantly increased body and muscle weights in both sedentary and exercising mice. Femoral μCT analysis showed increased bone volume and trabecular number (BV/TV +80%, Tb.N +70%, P treatment of mdx mice with the soluble ActRIIB-Fc results in a robust increase in bone mass, without any additive effect by voluntary running. Thus ActRIIB-Fc could be an attractive option in the treatment of musculoskeletal disorders.

Identification of a nonsense mutation at amino acid 584-arginine of platelet glycoprotein IIb in patients with type I glanzmann thrombasthenia

International Nuclear Information System (INIS)

Gu Jianming; Xu Wenfeng; Wang Xiaodong; Wu Qingyu; Qi Zhengwu; Ruan Changgeng

1993-08-01

Using southern blot, the restriction digests of genomic DNAs in eleven patients with Glanzmann thrombasthenia from ten unrelated kindred were probed with a platelet full-length GP IIb cDNA. An abnormal 2.3 kb Taq I fragment and two 1.65 kb and 0.65 kb fragments with reduced band intensity were found in the genes of two affected siblings from a family originated in city Huang Yan of Zhejiang Province. The Taq I digest of the abnormal gene was further probed with three portions of GP IIb cDNA, revealing that the heterozygous mutation was present in the region around exons 15 ∼ 17 of the GP IIb gene. Two primers for polymerase chain reaction (PCR) were then designed, and a 394 bp PCR product was generated and sequenced, indicating that a stop codon was substituted for an Arg codon at amino acid position 584 of GP IIb, and brought about a premature termination of translation and production of a shortened protein. The Western blot analysis showed that GP IIb and GP IIIa at the platelet surface were apparently deficient, it may be ascribed to the rapid turn-over of GP IIIa uncomplexed with the truncated GP II b. The abnormal 2.3 kb Tag I fragment was used as a specific genetic marker to detect the carrier status of the patient's family. The abnormal allele was proved to be derived from the mother, the two affected siblings are double heterozygotes carrying two different GP II b-defective alleles and one clinically unaffected sister has also inherited this defective allele, while the father carries another unidentified recessive abnormal GP IIb-defective allele

Long-lasting X-ray emission from type IIb supernova 2011dh and mass-loss history of the yellow supergiant progenitor

Energy Technology Data Exchange (ETDEWEB)

Maeda, Keiichi [Department of Astronomy, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Katsuda, Satoru [RIKEN (The Institute of Physical and Chemical Research) Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Bamba, Aya [Department of Physics and Mathematics, Aoyama Gakuin University, 5-10-1 Fuchinobe, Chuo-ku, Sagamihara, Kanagawa 252-5258 (Japan); Terada, Yukikatsu [Graduate School of Science and Engineering, Saitama University, Shimo-Okubo 255, Sakura, Saitama 338-8570 (Japan); Fukazawa, Yasushi, E-mail: keiichi.maeda@kusastro.kyoto-u.ac.jp [Department of Physical Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8526 (Japan)

2014-04-20

Type IIb supernova (SN) 2011dh, with conclusive detection of an unprecedented yellow supergiant (YSG) progenitor, provides an excellent opportunity to deepen our understanding on the massive star evolution in the final centuries toward the SN explosion. In this paper, we report on detection and analyses of thermal X-ray emission from SN IIb 2011dh at ∼500 days after the explosion on Chandra archival data, providing a solidly derived mass-loss rate of a YSG progenitor for the first time. We find that the circumstellar media should be dense, more than that expected from a Wolf-Rayet (W-R) star by one order of magnitude. The emission is powered by a reverse shock penetrating into an outer envelope, fully consistent with the YSG progenitor but not with a W-R progenitor. The density distribution at the outermost ejecta is much steeper than that expected from a compact W-R star, and this finding must be taken into account in modeling the early UV/optical emission from SNe IIb. The derived mass-loss rate is ∼3 × 10{sup –6} M {sub ☉} yr{sup –1} for the mass-loss velocity of ∼20 km s{sup –1} in the final ∼1300 yr before the explosion. The derived mass-loss properties are largely consistent with the standard wind mass-loss expected for a giant star. This is not sufficient to be a main driver to expel nearly all the hydrogen envelope. Therefore, the binary interaction, with a huge mass transfer having taken place at ≳ 1300 yr before the explosion, is a likely scenario to produce the YSG progenitor.

SN 2015as: a low-luminosity Type IIb supernova without an early light-curve peak

Science.gov (United States)

Gangopadhyay, Anjasha; Misra, Kuntal; Pastorello, A.; Sahu, D. K.; Tomasella, L.; Tartaglia, L.; Singh, Mridweeka; Dastidar, Raya; Srivastav, S.; Ochner, P.; Brown, Peter J.; Anupama, G. C.; Benetti, S.; Cappellaro, E.; Kumar, Brajesh; Kumar, Brijesh; Pandey, S. B.

2018-05-01

We present results of the photometric (from 3 to 509 d post-explosion) and spectroscopic (up to 230 d post-explosion) monitoring campaign of the He-rich Type IIb supernova (SN) 2015as. The (B - V) colour evolution of SN 2015as closely resemble those of SN 2008ax, suggesting that SN 2015as belongs to the SN IIb subgroup that does not show the early, short-duration photometric peak. The light curve of SN 2015as reaches the B-band maximum about 22 d after the explosion, at an absolute magnitude of -16.82 ± 0.18 mag. At ˜75 d after the explosion, its spectrum transitions from that of a SN II to a SN Ib. P Cygni features due to He I lines appear at around 30 d after explosion, indicating that the progenitor of SN 2015as was partially stripped. For SN 2015as, we estimate a 56Ni mass of ˜0.08 M⊙ and ejecta mass of 1.1-2.2 M⊙, which are similar to the values inferred for SN 2008ax. The quasi-bolometric analytical light-curve modelling suggests that the progenitor of SN 2015as has a modest mass (˜0.1 M⊙), a nearly compact (˜0.05 × 1013 cm) H envelope on top of a dense, compact (˜2 × 1011 cm) and a more massive (˜1.2 M⊙) He core. The analysis of the nebular phase spectra indicates that ˜0.44 M⊙ of O is ejected in the explosion. The intensity ratio of the [Ca II]/[O I] nebular lines favours either a main-sequence progenitor mass of ˜15 M⊙ or a Wolf-Rayet star of 20 M⊙.

The spectra of type IIB flux compactifications at large complex structure

International Nuclear Information System (INIS)

Brodie, Callum; Marsh, M.C. David

2016-01-01

We compute the spectra of the Hessian matrix, H, and the matrix M that governs the critical point equation of the low-energy effective supergravity, as a function of the complex structure and axio-dilaton moduli space in type IIB flux compactifications at large complex structure. We find both spectra analytically in an h − 1,2 +3 real-dimensional subspace of the moduli space, and show that they exhibit a universal structure with highly degenerate eigenvalues, independently of the choice of flux, the details of the compactification geometry, and the number of complex structure moduli. In this subspace, the spectrum of the Hessian matrix contains no tachyons, but there are also no critical points. We show numerically that the spectra of H and M remain highly peaked over a large fraction of the sampled moduli space of explicit Calabi-Yau compactifications with 2 to 5 complex structure moduli. In these models, the scale of the supersymmetric contribution to the scalar masses is strongly linearly correlated with the value of the superpotential over almost the entire moduli space, with particularly strong correlations arising for g s <1. We contrast these results with the expectations from the much-used continuous flux approximation, and comment on the applicability of Random Matrix Theory to the statistical modelling of the string theory landscape.

On R4 threshold corrections in type IIB string theory and (p,q)-string instantons

International Nuclear Information System (INIS)

Kiritsis, E.; Pioline, B.

1997-01-01

We obtain the exact non-perturbative thresholds of R 4 terms in type IIB string theory compactified to eight and seven dimensions. These thresholds are given by the perturbative tree-level and one-loop results together with the contribution of the D-instantons and of the (p,q)-string instantons. The invariance under U-duality is made manifest by rewriting the sum as a non-holomorphic-invariant modular function of the corresponding discrete U-duality group. In the eight-dimensional case, the threshold is the sum of an order-1 Eisenstein series for SL(2,Z) and an order-3/2 Eisenstein series for SL(3,Z). The seven-dimensional result is given by the order-3/2 Eisenstein series for SL(5,Z). We also conjecture formulae for the non-perturbative thresholds in lower-dimensional compactifications and discuss the relation with M-theory. (orig.)

Genetic organization of ascB-dapE internalin cluster serves as a potential marker for Listeria monocytogenes sublineages IIA, IIB, and IIC.

Science.gov (United States)

Chen, Jianshun; Fang, Chun; Zhu, Ningyu; Lv, Yonghui; Cheng, Changyong; Bei, Yijiang; Zheng, Tianlun; Fang, Weihuan

2012-05-01

Listeria monocytogenes is an important foodborne pathogen that comprises four genetic lineages: I, II, III, and IV. Of these, lineage II is frequently recovered from foods and environments and responsible for the increasing incidence of human listeriosis. In this study, the phylogenetic structure of lineage II was determined through sequencing analysis of the ascB-dapE internalin cluster. Fifteen sequence types proposed by multilocus sequence typing based on nine housekeeping genes were grouped into three distinct sublineages, IIA, IIB, and IIC. Organization of the ascBdapE internalin cluster could serve as a molecular marker for these sublineages, with inlGHE, inlGC2DE, and inlC2DE for IIA, IIB, and IIC, respectively. These sublineages displayed specific genetic and phenotypic characteristics. IIA and IIC showed a higher frequency of recombination (rho/theta). However, recombination events had greater effect (r/m) on IIB, leading to its high nucleotide diversity. Moreover, IIA and IIB harbored a wider range of internalin and stress-response genes, and possessed higher nisin tolerance, whereas IIC contained the largest portion of low-virulent strains owing to premature stop codons in inlA. The results of this study indicate that IIA, IIB, and IIC might occupy different ecological niches, and IIB might have a better adaptation to a broad range of environmental niches.

MULTI-WAVELENGTH OBSERVATIONS OF SUPERNOVA 2011ei: TIME-DEPENDENT CLASSIFICATION OF TYPE IIb AND Ib SUPERNOVAE AND IMPLICATIONS FOR THEIR PROGENITORS

International Nuclear Information System (INIS)

Milisavljevic, Dan; Margutti, Raffaella; Soderberg, Alicia M.; Chomiuk, Laura; Sanders, Nathan E.; Pignata, Giuliano; Bufano, Filomena; Fesen, Robert A.; Parrent, Jerod T.; Parker, Stuart; Mazzali, Paolo; Pian, Elena; Pickering, Timothy; Buckley, David A. H.; Crawford, Steven M.; Gulbis, Amanda A. S.; Hettlage, Christian; Hooper, Eric; Nordsieck, Kenneth H.; O'Donoghue, Darragh

2013-01-01

We present X-ray, UV/optical, and radio observations of the stripped-envelope, core-collapse supernova (SN) 2011ei, one of the least luminous SNe IIb or Ib observed to date. Our observations begin with a discovery within ∼1 day of explosion and span several months afterward. Early optical spectra exhibit broad, Type II-like hydrogen Balmer profiles that subside rapidly and are replaced by Type Ib-like He-rich features on a timescale of one week. High-cadence monitoring of this transition suggests absorption attributable to a high-velocity (∼> 12, 000 km s –1 ) H-rich shell, which is likely present in many Type Ib events. Radio observations imply a shock velocity of v ≈ 0.13 c and a progenitor star average mass-loss rate of M-dot ∼1.4×10 -5 M sun yr -1 (assuming wind velocity v w = 10 3 km s –1 ). This is consistent with independent constraints from deep X-ray observations with Swift-XRT and Chandra. Overall, the multi-wavelength properties of SN 2011ei are consistent with the explosion of a lower-mass (3-4 M ☉ ), compact (R * ∼ 11 cm), He-core star. The star retained a thin hydrogen envelope at the time of explosion, and was embedded in an inhomogeneous circumstellar wind suggestive of modest episodic mass loss. We conclude that SN 2011ei's rapid spectral metamorphosis is indicative of time-dependent classifications that bias estimates of the relative explosion rates for Type IIb and Ib objects, and that important information about a progenitor star's evolutionary state and mass loss immediately prior to SN explosion can be inferred from timely multi-wavelength observations.

MULTI-WAVELENGTH OBSERVATIONS OF SUPERNOVA 2011ei: TIME-DEPENDENT CLASSIFICATION OF TYPE IIb AND Ib SUPERNOVAE AND IMPLICATIONS FOR THEIR PROGENITORS

Energy Technology Data Exchange (ETDEWEB)

Milisavljevic, Dan; Margutti, Raffaella; Soderberg, Alicia M.; Chomiuk, Laura; Sanders, Nathan E. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Pignata, Giuliano; Bufano, Filomena [Departamento de Ciencias Fisicas, Universidad Andres Bello, Avda. Republica 252, Santiago (Chile); Fesen, Robert A.; Parrent, Jerod T. [Department of Physics and Astronomy, Dartmouth College, 6127 Wilder Lab, Hanover, NH 03755 (United States); Parker, Stuart [Parkdale Observatory, 225 Warren Road, RDl Oxford, Canterbury 7495 (New Zealand); Mazzali, Paolo [Max-Planck-Institut fuer Astrophysik, Karl-Schwarzschild-Strasse 1, D-85748 Garching (Germany); Pian, Elena [Kavli Institute for Theoretical Physics, Kohn Hall, University of California at Santa Barbara, Santa Barbara, CA 93106-4030 (United States); Pickering, Timothy; Buckley, David A. H.; Crawford, Steven M.; Gulbis, Amanda A. S.; Hettlage, Christian [South African Astronomical Observatory, P.O. Box 9, Observatory 7935, Cape Town (South Africa); Hooper, Eric; Nordsieck, Kenneth H. [Department of Astronomy, University of Wisconsin, Madison, WI 53706 (United States); O' Donoghue, Darragh, E-mail: dmilisav@cfa.harvard.edu [Southern African Large Telescope, P.O. Box 9, Observatory 7935, Cape Town (South Africa); and others

2013-04-10

We present X-ray, UV/optical, and radio observations of the stripped-envelope, core-collapse supernova (SN) 2011ei, one of the least luminous SNe IIb or Ib observed to date. Our observations begin with a discovery within {approx}1 day of explosion and span several months afterward. Early optical spectra exhibit broad, Type II-like hydrogen Balmer profiles that subside rapidly and are replaced by Type Ib-like He-rich features on a timescale of one week. High-cadence monitoring of this transition suggests absorption attributable to a high-velocity ({approx}> 12, 000 km s{sup -1}) H-rich shell, which is likely present in many Type Ib events. Radio observations imply a shock velocity of v Almost-Equal-To 0.13 c and a progenitor star average mass-loss rate of M-dot {approx}1.4 Multiplication-Sign 10{sup -5} M{sub sun} yr{sup -1} (assuming wind velocity v{sub w} = 10{sup 3} km s{sup -1}). This is consistent with independent constraints from deep X-ray observations with Swift-XRT and Chandra. Overall, the multi-wavelength properties of SN 2011ei are consistent with the explosion of a lower-mass (3-4 M{sub Sun }), compact (R{sub *} {approx}< 1 Multiplication-Sign 10{sup 11} cm), He-core star. The star retained a thin hydrogen envelope at the time of explosion, and was embedded in an inhomogeneous circumstellar wind suggestive of modest episodic mass loss. We conclude that SN 2011ei's rapid spectral metamorphosis is indicative of time-dependent classifications that bias estimates of the relative explosion rates for Type IIb and Ib objects, and that important information about a progenitor star's evolutionary state and mass loss immediately prior to SN explosion can be inferred from timely multi-wavelength observations.

Dual mechanism of integrin αIIbβ3 closure in procoagulant platelets.

Science.gov (United States)

Mattheij, Nadine J A; Gilio, Karen; van Kruchten, Roger; Jobe, Shawn M; Wieschhaus, Adam J; Chishti, Athar H; Collins, Peter; Heemskerk, Johan W M; Cosemans, Judith M E M

2013-05-10

Inactivation of integrin αIIbβ3 reverses platelet aggregate formation upon coagulation. Platelets from patient (Scott) and mouse (Capn1(-/-) and Ppif(-/-)) blood reveal a dual mechanism of αIIbβ3 inactivation: by calpain-2 cleavage of integrin-associated proteins and by cyclophilin D/TMEM16F-dependent phospholipid scrambling. These data provide novel insight into the switch mechanisms from aggregating to procoagulant platelets. Aggregation of platelets via activated integrin αIIbβ3 is a prerequisite for thrombus formation. Phosphatidylserine-exposing platelets with a key role in the coagulation process disconnect from a thrombus by integrin inactivation via an unknown mechanism. Here we show that αIIbβ3 inactivation in procoagulant platelets relies on a sustained high intracellular Ca(2+), stimulating intracellular cleavage of the β3 chain, talin, and Src kinase. Inhibition of calpain activity abolished protein cleavage, but only partly suppressed αIIbβ3 inactivation. Integrin αIIbβ3 inactivation was unchanged in platelets from Capn1(-/-) mice, suggesting a role of the calpain-2 isoform. Scott syndrome platelets, lacking the transmembrane protein TMEM16F and having low phosphatidylserine exposure, displayed reduced αIIbβ3 inactivation with the remaining activity fully dependent on calpain. In platelets from Ppif(-/-) mice, lacking mitochondrial permeability transition pore (mPTP) formation, agonist-induced phosphatidylserine exposure and αIIbβ3 inactivation were reduced. Treatment of human platelets with cyclosporin A gave a similar phenotype. Together, these data point to a dual mechanism of αIIbβ3 inactivation via calpain(-2) cleavage of integrin-associated proteins and via TMEM16F-dependent phospholipid scrambling with an assistant role of mPTP formation.

Cucurbitacin IIb exhibits anti-inflammatory activity through modulating multiple cellular behaviors of mouse lymphocytes.

Directory of Open Access Journals (Sweden)

Yao Wang

Full Text Available Cucurbitacin IIb (CuIIb is one of the major active compounds in Hemsleyadine tablets which have been used for clinical treatment of bacillary dysentery, enteritis and acute tonsilitis. However, its action mechanism has not been completely understood. This study aimed to explore the anti-inflammatory activity of CuIIb and its underlying mechanism in mitogen-activated lymphocytes isolated from mouse mesenteric lymph nodes. The results showed that CuIIb inhibited the proliferation of concanavalin A (Con A-activated lymphocytes in a time- and dose-dependent manner. CuIIb treatment arrested their cell cycle in S and G2/M phases probably due to the disruption of the actin cytoskeleton and the modulation of p27(Kip1 and cyclin levels. Moreover, the surface expression of activation markers CD69 and CD25 on Con A-activated CD3(+ T lymphocytes was suppressed by CuIIb treatment. Both Con A- and phorbol ester plus ionomycin-induced expression of TNF-α, IFN-γ and IL-6 proteins was attenuated upon exposure to CuIIb. Mechanistically, CuIIb treatment suppressed the phosphorylation of JNK and Erk1/2 but not p38 in Con A-activated lymphocytes. Although CuIIb unexpectedly enhanced the phosphorylation of IκB and NF-κB (p65, it blocked the nuclear translocation of NF-κB (p65. In support of this, CuIIb significantly decreased the mRNA levels of IκBα and TNF-α, two target genes of NF-κB, in Con A-activated lymphocytes. In addition, CuIIb downregulated Con A-induced STAT3 phosphorylation and increased cell apoptosis. Collectively, these results suggest that CuIIb exhibits its anti-inflammatory activity through modulating multiple cellular behaviors and signaling pathways, leading to the suppression of the adaptive immune response.

Inhibition of αIIbβ3 Ligand Binding by an αIIb Peptide that Clasps the Hybrid Domain to the βI Domain of β3.

Directory of Open Access Journals (Sweden)

Wen Hwa Lee

Full Text Available Agonist-stimulated platelet activation triggers conformational changes of integrin αIIbβ3, allowing fibrinogen binding and platelet aggregation. We have previously shown that an octapeptide, p1YMESRADR8, corresponding to amino acids 313-320 of the β-ribbon extending from the β-propeller domain of αIIb, acts as a potent inhibitor of platelet aggregation. Here we have performed in silico modelling analysis of the interaction of this peptide with αIIbβ3 in its bent and closed (not swing-out conformation and show that the peptide is able to act as a substitute for the β-ribbon by forming a clasp restraining the β3 hybrid and βI domains in a closed conformation. The involvement of species-specific residues of the β3 hybrid domain (E356 and K384 and the β1 domain (E297 as well as an intrapeptide bond (pE315-pR317 were confirmed as important for this interaction by mutagenesis studies of αIIbβ3 expressed in CHO cells and native or substituted peptide inhibitory studies on platelet functions. Furthermore, NMR data corroborate the above results. Our findings provide insight into the important functional role of the αIIb β-ribbon in preventing integrin αIIbβ3 head piece opening, and highlight a potential new therapeutic approach to prevent integrin ligand binding.

Realizing three generations of the Standard Model fermions in the type IIB matrix model

International Nuclear Information System (INIS)

Aoki, Hajime; Nishimura, Jun; Tsuchiya, Asato

2014-01-01

We discuss how the Standard Model particles appear from the type IIB matrix model, which is considered to be a nonperturbative formulation of superstring theory. In particular, we are concerned with a constructive definition of the theory, in which we start with finite-N matrices and take the large-N limit afterwards. In that case, it was pointed out recently that realizing chiral fermions in the model is more difficult than it had been thought from formal arguments at N=∞ and that introduction of a matrix version of the warp factor is necessary. Based on this new insight, we show that two generations of the Standard Model fermions can be realized by considering a rather generic configuration of fuzzy S"2 and fuzzy S"2×S"2 in the extra dimensions. We also show that three generations can be obtained by squashing one of the S"2’s that appear in the configuration. Chiral fermions appear at the intersections of the fuzzy manifolds with nontrivial Yukawa couplings to the Higgs field, which can be calculated from the overlap of their wave functions.

IIB backgrounds with five-form flux

International Nuclear Information System (INIS)

Gran, U.; Gutowski, J.; Papadopoulos, G.

2008-01-01

We investigate all N=2 supersymmetric IIB supergravity backgrounds with non-vanishing five-form flux. The Killing spinors have stability subgroups Spin(7) x R 8 , SU(4) x R 8 and G 2 . In the SU(4) x R 8 case, two different types of geometry arise depending on whether the Killing spinors are generic or pure. In both cases, the backgrounds admit a null Killing vector field which leaves invariant the SU(4) x R 8 structure, and an almost complex structure in the directions transverse to the lightcone. In the generic case, the twist of the vector field is trivial but the almost complex structure is non-integrable, while in the pure case the twist is non-trivial but the almost complex structure is integrable and associated with a relatively balanced Hermitian structure. The G 2 backgrounds admit a time-like Killing vector field and two spacelike closed one-forms, and the seven directions transverse to these admit a co-symplectic G 2 structure. The Spin(7) x R 8 backgrounds are pp-waves propagating in an eight-dimensional manifold with holonomy Spin(7). In addition we show that all the supersymmetric solutions of simple five-dimensional supergravity with a time-like Killing vector field, which include the AdS 5 black holes, lift to SU(4) x R 8 pure Killing spinor IIB backgrounds. We also show that the LLM solution is associated with a co-symplectic co-homogeneity one G 2 manifold which has principal orbit S 3 xS 3

The role of myostatin and activin receptor IIB in the regulation of unloading-induced myofiber type-specific skeletal muscle atrophy.

Science.gov (United States)

Babcock, Lyle W; Knoblauch, Mark; Clarke, Mark S F

2015-09-15

Chronic unloading induces decrements in muscle size and strength. This adaptation is governed by a number of molecular factors including myostatin, a potent negative regulator of muscle mass. Myostatin must first be secreted into the circulation and then bind to the membrane-bound activin receptor IIB (actRIIB) to exert its atrophic action. Therefore, we hypothesized that myofiber type-specific atrophy observed after hindlimb suspension (HLS) would be related to myofiber type-specific expression of myostatin and/or actRIIB. Wistar rats underwent HLS for 10 days, after which the tibialis anterior was harvested for frozen cross sectioning. Simultaneous multichannel immunofluorescent staining combined with differential interference contrast imaging was employed to analyze myofiber type-specific expression of myostatin and actRIIB and myofiber type cross-sectional area (CSA) across fiber types, myonuclei, and satellite cells. Hindlimb suspension (HLS) induced significant myofiber type-specific atrophy in myosin heavy chain (MHC) IIx (P Myostatin staining associated with myonuclei was less in HLS rats compared with controls, while satellite cell staining for myostatin remained unchanged. In contrast, the total number myonuclei and satellite cells per myofiber was reduced in HLS compared with ambulatory control rats (P myostatin-induced myofiber type-selective atrophy observed during chronic unloading. Copyright © 2015 the American Physiological Society.

Universality and the dynamical space-time dimensionality in the Lorentzian type IIB matrix model

Energy Technology Data Exchange (ETDEWEB)

Ito, Yuta [KEK Theory Center, High Energy Accelerator Research Organization,1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Nishimura, Jun [KEK Theory Center, High Energy Accelerator Research Organization,1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Graduate University for Advanced Studies (SOKENDAI),1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Tsuchiya, Asato [Department of Physics, Shizuoka University,836 Ohya, Suruga-ku, Shizuoka 422-8529 (Japan)

2017-03-27

The type IIB matrix model is one of the most promising candidates for a nonperturbative formulation of superstring theory. In particular, its Lorentzian version was shown to exhibit an interesting real-time dynamics such as the spontaneous breaking of the 9-dimensional rotational symmetry to the 3-dimensional one. This result, however, was obtained after regularizing the original matrix integration by introducing “infrared” cutoffs on the quadratic moments of the Hermitian matrices. In this paper, we generalize the form of the cutoffs in such a way that it involves an arbitrary power (2p) of the matrices. By performing Monte Carlo simulation of a simplified model, we find that the results become independent of p and hence universal for p≳1.3. For p as large as 2.0, however, we find that large-N scaling behaviors do not show up, and we cannot take a sensible large-N limit. Thus we find that there is a certain range of p in which a universal large-N limit can be taken. Within this range of p, the dynamical space-time dimensionality turns out to be (3+1), while for p=2.0, where we cannot take a sensible large-N limit, we observe a (5+1)d structure.

Extended no-scale structure and {alpha}'{sup 2} corrections to the type IIB action

Energy Technology Data Exchange (ETDEWEB)

Pedro, F.G. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Rummel, M. [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik; Hong Kong Univ. of Science and Technology (China). Inst. for Advanced Study; Westphal, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Kavali Institute for Theoretical Physics, Santa Barbara, CA (United States)

2013-06-15

We analyse a new N=1 string tree level correction at O({alpha}'{sup 2}) to the Kaehler potential of the volume moduli of type IIB Calabi-Yau flux compactification found recently by T. W. Grimm, R. Savelli and M. Weissenbacher (arXiv:1303.3317 [hep-th]) and its impact on the moduli potential. We find that it imposes a strong lower bound the Calabi-Yau volume in the Large Volume Scenario of moduli stabilisation. For KKLT-like scenarios we find that consistency of the action imposes an upper bound on the flux superpotential vertical stroke W{sub 0} vertical stroke or similar 10{sup 3}. We discuss the phenomenological implication of these bounds on V in the various scenarios.

Towards Matrix Models in IIB Superstrings

OpenAIRE

Olesen, P.

1997-01-01

I review the properties of a matrix action of relevance for IIB superstrings. This model generalizes the action proposed by Ishibashi, Kawai, Kitazawa, and Tsuchiya by introducing an auxillary field Y, which is the matrix version of the auxillary field g in the Schild action.

A review of the microscopic modeling of the 5-dim. black hole of IIB

Indian Academy of Sciences (India)

We review the theory of the microscopic modeling of the 5-dim. black hole of type IIB string theory in terms of the 1-5 brane system. A detailed discussion of the low energy effective Lagrangian of the brane system is presented and the black hole micro-states are identified. These considerations are valid in the strong ...

Pregnancy-specific glycoproteins bind integrin αIIbβ3 and inhibit the platelet-fibrinogen interaction.

Science.gov (United States)

Shanley, Daniel K; Kiely, Patrick A; Golla, Kalyan; Allen, Seamus; Martin, Kenneth; O'Riordan, Ronan T; Ball, Melanie; Aplin, John D; Singer, Bernhard B; Caplice, Noel; Moran, Niamh; Moore, Tom

2013-01-01

Pregnancy-specific glycoproteins (PSGs) are immunoglobulin superfamily members encoded by multigene families in rodents and primates. In human pregnancy, PSGs are secreted by the syncytiotrophoblast, a fetal tissue, and reach a concentration of up to 400 ug/ml in the maternal bloodstream at term. Human and mouse PSGs induce release of anti-inflammatory cytokines such as IL-10 and TGFβ1 from monocytes, macrophages, and other cell types, suggesting an immunoregulatory function. RGD tri-peptide motifs in the majority of human PSGs suggest that they may function like snake venom disintegrins, which bind integrins and inhibit interactions with ligands. We noted that human PSG1 has a KGD, rather than an RGD motif. The presence of a KGD in barbourin, a platelet integrin αIIbβ3 antagonist found in snake venom, suggested that PSG1 may be a selective αIIbβ3 ligand. Here we show that human PSG1 binds αIIbβ3 and inhibits the platelet - fibrinogen interaction. Unexpectedly, however, the KGD is not critical as multiple PSG1 domains independently bind and inhibit αIIbβ3 function. Human PSG9 and mouse Psg23 are also inhibitory suggesting conservation of this function across primate and rodent PSG families. Our results suggest that in species with haemochorial placentation, in which maternal blood is in direct contact with fetal trophoblast, the high expression level of PSGs reflects a requirement to antagonise abundant (3 mg/ml) fibrinogen in the maternal circulation, which may be necessary to prevent platelet aggregation and thrombosis in the prothrombotic maternal environment of pregnancy.

Identification of distal regulatory regions in the human alpha IIb gene locus necessary for consistent, high-level megakaryocyte expression.

Science.gov (United States)

Thornton, Michael A; Zhang, Chunyan; Kowalska, Maria A; Poncz, Mortimer

2002-11-15

The alphaIIb/beta3-integrin receptor is present at high levels only in megakaryocytes and platelets. Its presence on platelets is critical for hemostasis. The tissue-specific nature of this receptor's expression is secondary to the restricted expression of alphaIIb, and studies of the alphaIIb proximal promoter have served as a model of a megakaryocyte-specific promoter. We have examined the alphaIIb gene locus for distal regulatory elements. Sequence comparison between the human (h) and murine (m) alphaIIb loci revealed high levels of conservation at intergenic regions both 5' and 3' to the alphaIIb gene. Additionally, deoxyribonuclease (DNase) I sensitivity mapping defined tissue-specific hypersensitive (HS) sites that coincide, in part, with these conserved regions. Transgenic mice containing various lengths of the h(alpha)IIb gene locus, which included or excluded the various conserved/HS regions, demonstrated that the proximal promoter was sufficient for tissue specificity, but that a region 2.5 to 7.1 kb upstream of the h(alpha)IIb gene was necessary for consistent expression. Another region 2.2 to 7.4 kb downstream of the gene enhanced expression 1000-fold and led to levels of h(alpha)IIb mRNA that were about 30% of the native m(alpha)IIb mRNA level. These constructs also resulted in detectable h(alpha)IIb/m(beta)3 on the platelet surface. This work not only confirms the importance of the proximal promoter of the alphaIIb gene for tissue specificity, but also characterizes the distal organization of the alphaIIb gene locus and provides an initial localization of 2 important regulatory regions needed for the expression of the alphaIIb gene at high levels during megakaryopoiesis.

Is inflation from unwinding fluxes IIB?

Energy Technology Data Exchange (ETDEWEB)

Gautason, Fridrik Freyr [Instituut voor Theoretische Fysica, K.University Leuven,Celestijnenlaan 200D, B-3001 Leuven (Belgium); Institut de Physique Théorique, Université Paris Saclay, CEA, CNRS,Orme des Merisiers, F-91191 Gif-sur-Yvette (France); Schillo, Marjorie; Riet, Thomas Van [Instituut voor Theoretische Fysica, K.University Leuven,Celestijnenlaan 200D, B-3001 Leuven (Belgium)

2017-03-07

In this paper we argue that the mechanism of unwinding inflation is naturally present in warped compactifications of type IIB string theory with local throats. The unwinding of flux is caused by its annihilation against branes. The resulting inflaton potential is linear with periodic modulations. We initiate an analysis of the inflationary dynamics and cosmological observables, which are highly constrained by moduli stabilization. For the simplified model of single-Kähler Calabi-Yau spaces we find that many, though not all of the consistency constraints can be satisfied. Particularly, in this simple model geometric constraints are in tension with obtaining the observed amplitude of the scalar power spectrum. However, we do find 60 efolds of inflation with a trans-Planckian field excursion which offers the hope that slightly more complicated models can lead to a fully consistent explicit construction of large field inflation of this kind.

Rendimientos del colágeno, poliornitinas (tipos: IB, IIB y IC) y colágeno mas poliornitina IB, como substratos para el cultivo de ganglios ciliares disociados de embrión de pollo

OpenAIRE

Bustos Ruiz, M.; Alcaín Tejada, F.J.; Padilla-Alvarez, F.

1981-01-01

Dissociated ciliary ganglia of 8 days embryos were cultured in heart conditioned medium, employing differents substrata types: collagen, po¬lyornithines (types: IB,IIB and IC) and collagen plus polyornithine IB. The results from neuron survival (with and without prolongations) and non neuronal cells it obtained graphically. The polyornithines mollecular weights are discussed respect inductor factors binding for conditioned medium. The type IB is better than others types (IIB y IC), but collag...

A critical role for topoisomerase IIb and DNA double strand breaks in transcription.

Science.gov (United States)

Calderwood, Stuart K

2016-05-26

Recent studies have indicated a novel role for topoisomerase IIb in transcription. Transcription of heat shock genes, serum-induced immediate early genes and nuclear receptor-activated genes, each required DNA double strands generated by topoisomerase IIb. Such strand breaks seemed both necessary and sufficient for transcriptional activation. In addition, such transcription was associated with initiation of the DNA damage response pathways, including the activation of the enzymes: ataxia-telangiectasia mutated (ATM), DNA-dependent protein kinase and poly (ADP ribose) polymerase 1. DNA damage response signaling was involved both in transcription and in repair of DNA breaks generated by topoisomerase IIb.

Kindlins, integrin activation and the regulation of talin recruitment to αIIbβ3.

Directory of Open Access Journals (Sweden)

Bryan N Kahner

Full Text Available Talins and kindlins bind to the integrin β3 cytoplasmic tail and both are required for effective activation of integrin αIIbβ3 and resulting high-affinity ligand binding in platelets. However, binding of the talin head domain alone to β3 is sufficient to activate purified integrin αIIbβ3 in vitro. Since talin is localized to the cytoplasm of unstimulated platelets, its re-localization to the plasma membrane and to the integrin is required for activation. Here we explored the mechanism whereby kindlins function as integrin co-activators. To test whether kindlins regulate talin recruitment to plasma membranes and to αIIbβ3, full-length talin and kindlin recruitment to β3 was studied using a reconstructed CHO cell model system that recapitulates agonist-induced αIIbβ3 activation. Over-expression of kindlin-2, the endogenous kindlin isoform in CHO cells, promoted PAR1-mediated and talin-dependent ligand binding. In contrast, shRNA knockdown of kindlin-2 inhibited ligand binding. However, depletion of kindlin-2 by shRNA did not affect talin recruitment to the plasma membrane, as assessed by sub-cellular fractionation, and neither over-expression of kindlins nor depletion of kindlin-2 affected talin interaction with αIIbβ3 in living cells, as monitored by bimolecular fluorescence complementation. Furthermore, talin failed to promote kindlin-2 association with αIIbβ3 in CHO cells. In addition, purified talin and kindlin-3, the kindlin isoform expressed in platelets, failed to promote each other's binding to the β3 cytoplasmic tail in vitro. Thus, kindlins do not promote initial talin recruitment to αIIbβ3, suggesting that they co-activate integrin through a mechanism independent of recruitment.

Geology and mineral deposits of an area in the Departments of Antioquia and Caldas (Subzone IIB), Colombia

Science.gov (United States)

Feininger, Tomas; Barrero L., Dario; Castro, Nestor; Hall, R.B.

1973-01-01

The Inventario Minero National (IMN), a four-year cooperative geologic mapping and mineral resources appraisal project, was accomplished under an agreement between the Republic of Colombia and the U. S. Agency for International Development from 1964 through 1969. Subzone IIB, consisting essentially of the east half of Zone comprises nearly 20,000 km2 principally in the Department of Antioquia but including also small parts of the Departments of Caldas and Tolima. The rocks in IIB range from Precambrian to Holocene. Precambrian feldspar-quartz gneiss occupies a mosaic of fault-bounded blocks intruded by igneous rocks between the Oto fault and the Rio Magdalena. Paleozoic rocks are extensive, and include lightly metamorphosed graptolite-bearing Ordovician shale at Cristalina, and a major suite of graphitic quartz-mica schist, feldspathic and aluminous gneiss, quartzite, marble, amphibolite, and other rocks. Syntectonic intrusive gneiss included many of the older rocks during a late Paleozoic(?) orogeny, which was accompanied by Abukuma-type metamorphosing from lowermost greenschist to upper amphibolite facies. A Jurassic diorite pluton bounded by faults cuts volcanic rocks of unknown age east of the Otu fault. Cretaceous rocks are major units. Middle Cretaceous carbonaceous shale, sandstone, graywacke, conglomerate, and volcanic rocks are locally prominent. The Antioquian batholith (quartz diorite) of Late Cretaceous age cuts the middle Cretaceous and older rocks. A belt of Tertiary nonmarine clastic sedimentary rocks crops out along the Magdalena Valley. Patches of Tertiary alluvium are locally preserved in the mountains. Quaternary alluvium, much of it auriferous, is widespread in modern stream valleys. Structurally IIB constitutes part of a vast complex synclinorium intruded concordantly by syntectonic catazonal or mesozonal felsic plutons, and by the later epizonal post-tectonic Antioquian batholith. Previously unrecognized major wrench faults are outstanding

Key role of integrin α(IIb)β (3) signaling to Syk kinase in tissue factor-induced thrombin generation.

Science.gov (United States)

van der Meijden, Paola E J; Feijge, Marion A H; Swieringa, Frauke; Gilio, Karen; Nergiz-Unal, Reyhan; Hamulyák, Karly; Heemskerk, Johan W M

2012-10-01

The fibrin(ogen) receptor, integrin α(IIb)β(3), has a well-established role in platelet spreading, aggregation and clot retraction. How α(IIb)β(3) contributes to platelet-dependent coagulation is less well resolved. Here, we demonstrate that the potent suppressing effect of clinically used α(IIb)β(3) blockers on tissue factor-induced thrombin generation is linked to diminished platelet Ca(2+) responses and phosphatidylserine (PS) exposure. The same blockers suppress these responses in platelets stimulated with collagen and thrombin receptor agonists, whereas added fibrinogen potentiates these responses. In platelets spreading on fibrinogen, outside-in α(IIb)β(3) signaling similarly enhances thrombin-induced Ca(2+) rises and PS exposure. These responses are reduced in α(IIb)β(3)-deficient platelets from patients with Glanzmann's thrombasthenia. Furthermore, the contribution of α(IIb)β(3) to tissue factor-induced platelet Ca(2+) rises, PS exposure and thrombin generation in plasma are fully dependent on Syk kinase activity. Tyrosine phosphorylation analysis confirms a key role of Syk activation, which is largely but not exclusively dependent on α(IIb)β(3) activation. It is concluded that the majority of tissue factor-induced procoagulant activity of platelets relies on Syk activation and ensuing Ca(2+) signal generation, and furthermore that a considerable part of Syk activation relies on α(IIb)β(3) signaling. These results hence point to a novel role of Syk in integrin-dependent thrombin generation.

Effects of 1alpha-hydroxycholecalciferol on growth performance, parameters of tibia and plasma, meat quality, and type IIb sodium phosphate cotransporter gene expression of one- to twenty-one-day-old broilers.

Science.gov (United States)

Han, J C; Yang, X D; Zhang, T; Li, H; Li, W L; Zhang, Z Y; Yao, J H

2009-02-01

This experiment was conducted to investigate the effects of 1alpha-hydroxycholecalciferol (1alpha-OH D3) on the growth performance, tibia and plasma parameters, nutrient utilization, meat quality of the breast and thigh, and type IIb sodium phosphate cotranspoter gene expression of broilers. A total of 96 males of 1-d-old Arbor Acres broilers were randomly assigned to 8 cages of 12 birds each. Two dietary treatments were applied to 4 cages each. Diet 1 was prepared as the basal diet (nonphytate phosphorus, 0.21%), whereas diet 2 was the basal diet supplemented with 5 microg/kg of 1alpha-OH D3. Results showed that supplementation of the basal diet with 1alpha-OH D3 increased growth performance, tibia ash and strength, plasma inorganic phosphate concentration, utilization of total phosphorus and nonphytate phosphorus, lightness and yellowness of the breast and thigh meat, and intestinal type IIb sodium phosphate cotranspoter mRNA expression, whereas it decreased the shear force and water-holding capacity of the thigh meat. These data suggest that the addition of 1alpha-OH D3 might improve growth performance, tibia development, and meat quality in 1- to 21-d-old broilers by increasing the absorption and retention of phosphorus.

Goat activin receptor type IIB knockdown by muscle specific promoter driven artificial microRNAs.

Science.gov (United States)

Patel, Amrutlal K; Shah, Ravi K; Patel, Utsav A; Tripathi, Ajai K; Joshi, Chaitanya G

2014-10-10

Activin receptor type IIB (ACVR2B) is a transmembrane receptor which mediates signaling of TGF beta superfamily ligands known to function in regulation of muscle mass, embryonic development and reproduction. ACVR2B antagonism has shown to enhance the muscle growth in several disease and transgenic models. Here, we show ACVR2B knockdown by RNA interference using muscle creatine kinase (MCK) promoter driven artificial microRNAs (amiRNAs). Among the various promoter elements tested, the ∼1.26 kb MCK promoter region showed maximum transcriptional activity in goat myoblasts cells. We observed up to 20% silencing in non-myogenic 293T cells and up to 32% silencing in myogenic goat myoblasts by MCK directed amiRNAs by transient transfection. Goat myoblasts stably integrated with MCK directed amiRNAs showed merely 8% silencing in proliferating myoblasts which was increased to 34% upon induction of differentiation at transcript level whereas up to 57% silencing at protein level. Knockdown of ACVR2B by 5'-UTR derived amiRNAs resulted in decreased SMAD2/3 signaling, increased expression of myogenic regulatory factors (MRFs) and enhanced proliferation and differentiation of myoblasts. Unexpectedly, knockdown of ACVR2B by 3'-UTR derived amiRNAs resulted in increased SMAD2/3 signaling, reduced expression of MRFs and suppression of myogenesis. Our study offers muscle specific knockdown of ACVR2B as a potential strategy to enhance muscle mass in the farm animal species. Copyright © 2014 Elsevier B.V. All rights reserved.

Duality symmetries and the Type II string effective action

International Nuclear Information System (INIS)

Bergshoeff, E.

1996-01-01

We discuss the duality symmetries of Type II string effective actions in nine, ten and eleven dimensions. As a by-product we give a covariant action underlying the ten-dimensional Type IIB supergravity theory. We apply duality symmetries to construct dyonic Type II string solutions in six dimensions and their reformulation as solutions of the ten-dimensional Type IIB theory in ten dimensions. (orig.)

Cervical level IIb metastases in squamous cell carcinoma of the oral cavity: a systematic review and meta-analysis

Directory of Open Access Journals (Sweden)

Kou Y

2017-09-01

Full Text Available Yurong Kou,1,* Tengfei Zhao,2,* Shaohui Huang,2 Jie Liu,3 Weiyi Duan,2 Yunjing Wang,2 Zechen Wang,2 Delong Li,2 Chunliu Ning,2 Changfu Sun2 1Department of Oral Biology, School of Stomatology, China Medical University, Shenyang, Liaoning, People’s Republic of China; 2Department of Oral and Maxillofacial Surgery, School of Stomatology, China Medical University, Shenyang, Liaoning, People’s Republic of China; 3Centre of Science Experiment, China Medical University, Shenyang, Liaoning, People’s Republic of China *These authors contributed equally to this work Purpose: The aim of this study was to clarify whether level IIb dissection should be performed or avoided in the treatment of oral squamous cell carcinoma by meta-analysis.Materials and methods: Articles that were published before June 2017 were searched electronically in four databases (Web of Science, PubMed, Ovid and China National Knowledge Infrastructure without any date or language restrictions by two independent reviewers. Abstracts and full-text papers which investigated the cervical metastases to level IIb from primary head and neck cancers and were deemed potentially relevant were screened. Data were analyzed using RevMan 5.3.Results: Four hundred and fifty-five abstracts and 129 full-text papers were screened, and 22 studies were included in the analysis. Among the 2001 patients included, 112 patients had level IIb metastases, the pooled frequency of which was 6% (95% confidence interval [CI]: 4.0–7.0. Among the 400 patients with tongue squamous cell carcinoma from 12 studies, 37 patients had level IIb metastases, the pooled incidence of which was 7% (95% CI: 5.0–10.0. Metastases to level IIb always went together with level IIa, and only three patients were found to have isolated level IIb metastases without involving the other levels.Conclusion: Due to the low frequency of level IIb nodal metastases in oral squamous cell carcinoma patients and rare occurrence of isolated

S and U-duality constraints on IIB S-matrices

International Nuclear Information System (INIS)

Chalmers, Gordon

2000-01-01

S- and U-duality dictate that graviton scattering amplitudes in IIB superstring theory be automorphic functions on the appropriate fundamental domain which describe the inequivalent vacua of (compactified) theories. A constrained functional form of graviton scattering is proposed using Eisenstein series and their generalizations compatible with: (a) two-loop supergravity, (b) genus one superstring theory, (c) the perturbative coupling dependence of the superstring, and (d) with the unitarity structure of the massless modes. The form has a perturbative truncation in the genus expansion at a given order in the derivative expansion. Comparisons between graviton scattering S-matrices and effective actions for the first quantized superstring are made at the quantum level. Possible extended finiteness properties of maximally extended quantum supergravity theories in different dimensions is implied by the perturbative truncation of the functional form of graviton scattering in IIB superstring theory

Invasive cervical carcinoma (stage IB-IIB): assessment with MR imaging

International Nuclear Information System (INIS)

Sironi, S.; Del Maschio, A.; Belloni, C.; Taccagni, L.

1990-01-01

In patients with cervical carcinoma the selection of the optimal therapy depends on the precise preoperative assessment of the extent of disease. Currently, decisions regarding the management of these patients are made on the basis of clinical (FIGO) staging that has 50% mean error rate. To investigate the value of MR imaging in staging patients with invasive cervical cancer, we performed 25 MR examinations on 23 patients with histologic diagnosis of cervical cancer. All patients were clinically considered as having stage IB or IIB disease and underwent radical hysterectomy, providing specimens for pathologic correlation. The overall accuracy of MR imaging in staging cervical carcinoma (stage IB-IIB) was 78.1%. MR imaging seems to be the most reliable preoperative modality for staging invasive cervical cancer

Black-hole binaries as relics of gamma-ray burst/hypernova explosions

Science.gov (United States)

Moreno Mendez, Enrique

The Collapsar model, in which a fast-spinning massive star collapses into a Kerr black hole, has become the standard model to explain long-soft gamma-ray bursts and hypernova explosions (GRB/HN). However, stars massive enough (those with ZAMS mass ≳ (18--20) M⊙ ) to produce these events evolve through a path that loses too much angular momentum to produce a central engine capable of delivering the necessary energy. In this work I suggest that the soft X-ray transient sources are the remnants of GRBs/HNe. Binaries in which the massive primary star evolves a carbon-oxygen burning core, then start to transfer material to the secondary star (Case C mass transfer), causing the orbit to decay until a common-envelope phase sets in. The secondary spirals in, further narrowing the orbit of the binary and removing the hydrogen envelope of the primary star. Eventually the primary star becomes tidally locked and spins up, acquiring enough rotational energy to power up a GRB/HN explosion. The central engine producing the GRB/HN event is the Kerr black hole acting through the Blandford-Znajek mechanism. This model can explain not only the long-soft GRBs, but also the subluminous bursts (which comprise ˜ 97% of the total), the long-soft bursts and the short-hard bursts (in a neutron star, black hole merger). Because of our binary evolution through Case C mass transfer, it turns out that for the subluminous and cosmological bursts, the angular momentum O is proportional to m3/2D , where mD is the mass of the donor (secondary star). This binary evolution model has a great advantage over the Woosley Collapsar model; one can "dial" the donor mass in order to obtain whatever angular momentum is needed to drive the explosion. Population syntheses show that there are enough binaries to account for the progenitors of all known classes of GRBs.

Contribution of inhibitory receptor glycoprotein iib / iiia in coronary angioplasty and acute coronary syndrome, about 152 patients

International Nuclear Information System (INIS)

Sellami, Walid

2007-01-01

The aim of our study was to evaluate the immediate results and long-term intake of anti-GP IIb / IIIa inhibitors for patients with acute coronary syndrome treated with coronary angioplasty. The use of anti-GP IIb / IIIa is a valid therapeutic option in patients with acute coronary syndrome with signs of severity and for patients undergoing complex angioplasty. Adverse effects of anti-GP IIb / IIIa can be seen to encourage vigilance and careful monitoring during the administration of these molecules and perfect knowledge of their pharmacological properties for appropriate use.

Warped AdS{sub 6}×S{sup 2} in Type IIB supergravity II: global solutions and five-brane webs

Energy Technology Data Exchange (ETDEWEB)

D’Hoker, Eric; Gutperle, Michael; Uhlemann, Christoph F. [Mani L. Bhaumik Institute for Theoretical Physics,Department of Physics and Astronomy, University of California Los Angeles,475 Portola Plaza, Los Angeles, CA 90095 (United States)

2017-05-23

Motivated by the construction of holographic duals to five-dimensional superconformal quantum field theories, we obtain global solutions to Type IIB supergravity invariant under the superalgebra F(4) on a space-time of the form AdS{sub 6}×S{sup 2} warped over a two-dimensional Riemann surface Σ. In earlier work, the general local solutions were expressed in terms of two locally holomorphic functions A{sub ±} on Σ and global solutions were sketched when Σ is a disk. In the present paper, the physical regularity conditions on the supergravity fields required for global solutions are implemented on A{sub ±} for arbitrary Σ. Global solutions exist only when Σ has a non-empty boundary ∂Σ. The differentials ∂A{sub ±} are allowed to have poles only on ∂Σ and each pole corresponds to a semi-infinite (p,q) five-brane. The construction for the disk is carried out in detail and the conditions for the existence of global solutions are articulated for surfaces with more than one boundary and higher genus.

Type IIB Ileosigmoid knotting: a case report

African Journals Online (AJOL)

2016-06-03

Jun 3, 2016 ... peritonitis [4,6,7]; hence early diagnosis and operative ... clinical and radiological presentation of type II ileosigmoid volvulus ... Emergency laparotomy with possible resection and primary anastomosis in type I or resection and ...

Patient satisfaction after hospital therapie of peripheral artery disease in fontaine stage IIb either with konservativ or endovascular or operativ therapy

OpenAIRE

Gollnick, Ingo

2012-01-01

Evidence-based and guideline-conforming treatment of claudication in Fontaine stage IIb due to peripheral artery disease is basically conservative. However, many patients in Fontaine stage IIb disease are treated also treated surgically, e.g. with bypass operations or endarterectomy, or with endovascular methods (angioplasty and variations thereof ). The present study compares patient satisfaction with these three therapy modalities. Methods: 666 patients with Fontaine IIb cla...

Integrin α(IIb)β₃ exists in an activated state in subjects with elevated plasma homocysteine levels.

LENUS (Irish Health Repository)

McGarrigle, Sarah A

2011-01-01

Elevated levels of plasma homocysteine (Hcy) are an independent risk factor for cardiovascular disease and thrombosis. The molecular basis for this phenomenon is not known but may relate to modification of cell surface thiols. The platelet specific integrin α(IIb)β₃ is a cysteine-rich cell adhesion molecule that plays a critical role in platelet aggregation and adhesion in haemostasis and thrombosis. In this study, we looked for evidence of a homocysteine-induced modification of α(IIb)β₃ using a fluorescently labeled PAC-1 antibody that recognizes the activated conformation of the integrin on the platelet surface. We show that exogenous Hcy (10-100 µM) and homocysteine thiolactone (HcyTL) (10-100 µM) increased PAC-1 binding to platelets in a concentration dependent manner in vitro. In parallel, we show subjects with clinical hyperhomocysteinemia exhibit a greater degree of activation of α(IIb)β₃ compared to age-matched controls. These findings demonstrate that circulating Hcy can modulate the activation state of the platelet integrin α(IIb)β₃, a key player in platelet aggregation and thrombosis.

Type IIB supergravity solution for the T-dual of the η-deformed AdS_5×S"5 superstring

International Nuclear Information System (INIS)

Hoare, B.; Tseytlin, A.A.

2015-01-01

We find an exact type IIB supergravity solution that represents a one-parameter deformation of the T-dual of the AdS_5×S"5 background (with T-duality applied in all 6 abelian bosonic isometric directions). The non-trivial fields are the metric, dilaton and RR 5-form only. The latter has remarkably simple “undeformed” form when written in terms of a “deformation-rotated” vielbein basis. An unusual feature of this solution is that the dilaton contains a linear dependence on the isometric coordinates of the metric precluding a straightforward reversal of T-duality. If we still formally dualize back, we find exactly the metric, B-field and product of dilaton with RR field strengths as recently extracted from the η-deformed AdS_5×S"5 superstring action in http://arxiv.org/abs/1507.04239. We also discuss similar solutions for deformed AdS_n×S"n backgrounds with n=2,3. In the η→i limit we demonstrate that all these backgrounds can be interpreted as special limits of gauged WZW models and are also related to (a limit of) the Pohlmeyer-reduced models of the AdS_n×S"n superstrings.

IIB solutions with N>28 Killing spinors are maximally supersymmetric

International Nuclear Information System (INIS)

Gran, U.; Gutowski, J.; Papadopoulos, G.; Roest, D.

2007-01-01

We show that all IIB supergravity backgrounds which admit more than 28 Killing spinors are maximally supersymmetric. In particular, we find that for all N>28 backgrounds the supercovariant curvature vanishes, and that the quotients of maximally supersymmetric backgrounds either preserve all 32 or N<29 supersymmetries

Hydroxyurea with Radiation Therapy of the Carcinoma of the Cervix IIA, IIB

Energy Technology Data Exchange (ETDEWEB)

Kim, Jin Hee; Youn, Seon Min; Kim, Ok Bae [Keimyung University College of Medicine, Taegu (Korea, Republic of)

1995-12-15

Purpose : To evaluate the efficacy of hydroxyurea with radiation in carcinoma of the cervix, huge exophytic or endophytic stage IIa and Iib. Materials and Methods : Sixty four patients with carcinoma of the cervix stage IIA(29 patients) with exophytic({>=}3cm in diameter) or huge endophytic mass and IIB(35 patients) treated with radiation and hydroxyurea at the Department of Radiation Oncology, Dongsan Hospital, Keimyung University, School of Medicine from Aug, 1989 to May, 1991. The maximum and mean follow up durations were 68 and 57 months respectively. The radiation therapy consisted of external irradiation to the whole pelvis(3600-5400cGy) shield (4X10 cm), and combined with intracavitary irradiation (3000-3500cGy to point A). Hydroxyurea was to be taken in a single oral dose of 1.0gm/day during radiation therapy. Results : The control rate was 89.1%. The actuarial overall five year survival rate was 78.8% for stage IIA and 72.8% for stage IIB. The overall recurrence rate was 25%(16/64). Twenty-three percent of the patients developed or greater thrombocytopenia. Grade 3 or greater GI, GU complication and anemia were not noted. There was no treatment related death noted. Conclusion : We considered that hydroxyurea and radiation therapy may improve survival rate in huge exophytic and endophytic stage IIa cervical carcinoma with acceptible morbidity.

Hydroxyurea with Radiation Therapy of the Carcinoma of the Cervix IIA, IIB

International Nuclear Information System (INIS)

Kim, Jin Hee; Youn, Seon Min; Kim, Ok Bae

1995-01-01

Purpose : To evaluate the efficacy of hydroxyurea with radiation in carcinoma of the cervix, huge exophytic or endophytic stage IIa and Iib. Materials and Methods : Sixty four patients with carcinoma of the cervix stage IIA(29 patients) with exophytic(≥3cm in diameter) or huge endophytic mass and IIB(35 patients) treated with radiation and hydroxyurea at the Department of Radiation Oncology, Dongsan Hospital, Keimyung University, School of Medicine from Aug, 1989 to May, 1991. The maximum and mean follow up durations were 68 and 57 months respectively. The radiation therapy consisted of external irradiation to the whole pelvis(3600-5400cGy) shield (4X10 cm), and combined with intracavitary irradiation (3000-3500cGy to point A). Hydroxyurea was to be taken in a single oral dose of 1.0gm/day during radiation therapy. Results : The control rate was 89.1%. The actuarial overall five year survival rate was 78.8% for stage IIA and 72.8% for stage IIB. The overall recurrence rate was 25%(16/64). Twenty-three percent of the patients developed or greater thrombocytopenia. Grade 3 or greater GI, GU complication and anemia were not noted. There was no treatment related death noted. Conclusion : We considered that hydroxyurea and radiation therapy may improve survival rate in huge exophytic and endophytic stage IIa cervical carcinoma with acceptible morbidity

Type IIB thyroplasty for phonic tics in a pediatric patient with autism spectrum disorder: a case report.

Science.gov (United States)

Ahmed, Mostafa M; Heckman, W Wesley; Dailey, Seth H

2013-03-01

Autism spectrum disorders (ASDs) are commonly associated with Tourette syndrome (TS). TS is classically associated with tic production. A tic is defined as sudden, brief, involuntary production of movement (motor tics) or sound (phonic tics). Case report. We present a case report of a 14-year-old boy with ASD and vocal tics. Vocal tic frequency was nearly 2000 per day and 90 dB in volume. He presented to our laryngology clinic after multiple failed attempts of pharmacologic management of vocal fold botulinum toxin injection. After evaluation in our clinic, we recommended a lateralization (type IIB) thyroplasty. An autologous cartilage graft from the superior thyroid ala was used and held in place with a bioresorbable mesh. Using 4-0 prolene sutures, the mesh was secured in place. The operation was well tolerated with minimal signs of aspiration, and he was discharged to his home within 48 hours. Six months postoperatively, there was 90% reduction in tic frequency and 50% reduction in intensity. Additionally, he has shown improved ability to converse with his peers, participate in school activities, and even has improved nutritional status. Alteration of laryngeal geometry could serve as an effective site of intervention for intractable phonic tics. Reduction of phonic tic frequency and intensity may also stimulate language development in patients ASD. We also demonstrate additional use of bioresorbable plates in pediatric laryngeal framework surgery. Additional neurophysiologic studies are needed to explore the mechanism by which midline lateralization thyroplasty influences phonic tic generation. Copyright © 2013 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

The effects of age on treatment and outcomes in women with stages IB1-IIB cervical cancer.

Science.gov (United States)

Roque, Dario R; Cronin, Beth; Robison, Katina; Lopes, Vrishali; Rizack, Tina; Dizon, Don S

2013-10-01

Age may affect the treatment choice and subsequent outcome in elderly patients with cervical cancer. Given the potential for cure with either surgery or chemoradiation in early stage disease, we aimed to determine whether a patient's age influenced treatment received and the ensuing outcome. We identified 303 patients with stages IB1-IIB cervical carcinoma treated at our institution between 2000 and 2010, who were divided into two groups based on age at time of diagnosis: stage at presentation, and grade. Women ≥ 65 years of age were less likely to receive primary surgical management (p=0.03). Age did not influence disease-specific or all-cause mortality. However, women over 65 years who underwent primary surgery were at significantly increased risk of all-cause mortality compared to younger women (HR 6.53, 95% CI: 2.57-16.6). Age appears to influence treatment received by patients with stages IB1-IIB cervical cancer. Although there was no difference in cancer-specific mortality stratified by type of treatment received, surgery was associated with a 6.5-fold increased risk of all-cause mortality among women 65 years or over. © 2013.

Di-J/ψ Studies, Level 3 Tracking and the D0 Run IIb Upgrade

International Nuclear Information System (INIS)

Vint, Philip John

2009-01-01

The D0 detector underwent an upgrade to its silicon vertex detector and triggering systems during the transition from Run IIa to Run IIb to maximize its ability to fully exploit Run II at the Fermilab Tevatron. This thesis describes improvements made to the tracking and vertexing algorithms used by the high level trigger in both Run IIa and Run IIb, as well as a search for resonant di-J/ψ states using both Run IIa and Run IIb data. Improvements made to the tracking and vertexing algorithms during Run IIa included the optimization of the existing tracking software to reduce overall processing time and the certification and testing of a new software release. Upgrades made to the high level trigger for Run IIb included the development of a new tracking algorithm and the inclusion of the new Layer 0 silicon detector into the existing software. The integration of Layer 0 into the high level trigger has led to an improvement in the overall impact parameter resolution for tracks of ∼50%. The development of a new parameterization method for finding the error associated to the impact parameter of tracks returned by the high level tracking algorithm, in association with the inclusion of Layer 0, has led to improvements in vertex resolution of ∼4.5 (micro)m. A previous search in the di-J/ψ channel revealed a unpredicted resonance at ∼13.7 GeV/c 2 . A confirmation analysis is presented using 2.8 fb -1 of data and two different approaches to cuts. No significant excess is seen in the di-J/ψ mass spectrum.

Di-J/Ψ Studies, Level 3 Tracking and the D0 Run IIb Upgrade

Energy Technology Data Exchange (ETDEWEB)

Vint, Philip John [Imperial College, London (United Kingdom)

2010-02-01

The D0 detector underwent an upgrade to its silicon vertex detector and triggering systems during the transition from Run IIa to Run IIb to maximize its ability to fully exploit Run II at the Fermilab Tevatron. This thesis describes improvements made to the tracking and vertexing algorithms used by the high level trigger in both Run IIa and Run IIb, as well as a search for resonant di-J/Ψ states using both Run IIa and Run IIb data. Improvements made to the tracking and vertexing algorithms during Run IIa included the optimization of the existing tracking software to reduce overall processing time and the certification and testing of a new software release. Upgrades made to the high level trigger for Run IIb included the development of a new tracking algorithm and the inclusion of the new Layer 0 silicon detector into the existing software. The integration of Layer 0 into the high level trigger has led to an improvement in the overall impact parameter resolution for tracks of ~50%. The development of a new parameterization method for finding the error associated to the impact parameter of tracks returned by the high level tracking algorithm, in association with the inclusion of Layer 0, has led to improvements in vertex resolution of ~4.5 μm. A previous search in the di-J/Ψ channel revealed a unpredicted resonance at ~13.7 GeV/c². A confirmation analysis is presented using 2.8 fb^-1 of data and two different approaches to cuts. No significant excess is seen in the di-J/Ψ mass spectrum.

Platelet half-life in patients with primary hyperlipoproteinemia type IIa, IIb, and IV according to Fredrickson with and without clinical signs of atherosclerosis

Energy Technology Data Exchange (ETDEWEB)

Jaeger, E; Sinzinger, H; Widhalm, K; Kaliman, J; Hoefer, R [Vienna Univ. (Austria). 2. Medizinische Klinik; Ludwig Boltzmann-Institut fuer Nuklearmedizin, Vienna (Austria); Vienna Univ. (Austria). Kinderklinik; Vienna Univ. (Austria). Kardiologische Klinik)

1982-09-01

It is generally accepted that platelet half-life is shortened in atherosclerotic vascular diseases. Concerning changes due to hyperlipoproteinemia (HLP), however, there exist only few data. Therefore, we examined the platelet-half life in 60 patients with recently discovered HLP type IIa, IIb and IV according to Fredrickson before treatment in comparison to 60 controls. 33 of the HLP-patients had no clinical symptoms of angiopathy. 27 patients suffered from peripheral vascular disease or from coronary heart disease as verified by angiography. The labelling of autologous platelets was performed with 100..mu..Ci of /sup 111/Indium-oxine-sulfate at 37/sup 0/C for 5 minutes. The mean labelling efficiency was 90%, the recovery after 2 hours about 70%. Serum lipoproteins were estimated by means of ultracentrifugation and polyanionprecipitation according to Lipid Research Clinic Methods. In the patients with HLP platelet half-life was significantly shortened in comparison to the control group (p < 0.01). These changes were most pronounced in patients with HLP-type IIa and with atherosclerotic lesions, respectively. In patients with HLP-type IIa a very close correlation could be demonstrated between platelet half-life and LDL-cholesterol (r = -0.72; p < 0.001) as well as total cholesterol (r = -0.73; p < 0.001). These data prove that in HLP in-vivo platelet function as measured by platelet survival is significantly influenced even before the occurrence of clinically relevant symptoms of atherosclerosis.

Platelet glycoprotein IIb/IIIa polymorphism HPA-3 b/b is associated with increased risk of ischemic stroke in patients under 60 years of age.

Science.gov (United States)

Duan, Hao; Cai, Yan; Sun, Xiaojiang

2012-01-01

The role of genetic risk factors in ischemic stroke is unclear. Platelet glycoprotein IIb/IIIa (GpIIb-IIIa) has been implicated in the pathogenesis of ischemic stroke. We sought to evaluate the relationship between the GpIIb/IIIa complex gene polymorphism and ischemic stroke. We investigated the association of the GpIIb/IIIa complex gene polymorphism with stroke risk in 306 patients with acute ischemic stroke and 266 control subjects by determining the GpIIb and GpIIIa genotype from leukocyte DNA by polymerase chain reaction (PCR) followed by FokI and ScrFI digestion, respectively. Compared with controls, more patients presented with coronary heart disease, hypertension, smoking history, and diabetes. In addition, the patients had higher levels of cholesterol and glucose compared with the control subjects. All donors in the GpIIIa (n=572) group expressed the GpIIIa PlA1 (HPA-1 aa) phenotype. There were no significant differences between the HPA-3 genotype (GpIIb) patient distribution (aa=39.9%, ab=41.4%, bb=28.7%) and healthy control subjects (aa=36.1%, ab=35.0%, bb=28.9%) (P=0.580). Among study participants ischemic stroke >2-fold (P=0.008). The GpIIb Ile/Ser843 gene polymorphism is associated with ischemic stroke among young and middle-aged adults (ischemic stroke.

Regulation of an antisense RNA with the transition of neonatal to IIb myosin heavy chain during postnatal development and hypothyroidism in rat skeletal muscle.

Science.gov (United States)

Pandorf, Clay E; Jiang, Weihua; Qin, Anqi X; Bodell, Paul W; Baldwin, Kenneth M; Haddad, Fadia

2012-04-01

Postnatal development of fast skeletal muscle is characterized by a transition in expression of myosin heavy chain (MHC) isoforms, from primarily neonatal MHC at birth to primarily IIb MHC in adults, in a tightly coordinated manner. These isoforms are encoded by distinct genes, which are separated by ∼17 kb on rat chromosome 10. The neonatal-to-IIb MHC transition is inhibited by a hypothyroid state. We examined RNA products [mRNA, pre-mRNA, and natural antisense transcript (NAT)] of developmental and adult-expressed MHC genes (embryonic, neonatal, I, IIa, IIx, and IIb) at 2, 10, 20, and 40 days after birth in normal and thyroid-deficient rat neonates treated with propylthiouracil. We found that a long noncoding antisense-oriented RNA transcript, termed bII NAT, is transcribed from a site within the IIb-Neo intergenic region and across most of the IIb MHC gene. NATs have previously been shown to mediate transcriptional repression of sense-oriented counterparts. The bII NAT is transcriptionally regulated during postnatal development and in response to hypothyroidism. Evidence for a regulatory mechanism is suggested by an inverse relationship between IIb MHC and bII NAT in normal and hypothyroid-treated muscle. Neonatal MHC transcription is coordinately expressed with bII NAT. A comparative phylogenetic analysis also suggests that bII NAT-mediated regulation has been a conserved trait of placental mammals for most of the eutherian evolutionary history. The evidence in support of the regulatory model implicates long noncoding antisense RNA as a mechanism to coordinate the transition between neonatal and IIb MHC during postnatal development.

Flow and transport at the Las Cruces trench site: Experiment IIb

Energy Technology Data Exchange (ETDEWEB)

Vinson, J.; Hills, R.G. [New Mexico State Univ., Las Cruces, NM (United States); Wierenga, P.J.; Young, M.H. [Arizona Univ., Tucson, AZ (United States). Dept. of Soil and Water Science

1997-07-01

The US Nuclear Regulatory Commission (NRC) has been directed by Congress in the Low Level Waste Policy Act of 1980 to develop regulatory guidance and assist the individual states and compacts in siting and assessing future low level radioactive waste (LLW) disposal facilities. Three water flow and solute transport experiments were performed as part of a comprehensive field trench study near Las Cruces, New Mexico to test deterministic and stochastic models of vadose zone flow and transport. This report presents partial results from the third experiment (experiment IIb). Experiments IIa and b were conducted on the North side of the trench, on a plot 1.22 m wide by 12 m long, perpendicular to the trench. The area was drip irrigated during two time periods with water containing a variety of tracers. The advance of the water front during the two irrigation episodes was measured with tensiometers and neutron probes. Solute front positions were determined from soil solution sampling through suction samplers and from disturbed sampling. The results from experiment IIb show predominantly downward water movement through the layered unsaturated soil, as evidenced from neutron probe data and gravimetric sampling. Tritium plumes were only half as deep and half as wide as the water plumes at 310 days after the beginning of experiment IIb. Chromium, applied as Cr(VI), moved a readily as, and similar to tritium, but there was a loss of mass due to reduction of Cr(VI) to Cr(III). Chloride and nitrate, initially present at high concentrations in the soil solution, were displaced by the low concentration irrigation water, resulting in chloride and nitrate concentration distributions that looked like negative images of the tritium distributions. The extensive data presented should serve well as a data base for model testing.

Flow and transport at the Las Cruces trench site: Experiment IIb

International Nuclear Information System (INIS)

Vinson, J.; Hills, R.G.; Wierenga, P.J.; Young, M.H.

1997-07-01

The US Nuclear Regulatory Commission (NRC) has been directed by Congress in the Low Level Waste Policy Act of 1980 to develop regulatory guidance and assist the individual states and compacts in siting and assessing future low level radioactive waste (LLW) disposal facilities. Three water flow and solute transport experiments were performed as part of a comprehensive field trench study near Las Cruces, New Mexico to test deterministic and stochastic models of vadose zone flow and transport. This report presents partial results from the third experiment (experiment IIb). Experiments IIa and b were conducted on the North side of the trench, on a plot 1.22 m wide by 12 m long, perpendicular to the trench. The area was drip irrigated during two time periods with water containing a variety of tracers. The advance of the water front during the two irrigation episodes was measured with tensiometers and neutron probes. Solute front positions were determined from soil solution sampling through suction samplers and from disturbed sampling. The results from experiment IIb show predominantly downward water movement through the layered unsaturated soil, as evidenced from neutron probe data and gravimetric sampling. Tritium plumes were only half as deep and half as wide as the water plumes at 310 days after the beginning of experiment IIb. Chromium, applied as Cr(VI), moved a readily as, and similar to tritium, but there was a loss of mass due to reduction of Cr(VI) to Cr(III). Chloride and nitrate, initially present at high concentrations in the soil solution, were displaced by the low concentration irrigation water, resulting in chloride and nitrate concentration distributions that looked like negative images of the tritium distributions. The extensive data presented should serve well as a data base for model testing

Radiation therapy alone in the treatment of cervix cancer stages IIB and IIB. Results from Hospital Mario Gatti, Pontificia Universidade Catolica de Campinas

International Nuclear Information System (INIS)

Ferrigno, Robson; Oliveira Faria, Sergio Luis Campos de

1995-01-01

From September 1989 to December 1992, 178 patients with cervix cancer were treated with radiation therapy alone, being 81 stage IIIB patients were randomized according to the number of intracavitary brachytherapy insertion realized after external irradiation. Of these, 34 were treated with two intracavitary insertion (group A) and 47 with one insertion (group B). Among stage IIIB patients, 54 were treated with one intracavitary insertion after external irradiation (group C) and 47 with external irradiation alone as they had no geometrical condition for intracavitary insertion (group D). There were no statistical difference in 50 months disease free survival among patients stage IIB treated with one or two intracavitary insertion, 72,3% and 70.6% respectively (P=0,711). The 50 months disease free survival were better in patients stage IIIB treated with external irradiation followed by one intracavitary insertion, compared with those treated with external irradiation alone, 51,8% and 30,2% respectively (P=0,007). This series suggests that there is no difference in the treatment of stage IIB cervix cancer with one or two intracavitary insertion. Among stage IIIB patients, the worse result of those treated with external irradiation alone was probably due to the unfavorable prognostic factors, as they were excluded for brachytherapy because they showed no geometrical condition for intracavitary insertion and larger tumor volume. (author)

Two CRM protein subfamilies cooperate in the splicing of group IIB introns in chloroplasts.

Science.gov (United States)

Asakura, Yukari; Bayraktar, Omer Ali; Barkan, Alice

2008-11-01

Chloroplast genomes in angiosperms encode approximately 20 group II introns, approximately half of which are classified as subgroup IIB. The splicing of all but one of the subgroup IIB introns requires a heterodimer containing the peptidyl-tRNA hydrolase homolog CRS2 and one of two closely related proteins, CAF1 or CAF2, that harbor a recently recognized RNA binding domain called the CRM domain. Two CRS2/CAF-dependent introns require, in addition, a CRM domain protein called CFM2 that is only distantly related to CAF1 and CAF2. Here, we show that CFM3, a close relative of CFM2, associates in vivo with those CRS2/CAF-dependent introns that are not CFM2 ligands. Mutant phenotypes in rice and Arabidopsis support a role for CFM3 in the splicing of most of the introns with which it associates. These results show that either CAF1 or CAF2 and either CFM2 or CFM3 simultaneously bind most chloroplast subgroup IIB introns in vivo, and that the CAF and CFM subunits play nonredundant roles in splicing. These results suggest that the expansion of the CRM protein family in plants resulted in two subfamilies that play different roles in group II intron splicing, with further diversification within a subfamily to accommodate multiple intron ligands.

Type IIB Ileosigmoid knotting: a case report

Directory of Open Access Journals (Sweden)

Ajak Makor

2018-02-01

Full Text Available Ileosigmoid knotting is a rare cause of acute intestinal obstruction. It is more common in Africans and Asians than in white populations and it is more prevalent in males than in females with a ratio of 14:1. It is classified into four types (I, II, III and IV with further extra two subtypes of A and B where type A is the most common presentation. Preoperative diagnosis is a challenge to the frontline doctors in the accidents and emergency departments; especially with limited diagnostic tools. Ultrasonography may be misleading in most of the cases due to the similarity of the disease with other causes of acute abdomen, especially acute appendicitis. Clinical presentation of an unprecedented intestinal obstruction with constant upper to mid-abdominal quadrant pain associated with mild to moderate abdominal distension contrary to the severe abdominal distension in sigmoid volvulus are the hallmarks that can help the surgical team to reach an accurate and early diagnosis preoperatively to avoid the devastating ischemia and gangrene in case of delay.

Variation in one residue associated with the metal ion-dependent adhesion site regulates αIIbβ3 integrin ligand binding affinity.

Directory of Open Access Journals (Sweden)

Joel Raborn

Full Text Available The Asp of the RGD motif of the ligand coordinates with the β I domain metal ion dependent adhesion site (MIDAS divalent cation, emphasizing the importance of the MIDAS in ligand binding. There appears to be two distinct groups of integrins that differ in their ligand binding affinity and adhesion ability. These differences may be due to a specific residue associated with the MIDAS, particularly the β3 residue Ala(252 and corresponding Ala in the β1 integrin compared to the analogous Asp residue in the β2 and β7 integrins. Interestingly, mutations in the adjacent to MIDAS (ADMIDAS of integrins α4β7 and αLβ2 increased the binding and adhesion abilities compared to the wild-type, while the same mutations in the α2β1, α5β1, αVβ3, and αIIbβ3 integrins demonstrated decreased ligand binding and adhesion. We introduced a mutation in the αIIbβ3 to convert this MIDAS associated Ala(252 to Asp. By combination of this mutant with mutations of one or two ADMIDAS residues, we studied the effects of this residue on ligand binding and adhesion. Then, we performed molecular dynamics simulations on the wild-type and mutant αIIbβ3 integrin β I domains, and investigated the dynamics of metal ion binding sites in different integrin-RGD complexes. We found that the tendency of calculated binding free energies was in excellent agreement with the experimental results, suggesting that the variation in this MIDAS associated residue accounts for the differences in ligand binding and adhesion among different integrins, and it accounts for the conflicting results of ADMIDAS mutations within different integrins. This study sheds more light on the role of the MIDAS associated residue pertaining to ligand binding and adhesion and suggests that this residue may play a pivotal role in integrin-mediated cell rolling and firm adhesion.

Orbifolds of M-theory and type II string theories in two dimensions

International Nuclear Information System (INIS)

Roy, S.

1997-01-01

We consider several orbifold compactifications of M-theory and theircorresponding type II duals in two space-time dimensions. In particular, we show that while the orbifold compactification of M-theory on T 9 /J 9 is dual to the orbifold compactification of type IIB string theory on T 8 /I 8 , the same orbifold T 8 /I 8 of type IIA string theory is dual to M-theory compactified on a smooth product manifold K3 x T 5 . Similarly, while the orbifold compactification of M-theory on (K3 x T 5 )/σ. J 5 is dual to the orbifold compactification of type IIB string theory on (K3 x T 4 )/σ.I 4 , the same orbifold of type IIA string theory is dual to the orbifold T 4 x (K3 x S 1 )/σ.J 1 of M-theory. The spectrum of various orbifold compactifications of M-theory and type II string theories on both sides are compared giving evidence in favor of these duality conjectures. We also comment on a connection between the Dasgupta-Mukhi-Witten conjecture and the Dabholkar-Park-Sen conjecture for the six-dimensional orbifold models of type IIB string theory and M-theory. (orig.)

Crystallization of Enzyme IIB of the Cellobiose-specific Phosphotransferase System of Escherichia coli

NARCIS (Netherlands)

van Montfort, Robert; Pijning, Tjaard; Kalk, Kornelis; Schuurman-Wolters, Gea K.; Reizer, Jonathan; Safer Jr., Milton H.; Robillard, George; Dijkstra, Bauke W.

1994-01-01

Crystals of enzyme IIB of the cellobiose-specific phosphotransferase system have been obtained from 15% polyethylene glycol 4000 using both streak-seeding and macroseeding techniques at 4°. Crystals were grown with the hanging drop method of vapour diffusion. Addition of 2-propanol and

Structure-guided design of a high-affinity platelet integrin αIIbβ3 receptor antagonist that disrupts Mg²⁺ binding to the MIDAS.

Science.gov (United States)

Zhu, Jieqing; Choi, Won-Seok; McCoy, Joshua G; Negri, Ana; Zhu, Jianghai; Naini, Sarasija; Li, Jihong; Shen, Min; Huang, Wenwei; Bougie, Daniel; Rasmussen, Mark; Aster, Richard; Thomas, Craig J; Filizola, Marta; Springer, Timothy A; Coller, Barry S

2012-03-14

An integrin found on platelets, α(IIb)β(3) mediates platelet aggregation, and α(IIb)β(3) antagonists are effective antithrombotic agents in the clinic. Ligands bind to integrins in part by coordinating a magnesium ion (Mg(2+)) located in the β subunit metal ion-dependent adhesion site (MIDAS). Drugs patterned on the integrin ligand sequence Arg-Gly-Asp have a basic moiety that binds the α(IIb) subunit and a carboxyl group that coordinates the MIDAS Mg(2+) in the β(3) subunits. They induce conformational changes in the β(3) subunit that may have negative consequences such as exposing previously hidden epitopes and inducing the active conformation of the receptor. We recently reported an inhibitor of α(IIb)β(3) (RUC-1) that binds exclusively to the α(IIb) subunit; here, we report the structure-based design and synthesis of RUC-2, a RUC-1 derivative with a ~100-fold higher affinity. RUC-2 does not induce major conformational changes in β(3) as judged by monoclonal antibody binding, light scattering, gel chromatography, electron microscopy, and a receptor priming assay. X-ray crystallography of the RUC-2-α(IIb)β(3) headpiece complex in 1 mM calcium ion (Ca(2+))/5 mM Mg(2+) at 2.6 Å revealed that RUC-2 binds to α(IIb) the way RUC-1 does, but in addition, it binds to the β(3) MIDAS residue glutamic acid 220, thus displacing Mg(2+) from the MIDAS. When the Mg(2+) concentration was increased to 20 mM, however, Mg(2+) was identified in the MIDAS and RUC-2 was absent. RUC-2's ability to inhibit ligand binding and platelet aggregation was diminished by increasing the Mg(2+) concentration. Thus, RUC-2 inhibits ligand binding by a mechanism different from that of all other α(IIb)β(3) antagonists and may offer advantages as a therapeutic agent.

An evaluation of canal curvature at the apical one third in type II mesial canals of mandibular molars

Directory of Open Access Journals (Sweden)

Hye-Rim Yun

2012-05-01

Full Text Available Objectives The purpose of this study was to evaluate the buccolingual curvature at the apical one third in type II mesial canals of mandibular molars using the radius and angle of curvature. Materials and Methods Total 100 mandibular molars were selected. Following an endodontic access in the teeth, their distal roots were removed. #15 H- or K-files (Dentsply Maillefer were inserted into the mesiobuccal and mesiolingual canals of the teeth. Radiographs of the teeth were taken for the proximal view. Among them, type II canals were selected and divided into two subgroups, IIa and IIb. In type IIa, two separate canals merged into one canal before reaching the apex and in type IIb, two separate canals merged into one canal within the apical foramen. The radius and angle of curvature of specimens were examined. Results In type II, mean radius of curvature in mesiolingual and mesiobuccal canals were 2.82 mm and 3.58 mm, respectively. The radius of the curvature of mesiolingual canals were significantly smaller than that of mesiobuccal canals in type II, and especially in type IIa. However, there were no statistically significant differences in radius of curvature between mesiobuccal and mesiolingual canals in type IIb and there were no significant differences in angle of curvature between type IIa and IIb. Conclusion In this study, type II mesial canals of mandibular molars showed severe curvature in the proximal view. Especially, mesiolingual canals of type IIa had more abrupt curvature than mesiobuccal canals at the apical one third.

Airborne gamma-ray spectrometer and magnetometer survey: Indian Wells, Texas. Final report. Detail area, Volume IIB

International Nuclear Information System (INIS)

Volume IIB contains appendices for: flight line maps; geology maps; explanation of geologic legend; flight line/geology maps; radiometric contour maps; magnetic contour maps; geochemical factor analysis maps

Comparison of cDNA-derived protein sequences of the human fibronectin and vitronectin receptor α-subunits and platelet glycoprotein IIb

International Nuclear Information System (INIS)

Fitzgerald, L.A.; Poncz, M.; Steiner, B.; Rall, S.C. Jr.; Bennett, J.S.; Phillips, D.R.

1987-01-01

The fibronectin receptor (FnR), the vitronectin receptor (VnR), and the platelet membrane glycoprotein (GP) IIb-IIIa complex are members of a family of cell adhesion receptors, which consist of noncovalently associated α- and β-subunits. The present study was designed to compare the cDNA-derived protein sequences of the α-subunits of human FnR, VnR, and platelet GP IIb. cDNA clones for the α-subunit of the FnR (FnR/sub α/) were obtained from a human umbilical vein endothelial (HUVE) cell library by using an oligonucleotide probe designed from a peptide sequence of platelet GP IIb. cDNA clones for platelet GP IIb were isolated from a cDNA expression library of human erythroleukemia cells by using antibodies. cDNA clones of the VnR α-subunit (VnR/sub α/) were obtained from the HUVE cell library by using an oligonucleotide probe from the partial cDNA sequence for the VnR/sub α/. Translation of these sequences showed that the FNR/sub α/, the VnR/sub α/, and GP IIb are composed of disulfide-linked large (858-871 amino acids) and small (137-158 amino acids) chains that are posttranslationally processed from a single mRNA. A single hydrophobic segment located near the carboxyl terminus of each small chain appears to be a transmembrane domain. The large chains appear to be entirely extracellular, and each contains four repeated putative Ca 2+ -binding domains of about 30 amino acids that have sequence similarities to other Ca 2+ -binding proteins. The identity among the protein sequences of the three receptor α-subunits ranges from 36.1% to 44.5%, with the Ca 2+ -binding domains having the greatest homology. These proteins apparently evolved by a process of gene duplication

Synergistic effect of signaling from receptors of soluble platelet agonists and outside-in signaling in formation of a stable fibrinogen-integrin αIIbβ3-actin cytoskeleton complex.

Science.gov (United States)

Budnik, Ivan; Shenkman, Boris; Savion, Naphtali

2015-01-01

Thrombus formation in the injured vessel wall is a highly complex process involving various blood-born components that go through specific temporal and spatial changes as observed by intravital videomicroscopy. Platelets bind transiently to the developing thrombus and may either become stably incorporated into or disengage from the thrombus. The aim of the present study was to reveal the processes involved in the formation of a stable thrombus. Platelet-rich plasma and washed platelets were studied by the aggregometer. The aggregate stability was challenged by eptifibatide. Platelet Triton-insoluble fraction was prepared and the actin and αIIb content in the cytoskeleton was analyzed by western blot. Maximal actin polymerization is achieved 1min after platelet activation while maximal αIIbβ3-actin cytoskeleton association requires 5 to 10min of activation and fibrinogen-mediated platelet-to-platelet bridging. Thus, actin polymerization is dependent on platelet activation and requires neither αIIbβ3 integrin occupation nor platelet aggregation. Formation of a stable aggregate requires platelet activation for more than 1min, complete increase in actin cytoskeleton fraction and partial association of αIIbβ3 with the actin cytoskeleton. However, direct αIIbβ3 activation is not sufficient for cytoskeleton complex formation. Thus, stable αIIbβ3-fibrinogen interaction, representing stable aggregate, is achieved after more than 1min agonist activation, involving inside-out and outside-in signaling but not after direct integrin activation, involving only outside-in signaling. Formation of a stable fibrinogen-αIIbβ3-actin cytoskeleton complex is the result of the combined effect of platelet stimulation by soluble agonists, activation of αIIbβ3, fibrinogen binding and platelet-to-platelet bridging. Copyright © 2014 Elsevier Ltd. All rights reserved.

GUTs in type IIB orientifold compactifications

International Nuclear Information System (INIS)

Blumenhagen, Ralph; Braun, Volker; Grimm, Thomas W.; Weigand, Timo

2009-01-01

We systematically analyse globally consistent SU(5) GUT models on intersecting D7-branes in genuine Calabi-Yau orientifolds with O3- and O7-planes. Beyond the well-known tadpole and K-theory cancellation conditions there exist a number of additional subtle but quite restrictive constraints. For the realisation of SU(5) GUTs with gauge symmetry breaking via U(1) Y flux we present two classes of suitable Calabi-Yau manifolds defined via del Pezzo transitions of the elliptically fibred hypersurface P 1,1,1,6,9 [18] and of the Quintic P 1,1,1,1,1 [5], respectively. To define an orientifold projection we classify all involutions on del Pezzo surfaces. We work out the model building prospects of these geometries and present five globally consistent string GUT models in detail, including a 3-generation SU(5) model with no exotics whatsoever. We also realise other phenomenological features such as the 10105 H Yukawa coupling and comment on the possibility of moduli stabilisation, where we find an entire new set of so-called swiss-cheese type Calabi-Yau manifolds. It is expected that both the general constrained structure and the concrete models lift to F-theory vacua on compact Calabi-Yau fourfolds.

GUTs on Compact Type IIB Orientifolds

Energy Technology Data Exchange (ETDEWEB)

Blumenhagen, Ralph; /Munich, Max Planck Inst.; Braun, Volker; /Dublin Inst.; Grimm, Thomas W.; /Bonn U.; Weigand, Timo; /SLAC

2008-12-01

We systematically analyze globally consistent SU(5) GUT models on intersecting D7-branes in genuine Calabi-Yau orientifolds with O3- and O7-planes. Beyond the well-known tadpole and K-theory cancellation conditions there exist a number of additional subtle but quite restrictive constraints. For the realization of SU(5) GUTs with gauge symmetry breaking via U(1)Y flux we present two classes of suitable Calabi-Yau manifolds defined via del Pezzo transitions of the elliptically fibred hypersurface P{sub 1,1,1,6,9}[18] and of the Quintic P{sub 1,1,1,1,1}[5], respectively. To define an orientifold projection we classify all involutions on del Pezzo surfaces. We work out the model building prospects of these geometries and present five globally consistent string GUT models in detail, including a 3-generation SU(5) model with no exotics whatsoever. We also realize other phenomenological features such as the 10 10 5{sub H} Yukawa coupling and comment on the possibility of moduli stabilization, where we find an entire new set of so-called swiss-cheese type Calabi-Yau manifolds. It is expected that both the general constrained structure and the concrete models lift to F-theory vacua on compact Calabi-Yau fourfolds.

Muscle hypertrophy and fast fiber type conversions in heavy resistance-trained women.

Science.gov (United States)

Staron, R S; Malicky, E S; Leonardi, M J; Falkel, J E; Hagerman, F C; Dudley, G A

1990-01-01

Twenty-four women completed a 20-week heavy-resistance weight training program for the lower extremity. Workouts were twice a week and consisted of warm-up exercises followed by three sets each of full squats, vertical leg presses, leg extensions, and leg curls. All exercises were performed to failure using 6-8 RM (repetition maximum). Weight training caused a significant increase in maximal isotonic strength (1 RM) for each exercise. After training, there was a decrease in body fat percentage (p less than 0.05), and an increase in lean body mass (p less than 0.05) with no overall change in thigh girth. Biopsies were obtained before and after training from the superficial portion of the vastus lateralis muscle. Sections were prepared for histological and histochemical examination. Six fiber types (I, IC, IIC, IIA, IIAB, and IIB) were distinguished following routine myofibrillar adenosine triphosphatase histochemistry. Areas were determined for fiber types I, IIA, and IIAB + IIB. The heavy-resistance training resulted in significant hypertrophy of all three groups: I (15%), IIA (45%), and IIAB + IIB (57%). These data are similar to those in men and suggest considerable hypertrophy of all major fiber types is also possible in women if exercise intensity and duration are sufficient. In addition, the training resulted in a significant decrease in the percentage of IIB with a concomitant increase in IIA fibers, suggesting that strength training may lead to fiber conversions.

Long branch-chains of amylopectin with B-type crystallinity in rice seed with inhibition of starch branching enzyme I and IIb resist in situ degradation and inhibit plant growth during seedling development : Degradation of rice starch with inhibition of SBEI/IIb during seedling development.

Science.gov (United States)

Pan, Ting; Lin, Lingshang; Wang, Juan; Liu, Qiaoquan; Wei, Cunxu

2018-01-08

Endosperm starch provides prime energy for cereal seedling growth. Cereal endosperm with repression of starch branching enzyme (SBE) has been widely studied for its high resistant starch content and health benefit. However, in barley and maize, the repression of SBE changes starch component and amylopectin structure which affects grain germination and seedling establishment. A high resistant starch rice line (TRS) has been developed through inhibiting SBEI/IIb, and its starch has very high resistance to in vitro hydrolysis and digestion. However, it is unclear whether the starch resists in situ degradation in seed and influences seedling growth after grain germination. In this study, TRS and its wild-type rice cultivar Te-qing (TQ) were used to investigate the seedling growth, starch property changes, and in situ starch degradation during seedling growth. The slow degradation of starch in TRS seed restrained the seedling growth. The starch components including amylose and amylopectin were simultaneously degraded in TQ seeds during seedling growth, but in TRS seeds, the amylose was degraded faster than amylopectin and the amylopectin long branch-chains with B-type crystallinity had high resistance to in situ degradation. TQ starch was gradually degraded from the proximal to distal region of embryo and from the outer to inner in endosperm. However, TRS endosperm contained polygonal, aggregate, elongated and hollow starch from inner to outer. The polygonal starch similar to TQ starch was completely degraded, and the other starches with long branch-chains of amylopectin and B-type crystallinity were degraded faster at the early stage of seedling growth but had high resistance to in situ degradation during TRS seedling growth. The B-type crystallinity and long branch-chains of amylopectin in TRS seed had high resistance to in situ degradation, which inhibited TRS seedling growth.

Differential impacts of clinical variables and 5-fluorouracil-based adjuvant chemotherapy on 5-year disease-free survival of patients with stage IIa and IIb colon cancer

Directory of Open Access Journals (Sweden)

Yi-Hung Kuo

2018-01-01

Conclusion: Different predictors of DFS were observed in stage IIa and IIb colon cancer; adjuvant chemotherapy could provide a survival benefit for patients with stage IIb colon cancer who have one of the four factors that were studied in our hospital-based analysis.

Inner-shell photoionization of group-IIB atoms

International Nuclear Information System (INIS)

Kutzner, M.; Tidwell, C.; Vance, S.E.; Radojevic, V.

1994-01-01

Total and partial photoionization cross sections, branching ratios, and angular-distribution asymmetry parameters for inner subshells (nl,l≥2) of the group-IIB elements zinc, cadmium, and mercury have been calculated in both the relativistic random-phase approximation and the relativistic random-phase approximation modified to include relaxation. Comparisons are made between the results of the two theoretical methods and with experiment where available. The present theoretical results for the 3d inner-shell photoionization of zinc are not in accord with experiment. We confirm previous work [S. L. Carter and H. P. Kelly, J. Phys. B 11, 2467 (1978)] which demonstrated that relaxation is an important effect in photoionization of the 4d subshell of atomic cadmium. It is also found that the inclusion of relaxation effects resolves a discrepancy between theory and experiment for the 4f inner-shell photoionization of atomic mercury

Group IIB-VIA semiconductor oxide cluster ions

Science.gov (United States)

Jayasekharan, Thankan

2018-05-01

Metal oxide cluster ions, MnOm± (M = Zn, Cd) and HgnOm- of various stoichiometry have been generated from solid IIB-VIA semiconductor oxides targets, (ZnO(s), CdO(s), and HgO(s)) by using pulse laser desorption ionization time of flight mass spectrometry with a laser of λ = 355 nm. Analysis of mass spectral data indicates the formation of stoichiometric cluster ions viz., (ZnO)n=1-30+ and (CdO)n=1-40+ along with -O bound anions, (ZnO)n=1-30O-, (CdO)n=1-40O- and (HgO)n=1-36O- from their respective solids. Further, metal oxoanions such as ZnOn=2,3-, CdOn=2,3,6-, and HgOn=2,3,6,7- have also been noted signifying the higher coordination ability of both Cd and Hg with O/O2/O3 species.

Structure-activity relationships of an antimicrobial peptide plantaricin s from two-peptide class IIb bacteriocins.

Science.gov (United States)

Soliman, Wael; Wang, Liru; Bhattacharjee, Subir; Kaur, Kamaljit

2011-04-14

Class IIb bacteriocins are ribosomally synthesized antimicrobial peptides comprising two different peptides synergistically acting in equal amounts for optimal potency. In this study, we demonstrate for the first time potent (nanomolar) antimicrobial activity of a representative class IIb bacteriocin, plantaricin S (Pls), against four pathogenic gram-positive bacteria, including Listeria monocytogenes. The structure-activity relationships for Pls were studied using activity assays, circular dichroism (CD), and molecular dynamics (MD) simulations. The two Pls peptides and five Pls derived fragments were synthesized. The CD spectra of the Pls and selected fragments revealed helical conformations in aqueous 2,2,2-trifluoroethanol. The MD simulations showed that when the two Pls peptides are in antiparallel orientation, the helical regions interact and align, mediated by strong attraction between conserved GxxxG/AxxxA motifs. The results strongly correlate with the antimicrobial activity suggesting that helix-helix alignment of the two Pls peptides and interaction between the conserved motifs are crucial for interaction with the target cell membrane.

On four-derivative terms in IIB Calabi-Yau orientifold reductions

Energy Technology Data Exchange (ETDEWEB)

Weissenbacher, Matthias [Kavli Institute for the Physics and Mathematics of the Universe, University of Tokyo,Kashiwa-no-ha 5-1-5, 277-8583 (Japan)

2017-04-11

We perform a Kaluza-Klein reduction of IIB supergravity including purely gravitational α{sup ′3}-corrections on a Calabi-Yau threefold, and perform the orientifold projection accounting for the presence of O3/O7-planes. We consider infinitesimal Kähler deformations of the Calabi-Yau background and derive the complete set of four-derivative couplings quadratic in these fluctuations coupled to gravity. In particular, we find four-derivative couplings of the Kähler moduli fields in the four-dimensional effective supergravity theory, which are referred to as friction couplings in the context of inflation.

New supersymmetric AdS4 type II vacua

International Nuclear Information System (INIS)

Tsimpis, D.

2010-01-01

We review the supersymmetric AdS 4 x w M 6 backgrounds of type IIA/IIB supergravity constructed in[1]. In type IIA the supersymmetry is N=2, and the six-dimensional internal space is locally an S 2 bundle over a four-dimensional Kaehler-Einstein base; in IIB the internal space is the direct product of a circle and a five-dimensional squashed Sasaki-Einstein manifold. These backgrounds do not contain any sources, all fluxes (including the Romans mass in IIA) are generally non-zero, and the dilaton and warp factor are non-constant. The IIA solutions include the massive deformations of the IIA reduction of the eleven-dimensional AdS 4 x Y p,q solutions, and had been predicted to exist on the basis of the AdS 4 /CFT 3 correspondence. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

The G2 spinorial geometry of supersymmetric IIB backgrounds

International Nuclear Information System (INIS)

Gran, U; Gutowski, J; Papadopoulos, G

2006-01-01

We solve the Killing spinor equations of supersymmetric IIB backgrounds which admit one supersymmetry and the Killing spinor has stability subgroup G 2 in Spin(9, 1) x U(1). We find that such backgrounds admit a timelike Killing vector field and the geometric structure of the spacetime reduces from Spin(9, 1) x U(1) to G 2 . We determine the type of G 2 structure that the spacetime admits by computing the covariant derivatives of the spacetime forms associated with the Killing spinor bilinears. We also solve the Killing spinor equations of backgrounds with two supersymmetries and Spin(7) x R 8 -invariant spinors, and four supersymmetries with SU(4) x R 8 - and with G 2 -invariant spinors. We show that the Killing spinor equations factorize in two sets, one involving the geometry and the 5-form flux, and the other the 3-form flux and the scalars. In the Spin(7) x R 8 and SU(4) x R 8 cases, the spacetime admits a parallel null vector field and so the spacetime metric can be locally described in terms of Penrose coordinates adapted to the associated rotation free, null, geodesic congruence. The transverse space of the congruence is a Spin(7) and a SU(4) holonomy manifold, respectively. In the G 2 case, all the fluxes vanish and the spacetime is the product of a three-dimensional Minkowski space with a holonomy G 2 manifold

Intraoperative validation of CT-based lymph nodal levels, sublevels IIa and IIb: Is it of clinical relevance in selective radiation therapy?

International Nuclear Information System (INIS)

Levendag, Peter; Gregoire, Vincent; Hamoir, Marc; Voet, Peter; Est, Henrie van der; Heijmen, Ben; Kerrebijn, Jeroen

2005-01-01

Purpose: The objectives of this study are to discuss the intraoperative validation of CT-based boundaries of lymph nodal levels in the neck, and in particular the clinical relevance of the delineation of sublevels IIa and IIb in case of selective radiation therapy (RT). Methods and Materials: To validate the radiologically defined level contours, clips were positioned intraoperatively at the level boundaries defined by surgical anatomy. In 10 consecutive patients, clips were placed, at the time of a neck dissection being performed, at the most cranial border of the neck. Anterior-posterior and lateral X-ray films were obtained intraoperatively. Next, in 3 patients, neck levels were contoured on preoperative contrast-enhanced CT scans according to the international consensus guidelines. From each of these 3 patients, an intraoperative CT scan was also obtained, with clips placed at the surgical-anatomy-based level boundaries. The preoperative (CT-based) and intraoperative (surgery-defined) CT scans were matched. Results: Clips placed at the most cranial part of the neck lined up at the caudal part of the transverse process of the cervical vertebra C-I. The posterior border of surgical level IIa (spinal accessory nerve [SAN]) did not match with the posterior border of CT-based level IIa (internal jugular vein [IJV]). Other surgical boundaries and CT-based contours were in good agreement. Conclusions: The cranial border of the neck, i.e., the cranial border of level IIa/IIb, corresponds to the caudal edge of the lateral process of C-I. Except for the posterior border between level IIa and level IIb, a perfect match was observed between the other surgical-clip-identified levels II-V boundaries (surgical-anatomy) and the CT-based delineation contours. It is argued that (1) because of the parotid gland overlapping part of level II, and (2) the frequent infestation of occult metastatic cells in the lymph channels around the IJV, the division of level II into radiologic

Invasive cervical carcinoma (Stages IB-IIB)

International Nuclear Information System (INIS)

Sironi, S.; Zanello, A.; Rodighiero, M.G.; Vanzulli, A.; Del Maschio, A.; Taccagni, G.L.; Belloni, C.

1991-01-01

In the patients with invasive cervical carcinoma, the accurate assessment of parametrial invasion greatly affects the therapeutic choice between surgery and radiation therapy. As a matter of fact, surgery is usually performed only in the patients with carcinoma confined to the cervix, whereas those with parametrial involvement, or more advanced stages, are treated with radiation therapy. This prospective study was aimed at investigating the comparative adequecy of CT and MR imaging in assessing parametrial status in the patients with invasive cervical cancer. Twenty-one consecutive patients, with histologic diagnosis of cervical carcinoma, were investigated. All of them were clinically considered as having invasive cervical cancer (FIGO stage IB-IIB) and subsequently underwent surgery. In all cases, detailed histology of the parametrium was obtained. Pathological data were compared with CT and MR findings in all cases. As for assessing parametrial involvement by cancer, CT had 62% accuracy, 63% sensitivity, and 60% specificity, versus MR imaging 81% accuracy, 69% sensitivity, and 80% specificify. Therefore, MR imaging appears to be superior to CT in assessing the parametrial status of patients with invasive cervical carcinoma; the method yields valuable information for treatment planning

Isolation and characterization of major histocompatibility complex class IIB genes from the nurse shark.

Science.gov (United States)

Bartl, S; Weissman, I L

1994-01-04

The major histocompatibility complex (MHC) contains a set of linked genes which encode cell surface proteins involved in the binding of small peptide antigens for their subsequent recognition by T lymphocytes. MHC proteins share structural features and the presence and location of polymorphic residues which play a role in the binding of antigens. In order to compare the structure of these molecules and gain insights into their evolution, we have isolated two MHC class IIB genes from the nurse shark, Ginglymostoma cirratum. Two clones, most probably alleles, encode proteins which differ by 13 amino acids located in the putative antigen-binding cleft. The protein structure and the location of polymorphic residues are similar to their mammalian counterparts. Although these genes appear to encode a typical MHC protein, no T-cell-mediated responses have been demonstrated in cartilaginous fish. The nurse shark represents the most phylogenetically primitive organism in which both class IIA [Kasahara, M., Vazquez, M., Sato, K., McKinney, E.C. & Flajnik, M.F. (1992) Proc. Natl. Acad. Sci USA 89, 6688-6692] and class IIB genes, presumably encoding the alpha/beta heterodimer, have been isolated.

Discriminating neutrino mass models using Type-II see-saw formula

Indian Academy of Sciences (India)

though a fuller analysis needs the full matrix form when all terms are present. This is followed by the normal hierarchical model (Type [III]) and inverted hierarchical model with opposite CP phase (Type [IIB]). γ ≃ 10−2 for both of them. Our main results on neutrino masses and mixings in Type-II see-saw formula are presented ...

PKL-tests, test series IIB (end of blowdown). Vol. 2

International Nuclear Information System (INIS)

Umminger, K.; Mandl, R.; Nopper, H.; Siemens AG Unternehmensbereich KWU, Erlangen

1987-01-01

As part of the federally subsidized research project 1500 287/A0, the system behavior of a 1300 MWe pressurized water reactor (PWR) was investigated during the depressurization phase (end-of-blowdown, EOB), as well as during the refill and reflood phases of a loss of coolant accident involving a large break in the reactor coolant loop. Appropriate modifications to the system and supplementary instrumentation have made it possible to simulate the EOB (as of 26 bar), the refill phase and reflood phase in sequence. This report includes a detailed description of the instrumentation and the data acquisition system used in Test Series PKL IIB. (orig.) With 6 refs., 2 tabs., 60 figs [de

Bailout use of platelet glycoprotein IIb-IIIa inhibition during coronary stent implantation: observations from the ESPRIT trial.

Science.gov (United States)

Cantor, Warren J; Madan, Mina; O'Shea, J Conor; Chisholm, Robert J; Lui, Henry K; Cohen, David J; Feldman, Robert L; Green, Robert; Hellkamp, Anne S; Kitt, Michael M; Tcheng, James E

2005-07-01

Glycoprotein (GP) IIb/IIIa inhibitors are often used as a rescue or bailout therapy to manage complications arising during percutaneous coronary intervention, rather than as prophylactic treatment. We sought to identify the characteristics and outcomes of patients requiring bailout treatment. The ESPRIT trial randomized 2,064 patients to receive eptifibatide or placebo starting immediately before percutaneous coronary intervention (PCI). Bailout therapy was used in 77 patients: 43 (4.2%) randomized to placebo and 34 (3.3%) to eptifibatide (p = 0.3). Bailout therapy for thrombosis was used more often in the placebo group (2.1% versus 1.0%; p = 0.03). Multivariable predictors of bailout included a greater than or equal to 90% stenosis, or visible thrombus on the baseline angiogram, and no aspirin pre-treatment before PCI. However, overall the model predicted bailout poorly (c-index = 0.64). The need for bailout cannot be reliably predicted using baseline characteristics. Patients experiencing complications have poor clinical outcomes despite bailout use of GP IIb/IIIa inhibitors.

Complementary effects of thienopyridine pretreatment and platelet glycoprotein IIb/IIIa integrin blockade with eptifibatide in coronary stent intervention; results from the ESPRIT trial.

Science.gov (United States)

Dery, Jean-Pierre; Campbell, Mark E; Mathias, Jasmine; Pieper, Karen S; Harrington, Robert A; Madan, Mina; Gibson, C Michael; Tolleson, Thaddeus R; O'Shea, J Conor; Tcheng, James E

2007-07-01

This analysis sought to investigate the complementary effect of thienopyridine pretreatment and platelet glycoprotein (GP) IIb/IIIa integrin blockade in coronary stent intervention. Definitive evidence supporting combined antiplatelet therapy consisting of thienopyridine pretreatment and GP IIb/IIIa receptor blockade in patients undergoing percutaneous coronary intervention (PCI) with stent implantation is limited. We retrospectively analyzed clinical outcomes by thienopyridine use in the 2,040 patients randomized to eptifibatide or placebo who underwent PCI in the ESPRIT trial. A total of 901 patients received a loading dose of thienopyridine before PCI (group 1), 123 received thienopyridine pretreatment without a loading dose (group 2), and 1,016 were not treated with thienopyridine before PCI (group 3). The composite incidence of death or myocardial infarction at 30 days was significantly lower in group 1 than in groups 2 and 3 combined (OR, 0.71 [95%CI, 0.52-0.99]; P = 0.0417). A similar trend was seen for the composite of death, myocardial infarction, or urgent target vessel revascularization (unadjusted OR, 0.77 [0.57-1.05]; P = 0.1025). After adjusting for baseline characteristics, these differences were no longer significant. No interactions were identified with eptifibatide assignment for any of the group comparisons. Pretreatment with a loading dose of thienopyridine lowers the rate of ischemic complications regardless of treatment with a GP IIb/IIIa inhibitor. Conversely, the efficacy of eptifibatide is maintained whether or not a loading dose of a thienopyridine is administered. Optimal outcomes are achieved in patients receiving thienopyridine pretreatment along with platelet GP IIb/IIIa inhibitor therapy. (c) 2007 Wiley-Liss, Inc.

The D-instanton and other supersymmetric D-branes in IIB plane-wave string theory

International Nuclear Information System (INIS)

Gaberdiel, Matthias R.; Green, Michael B.

2003-01-01

A class of D-branes for the type IIB plane-wave background is considered that preserve half the dynamical supersymmetries of the light-cone gauge. The D-branes of this type are the Euclidean (or instantonic) (0,0), (0,4), and (4,0) branes (where (r,s) denotes a brane oriented with r axes in the first four directions transverse to the +, - light-cone, and s axes in the second four directions). Corresponding Lorentzian D-branes are (+,-;0,0), (+,-;0,4), and (+,-;4,0). These are constructed in two ways. The first uses a boundary state formalism which implements appropriate fermionic gluing conditions and the second is based on a direct quantization of the open strings ending on the branes. In distinction to the D-branes considered earlier these have massless world-volume fermions but do not possess kinematical supersymmetries. Cylinder diagrams describing the overlap between a pair of boundary states displaced by some distance are evaluated. The open-string description of this system involves mode frequencies that are, in general, given by irrational solutions to transcendental equations. The closed-string and open-string descriptions are shown to be equivalent by a nontrivial implementation of the S modular transformation. A classical description of the D-instanton (the (0,0) case) in light-cone gauge is also given

Equipoise in the enhanced supression of the platelet IIb/IIIa receptor with integrilin trial (ESPRIT): a critical appraisal.

Science.gov (United States)

Mann, Howard; London, Alex John; Mann, Jeffrey

2005-01-01

Enhanced Supression of the Platelet IIb/IIIa Receptor with Integrilin Trial (ESPRIT) was a multicenter randomized controlled clinical trial in which participants were randomized between eptifibatide and placebo. A "clinical hold" was initially placed on the trial by the US Food and Drug Administration (FDA), which was concerned about the placebo-only control arm. The hold was lifted after additional information concerning the use of platelet glycoprotein IIb/IIIa inhibitors in clinical practice, derived from a survey of interventional cardiologists, was provided. The trial's principal investigator and colleagues have described how these issues were resolved, and advance a claim of equipoise for the trial. In this critical appraisal we examine the information and arguments proffered in support of the trial design and conclude that they evidence a misunderstanding of equipoise. We believe that a placebo-only control arm was not justified by the information provided by the trialists.

The Combination of GIS and Biphasic to Better Predict In Vivo Dissolution of BCS Class IIb Drugs, Ketoconazole and Raloxifene.

Science.gov (United States)

Tsume, Yasuhiro; Igawa, Naoto; Drelich, Adam J; Amidon, Gregory E; Amidon, Gordon L

2018-01-01

The formulation developments and the in vivo assessment of Biopharmaceutical Classification System (BCS) class II drugs are challenging due to their low solubility and high permeability in the human gastrointestinal (GI) tract. Since the GI environment influences the drug dissolution of BCS class II drugs, the human GI characteristics should be incorporated into the in vitro dissolution system to predict bioperformance of BCS class II drugs. An absorptive compartment may be important in dissolution apparatus for BCS class II drugs, especially for bases (BCS IIb) because of high permeability, precipitation, and supersaturation. Thus, the in vitro dissolution system with an absorptive compartment may help predicting the in vivo phenomena of BCS class II drugs better than compendial dissolution apparatuses. In this study, an absorptive compartment (a biphasic device) was introduced to a gastrointestinal simulator. This addition was evaluated if this in vitro system could improve the prediction of in vivo dissolution for BCS class IIb drugs, ketoconazole and raloxifene, and subsequent absorption. The gastrointestinal simulator is a practical in vivo predictive tool and exhibited an improved in vivo prediction utilizing the biphasic format and thus a better tool for evaluating the bioperformance of BCS class IIb drugs than compendial apparatuses. Copyright © 2018. Published by Elsevier Inc.

Radiation therapy for stage IIA and IIB testicular seminoma: peripheral dose calculations and risk assessments

Science.gov (United States)

Mazonakis, Michalis; Berris, Theocharris; Lyraraki, Efrossyni; Damilakis, John

2015-03-01

This study was conducted to calculate the peripheral dose to critical structures and assess the radiation risks from modern radiotherapy for stage IIA/IIB testicular seminoma. A Monte Carlo code was used for treatment simulation on a computational phantom representing an average adult. The initial treatment phase involved anteroposterior and posteroanaterior modified dog-leg fields exposing para-aortic and ipsilateral iliac lymph nodes followed by a cone-down phase for nodal mass irradiation. Peripheral doses were calculated using different modified dog-leg field dimensions and an extended conventional dog-leg portal. The risk models of the BEIR-VII report and ICRP-103 were combined with dosimetric calculations to estimate the probability of developing stochastic effects. Radiotherapy for stage IIA seminoma with a target dose of 30 Gy resulted in a range of 23.0-603.7 mGy to non-targeted peripheral tissues and organs. The corresponding range for treatment of stage IIB disease to a cumulative dose of 36 Gy was 24.2-633.9 mGy. A dose variation of less than 13% was found by altering the field dimensions. Radiotherapy with the conventional instead of the modern modified dog-leg field increased the peripheral dose up to 8.2 times. The calculated heart doses of 589.0-632.9 mGy may increase the risk for developing cardiovascular diseases whereas the testicular dose of more than 231.9 mGy may lead to a temporary infertility. The probability of birth abnormalities in the offspring of cancer survivors was below 0.13% which is much lower than the spontaneous mutation rate. Abdominoplevic irradiation may increase the lifetime intrinsic risk for the induction of secondary malignancies by 0.6-3.9% depending upon the site of interest, patient’s age and tumor dose. Radiotherapy for stage IIA/IIB seminoma with restricted fields and low doses is associated with an increased morbidity. These data may allow the definition of a risk-adapted follow-up scheme for long

Isolation and characterization of major histocompatibility complex class IIB genes from the nurse shark.

OpenAIRE

Bartl, S; Weissman, I L

1994-01-01

The major histocompatibility complex (MHC) contains a set of linked genes which encode cell surface proteins involved in the binding of small peptide antigens for their subsequent recognition by T lymphocytes. MHC proteins share structural features and the presence and location of polymorphic residues which play a role in the binding of antigens. In order to compare the structure of these molecules and gain insights into their evolution, we have isolated two MHC class IIB genes from the nurse...

Radiotherapy results of uterine cervix cancer stape IIB : overall survival, prognostic facters, patterns of failure and late complications

Energy Technology Data Exchange (ETDEWEB)

Kim, Eun Seog; Choi, Doo Ho [Soonchunhyang Univ. College of Medicine, Asan (Korea, Republic of); Huh, Seung Jae [Samsung Medical Center, Sungkyunkwan Univ. College of Medicine, Seoul (Korea, Republic of)

1998-03-01

Treatment of choice for uterine cervix cancer stage IIB is radiotherapy. We analyzed survivals, prognostic factors, patterns of failure and complications. This is a retrospective analysis of 167 patients with stage IIB carcinoma of uterine cervix treated with curative external pelvic and high dose rate intracavitary radiotherapy at the Department of Therapeutic Radiology, Soonchunhyang University Hospital from August 1985 to August 1994. All the patients followed up from 3 to 141 months(mean 60 months) and age of patients ranged from 31 to 78 years at presentation(mean : 55 years). Overall complete response rate was 84%. The response rate for squamous cell carcimoma and adenocarcinoma were 86% and 60%, respectively. Overall 5-years survival rate and disease free survival rate was 62 and 59%, respectively. Mass size and treatment response were significant prognostic factors for survival. Pathologic type and parametrial involvement were marginally significants prognostic factors. Local failure was 43 cases, distant metastasis was 14 cases and local failure plus distant metastasis was 3 cases, and most of local failures occurred within 24 months, distant metastasis within 12 months after treatment. Twenty eight(16.8%) patients developed late rectal and urinary complications There were tendency to increasing severity and frequency according to increased fractional dose and total(rectal and bladder) dose. Survival rate was significantly related to tumor size and radiotherapy response. Tumor size should be considered in the clinical staging. To increased survival and local control, clinical trials such as decreasing duration of radiotherapy or addition of chemotherapy is needed. To detect early recurrence, regular follow up after RT is important. Because total rectal and bladder dose affected late complications, meticulous vaginal packing is needed to optimize dose of normal tissues and to decrease late complications.

Posttranslational modification of hepatic cytochrome P-450. Phosphorylation of phenobarbital-inducible P-450 forms PB-4 (IIB1) and PB-5 (IIB2) in isolated rat hepatocytes and in vivo

International Nuclear Information System (INIS)

Koch, J.A.; Waxman, D.J.

1989-01-01

Phosphorylation of hepatic cytochrome P-450 was studied in isolated hepatocytes incubated in the presence of agents known to stimulate protein kinase activity. Incubation of hepatocytes isolated from phenobarbital-induced adult male rats with [ 32 P]orthophosphate in the presence of N 6 , O 2' -dibutyryl-cAMP (diBtcAMP) or glucagon resulted in the phosphorylation of microsomal proteins that are immunoprecipitable by polyclonal antibodies raised to the phenobarbital-induced P-450 form PB-4 (P-450 gene IIB1). Two-dimensional gel electrophoresis revealed that these 32 P-labeled microsomal proteins consist of a mixture of P-450 PB-4 and the closely related P-450 PB-5 (gene IIB2), both of which exhibited heterogeneity in the isoelectric focusing dimension. Phosphorylation of both P-450 forms was markedly enhanced by diBtcAMP at concentrations as low as 5 μM. Phosphoamino acid analysis of the 32 P-labeled P-450 PB-4 + PB-5 immunoprecipitate revealed that these P-450s are phosphorylated on serine in the isolated hepatocytes. Peptide mapping indicated that the site of phosphorylation in hepatocytes is indistinguishable from the site utilized by cAMP-dependent protein kinase in vitro, which was previously identified as serine-128 for the related rabbit protein P-450 LM2. In vitro analyses revealed that phosphorylation of P-450 PB-4 leads to a loss of monooxygenase activity, suggesting that the posttranslational modification of this P-450 enzyme by cAMP-dependent protein kinase may play a role in the modulation of P-450-dependent monooxygenase activity in vivo

Specificity of RSG-1.2 peptide binding to RRE-IIB RNA element of HIV-1 over Rev peptide is mainly enthalpic in origin.

Science.gov (United States)

Kumar, Santosh; Bose, Debojit; Suryawanshi, Hemant; Sabharwal, Harshana; Mapa, Koyeli; Maiti, Souvik

2011-01-01

Rev is an essential HIV-1 regulatory protein which binds to the Rev responsive element (RRE) present within the env gene of HIV-1 RNA genome. This binding facilitates the transport of the RNA to the cytoplasm, which in turn triggers the switch between viral latency and active viral replication. Essential components of this complex have been localized to a minimal arginine rich Rev peptide and stem IIB region of RRE. A synthetic peptide known as RSG-1.2 binds with high binding affinity and specificity to the RRE-IIB than the Rev peptide, however the thermodynamic basis of this specificity has not yet been addressed. The present study aims to probe the thermodynamic origin of this specificity of RSG-1.2 over Rev Peptide for RRE-IIB. The temperature dependent melting studies show that RSG-1.2 binding stabilizes the RRE structure significantly (ΔT(m) = 4.3°C), in contrast to Rev binding. Interestingly the thermodynamic signatures of the binding have also been found to be different for both the peptides. At pH 7.5, RSG-1.2 binds RRE-IIB with a K(a) = 16.2±0.6×10(7) M(-1) where enthalpic change ΔH = -13.9±0.1 kcal/mol is the main driving force with limited unfavorable contribution from entropic change TΔS = -2.8±0.1 kcal/mol. A large part of ΔH may be due to specific stacking between U72 and Arg15. In contrast binding of Rev (K(a) = 3.1±0.4×10(7) M(-1)) is driven mainly by entropy (ΔH = 0 kcal/mol and TΔS = 10.2±0.2 kcal/mol) which arises from major conformational changes in the RNA upon binding.

The mirror transform of type I vacua in six dimensions

International Nuclear Information System (INIS)

Sen, A.; Sethi, S.

1997-01-01

We study certain compactifications of the type I string on K3. The three topologically distinct choices of gauge bundles for the type I theory are shown to be equivalent to type IIB orientifolds with different choices of background anti-symmetric tensor field flux. Using a mirror transformation we relate these models to orientifolds with fixed seven planes, and without any anti-symmetric tensor field flux. This map allows us to relate these type I vacua to particular six-dimensional F-theory and heterotic string compactifications. (orig.)

N-terminal sequence of human leukocyte glycoprotein Mo1: conservation across species and homology to platelet IIb/IIIa.

Science.gov (United States)

Pierce, M W; Remold-O'Donnell, E; Todd, R F; Arnaout, M A

1986-12-12

Mo1 and gp160-gp93 are two surface membrane glycoprotein heterodimers present on granulocytes and monocytes derived from humans and guinea pigs, respectively. We purified both antigens and found that their alpha subunits had identical N-termini which were significantly homologous to the alpha subunit of the human adhesion platelet glycoprotein IIb/IIIa.

Neuromuscular partitioning, architectural design, and myosin fiber types of the M. vastus lateralis of the llama (Lama glama).

Science.gov (United States)

Graziotti, Guillermo H; Palencia, Pablo; Delhon, Gustavo; Rivero, José-Luis L

2004-11-01

The llama (Lama glama) is one of the few mammals of relatively large body size in which three fast myosin heavy chain isoforms (i.e., IIA, IIX, IIB) are extensively expressed in their locomotory muscles. This study was designed to gain insight into the morphological and functional organization of skeletal musculature in this peculiar animal model. The neuromuscular partitioning, architectural design, and myosin fiber types were systematically studied in the M. vastus lateralis of adult llamas (n = 15). Four nonoverlapping neuromuscular partitions or compartments were identified macroscopically (using a modified Sihler's technique for muscle depigmentation), although they did not conform strictly to the definitions of "neuromuscular compartments." Each neuromuscular partition was innervated by primary branches of the femoral nerve and was arranged within the muscle as paired partitions, two in parallel (deep-superficial compartmentalization) and the other two in-series (proximo-distal compartmentalization). These neuromuscular partitions of the muscle varied in their respective architectural designs (studied after partial digestion with diluted nitric acid) and myosin fiber type characteristics (identified immunohistochemically with specific anti-myosin monoclonal antibodies, then examined by quantitative histochemistry and image analysis). The deep partitions of the muscle had longer fibers, with lower angles of pinnation, and higher percentages of fast-glycolytic fibers than the superficial partitions of the muscle. These differences clearly suggest a division of labor in the whole M. vastus lateralis of llamas, with deep partitions exhibiting features well adapted for dynamic activities in the extension of stifle, whereas superficial portions seem to be related to the antigravitational role of the muscle in preserving the extension of the stifle during standing and stance phase of the stride. This peculiar structural and functional organization of the llama M

Procedural and clinical outcomes after use of the glycoprotein IIb/IIIa inhibitor abciximab for saphenous vein graft interventions

Energy Technology Data Exchange (ETDEWEB)

Harskamp, Ralf E., E-mail: r.e.harskamp@gmail.com [Academic Medical Center–University of Amsterdam, Amsterdam (Netherlands); VU University Medical Center, Amsterdam (Netherlands); Duke Clinical Research Institute, Durham, NC (United States); Hoedemaker, Niels [Academic Medical Center–University of Amsterdam, Amsterdam (Netherlands); Newby, L. Kristin [Duke Clinical Research Institute, Durham, NC (United States); Woudstra, Pier; Grundeken, Maik J.; Beijk, Marcel A.; Piek, Jan J.; Tijssen, Jan G. [Academic Medical Center–University of Amsterdam, Amsterdam (Netherlands); Mehta, Rajendra H. [Duke Clinical Research Institute, Durham, NC (United States); Winter, Robbert J. de [Academic Medical Center–University of Amsterdam, Amsterdam (Netherlands)

2016-01-15

Background: Percutaneous coronary intervention (PCI) of saphenous vein grafts (SVG) poses a high-risk for distal coronary thromboembolic events. Glycoprotein IIb/IIIa inhibitors are frequently used in hope of reducing the impact of this, although the safety and efficacy of these drugs to improve outcomes in this setting are understudied. Methods: Patients were included if they had prior coronary artery bypass surgery and subsequently underwent PCI of ≥ 1 SVG graft at a Dutch academic center between 1997 and 2008. These patients were matched 1:1 based on peri-procedural use of abciximab using a propensity-score matching algorithm based on 17 variables. Conditional logistic regression and Cox regression stratified on matched pairs were performed to evaluate the association between abciximab use and MACCE (the composite measure of mortality, myocardial infarction, stroke and repeat revascularization) at 30 days and up to 1 year. Results: The composite of 30-day MACCE occurred in 18 patients (15.3%) in the abciximab group and 16 patients (13.6%) in the propensity matched control group (OR: 1.13, 95% CI: 0.57–2.21, p = 0.73). At 1-year follow-up, MACCE rates were also similar (32.5% vs. 33.9%, HR: 0.97, 95% CI: 0.59–1.59). Major bleeding (BARC types 3a–c) was higher in the abciximab group (11.9% vs. 4.2%, OR: 2.80, 95% CI: 1.01–7.77). Ischemic outcomes did not differ among patients with acute coronary syndromes. Conclusion: The use of intravenous abciximab was not associated with improved clinical outcomes up to 1-year among patients undergoing SVG PCI, but was related to more bleeding. - Highlights: • PCI of SVG poses a high-risk for distal coronary thromboembolic events. • Glycoprotein IIb/IIIa inhibitors are frequently used in an attempt to reduce this risk. • We evaluated the safety and efficacy of abciximab (a glycoprotein IIb/IIIa inhibitor) using a propensity-score matched analysis of 236 patients at a large academic medical center. • Thirty

Endothelial Fcγ Receptor IIB Activation Blunts Insulin Delivery to Skeletal Muscle to Cause Insulin Resistance in Mice

Science.gov (United States)

Tanigaki, Keiji; Chambliss, Ken L.; Yuhanna, Ivan S.; Sacharidou, Anastasia; Ahmed, Mohamed; Atochin, Dmitriy N.; Huang, Paul L.

2016-01-01

Modest elevations in C-reactive protein (CRP) are associated with type 2 diabetes. We previously revealed in mice that increased CRP causes insulin resistance and mice globally deficient in the CRP receptor Fcγ receptor IIB (FcγRIIB) were protected from the disorder. FcγRIIB is expressed in numerous cell types including endothelium and B lymphocytes. Here we investigated how endothelial FcγRIIB influences glucose homeostasis, using mice with elevated CRP expressing or lacking endothelial FcγRIIB. Whereas increased CRP caused insulin resistance in mice expressing endothelial FcγRIIB, mice deficient in the endothelial receptor were protected. The insulin resistance with endothelial FcγRIIB activation was due to impaired skeletal muscle glucose uptake caused by attenuated insulin delivery, and it was associated with blunted endothelial nitric oxide synthase (eNOS) activation in skeletal muscle. In culture, CRP suppressed endothelial cell insulin transcytosis via FcγRIIB activation and eNOS antagonism. Furthermore, in knock-in mice harboring constitutively active eNOS, elevated CRP did not invoke insulin resistance. Collectively these findings reveal that by inhibiting eNOS, endothelial FcγRIIB activation by CRP blunts insulin delivery to skeletal muscle to cause insulin resistance. Thus, a series of mechanisms in endothelium that impairs insulin movement has been identified that may contribute to type 2 diabetes pathogenesis. PMID:27207525

Scale invariance of the η-deformed AdS5×S5 superstring, T-duality and modified type II equations

Directory of Open Access Journals (Sweden)

G. Arutyunov

2016-02-01

Full Text Available We consider the ABF background underlying the η-deformed AdS5×S5 sigma model. This background fails to satisfy the standard IIB supergravity equations which indicates that the corresponding sigma model is not Weyl invariant, i.e. does not define a critical string theory in the usual sense. We argue that the ABF background should still define a UV finite theory on a flat 2d world-sheet implying that the η-deformed model is scale invariant. This property follows from the formal relation via T-duality between the η-deformed model and the one defined by an exact type IIB supergravity solution that has 6 isometries albeit broken by a linear dilaton. We find that the ABF background satisfies candidate type IIB scale invariance conditions which for the R–R field strengths are of the second order in derivatives. Surprisingly, we also find that the ABF background obeys an interesting modification of the standard IIB supergravity equations that are first order in derivatives of R–R fields. These modified equations explicitly depend on Killing vectors of the ABF background and, although not universal, they imply the universal scale invariance conditions. Moreover, we show that it is precisely the non-isometric dilaton of the T-dual solution that leads, after T-duality, to modification of type II equations from their standard form. We conjecture that the modified equations should follow from κ-symmetry of the η-deformed model. All our observations apply also to η-deformations of AdS3×S3×T4and AdS2×S2×T6models.

Skeletal muscle myostatin mRNA expression is fiber-type specific and increases during hindlimb unloading

Science.gov (United States)

Carlson, C. J.; Booth, F. W.; Gordon, S. E.

1999-01-01

Transgenic mice lacking a functional myostatin (MSTN) gene demonstrate greater skeletal muscle mass resulting from muscle fiber hypertrophy and hyperplasia (McPherron, A. C., A. M. Lawler, and S. -J. Lee. Nature 387: 83-90, 1997). Therefore, we hypothesized that, in normal mice, MSTN may act as a negative regulator of muscle mass. Specifically, we hypothesized that the predominately slow (type I) soleus muscle, which demonstrates greater atrophy than the fast (type II) gastrocnemius-plantaris complex (Gast/PLT), would show more elevation in MSTN mRNA abundance during hindlimb unloading (HU). Surprisingly, MSTN mRNA was not detectable in weight-bearing or HU soleus muscle, which atrophied 42% by the 7th day of HU in female ICR mice. In contrast, MSTN mRNA was present in weight-bearing Gast/PLT muscle and was significantly elevated (67%) at 1 day but not at 3 or 7 days of HU. However, the Gast/PLT muscle had only atrophied 17% by the 7th day of HU. Because the soleus is composed only of type I and IIa fibers, whereas the Gast/PLT expresses type IId/x and IIb in addition to type I and IIa, it was necessary to perform a more careful analysis of the relationship between MSTN mRNA levels and myosin heavy-chain (MHC) isoform expression (as a marker of fiber type). A significant correlation (r = 0.725, P < 0. 0005) was noted between the percentage of MHC isoform IIb expression and MSTN mRNA abundance in several muscles of the mouse hindlimb. These results indicate that MSTN expression is not strongly associated with muscle atrophy induced by HU; however, it is strongly associated with MHC isoform IIb expression in normal muscle.

Increased risk for vascular complications due to GP IIb/IIIa-antagonists in patients with cardiogenic shock supported by intraaortic balloon pump (IABP

Directory of Open Access Journals (Sweden)

Jens Röther

2015-08-01

Conclusion: Vascular events with the use of IABP are common but in our study, not significantly associated with a higher mortality. Treatment with GP IIb/IIIa-antagonists is associated with a higher risk of vascular events.

11th international symposium on nuclei in the cosmos. Book of abstracts

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-07-01

The following topics are dealt with: The big bang, the first stars, chemical evolution and stars, grains and {gamma}-ray observations, core-collapse supernovae, hypernovae and mergers, compact objects, the s-process, novae, X-ray bursts, explosive nucleosynthesis, type Ia supernovae, the p process ans exotic nuclei, the r-process, future facilities. (HSI)

Survival of nonsurgically staged patients with negative lymphangiograms who had Stage IIB carcinoma of the cervix treated by pelvic radiation plus hydroxyurea

International Nuclear Information System (INIS)

Piver, M.S.; Krishnamsetty, R.M.; Emrich, L.J.

1985-01-01

Twenty patients with Stage IIB carcinoma of the cervix who did not undergo pretherapy para-aortic lymphadenectomy, but who had negative preradiation therapy lymphangiograms, were treated with pelvic radiation plus hydroxyurea. Patients received a median of 5020 rads of pelvic radiation plus 4000 rads of radium to point A. During radiation therapy and for a total of 12 weeks, patients received hydroxyurea administered at a dose of 80 mg/kg of body weight every 3 days if the white blood cell count was greater than or equal to 2,500/mm3 and platelets were greater than or equal to 75,000/mm3. The median follow-up time was 28 months (6 to 83 months). The estimated 5-year survival rate was 92%. Seventeen patients are alive with no evidence of disease (median, 28 months); one died of intercurrent disease with no evidence of disease (17 months); one is alive with no evidence of disease after recurrence (18 months); and one died of cervical cancer (22 months). The survival rate of patients with nonsurgically staged negative pretherapy lymphangiograms who had Stage IIB cervical cancer treated by pelvic radiation therapy plus hydroxyurea approximated the improved survival rate reported for patients with negative pretherapy para-aortic lymphadenectomy who were treated with pelvic radiation therapy plus hydroxyurea. Both studies would suggest that pelvic radiation plus hydroxyurea improves the rate of survival in patients with Stage IIB cervical cancer

On the construction of SL(2,Z) type IIB 5-branes

International Nuclear Information System (INIS)

Lu, J.X.; Roy, S.

1999-01-01

This talk reviews our recent work on the construction of SL(2,Z) multiplets of type lIB superfivebranes. We here pay particular attention to the methods employed and some salient features of the solutions. (author)

Genomic clone encoding the α chain of the OKM1, LFA-1, and platelet glycoprotein IIb-IIIa molecules

International Nuclear Information System (INIS)

Cosgrove, L.J.; Sandrin, M.S.; Rajasekariah, P.; McKenzie, I.F.C.

1986-01-01

LFA-1, an antigen involved in cytolytic T lymphocyte-mediated killing, and Mac-1, the receptor for complement component C3bi, constitute a family of structurally and functionally related cell surface glycoproteins involved in cellular interactions. In both mouse and man, Mac-1 (OKM1) and LFA-1 share a common 95-kDa β subunit but are distinguished by their α chains, which have different cellular distributions, apparent molecular masses (165 and 177 kDa, respectively), and peptide maps. The authors report the isolation of a genomic clone from a human genomic library that on transfection into mouse fibroblasts produced a molecule(s) reactive with monoclonal antibodies to OKM1, to LFA-1, and to platelet glycoprotein IIb-IIIa. This gene was cloned by several cycles of transfection of L cells with a human genomic library cloned in λ phase Charon 4A and subsequent rescue of the λ phage. Transfection with the purified recombinant λ DNA yielded a transfectant that expressed the three human α chains of OKM1, LFA-1, and glycoprotein IIb-IIIa, presumably in association with the murine β chain

HCV IRES domain IIb affects the configuration of coding RNA in the 40S subunit's decoding groove.

Science.gov (United States)

Filbin, Megan E; Kieft, Jeffrey S

2011-07-01

Hepatitis C virus (HCV) uses a structured internal ribosome entry site (IRES) RNA to recruit the translation machinery to the viral RNA and begin protein synthesis without the ribosomal scanning process required for canonical translation initiation. Different IRES structural domains are used in this process, which begins with direct binding of the 40S ribosomal subunit to the IRES RNA and involves specific manipulation of the translational machinery. We have found that upon initial 40S subunit binding, the stem-loop domain of the IRES that contains the start codon unwinds and adopts a stable configuration within the subunit's decoding groove. This configuration depends on the sequence and structure of a different stem-loop domain (domain IIb) located far from the start codon in sequence, but spatially proximal in the IRES•40S complex. Mutation of domain IIb results in misconfiguration of the HCV RNA in the decoding groove that includes changes in the placement of the AUG start codon, and a substantial decrease in the ability of the IRES to initiate translation. Our results show that two distal regions of the IRES are structurally communicating at the initial step of 40S subunit binding and suggest that this is an important step in driving protein synthesis.

[Complications of surgical stage of treatment in patients with cancer of cervix uteri stage IIB].

Science.gov (United States)

Kryzhanivs'ka, A Ie

2013-11-01

The results of treatment of 127 patients, suffering cervix uteri cancer stage IIB in period of 1998 - 2012 yrs, were analyzed. Complications of surgical stage of the combined treatment have had occurred in 40.9% patients, including 40.5% patients, to whom neoadjuvant chemotherapy was conducted and in 41.5%--radiation therapy (RTH). The main postoperative complications--retroperitoneal lymphatic cysts--were revealed in 35.4% patients. The factors, raising the risk of postoperative complications occurrence, are following: the primary tumor spreading, metastatic affection of lymphatic nodes of pelvic cavity, preoperative conduction of RTH or chemotherapy.

Stent parameters predict major adverse clinical events and the response to platelet glycoprotein IIb/IIIa blockade: findings of the ESPRIT trial.

Science.gov (United States)

Tcheng, James E; Lim, Ing Haan; Srinivasan, Shankar; Jozic, Joseph; Gibson, C Michael; O'Shea, J Conor; Puma, Joseph A; Simon, Daniel I

2009-02-01

Only limited data describe relationships between stent parameters (length and diameter), adverse events after percutaneous coronary intervention, and effects of platelet glycoprotein IIb/IIIa blockade by stent parameters. In this post hoc analysis of the 1983 patients receiving a stent in the Enhanced Suppression of the Platelet Glycoprotein IIb/IIIa Receptor with Integrilin Therapy randomized percutaneous coronary intervention trial of eptifibatide versus placebo, rates of the major adverse cardiac event (MACE) end point (death, myocardial infarction, urgent target-vessel revascularization, or thrombotic bailout) at 48 hours and 1 year were correlated with stent parameters and then analyzed by randomization to eptifibatide versus placebo. In the placebo group, MACE increased with number of stents implanted, total stent length (by quartiles of or=30 mm), and total stented vessel area (by quartiles of area or=292 mm(2)). By stent parameters, MACE at 48 hours was reduced in the eptifibatide group at stent lengths of 18 to or=30 mm (OR, 0.43; 95% CI, 0.25 to 0.75; P=0.003), stent diameters of >2.5 to <3.5 mm (OR, 0.56; 95% CI, 0.39 to 0.82; P=0.002), and with 2 stents implanted (OR, 0.39; 95% CI, 0.22 to 0.69; P=0.001). In the placebo group, near-linear relationships were observed between both increasing stent length and increasing stented vessel area and MACE at 48 hours and 1 year (all, P<0.001); these gradients were flattened in the eptifibatide group (P=0.005 for stent length). Stent parameters predict MACE after percutaneous coronary intervention. Glycoprotein IIb/IIIa blockade mitigates much of the hazard of increasing procedural complexity.

Bitistatin-functionalized fluorescent nanodiamond particles specifically bind to purified human platelet integrin receptor αIIbβ3 and activated platelets.

Science.gov (United States)

Marcinkiewicz, Cezary; Gerstenhaber, Jonathan A; Sternberg, Mark; Lelkes, Peter I; Feuerstein, Giora

2017-01-01

Thromboembolic events (TEE) underwrite key causes of death in developed countries. While advanced imaging technologies such as computed tomography scans serve to diagnose blood clots during acute cardiovascular events, no such technology is available in routine primary care for TEE risk assessment. Here, we describe an imaging platform technology based on bioengineered fluorescent nanodiamond particles (F-NDPs) functionalized with bitistatin (Bit), a disintegrin that specifically binds to the α IIb β 3 integrin, platelet fibrinogen receptor (PFR) on activated platelets. Covalent linkage of purified Bit to F-NDP was concentration-dependent and saturable, as validated by enzyme-linked immunosorbent assay using specific anti-Bit antibodies. F-NDP-Bit interacted with purified PFR, either in immobilized or soluble form. Lotrafiban, a nonpeptide, α IIb β 3 receptor antagonist, specifically blocked F-NDP-Bit-PFR complex formation. Moreover, F-NDP-Bit specifically binds to activated platelets incorporated into a clot generated by thrombin-activated rat platelet-rich plasma (PRP). Our results suggest that engineered F-NDP-Bit particles could serve as noninvasive, "real-time" optical diagnostics for clots present in blood vessels.

Phase IIA and IIB experiments of JAERI/U.S.DOE collaborative program on fusion blanket neutronics

International Nuclear Information System (INIS)

Oyama, Yukio

1989-12-01

Phase IIA and IIB experiments on fusion blanket neutronics has been performed on a basis of JAERI/USDOE collaborative program. In the Phase II experimental series, a D-T neutron source and a test blanket were contained by a lithium-carbonate enclosure to adjust the incident neutron spectrum to the test blanket so as to simulate that of a fusion reactor. First two series of the Phase II, IIA and IIB, focused especially on influences of beryllium configurations for neutron multiplying zone to neutronic parameters. Measured parameters were tritium production rate using Li-glass and NE213 scintillators, and Li-metal foil and Lithium-oxide block with liquid scintillation technique; neutron spectrum using NE213 scintillator and proton recoil proportional counter; reaction rate using foil activation technique. These parameters were compared among six different beryllium configurations of the experimental system. Consistency between different techniques for each measured parameter was also tested among different experimental systems and confirmed to be within experimental errors. This report describes, in detail, experimental conditions, assemblies, equipments and neutron source in Part I. The part II compiles all information required for a calculational analysis of this experiment, e.g., dimensions of the target room, target assembly, experimental assembly, their material densities and numerical data of experimental results. This compilation provides benchmark data to test calculation models and computing code systems used for a nuclear design of a fusion reactor. (author)

Risk model in stage IB1-IIB cervical cancer with positive node after radical hysterectomy

Directory of Open Access Journals (Sweden)

Chen Z

2016-05-01

Full Text Available Zhilan Chen,1,2,* Kecheng Huang,1,* Zhiyong Lu,1,3 Song Deng,1,4 Jiaqiang Xiong,1 Jia Huang,1 Xiong Li,5 Fangxu Tang,1 Zhihao Wang,6 Haiying Sun,1 Lin Wang,1 Shasha Zhou,1 Xiaoli Wang,1 Yao Jia,1 Ting Hu,1 Juan Gui,7 Dongyi Wan,1 Ding Ma,1 Shuang Li,1 Shixuan Wang11Department of Obstetrics and Gynecology, Tongji Hospital, Tongji Medical College, Huazhong University of Science and Techonology, Wuhan, 2Department of Obstetrics and Gynecology, Wuhan General Hospital of Guangzhou Military Command, Wuhan, 3Hubei Key Laboratory of Embryonic Stem Cell Research, Tai-He Hospital, Hubei University of Medicine, Shiyan, Hubei, 4Department of Obstetrics and Gynecology, University Hospital of Hubei University for Nationalities, Enshi, Hubei, 5Department of Obstetrics and Gynecology, Wuhan Central Hospital, Wuhan, 6Department of Pathology and Pathophysiology, Key Laboratory of Ministry of Education of China for Neurological Disorders, Huazhong University of Science and Techonology, Wuhan, 7Department of Obstetrics and Gynecology, Renmin Hospital, Wuhan University, Wuhan, People’s Republic of China*These authors contributed equally to this workAbstract: The purpose of this study was to identify risk factors in patients with surgically treated node-positive IB1-IIB cervical cancer and to establish a risk model for disease-free survival (DFS and overall survival (OS. A total of 170 patients who underwent radical hysterectomy and bilateral pelvic lymphadenectomy as primary treatment for node-positive International Federation of Gynaecology and Obstetrics (FIGO stage IB1-IIB cervical cancer from January 2002 to December 2008 were retrospectively analyzed. Five published risk models were evaluated in this population. The variables, including common iliac lymph node metastasis and parametrial invasion, were independent predictors of outcome in a multivariate analysis using a Cox regression model. Three distinct prognostic groups (low, intermediate, and high risk

Is glycoprotein IIb/IIIa antagonism as effective in women as in men following percutaneous coronary intervention?. Lessons from the ESPRIT study.

Science.gov (United States)

Fernandes, Laura S; Tcheng, James E; O'Shea, J Conor; Weiner, Bonnie; Lorenz, Todd J; Pacchiana, Cindy; Berdan, Lisa G; Maresh, Kelly J; Joseph, Diane; Madan, Mina; Mann, Tift; Kilaru, Rakhi; Hochman, Judith S; Kleiman, Neal S

2002-09-18

The study was done to determine whether eptifibatide, a platelet glycoprotein (GP) IIb/IIIa antagonist, prevents ischemic complications following percutaneous coronary interventions (PCIs) in women as well as in men. Eptifibatide reduces ischemic complications after nonurgent coronary stent interventions. We compared outcomes in women (n = 562) and men (n = 1,502) enrolled in the Enhanced Suppression of the Platelet GP IIb/IIIa Receptor with Integrilin Therapy (ESPRIT) trial of double-bolus eptifibatide during PCI. Women in the ESPRIT trial were older, and more frequently had hypertension, diabetes mellitus, or acute coronary syndromes, but were less likely to have prior PCI or coronary artery bypass graft surgery. The primary end point, a composite at 48 h of death, myocardial infarction (MI), urgent target vessel revascularization (TVR), and unplanned GP IIb/IIIa use, occurred in 10.5% of women and 7.9% of men (p = 0.082). The composite of death, MI, or TVR after one year occurred in 24.5% of women compared with 18% of men (p = 0.0008). At 48 h, eptifibatide reduced the composite of death, MI, and TVR from 14.5% to 6.0% in women versus 9.0% to 6.8% in men. At one year, these differences persisted: 28.9% versus 20.0% for women and 19.5% versus 16.6% for men. No statistical interaction existed between treatment and gender at either 48 h (p = 0.063) or one year (p = 0.2). Bleeding occurred more commonly in women (5.5% vs. 2.6%, p = 0.002), and was more common in eptifibatide-treated women. After adjustment for age, weight, and hypertension, no interaction between treatment and gender was present. Eptifibatide is effective to prevent ischemic complications of PCI in women and may eliminate gender-related differences in PCI outcomes.

Ontogenetic changes in skeletal muscle fiber type, fiber diameter and myoglobin concentration in the Northern elephant seal (Mirounga angustirostris

Directory of Open Access Journals (Sweden)

Colby eMoore

2014-06-01

Full Text Available Northern elephant seals (Mirounga angustirostris (NES are known to be deep, long-duration divers and to sustain long-repeated patterns of breath-hold, or apnea. Some phocid dives remain within the bounds of aerobic metabolism, accompanied by physiological responses inducing lung compression, bradycardia and peripheral vasoconstriction. Current data suggest an absence of type IIb fibers in pinniped locomotory musculature. To date, no fiber type data exist for NES, a consummate deep diver. In this study, NES were biopsied in the wild. Ontogenetic changes in skeletal muscle were revealed through succinate dehydrogenase (SDH based fiber typing. Results indicated a predominance of uniformly shaped, large type I fibers and elevated myoglobin (Mb concentrations in the longissimus dorsi (LD muscle of adults. No type II muscle fibers were detected in any adult sampled. This was in contrast to the juvenile animals that demonstrated type II myosin in Western Blot analysis, indicative of an ontogenetic change in skeletal muscle with maturation. These data support previous hypotheses that the absence of type II fibers indicates reliance on aerobic metabolism during dives, as well as a depressed metabolic rate and low energy locomotion. We also suggest that the lack of type IIb fibers (adults may provide a protection against ischemia reperfusion (IR injury in vasoconstricted peripheral skeletal muscle.

Platelet Glycoprotein IIb/IIIa Receptor Inhibition in Non-ST-Elevation Acute Coronary Syndromes : Early Benefit During Medical Treatment Only, With Additional Protection During Percutaneous Coronary Intervention

NARCIS (Netherlands)

K.M. Akkerhuis (Martijn); P. Théroux (Pierre); R.M. Califf (Robert); E.J. Topol (Eric); M.L. Simoons (Maarten); H. Boersma (Eric)

1999-01-01

textabstractBACKGROUND: Glycoprotein (GP) IIb/IIIa receptor blockers prevent life-threatening cardiac complications in patients with acute coronary syndromes without ST-segment elevation and protect against thrombotic complications associated with percutaneous coronary

Structural characterization of the PTS IIA and IIB proteins associated with pneumococcal fucose utilization.

Science.gov (United States)

Higgins, Melanie A; Hamilton, Aileen M; Boraston, Alisdair B

2017-05-01

Streptococcus pneumoniae harbors a significant number of transporters, including phosphotransferase (PTS) systems, allowing the bacterium to utilize a number of different carbohydrates for metabolic and other purposes. The genes encoding for one PTS transport system in particular (EII fuc ) are found within a fucose utilization operon in S. pneumoniae TIGR4. Here, we report the three-dimensional structures of IIA fuc and IIB fuc providing evidence that this PTS system belongs to the EII man family. Additionally, the predicted metabolic pathway for this distinctive fucose utilization system suggests that EII fuc transports the H-disaccharide blood group antigen, which would represent a novel PTS transporter specificity. Proteins 2017; 85:963-968. © 2016 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

A phase IIb multicentre study comparing the efficacy of trabectedin to doxorubicin in patients with advanced or metastatic untreated soft tissue sarcoma: The TRUSTS trial

NARCIS (Netherlands)

Bui-Nguyen, B.; Butrynski, J.E.; Penel, N.; Blay, J.Y.; Isambert, N.; Milhem, M.; Kerst, J.M.; Reyners, A.K.; Litiere, S.; Marreaud, S.; Collin, F.; Graaf, W.T.A. van der

2015-01-01

PURPOSE: To evaluate whether trabectedin as first-line chemotherapy for advanced/metastatic soft tissue sarcoma prolongs progression-free survival (PFS), compared to doxorubicin and, in the phase IIb part here, to select the most appropriate trabectedin treatment schedule (3-hour or 24-hour

Supersymmetric RG flows and Janus from type II orbifold compactification

Energy Technology Data Exchange (ETDEWEB)

Karndumri, Parinya; Upathambhakul, Khem [Chulalongkorn University, String Theory and Supergravity Group, Department of Physics, Faculty of Science, Bangkok (Thailand)

2017-07-15

We study holographic RG flow solutions within four-dimensional N = 4 gauged supergravity obtained from type IIA and IIB string theories compactified on T{sup 6}/Z{sub 2} x Z{sub 2} orbifold with gauge, geometric and non-geometric fluxes. In type IIB non-geometric compactifications, the resulting gauged supergravity has ISO(3) x ISO(3) gauge group and admits an N = 4 AdS{sub 4} vacuum dual to an N = 4 superconformal field theory (SCFT) in three dimensions. We study various supersymmetric RG flows from this N = 4 SCFT to N = 4 and N = 1 non-conformal field theories in the IR. The flows preserving N = 4 supersymmetry are driven by relevant operators of dimensions Δ = 1, 2 or alternatively by one of these relevant operators, dual to the dilaton, and irrelevant operators of dimensions Δ = 4 while the N = 1 flows in addition involve marginal deformations. Most of the flows can be obtained analytically. We also give examples of supersymmetric Janus solutions preserving N = 4 and N = 1 supersymmetries. These solutions should describe two-dimensional conformal defects within the dual N = 4 SCFT. Geometric compactifications of type IIA theory give rise to N = 4 gauged supergravity with ISO(3) x U(1){sup 6} gauge group. In this case, the resulting gauged supergravity admits an N = 1 AdS{sub 4} vacuum. We also numerically study possible N = 1 RG flows to non-conformal field theories in this case. (orig.)

D-strings in unconventional type I vacuum configurations

International Nuclear Information System (INIS)

Bianchi, M.; Gava, E.; Morales, F.; Narain, K.S.

1998-11-01

We determine the spectrum of D-string bound states in various classes of generalized type I vacuum configurations with sixteen and eight supercharges. The precise matching of the BPS spectra confirms the duality between unconventional type IIB orientfolds with quantized NS-NS antisymmetric tensor and heterotic CHL models in D=8. A similar analysis puts the duality between type II (4,0) models and type I strings without open strings on a firmer ground. The analysis can be extended to type II (2,0) asymmetric orbifolds and their type I duals that correspond to unconventional K3 compactifications. Finally we discuss BPS-saturated threshold corrections to the corresponding low-energy effective lagrangians. In particular we show how the exact moduli dependence of some F 4 terms in the eight-dimensional type II (4,0) orbifold is reproduced by the infinite sum of D-instanton contributions in the dual type I theory. (author)

THE PROGENITOR OF THE TYPE IIb SN 2008ax REVISITED

International Nuclear Information System (INIS)

Folatelli, Gastón; Bersten, Melina C.; Benvenuto, Omar G.; Kuncarayakti, Hanindyo; Maeda, Keiichi; Nomoto, Ken’ichi

2015-01-01

Hubble Space Telescope observations of the site of the supernova (SN) SN 2008ax obtained in 2011 and 2013 reveal that the possible progenitor object detected in pre-explosion images was in fact multiple. Four point sources are resolved in the new, higher-resolution images. We identify one of the sources with the fading SN. The other three objects are consistent with single supergiant stars. We conclude that their light contaminated the previously identified progenitor candidate. After subtraction of these stars, the progenitor appears to be significantly fainter and bluer than previously measured. Post-explosion photometry at the SN location indicates that the progenitor object has disappeared. If single, the progenitor is compatible with a supergiant star of B to mid-A spectral type, while a Wolf–Rayet (W-R) star would be too luminous in the ultraviolet to account for the observations. Moreover, our hydrodynamical modeling shows that the pre-explosion mass was 4–5 M ⊙ and the radius was 30–50 R ⊙ , which is incompatible with a W-R progenitor. We present a possible interacting binary progenitor computed with our evolutionary models that reproduces all the observational evidence. A companion star as luminous as an O9–B0 main-sequence star may have remained after the explosion

Type II pp-wave matrix models from point-like gravitons

International Nuclear Information System (INIS)

Lozano, Yolanda; RodrIguez-Gomez, Diego

2006-01-01

The BMN Matrix model can be regarded as a theory of coincident M-theory gravitons, which expand by Myers dielectric effect into the 2-sphere and 5-sphere giant graviton vacua of the theory. In this note we show that, in the same fashion, Matrix String theory in Type IIA pp-wave backgrounds arises from the action for coincident Type IIA gravitons. In Type IIB, we show that the action for coincident gravitons in the maximally supersymmetric pp-wave background gives rise to a Matrix model which supports fuzzy 3-sphere giant graviton vacua with the right behavior in the classical limit. We discuss the relation between our Matrix model and the Tiny Graviton Matrix theory

Specific Molecular Signatures for Type II Crustins in Penaeid Shrimp Uncovered by the Identification of Crustin-Like Antimicrobial Peptides in Litopenaeus vannamei

Science.gov (United States)

Barreto, Cairé; Coelho, Jaqueline da Rosa; Yuan, Jianbo; Xiang, Jianhai; Perazzolo, Luciane Maria

2018-01-01

Crustins form a large family of antimicrobial peptides (AMPs) in crustaceans composed of four sub-groups (Types I-IV). Type II crustins (Type IIa or “Crustins” and Type IIb or “Crustin-like”) possess a typical hydrophobic N-terminal region and are by far the most representative sub-group found in penaeid shrimp. To gain insight into the molecular diversity of Type II crustins in penaeids, we identified and characterized a Type IIb crustin in Litopenaeus vannamei (Crustin-like Lv) and compared Type II crustins at both molecular and transcriptional levels. Although L. vannamei Type II crustins (Crustin Lv and Crustin-like Lv) are encoded by separate genes, they showed a similar tissue distribution (hemocytes and gills) and transcriptional response to the shrimp pathogens Vibrio harveyi and White spot syndrome virus (WSSV). As Crustin Lv, Crustin-like Lv transcripts were found to be present early in development, suggesting a maternal contribution to shrimp progeny. Altogether, our in silico and transcriptional data allowed to conclude that (1) each sub-type displays a specific amino acid signature at the C-terminal end holding both the cysteine-rich region and the whey acidic protein (WAP) domain, and that (2) shrimp Type II crustins evolved from a common ancestral gene that conserved a similar pattern of transcriptional regulation. PMID:29337853

The Type IIb Supernova 2013df and its Cool Supergiant Progenitor

Science.gov (United States)

VanDyk, Schuyler D.; Zeng, Weikang; Fox, Ori D.; Cenko, S. Bradley; Clubb, Kelsey I.; Filippenko, Alexei; Foley, Ryan J.; Miller, Adam A.; Smith, Nathan; Kelly, Patrick L.;

THE PROGENITOR OF THE TYPE IIb SN 2008ax REVISITED

Energy Technology Data Exchange (ETDEWEB)

Folatelli, Gastón; Bersten, Melina C.; Benvenuto, Omar G. [Instituto de Astrofísica de La Plata (Argentina); Kuncarayakti, Hanindyo [Millennium Institute of Astrophysics (MAS), Casilla 36-D, Santiago (Chile); Maeda, Keiichi; Nomoto, Ken’ichi, E-mail: gaston@fcaglp.unlp.edu.ar [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo, Kashiwa, Chiba 277-8583 (Japan)

2015-10-01

Hubble Space Telescope observations of the site of the supernova (SN) SN 2008ax obtained in 2011 and 2013 reveal that the possible progenitor object detected in pre-explosion images was in fact multiple. Four point sources are resolved in the new, higher-resolution images. We identify one of the sources with the fading SN. The other three objects are consistent with single supergiant stars. We conclude that their light contaminated the previously identified progenitor candidate. After subtraction of these stars, the progenitor appears to be significantly fainter and bluer than previously measured. Post-explosion photometry at the SN location indicates that the progenitor object has disappeared. If single, the progenitor is compatible with a supergiant star of B to mid-A spectral type, while a Wolf–Rayet (W-R) star would be too luminous in the ultraviolet to account for the observations. Moreover, our hydrodynamical modeling shows that the pre-explosion mass was 4–5 M{sub ⊙} and the radius was 30–50 R{sub ⊙}, which is incompatible with a W-R progenitor. We present a possible interacting binary progenitor computed with our evolutionary models that reproduces all the observational evidence. A companion star as luminous as an O9–B0 main-sequence star may have remained after the explosion.

Measurements on irradiated L1 sensor prototypes for the D0 Run IIb silicon detector project

International Nuclear Information System (INIS)

Ahsan, M.; Bolton, T.; Carnes, K.; Demarteau, M.; Demina, R.; Gray, T.; Korjenevski, S.; Lehner, F.; Lipton, R.; Mao, H.S.; McCarthy, R.

2010-01-01

We report on irradiation studies of Hamamatsu prototype silicon microstrip detectors for layer 1 of the D0 upgrade project for Run IIb. The irradiation was carried out with 10 MeV protons up to proton fluence of 10 14 p/cm 2 at the J.R. Macdonald Laboratory, Manhatten, KS. The flux calibration was carefully checked using different dose normalization techniques. The results based on the obtained sensor leakage currents after irradiation show that the NIEL scaling hypothesis for low energy protons has to be applied with great care. We observe 30-40% less radiation damage in silicon for 10 MeV proton exposure than is expected from the predicted NIEL scaling.

Measurements on irradiated L1 sensor prototypes for the D0 Run IIb silicon detector project

Energy Technology Data Exchange (ETDEWEB)

Ahsan, M.; Bolton, T.; Carnes, K.; /Kansas State U.; Demarteau, M.; /Fermilab; Demina, R.; /Rochester U.; Gray, T.; /Kansas State U.; Korjenevski, S.; /Rochester U.; Lehner, F.; /Zurich U.; Lipton, R.; Mao, H.S.; /Fermilab; McCarthy, R.; /SUNY, Stony Brook /Kansas State U. /Fermilab

2010-01-01

We report on irradiation studies of Hamamatsu prototype silicon microstrip detectors for layer 1 of the D0 upgrade project for Run IIb. The irradiation was carried out with 10 MeV protons up to proton fluence of 10{sup 14} p/cm{sup 2} at the J.R. Macdonald Laboratory, Manhatten, KS. The flux calibration was carefully checked using different dose normalization techniques. The results based on the obtained sensor leakage currents after irradiation show that the NIEL scaling hypothesis for low energy protons has to be applied with great care. We observe 30-40% less radiation damage in silicon for 10 MeV proton exposure than is expected from the predicted NIEL scaling.

PGC-1α mRNA Level and Oxidative Capacity of the Plantaris Muscle in Rats with Metabolic Syndrome, Hypertension, and Type 2 Diabetes

International Nuclear Information System (INIS)

Nagatomo, Fumiko; Fujino, Hidemi; Kondo, Hiroyo; Gu, Ning; Takeda, Isao; Ishioka, Noriaki; Tsuda, Kinsuke; Ishihara, Akihiko

2011-01-01

We examined the fiber profiles and the mRNA levels of peroxisome proliferator-activated receptors (PPARα and PPARδ/β) and of the PPARγ coactivator-1α (PGC-1α) in the plantaris muscles of 15-week-old control (WR), metabolic syndrome (CP), hypertensive (SHR), and type 2 diabetic (GK) rats. The deep regions in the muscles of SHR and GK rats exhibited lower percentages of high-oxidative type I and IIA fibers and higher percentages of low-oxidative type IIB fibers compared with WR and CP rats. The surface regions in the muscles of CP, SHR, and GK rats exhibited lower percentages of high-oxidative type IIA fibers and higher percentages of low-oxidative type IIB fibers compared with WR rats. The muscles of SHR and GK rats had lower oxidative enzyme activity compared with WR rats. The muscles of SHR rats had the lowest PPARδ/β mRNA level. In addition, the muscles of SHR and GK rats had lower PGC-1α mRNA level compared with WR and CP rats. We concluded that the plantaris muscles of rats with hypertension and type 2 diabetes have lower oxidative capacity, which is associated with the decreased level of PGC-1α mRNA

ANALISIS PENENTUAN HARGA POKOK PRODUKSI DENGAN MENGGUNAKAN METODE TIME DRIVEN ACTIVITY BASED COSTING (TDABC PADA PT IIB

Directory of Open Access Journals (Sweden)

Arfan Bakhtiar

2017-01-01

  PT IIB is a manufacturing companywith major product Carton box packaging and Pulp Tray and Pallet as side products. This products using materials cardboard, scrap paper and wood. Company using calculations with adding material costs, employees’ salary costs in each activity and% profit. The bigsize product need large space, demanding supply system of Just In Time (JIT, is timely in production only to order, if there is an additional need to do overtime. So it takes time calculation standard that can be estimated lead time. So, need a method to determine an accurate cost to unify the cost of each activity, support costs and standard time. The method used is the Time-Driven Activity Based Costing (TDABC. TDABC is a method of formulating the charges on the basis of time, all of the resources used in the production are converted into units of time. The results of this research to acquire all of the costs related to production processes and support costs, gain time standard that is necessary to make three types of products and obtain a calculation of the cost of production for Box RSC Rp 4.006,-, Box DC Rp 4.449,-, Pulp Tray Rp 350,- and Pallet Kayu Rp 155.902,-,and obtain comparative results of the calculation TDABC method and company.

Schwinger type processes via branes and their gravity duals

International Nuclear Information System (INIS)

Gorsky, A.S.; Saraikin, K.A.; Selivanov, K.G.

2002-01-01

We consider Schwinger type processes involving the creation of the charge and monopole pairs in the external fields and propose interpretation of these processes via corresponding brane configurations in type IIB string theory. We suggest simple description of some new interesting nonperturbative processes like monopole/dyon transitions in the electric field and W-boson decay in the magnetic field using the brane language. Nonperturbative pair production in the strong coupling regime using the AdS/CFT correspondence is studied. The treatment of the similar processes in the noncommutative theories when noncommutativity is traded for the background fields is presented and the possible role of the critical magnetic field which is S-dual to the critical electric field is discussed

Composition and cross-sectional area of muscle fibre types in relation to daily gain and lean and fat content of carcass in Landrace and Yorkshire pigs

Directory of Open Access Journals (Sweden)

M. RUUSUNEN

2008-12-01

Full Text Available The muscle fibre-type properties of longissimus were compared between Landrace and Yorkshire breeds and between the sexes in an attempt to shed light on the relationship of these histochemical parameters to animal growth and carcass composition. Muscle fibres were classified into three groups, type I, type IIA and type IIB, using the myosin ATPase method. At a given live weight, the cross-sectional area of type I fibres (CSA I was smaller (p

High frequency of Fredrickson's phenotypes IV and IIb in Brazilians infected by human immunodeficiency virus

Directory of Open Access Journals (Sweden)

Oliveira Helena CF

2005-06-01

Full Text Available Abstract Background Human immunodeficiency virus (HIV infection is very prevalent in Brazil. HIV therapy has been recently associated with coronary heart disease (CHD. Dyslipidemia is a major risk factor for CHD that is frequently described in HIV positive patients, but very few studies have been conducted in Brazilian patients evaluating their lipid profiles. Methods In the present work, we evaluated the frequency and severity of dyslipidemia in 257 Brazilian HIV positive patients. Two hundred and thirty-eight (93% were submitted to antiretroviral therapy (224 treated with protease inhibitors plus nucleoside reverse transcriptase inhibitors, 14 treated only with the latter, 12 naive and 7 had no records of treatment. The average time on drug treatment with antiretroviral therapy was 20 months. None of the patients was under lipid lowering drugs. Cholesterol, triglyceride, phospholipid and free fatty acids were determined by enzymatic colorimetric methods. Lipoprotein profile was estimated by the Friedewald formula and Fredrickson's phenotyping was obtained by serum electrophoresis on agarose. Apolipoprotein B and AI and lipoprotein "a" were measured by nephelometry. Results The Fredrickson phenotypes were: type IIb (51%, IV (41%, IIa (7%. In addition one patient was type III and another type V. Thirty-three percent of all HIV+ patients presented serum cholesterol levels ≥ 200 mg/dL, 61% LDL-cholesterol ≥ 100 mg/dL, 65% HDL-cholesterol below 40 mg/dL, 46% triglycerides ≥ 150 mg/dL and 10% have all these parameters above the limits. Eighty-six percent of patients had cholesterol/HDL-cholesterol ratio ≥ 3.5, 22% increased lipoprotein "a", 79% increased free fatty acids and 9% increased phospholipids. The treatment with protease inhibitors plus nucleoside reverse transcriptase inhibitors increased the levels of cholesterol and triglycerides in these patients when compared with naïve patients. The HDL-cholesterol (p = 0.01 and

Exotic dual of type II double field theory

Directory of Open Access Journals (Sweden)

Eric A. Bergshoeff

2017-04-01

Full Text Available We perform an exotic dualization of the Ramond–Ramond fields in type II double field theory, in which they are encoded in a Majorana–Weyl spinor of O(D,D. Starting from a first-order master action, the dual theory in terms of a tensor–spinor of O(D,D is determined. This tensor–spinor is subject to an exotic version of the (self-duality constraint needed for a democratic formulation. We show that in components, reducing O(D,D to GL(D, one obtains the expected exotically dual theory in terms of mixed Young tableaux fields. To this end, we generalize exotic dualizations to self-dual fields, such as the 4-form in type IIB string theory.

Bitistatin-functionalized fluorescent nanodiamond particles specifically bind to purified human platelet integrin receptor αIIbβ3 and activated platelets

Directory of Open Access Journals (Sweden)

Marcinkiewicz C

2017-05-01

Full Text Available Cezary Marcinkiewicz,1,2 Jonathan A Gerstenhaber,1 Mark Sternberg,2 Peter I Lelkes,1 Giora Feuerstein1,2 1Department of Bioengineering, College of Engineering, Temple University, Philadelphia, 2Debina Diagnostic, Inc., Newton Square, PA, USA Abstract: Thromboembolic events (TEE underwrite key causes of death in developed countries. While advanced imaging technologies such as computed tomography scans serve to diagnose blood clots during acute cardiovascular events, no such technology is available in routine primary care for TEE risk assessment. Here, we describe an imaging platform technology based on bioengineered fluorescent nanodiamond particles (F-NDPs functionalized with bitistatin (Bit, a disintegrin that specifically binds to the αIIbβ3 integrin, platelet fibrinogen receptor (PFR on activated platelets. Covalent linkage of purified Bit to F-NDP was concentration-dependent and saturable, as validated by enzyme-linked immunosorbent assay using specific anti-Bit antibodies. F-NDP–Bit interacted with purified PFR, either in immobilized or soluble form. Lotrafiban, a nonpeptide, αIIbβ3 receptor antagonist, specifically blocked F-NDP–Bit–PFR complex formation. Moreover, F-NDP–Bit specifically binds to activated platelets incorporated into a clot generated by thrombin-activated rat platelet-rich plasma (PRP. Our results suggest that engineered F-NDP–Bit particles could serve as noninvasive, “real-time” optical diagnostics for clots present in blood vessels. Keywords: carbon nanoparticles, blood clots, imaging, platelet fibrinogen receptor, fluorescence, disintegrin, thromboembolic complications, thrombosis

Surgical excision of Essure® devices with ESHRE Class IIb uterine malformation: sequential hysteroscopic-laparoscopic approach to the septate uterus.

Science.gov (United States)

Sills, E S; Palermo, G D

2016-03-28

While contraindications to Essure® placement have been provided by the manufacturer, there is no consensus on how best to remove these contraceptive devices. Here, we describe a non-hysterectomy removal of Essure® for a patient with a septate uterus (ESHRE Class IIb uterine malformation). A 35yr old G4 P2 presented for removal of Essure® implants after three years of gradually increasing pelvic pain, weight gain, headache, dizziness, lower extremity paresthesia, and fatigue which followed hysteroscopic sterilization (HS). Prior to HS, the patient was in good general health. She did not smoke and had never had a miscarriage. HS was performed under general anesthesia in October 2012. HSG obtained three months later, confirmed bilateral tubal occlusion but revealed an abnormal uterine cavity. A repeat HSG in 2015 showed minimal device migration, no contrast dye spill and a deeply bifid uterine cavity. At our center laparoscopic cornual dissection and bilateral partial tubal resection achieved removal of both devices intact and the patient was discharged three hours after surgery. Her postoperative recovery was uneventful. The presence of a Müllerian anomaly is a relative contraindication to the Essure® procedure. This is the first reported description of successful removal of Essure® coils in the setting of an ESHRE Class IIb uterine anomaly, and underscores the importance of careful patient selection, accurate pre-operative imaging and a conservative technique which renders hysterectomy unnecessary.

Treatment of bulky stage IB and IIB cervical cancers with outpatient neutron brachytherapy, external pelvic radiation and extrafascial hysterectomy

International Nuclear Information System (INIS)

Van Nagell, J.R.; Maruyama, Y.; Yoneda, J.; Donaldson, E.S.; Hanson, M.B.; Gallion, H.H.; Powell, D.E.; Kryscio, R.J.

1986-01-01

From January, 1977, to December, 1982, twenty-nine patients with bulky (>4 cms diameter) Stage IB or IIB cervical cancer were treated at the University of Kentucky Medical Center by a combination of out-patient neutron brachytherapy (Cf-252) and external pelvic radiation followed by extrafascial hysterectomy. Residual tumor was present in the hysterectomy specimens of 25 per cent. Complications during and following radiation therapy and surgery were minimal and included vaginal stenosis, proctitis, and hemorrhagic cystitis. The mean duration of hospitalization for surgery in these patients was 6.6 days (range 5-15 days) and postoperative morbidity was low. No patient required blood transfusion. Four patients developed urinary tract infections and two had superficial wound separations. Following treatment, patients were seen at monthly intervals for one year, every three months for two years, and every six months thereafter. No patient has been lost to follow-up. Two patients (7 per cent) developed tumor recurrence and have died of disease (1 of distant metastases; 1 local). The remaining 27 patients (93 per cent) are alive and well with no evidence of disease 24-89 months (mean 48 months) after therapy. No radiogenic fistulae or bowel obstruction were observed. These preliminary results suggest that the combination of outpatient neutron brachytherapy, external pelvic radiation, and extrafascial hysterectomy for patients with Stage IB and IIB cervical cancer is well tolerated. Complications associated with this treatment regimen have been minimal, and the recurrence rate is low. The duration of intracavitary neutron brachytherapy was short, and outpatient therapy was well received by patients

On the effective theory of type II string compactifications on nilmanifolds and coset spaces

International Nuclear Information System (INIS)

Caviezel, Claudio

2009-01-01

In this thesis we analyzed a large number of type IIA strict SU(3)-structure compactifications with fluxes and O6/D6-sources, as well as type IIB static SU(2)-structure compactifications with fluxes and O5/O7-sources. Restricting to structures and fluxes that are constant in the basis of left-invariant one-forms, these models are tractable enough to allow for an explicit derivation of the four-dimensional low-energy effective theory. The six-dimensional compact manifolds we studied in this thesis are nilmanifolds based on nilpotent Lie-algebras, and, on the other hand, coset spaces based on semisimple and U(1)-groups, which admit a left-invariant strict SU(3)- or static SU(2)-structure. In particular, from the set of 34 distinct nilmanifolds we identified two nilmanifolds, the torus and the Iwasawa manifold, that allow for an AdS 4 , N = 1 type IIA strict SU(3)-structure solution and one nilmanifold allowing for an AdS 4 , N = 1 type IIB static SU(2)-structure solution. From the set of all the possible six-dimensional coset spaces, we identified seven coset spaces suitable for strict SU(3)-structure compactifications, four of which also allow for a static SU(2)-structure compactification. For all these models, we calculated the four-dimensional low-energy effective theory using N = 1 supergravity techniques. In order to write down the most general four-dimensional effective action, we also studied how to classify the different disconnected ''bubbles'' in moduli space. (orig.)

Ciprofloxacin DPI: a randomised, placebo-controlled, phase IIb efficacy and safety study on cystic fibrosis.

Science.gov (United States)

Dorkin, Henry L; Staab, Doris; Operschall, Elisabeth; Alder, Jeff; Criollo, Margarita

2015-01-01

Treatment of infective bronchitis involving Pseudomonas aeruginosa is a cornerstone of care in patients with cystic fibrosis (CF). This phase IIb, randomised, double-blind, placebo-controlled study assessed the efficacy and safety of ciprofloxacin dry powder for inhalation (DPI) in this population. Patients with CF, ≥12 years of age (N=286), were randomised to ciprofloxacin DPI (32.5 mg (n=93) or 48.75 mg (n=93)), or corresponding placebo (32.5 mg, n=65; 48.75 mg, n=35) twice daily for 28 days. The primary objective was the change in forced expiratory volume in 1 s (FEV1) from baseline (day 0) to end of treatment (day 29) in the intent-to-treat population for ciprofloxacin DPI compared with the corresponding placebo group. The primary effectiveness objective was not met; there were no significant differences in change in FEV1 between ciprofloxacin DPI and the corresponding placebo group for either dose (p=0.154). However, in pooled analyses, FEV1 decline from baseline to treatment end was significantly lower with ciprofloxacin DPI than with placebo (pooled data; p=0.02). Ciprofloxacin DPI showed positive effects on sputum bacterial load and quality of life, but these effects were not maintained at the 4-week follow-up. Ciprofloxacin DPI was well tolerated and there were no significant differences in type/incidence of treatment-emergent adverse events by treatment group (p=0.115). Further investigations are needed to determine the full scope of the beneficial effects of ciprofloxacin DPI for patients with CF. Clinicaltrials.gov NCT00645788; EudraCT 2008-008314-40.

Ibrutinib Inhibits Platelet Integrin αIIbβ3 Outside-In Signaling and Thrombus Stability But Not Adhesion to Collagen.

Science.gov (United States)

Bye, Alexander P; Unsworth, Amanda J; Vaiyapuri, Sakthivel; Stainer, Alexander R; Fry, Michael J; Gibbins, Jonathan M

2015-11-01

Ibrutinib is an irreversible Bruton tyrosine kinase inhibitor approved for treatment of Waldenstrom macroglobulinemia, chronic lymphocytic leukemia, and mantle cell lymphoma that increases the risk of bleeding among patients. Platelets from ibrutinib-treated patients exhibit deficiencies in collagen-evoked signaling in suspension; however, the significance of this observation and how it relates to bleeding risk is unclear, as platelets encounter immobile collagen in vivo. We sought to clarify the effects of ibrutinib on platelet function to better understand the mechanism underlying bleeding risk. By comparing signaling in suspension and during adhesion to immobilized ligands, we found that the collagen signaling deficiency caused by ibrutinib is milder during adhesion to immobilized collagen. We also found that platelets in whole blood treated with ibrutinib adhered to collagen under arterial shear but formed unstable thrombi, suggesting that the collagen signaling deficiency caused by ibrutinib may not be the predominant cause of bleeding in vivo. However, clot retraction and signaling evoked by platelet adhesion to immobilized fibrinogen were also inhibited by ibrutinib, indicating that integrin αIIbβ3 outside-in signaling is also effected in addition to GPVI signaling. When ibrutinib was combined with the P2Y12 inhibitor, cangrelor, thrombus formation under arterial shear was inhibited additively. These findings suggest that (1) ibrutinib causes GPVI and integrin αIIbβ3 platelet signaling deficiencies that result in formation of unstable thrombi and may contribute toward bleeding observed in vivo and (2) combining ibrutinib with P2Y12 antagonists, which also inhibit thrombus stability, may have a detrimental effect on hemostasis. © 2015 American Heart Association, Inc.

The impact of supersaturation level for oral absorption of BCS class IIb drugs, dipyridamole and ketoconazole, using in vivo predictive dissolution system: Gastrointestinal Simulator (GIS).

Science.gov (United States)

Tsume, Yasuhiro; Matsui, Kazuki; Searls, Amanda L; Takeuchi, Susumu; Amidon, Gregory E; Sun, Duxin; Amidon, Gordon L

2017-05-01

The development of formulations and the assessment of oral drug absorption for Biopharmaceutical Classification System (BCS) class IIb drugs is often a difficult issue due to the potential for supersaturation and precipitation in the gastrointestinal (GI) tract. The physiological environment in the GI tract largely influences in vivo drug dissolution rates of those drugs. Thus, those physiological factors should be incorporated into the in vitro system to better assess in vivo performance of BCS class IIb drugs. In order to predict oral bioperformance, an in vitro dissolution system with multiple compartments incorporating physiologically relevant factors would be expected to more accurately predict in vivo phenomena than a one-compartment dissolution system like USP Apparatus 2 because, for example, the pH change occurring in the human GI tract can be better replicated in a multi-compartmental platform. The Gastrointestinal Simulator (GIS) consists of three compartments, the gastric, duodenal and jejunal chambers, and is a practical in vitro dissolution apparatus to predict in vivo dissolution for oral dosage forms. This system can demonstrate supersaturation and precipitation and, therefore, has the potential to predict in vivo bioperformance of oral dosage forms where this phenomenon may occur. In this report, in vitro studies were performed with dipyridamole and ketoconazole to evaluate the precipitation rates and the relationship between the supersaturation levels and oral absorption of BCS class II weak base drugs. To evaluate the impact of observed supersaturation levels on oral absorption, a study utilizing the GIS in combination with mouse intestinal infusion was conducted. Supersaturation levels observed in the GIS enhanced dipyridamole and ketoconazole absorption in mouse, and a good correlation between their supersaturation levels and their concentration in plasma was observed. The GIS, therefore, appears to represent in vivo dissolution phenomena and

N=1 domain wall solutions of massive type II supergravity as generalized geometries

International Nuclear Information System (INIS)

Louis, J.

2006-05-01

We study N=1 domain wall solutions of type IIB supergravity compactified on a Calabi-Yau manifold in the presence of RR and NS electric and magnetic fluxes. We show that the dynamics of the scalar fields along the direction transverse to the domain wall is described by gradient flow equations controlled by a superpotential W. We then provide a geometrical interpretation of the gradient flow equations in terms of the mirror symmetric compactification of type IIA. They correspond to a set of generalized Hitchin flow equations of a manifold with SU(3) x SU(3)structure which is fibered over the direction transverse to the domain wall. (Orig.)

Deficiencies in both starch synthase IIIa and branching enzyme IIb lead to a significant increase in amylose in SSIIa-inactive japonica rice seeds.

Science.gov (United States)

Asai, Hiroki; Abe, Natsuko; Matsushima, Ryo; Crofts, Naoko; Oitome, Naoko F; Nakamura, Yasunori; Fujita, Naoko

2014-10-01

Starch synthase (SS) IIIa has the second highest activity of the total soluble SS activity in developing rice endosperm. Branching enzyme (BE) IIb is the major BE isozyme, and is strongly expressed in developing rice endosperm. A mutant (ss3a/be2b) was generated from wild-type japonica rice which lacks SSIIa activity. The seed weight of ss3a/be2b was 74-94% of that of the wild type, whereas the be2b seed weight was 59-73% of that of the wild type. There were significantly fewer amylopectin short chains [degree of polymerization (DP) ≤13] in ss3a/be2b compared with the wild type. In contrast, the amount of long chains (DP ≥25) connecting clusters of amylopectin in ss3a/be2b was higher than in the wild type and lower than in be2b. The apparent amylose content of ss3a/be2b was 45%, which was >1.5 times greater than that of either ss3a or be2b. Both SSIIIa and BEIIb deficiencies led to higher activity of ADP-glucose pyrophosphorylase (AGPase) and granule-bound starch synthase I (GBSSI), which partly explains the high amylose content in the ss3a/be2b endosperm. The percentage apparent amylose content of ss3a and ss3a/be2b at 10 days after flowering (DAF) was higher than that of the wild type and be2b. At 20 DAF, amylopectin biosynthesis in be2b and ss3a/be2b was not observed, whereas amylose biosynthesis in these lines was accelerated at 30 DAF. These data suggest that the high amylose content in the ss3a/be2b mutant results from higher amylose biosynthesis at two stages, up to 20 DAF and from 30 DAF to maturity. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Scintigraphic detection of acute experimental endocarditis with the technetium-99m labelled glycoprotein IIb/IIIa receptor antagonist DMP444

Energy Technology Data Exchange (ETDEWEB)

Oyen, W.J.G.; Boerman, O.C.; Corstens, F.H.M. [Department of Nuclear Medicine, University Hospital Nijmegen, Nijmegen (Netherlands); Brouwers, F.M. [Department of Nuclear Medicine, University Hospital Nijmegen, Nijmegen (Netherlands); Department of Internal Medicine, University Hospital Nijmegen, Nijmegen (Netherlands); Barrett, J.A. [DuPont Pharmaceutical Company, Radiopharmaceutical Division, North Billerica, MA (United States); Verheugt, F.W.A. [Department of Cardiology, University Hospital Nijmegen, Nijmegen (Netherlands); Ruiter, D.J. [Department of Pathology, University Hospital Nijmegen, Nijmegen (Netherlands); Meer, J.W.M. van der [Department of Internal Medicine, University Hospital Nijmegen, Nijmegen (Netherlands)

2000-04-01

Bacterial endocarditis is an important clinical problem that may result in persistent bacteraemia and irreversible cardiac damage. Since endocarditis is characterized by aggregation of activated platelets, fibrin and bacteria, we studied DMP444, a technetium-99m labelled high-affinity antagonist of the GP IIb/IIIa receptor that is expressed on activated platelets. In seven Beagle dogs (11-15 kg), the left ventricle was catheterized via the right carotid artery. One hour later, 5 x 10{sup 7} colony forming units of Staphylococcus aureus were injected intracardially. Half an hour later, the catheter was removed. Two extra dogs underwent a complete sham procedure. One day after the intervention, five infected and the two non-infected dogs were injected with 37 MBq/kg {sup 99m}Tc-DMP444 and two infected dogs with 37 MBq/kg {sup 99m}Tc-IgG (used as a non-specific control agent) and imaged up to 4 h after injection. Samples were obtained for tissue counting, microbiology and histology. From 1 to 2 h post injection onward, there was clear focal accumulation of DMP444 in the aortic valve region when endocarditis was present, and this accumulation increased with time. The non-infected and the {sup 99m}Tc-IgG injected dogs showed only persisting blood pool activity without any focal abnormality. At 4 h post injection, the in vivo valve-to-blood pool ratios were 1.87{+-}0.18 in endocarditis, 1.01{+-}0.05 in non-infected controls and 1.09{+-}0.02 in {sup 99m}Tc-IgG injected dogs (P<0.05). It is concluded that targeting activated platelets with the {sup 99m}Tc-labelled GP IIb/IIIa antagonist DMP444 allows a final diagnosis of experimental bacterial endocarditis within 4 h owing to high, specific and fast in vivo uptake. (orig.)

Scintigraphic detection of acute experimental endocarditis with the technetium-99m labelled glycoprotein IIb/IIIa receptor antagonist DMP444

International Nuclear Information System (INIS)

Oyen, W.J.G.; Boerman, O.C.; Corstens, F.H.M.; Brouwers, F.M.; Barrett, J.A.; Verheugt, F.W.A.; Ruiter, D.J.; Meer, J.W.M. van der

2000-01-01

Bacterial endocarditis is an important clinical problem that may result in persistent bacteraemia and irreversible cardiac damage. Since endocarditis is characterized by aggregation of activated platelets, fibrin and bacteria, we studied DMP444, a technetium-99m labelled high-affinity antagonist of the GP IIb/IIIa receptor that is expressed on activated platelets. In seven Beagle dogs (11-15 kg), the left ventricle was catheterized via the right carotid artery. One hour later, 5 x 10 7 colony forming units of Staphylococcus aureus were injected intracardially. Half an hour later, the catheter was removed. Two extra dogs underwent a complete sham procedure. One day after the intervention, five infected and the two non-infected dogs were injected with 37 MBq/kg 99m Tc-DMP444 and two infected dogs with 37 MBq/kg 99m Tc-IgG (used as a non-specific control agent) and imaged up to 4 h after injection. Samples were obtained for tissue counting, microbiology and histology. From 1 to 2 h post injection onward, there was clear focal accumulation of DMP444 in the aortic valve region when endocarditis was present, and this accumulation increased with time. The non-infected and the 99m Tc-IgG injected dogs showed only persisting blood pool activity without any focal abnormality. At 4 h post injection, the in vivo valve-to-blood pool ratios were 1.87±0.18 in endocarditis, 1.01±0.05 in non-infected controls and 1.09±0.02 in 99m Tc-IgG injected dogs (P 99m Tc-labelled GP IIb/IIIa antagonist DMP444 allows a final diagnosis of experimental bacterial endocarditis within 4 h owing to high, specific and fast in vivo uptake. (orig.)

A peptide affinity column for the identification of integrin alpha IIb-binding proteins.

Science.gov (United States)

Daxecker, Heide; Raab, Markus; Bernard, Elise; Devocelle, Marc; Treumann, Achim; Moran, Niamh

2008-03-01

To understand the regulation of integrin alpha(IIb)beta(3), a critical platelet adhesion molecule, we have developed a peptide affinity chromatography method using the known integrin regulatory motif, LAMWKVGFFKR. Using standard Fmoc chemistry, this peptide was synthesized onto a Toyopearl AF-Amino-650 M resin on a 6-aminohexanoic acid (Ahx) linker. Peptide density was controlled by acetylation of 83% of the Ahx amino groups. Four recombinant human proteins (CIB1, PP1, ICln and RN181), previously identified as binding to this integrin regulatory motif, were specifically retained by the column containing the integrin peptide but not by a column presenting an irrelevant peptide. Hemoglobin, creatine kinase, bovine serum albumin, fibrinogen and alpha-tubulin failed to bind under the chosen conditions. Immunodetection methods confirmed the binding of endogenous platelet proteins, including CIB1, PP1, ICln RN181, AUP-1 and beta3-integrin, from a detergent-free platelet lysate. Thus, we describe a reproducible method that facilitates the reliable extraction of specific integrin-binding proteins from complex biological matrices. This methodology may enable the sensitive and specific identification of proteins that interact with linear, membrane-proximal peptide motifs such as the integrin regulatory motif LAMWKVGFFKR.

A family with autosomal dominant mutilating neuropathy not linked to either Charcot-Marie-Tooth disease type 2B (CMT2B) or hereditary sensory neuropathy type I (HSN I) loci.

Science.gov (United States)

Bellone, Emilia; Rodolico, Carmelo; Toscano, Antonio; Di Maria, Emilio; Cassandrini, Denise; Pizzuti, Antonio; Pigullo, Simona; Mazzeo, Anna; Macaione, Vincenzo; Girlanda, Paolo; Vita, Giuseppe; Ajmar, Franco; Mandich, Paola

2002-03-01

Sensory loss and ulcero-mutilating features have been observed in hereditary sensory neuropathy type I and in hereditary motor and sensory neuropathy type IIB, also referred as Charcot-Marie-Tooth disease type 2B. To date two loci associated with ulcero-mutilating neuropathy have been described: CMT2B at 3q13-q22 and HSN I at 9q22.1-q22.3. We performed linkage analysis with chromosomal markers representing the hereditary sensory neuropathy type I and Charcot-Marie-Tooth disease type 2B loci on an Italian family with a severe distal sensory loss leading to an ulcero-mutilating peripheral neuropathy. Negative likelihood-of-odds scores excluded any evidence of linkage to both chromosome 3q13 and chromosome 9q22 markers, confirming the genetic heterogeneity of this clinical entity and the presence of a third locus responsible for ulcero-mutilating neuropathies.

A volumetric analysis of GTVD and CTVHR as defined by the GEC ESTRO recommendations in FIGO stage IIB and IIIB cervical cancer patients treated with IGABT in a prospective multicentric trial (EMBRACE)

DEFF Research Database (Denmark)

Jastaniyah, Noha; Yoshida, Kenji; Tanderup, Kari

2016-01-01

PURPOSE: To quantify the gross tumor volume at diagnosis (GTVD) and high-risk clinical target volume (CTVHR) at brachytherapy (BT) and describe subgroups of patients with different patterns of response to chemoradiotherapy (CRT) in patients with FIGO stage IIB and IIIB cervical cancer treated wit...

THE YELLOW SUPERGIANT PROGENITOR OF THE TYPE II SUPERNOVA 2011dh IN M51

International Nuclear Information System (INIS)

Maund, J. R.; Fraser, M.; Smartt, S. J.; Kotak, R.; Magill, L.; Ergon, M.; Sollerman, J.; Pastorello, A.; Benetti, S.; Botticella, M.-T.; Valenti, S.; Bufano, F.; Danziger, I. J.; Stephens, A. W.

2011-01-01

We present the detection of the putative progenitor of the Type IIb SN 2011dh in archival pre-explosion Hubble Space Telescope images. Using post-explosion Adaptive Optics imaging with Gemini NIRI+ALTAIR, the position of the supernova (SN) in the pre-explosion images was determined to within 23 mas. The progenitor candidate is consistent with an F8 supergiant star (logL/L sun = 4.92 ± 0.20 and T eff = 6000 ± 280 K). Through comparison with stellar evolution tracks, this corresponds to a single star at the end of core C-burning with an initial mass of M ZAMS = 13 ± 3 M sun . The possibility of the progenitor source being a cluster is rejected, on the basis of: (1) the source not being spatially extended, (2) the absence of excess Hα emission, and (3) the poor fit to synthetic cluster spectral energy distributions (SEDs). It is unclear if a binary companion is contributing to the observed SED, although given the excellent correspondence of the observed photometry to a single star SED we suggest that the companion does not contribute significantly. Early photometric and spectroscopic observations show fast evolution similar to the transitional Type IIb SN 2008ax and suggest that a large amount of the progenitor's hydrogen envelope was removed before explosion. Late-time observations will reveal if the yellow supergiant or the putative companion star were responsible for this SN explosion.

"STUDY OF CONCURRENT CISPLATIN AND EXTERNAL RADIOTHERAPY PRIOR TO RADICAL HYSTERECTOMY AND LYMPHADENECTOMY IN PATIENTS WITH STAGE IB-IIB CERVICAL CANCER"

Directory of Open Access Journals (Sweden)

M. Modares Gilani

2004-06-01

Full Text Available The purpose of this study was to describe the feasibility of a combined preoperative chemoradiation program Ib-IIa, bulky and suspicious IIb by radical surgery in patients with stage Ib-IIb cervical cancer. From September 1999 to April 2002, 30 patients with carcinoma of the cervix were treated with preoperative external beam radiotherapy of 45 Gy in 5 weeks. Patients received concurrent continuous infusion of cisplatin 50 mg/m2 for one day in week during 5 weeks of radiation. Radical surgery was performed 4-6 weeks after completion of the preoperative treatment. Toxicity with chemoradiation was usually mild. Two patients developed vesicovaginal fistula, and four developed long-term hydronephrosis that needed ureteral stenting. Clinical response was observed in 100% of the patients (23.7% complete response. The analysis of the surgical specimens revealed complete pathological response in 43.3% of the cases and partial pathological response in 56.7%. The degree of pathological response was not predictable by the degree of clinical response. Thirty months disease-free survival and overall survival were 66.3% and 77.31%, respectively. Patients with complete and partial pathological response were not significantly different in terms of disease-free survival (p= 0.08 and overall survival (p= 0.3. Cisplatin in preoperative chemoradiation is effective and usually welltolerated in bulky cervical cancer and parametrial invasion, inducing a high rate of clinical and pathological complete responses. When this therapy is followed by radical surgery, disease-free and overall survival rates are higher. The latter may be possible only through extensive surgical resection with a parallel increase in complication rates.

Chern-Simons couplings for dielectric F-strings in matrix string theory

International Nuclear Information System (INIS)

Brecher, Dominic; Janssen, Bert; Lozano, Yolanda

2002-01-01

We compute the non-abelian couplings in the Chern-Simons action for a set of coinciding fundamental strings in both the type IIA and type IIB Matrix string theories. Starting from Matrix theory in a weakly curved background, we construct the linear couplings of closed string fields to type IIA Matrix strings. Further dualities give a type IIB Matrix string theory and a type IIA theory of Matrix strings with winding. (Abstract Copyright[2002], Wiley Periodicals, Inc.)

RUNX1-induced silencing of non-muscle myosin heavy chain IIB contributes to megakaryocyte polyploidization.

Science.gov (United States)

Lordier, Larissa; Bluteau, Dominique; Jalil, Abdelali; Legrand, Céline; Pan, Jiajia; Rameau, Philippe; Jouni, Dima; Bluteau, Olivier; Mercher, Thomas; Leon, Catherine; Gachet, Christian; Debili, Najet; Vainchenker, William; Raslova, Hana; Chang, Yunhua

2012-03-06

Megakaryocytes are unique mammalian cells that undergo polyploidization (endomitosis) during differentiation, leading to an increase in cell size and protein production that precedes platelet production. Recent evidence demonstrates that endomitosis is a consequence of a late failure in cytokinesis associated with a contractile ring defect. Here we show that the non-muscle myosin IIB heavy chain (MYH10) is expressed in immature megakaryocytes and specifically localizes in the contractile ring. MYH10 downmodulation by short hairpin RNA increases polyploidization by inhibiting the return of 4N cells to 2N, but other regulators, such as of the G1/S transition, might regulate further polyploidization of the 4N cells. Conversely, re-expression of MYH10 in the megakaryocytes prevents polyploidization and the transition of 2N to 4N cells. During polyploidization, MYH10 expression is repressed by the major megakaryocyte transcription factor RUNX1. Thus, RUNX1-mediated silencing of MYH10 is required for the switch from mitosis to endomitosis, linking polyploidization with megakaryocyte differentiation.

Contribution of Lateral Column Lengthening to Correction of Forefoot Abduction in Stage IIb Adult Acquired Flatfoot Deformity Reconstruction.

Science.gov (United States)

Chan, Jeremy Y; Greenfield, Stephen T; Soukup, Dylan S; Do, Huong T; Deland, Jonathan T; Ellis, Scott J

2015-12-01

Correction of forefoot abduction in stage IIb adult acquired flatfoot likely depends on the amount of lateral column lengthening (LCL) performed, although this represents only one aspect of a successful reconstruction. The purpose of this study was to evaluate the correlation between common reconstructive variables and the observed change in forefoot abduction. Forty-one patients who underwent flatfoot reconstruction involving an Evans-type LCL were assessed retrospectively. Preoperative and postoperative anteroposterior (AP) radiographs of the foot at a minimum of 40 weeks (mean, 2 years) after surgery were reviewed to determine correction in forefoot abduction as measured by talonavicular coverage (TNC) angle, talonavicular uncoverage percent, talus-first metatarsal (T-1MT) angle, and lateral incongruency angle. Fourteen demographic and intraoperative variables were evaluated for association with change in forefoot abduction including age, gender, height, weight, body mass index, as well as the amount of LCL and medializing calcaneal osteotomy performed, LCL graft type, Cotton osteotomy, first tarsometatarsal fusion, flexor digitorum longus transfer, spring ligament repair, gastrocnemius recession and any one of the modified McBride/Akin/Silver procedures. Two variables significantly affected the change in lateral incongruency angle. These were weight (P = .04) and the amount of LCL performed (P < .001). No variables were associated with the change in TNC angle, talonavicular uncoverage percent, or T-1MT angle. Multivariate regression analysis revealed that LCL was the only significant predictor of the change in lateral incongruency angle. The final regression model for LCL showed a good fit (R2 = 0.70, P < .001). Each millimeter of LCL corresponded to a 6.8-degree change in lateral incongruency angle. Correction of forefoot abduction in flatfoot reconstruction was primarily determined by the LCL procedure and could be modeled linearly. We believe that the

Preoperative radiotherapy with high dose rate brachytherapy in the treatment of stage IIB cervix cancer. A retrospective analysis of histological specimens

International Nuclear Information System (INIS)

Ferrigno, Robson; Trippe, N; Novaes, P.E.; Brandani, I.B.; Hanriot, R.; Souza, L.M.; Pellizzon, A.C.; Salvajoli, J.V.; Baraldi, H.E.; Maia, M.A.; Fogaroli, R.C.

1996-01-01

Purpose/Objective: To evaluate the histological specimens of the stage IIB cervix cancer patients who were treated by preoperative radiotherapy with external beam radiotherapy (EBRT) and high dose rate (HDR) brachytherapy. Materials and Methods: From August 1992 to August 1995, 32 patients with stage IIB cervix cancer were underwent to preoperative radiotherapy. All patients received EBRT at the whole pelvis with total dose of 45Gy in 25 fractions of 1,8Gy through a 4 MV linear accelerator. The HDR brachytherapy was realized through a Micro-Selectron device, working with Iridium-192 with initial activity of 10 Ci. The prescribed dose was 6,0Gy at point A, defined by the Manchester, system in 2 weekly insertions during the course of EBRT. The insertions were done by the Fletcher colpostats in association with intrauterine tandem. Four to six weeks after the end of radiotherapy, the patients were underwent to Total Hysterectomy and Salpingoforectomy through Piver second level technique. The uterine specimens were histologically analysed with attention to residual disease at the cervix and lymph nodes status. Results: The histological analysis showed that 19 (59,4%) patients had no residual tumor at the cervix while 13 (40,6%) had microscopic residual tumor. The lymph nodes were negative in 30 (93,8%) patients and positive in 2 (6,3%). All positive lymph nodes patients also had microscopic residual tumor at the cervix. With the follow up ranging from six to 42 months and medium of 21 months, 29 (90,6%) patients are alive with no evidence of disease, one (5,6%) is alive with local recurrence and two (6,2%) have died due to the progression of local disease. Of the 19 patients with negative specimens, 18 (94,7%) are alive with no evidence of disease and of the 13 patients with positive specimens, 11 (84,6%) are alive with no evidence of disease. Local recurrence occurred in two patients with positive specimens and in one with negative. These differences are not

Improvement of Endurance Based on Muscle Fiber-Type Composition by Treatment with Dietary Apple Polyphenols in Rats.

Science.gov (United States)

Mizunoya, Wataru; Miyahara, Hideo; Okamoto, Shinpei; Akahoshi, Mariko; Suzuki, Takahiro; Do, Mai-Khoi Q; Ohtsubo, Hideaki; Komiya, Yusuke; Lan, Mu; Waga, Toshiaki; Iwata, Akira; Nakazato, Koichi; Ikeuchi, Yoshihide; Anderson, Judy E; Tatsumi, Ryuichi

2015-01-01

A recent study demonstrated a positive effect of apple polyphenol (APP) intake on muscle endurance of young-adult animals. While an enhancement of lipid metabolism may be responsible, in part, for the improvement, the contributing mechanisms still need clarification. Here we show that an 8-week intake of 5% (w/w) APP in the diet, up-regulates two features related to fiber type: the ratio of myosin heavy chain (MyHC) type IIx/IIb and myoglobin protein expression in plantaris muscle of 9-week-old male Fischer F344 rats compared to pair-fed controls (P strategy for application in animal sciences, and human sports and age-related health sciences.

Une fosse du Bronze final IIb dans le Val d’Orléans à Sandillon (Loiret : données archéologiques et contexte environnemental A Late Bronze Age pit IIb in the Val d’Orléans at Sandillon (Loiret: archaeological data and environmental context

Directory of Open Access Journals (Sweden)

Hélène Froquet

2008-06-01

Full Text Available Un diagnostic archéologique réalisé en 2004 à Sandillon (Loiret a permis la découverte d’une occupation du Bronze final IIb dans la plaine alluviale de la Loire. Les structures sont peu nombreuses, mais une fosse se distingue par un ensemble céramique exceptionnel par sa richesse, sa conservation et la présence de formes encore inconnues en région Centre. Ce corpus céramique, corrélé par une datation par radiocarbone, offre désormais un jalon fiable pour la région. Par ailleurs, ces vestiges ont pu être replacés dans leur environnement immédiat grâce à une étude géomorphologique et à l’analyse des restes carpologiques contenus dans la fosse. Ainsi, le croisement des données permet de tenter une approche paléo environnementale sur une occupation en contexte fluviatile et de préciser les relations entre l’homme et son milieu durant cette période chronologique.An archaeological diagnostic carried out in 2004 at Sandillon (Loiret enabled the discovery of a final Bronze Age IIb occupation in the alluvial Loire valley. There are few structures but one pit is noteworthy for a ceramic collection, exceptional in its abundance, its preservation and the presence of previously unknown forms in the Centre region. This ceramic corpus, dated by radiocarbon, henceforth provides a reliable standard for the region. Moreover, these relics could be set in their immediate environment thanks to a geomorphological study and to the analysis of carpological remains contained in the pit. So, the crossing of data allows us to attempt an environmental paleolithic approach to an occupation in a freshwater context and to clarify the relationship between man and his environment in this chronological period.

Type II heat-labile enterotoxins from 50 diverse Escherichia coli isolates belong almost exclusively to the LT-IIc family and may be prophage encoded.

Directory of Open Access Journals (Sweden)

Michael G Jobling

Full Text Available Some enterotoxigenic Escherichia coli (ETEC produce a type II heat-labile enterotoxin (LT-II that activates adenylate cyclase in susceptible cells but is not neutralized by antisera against cholera toxin or type I heat-labile enterotoxin (LT-I. LT-I variants encoded by plasmids in ETEC from humans and pigs have amino acid sequences that are ≥ 95% identical. In contrast, LT-II toxins are chromosomally encoded and are much more diverse. Early studies characterized LT-IIa and LT-IIb variants, but a novel LT-IIc was reported recently. Here we characterized the LT-II encoding loci from 48 additional ETEC isolates. Two encoded LT-IIa, none encoded LT-IIb, and 46 encoded highly related variants of LT-IIc. Phylogenetic analysis indicated that the predicted LT-IIc toxins encoded by these loci could be assigned to 6 subgroups. The loci corresponding to individual toxins within each subgroup had DNA sequences that were more than 99% identical. The LT-IIc subgroups appear to have arisen by multiple recombinational events between progenitor loci encoding LT-IIc1- and LT-IIc3-like variants. All loci from representative isolates encoding the LT-IIa, LT-IIb, and each subgroup of LT-IIc enterotoxins are preceded by highly-related genes that are between 80 and 93% identical to predicted phage lysozyme genes. DNA sequences immediately following the B genes differ considerably between toxin subgroups, but all are most closely related to genomic sequences found in predicted prophages. Together these data suggest that the LT-II loci are inserted into lambdoid type prophages that may or may not be infectious. These findings raise the possibility that production of LT-II enterotoxins by ETEC may be determined by phage conversion and may be activated by induction of prophage, in a manner similar to control of production of Shiga-like toxins by converting phages in isolates of enterohemmorhagic E. coli.

Impact of time to treatment on the effects of bivalirudin vs. glycoprotein IIb/IIIa inhibitors and heparin in patients undergoing primary percutaneous coronary intervention

DEFF Research Database (Denmark)

Schoos, Mikkel; De Luca, Giuseppe; Dangas, George D

2016-01-01

AIMS: In the HORIZONS-AMI trial, bivalirudin compared to unfractionated heparin (UFH) plus a glycoprotein IIb/IIIa inhibitor (GPI) improved net clinical outcomes in patients undergoing primary percutaneous coronary intervention (PCI) at the cost of an increased rate of acute stent thrombosis. We...... sought to examine whether these effects are dependent on time to treatment. METHODS AND RESULTS: The interaction between anticoagulation regimen and symptom onset to first balloon inflation time (SBT) on the 30-day and three-year rates of major adverse cardiac events (MACE) was examined in 3...

[Types of dislipidemia in children with metabolic syndrome].

Science.gov (United States)

Hromnats'ka, N M

2014-01-01

To study dyslipidemia types in children with metabolic syndrome. From 1520 children of total population 155 children aged from 9 to 18 years were selected, who formed 2 groups: 1 group--85 children with metabolic syndrome, 2 group--54 children with normal body mass. Anthropometry, blood pressure measurement, estimation of total cholesterol, low density cholesterol, very low density cholesterol, high density cholesterol, tryglicerides in blood were done. The total cholesterol level was 1,1 times higher (p = 0.001), low density cholesterol 1,4 times higher (p = 0.001), very low density cholesterol 1,1 times higher (p= 0.015), tryglicerides 1,1 times higher (p = 0.020) in children with metabolic syndrome than in children of control group. In children with metabolic syndrome sensitively more often IIa, IV dislipidemia types and isolated hypercholesterolemia and less often IIb, III dislipidemia types and high density cholesterol isolated decrease were diagnosed. So children with metabolic syndrome were characterized by atherogenic types of dislipidemias which determine early atherosclerosis development. Children with metabolic syndrome must be examined on the lipid metabolism violation with the aim of its prevention and correction.

A pilot study: sequential gemcitabine/cisplatin and icotinib as induction therapy for stage IIB to IIIA non-small-cell lung adenocarcinoma

Science.gov (United States)

2013-01-01

Background A phase II clinical trial previously evaluated the sequential administration of erlotinib after chemotherapy for advanced non-small-cell lung cancer (NSCLC). This current pilot study assessed the feasibility of sequential induction therapy in patients with stage IIB to IIIA NSCLC adenocarcinoma. Methods Patients received gemcitabine 1,250 mg/m2 on days 1 and 8 and cisplatin 75 mg/m2 on day 1, followed by oral icotinib (125 mg, three times a day) on days 15 to 28. A repeatcomputed tomography(CT) scan evaluated the response to the induction treatment after two 4-week cycles and eligible patients underwent surgical resection. The primary objective was to assess the objective response rate (ORR), while EGFR and KRAS mutations and mRNA and protein expression levels of ERCC1 and RRM1 were analyzed in tumor tissues and blood samples. Results Eleven patients, most with stage IIIA disease, completed preoperative treatment. Five patients achieved partial response according to the Response Evaluation Criteria in Solid Tumors (RECIST) criteria (ORR=45%) and six patients underwent resection. Common toxicities included neutropenia, alanine transaminase (ALT) elevation, fatigue, dry skin, rash, nausea, alopecia and anorexia. No serious complications were recorded perioperatively. Three patients had exon 19 deletions and those with EGFR mutations were more likely to achieve a clinical response (P= 0.083). Furthermore, most cases who achieved a clinical response had low levels of ERCC1 expression and high levels of RRM1. Conclusions Two cycles of sequentially administered gemcitabine/cisplatin with icotinib as an induction treatment is a feasible and efficacious approach for stage IIB to IIIA NSCLC adenocarcinoma, which provides evidence for the further investigation of these chemotherapeutic and molecularly targeted therapies. PMID:23621919

Generalized N=1 orientifold compactifications and the Hitchin functionals

International Nuclear Information System (INIS)

Benmachiche, Iman; Grimm, Thomas W.

2006-01-01

The four-dimensional N=1 supergravity theories arising in compactifications of type IIA and type IIB on generalized orientifold backgrounds with background fluxes are discussed. The Kahler potentials are derived for reductions on SU(3) structure orientifolds and shown to consist of the logarithm of the two Hitchin functionals. These are functions of even and odd forms parameterizing the geometry of the internal manifold, the B-field and the dilaton. The superpotentials induced by background fluxes and the non-Calabi-Yau geometry are determined by a reduction of the type IIA and type IIB fermionic actions on SU(3) and generalized SU(3)xSU(3) manifolds. Mirror spaces of Calabi-Yau orientifolds with electric and part of the magnetic NS-NS fluxes are conjectured to be certain SU(3)xSU(3) structure manifolds. Evidence for this identification is provided by comparing the generalized type IIA and type IIB superpotentials

Does the Modified Gartland Classification Clarify Decision Making?

Science.gov (United States)

Leung, Sophia; Paryavi, Ebrahim; Herman, Martin J; Sponseller, Paul D; Abzug, Joshua M

2018-01-01

The modified Gartland classification system for pediatric supracondylar fractures is often utilized as a communication tool to aid in determining whether or not a fracture warrants operative intervention. This study sought to determine the interobserver and intraobserver reliability of the Gartland classification system, as well as to determine whether there was agreement that a fracture warranted operative intervention regardless of the classification system. A total of 200 anteroposterior and lateral radiographs of pediatric supracondylar humerus fractures were retrospectively reviewed by 3 fellowship-trained pediatric orthopaedic surgeons and 2 orthopaedic residents and then classified as type I, IIa, IIb, or III. The surgeons then recorded whether they would treat the fracture nonoperatively or operatively. The κ coefficients were calculated to determine interobserver and intraobserver reliability. Overall, the Wilkins-modified Gartland classification has low-moderate interobserver reliability (κ=0.475) and high intraobserver reliability (κ=0.777). A low interobserver reliability was found when differentiating between type IIa and IIb (κ=0.240) among attendings. There was moderate-high interobserver reliability for the decision to operate (κ=0.691) and high intraobserver reliability (κ=0.760). Decreased interobserver reliability was present for decision to operate among residents. For fractures classified as type I, the decision to operate was made 3% of the time and 27% for type IIa. The decision was made to operate 99% of the time for type IIb and 100% for type III. There is almost full agreement for the nonoperative treatment of Type I fractures and operative treatment for type III fractures. There is agreement that type IIb fractures should be treated operatively and that the majority of type IIa fractures should be treated nonoperatively. However, the interobserver reliability for differentiating between type IIa and IIb fractures is low. Our results

Stability of 4-dimensional space-time from the IIB matrix model via the improved mean field approximation

International Nuclear Information System (INIS)

Aoyama, Tatsumi; Kawai, Hikaru; Shibusa, Yuuichiro

2006-01-01

We investigate the origin of our four-dimensional space-time by considering dynamical aspects of the IIB matrix model using the improved mean field approximation. Previous works have focused on the specific choices of configurations as ansatz which preserve SO(d) rotational symmetry. In this report, an extended ansatz is proposed and examined up to a third-order approximation which includes both the SO(4) ansatz and the SO(7) ansatz in their respective limits. From the solutions of the self-consistency condition represented by the extrema of the free energy of the system, it is found that some of the solutions found in the SO(4) or SO(7) ansatz disappear in the extended ansatz. This implies that the extension of ansatz can be used to distinguish stable solutions from unstable solutions. It is also found that there is a non-trivial accumulation of extrema including the SO(4)-preserving solution, which may lead to the formation of a plateau. (author)

Assessment of Parametrial Response by Growth Pattern in Patients With International Federation of Gynecology and Obstetrics Stage IIB and IIIB Cervical Cancer: Analysis of Patients From a Prospective, Multicenter Trial (EMBRACE)

Energy Technology Data Exchange (ETDEWEB)

Yoshida, Kenji [Medical University of Vienna, Comprehensive Cancer Center, Vienna (Austria); Kobe University Graduate School of Medicine, Kobe (Japan); Jastaniyah, Noha [Medical University of Vienna, Comprehensive Cancer Center, Vienna (Austria); King Faisal Specialist Hospital and Research Center, Riyadh (Saudi Arabia); Sturdza, Alina, E-mail: alina.sturdza@akhwien.at [Medical University of Vienna, Comprehensive Cancer Center, Vienna (Austria); Lindegaard, Jacob [Aarhus University Hospital, Aarhus (Denmark); Segedin, Barbara [Institute of Oncology Ljubljana, Ljubljana (Slovenia); Mahantshetty, Umesh [Tata Memorial Hospital, Mumbai (India); Rai, Bhavana [Post Graduate Institute of Medical Education and Research, Chandigarh (India); Jürgenliemk-Schulz, Ina [University Medical Center, Utrecht (Netherlands); Haie-Meder, Christine [Institut Gustave Roussy, Paris (France); Sasaki, Ryohei [Kobe University Graduate School of Medicine, Kobe (Japan); Pötter, Richard [Medical University of Vienna, Comprehensive Cancer Center, Vienna (Austria)

2015-11-15

Purpose: To assess disease response along the parametrial space according to tumor morphology in patients with International Federation of Gynecology and Obstetrics (FIGO) stage IIB and IIIB cervical cancer at the time of image-guided adaptive brachytherapy. Methods and Materials: Patients with FIGO stage IIB and IIIB cervical cancer registered as of November 2013 in the EMBRACE study were evaluated. Tumors were stratified according to morphologic subtype on magnetic resonance imaging (expansive and infiltrative), and the characteristics of those subtypes were analyzed. Parametrial involvement at diagnosis and at brachytherapy was evaluated, and the response to chemo-radiotherapy was classified as good, moderate, or poor. The response grade was compared between the 2 groups and analyzed with regard to tumor volumes, and dosimetric parameters. Results: A total of 452 patients were evaluated, of whom 186 had expansive growth type and 266 had infiltrative morphology. Patients with infiltrative tumors had more extensive disease, as indicated by a higher rate of FIGO stage IIIB disease, as well as radiologic evidence of extension into the distal parametrial space and to the pelvic side wall on magnetic resonance imaging. Cervical necrosis was more common in the infiltrative group. Good response was more common in the expansive group (34% vs 24%; P=.02), and poor response was more common in the infiltrative group (11% and 19%; P=.02). Mean gross tumor volume at diagnosis was equal in both groups (51.7 cm{sup 3}). The high-risk clinical target volume was larger in infiltrative tumors (37.9 cm{sup 3} vs 33.3 cm{sup 3}, P=.005). The mean high-risk clinical target volume D{sub 90} was slightly higher in expansive tumors (92.7 Gy and 89.4 Gy, P<.001). Conclusion: Infiltrative tumors are more advanced at presentation and respond less favorably to chemo-radiotherapy when compared with expansive tumors that are more or less equivalent in size. The use of image

Comparison of one and two low dose rate brachytherapy insertions in the treatment of stage IIB cervix cancer with radiation therapy alone

International Nuclear Information System (INIS)

Ferrigno, Robson; Faria, S.L.C.O.

1996-01-01

Purpose/Objective: To compare one and two intracavitary brachytherapy with low dose rate in the management of stage IIB cervix cancer through a prospective and randomized trial. Materials and Methods: From September 1989 to December 1992, 81 patients with stage IIB cervix cancer were randomized in two arms according to the number of intracavitary brachytherapy insertion to be realized. Of these, 34 were treated by two intracavitary insertions (group A) and 47 by one insertion (group B). The external beam radiotherapy (EBRT) was realized through a Cobalt unit at whole pelvis with total dose of 40Gy in 20 fractions of 2,0Gy, in box arrangement, followed by parametrial complementation of 10Gy. The brachytherapy was realized right after the end of EBRT. The patients from group A were underwent to two insertions of 25Gy, calculated at point A, defined by the Manchester system. The interval between each insertions was 2 weeks. The patients from group B were underwent to one insertion of 40 Gy at point A. The average dose rate was 60cGy per hour at point A. Results: With the follow up ranging from 36 to 75 months and medium of 55 months, the disease free survival of the patients from group A was not statistically different of those from group B, 70,6% and 72,3% respectively (p=0,711). Local recurrence occurred in four patients from group A (11,7%) and in eight from group B (17%). Distant metastasis occurred in one patient from group A (2,9%) and in two from group B (4,2%). Three patients from group A (8,8%) and three from group B (6,4%) were lost to follow up and considered as dead. The causes of death among patients from group A were progression of local disease in four, distant metastasis in one, complicated diabetes mellitus in one and actinic intestinal complications in other one. The cause of deaths among patients from group B were progression of local disease in eight and distant metastasis in two. The grade I and II rectal complications rate was 5,9% and 6,3% at

AdS solutions through transgression

International Nuclear Information System (INIS)

Donos, Aristomenis; Gauntlett, Jerome P.; Kim, Nakwoo

2008-01-01

We present new classes of explicit supersymmetric AdS 3 solutions of type IIB supergravity with non-vanishing five-form flux and AdS 2 solutions of D = 11 supergravity with electric four-form flux. The former are dual to two-dimensional SCFTs with (0,2) supersymmetry and the latter to supersymmetric quantum mechanics with two supercharges. We also investigate more general classes of AdS 3 solutions of type IIB supergravity and AdS 2 solutions of D = 11 supergravity which in addition have non-vanishing three-form flux and magnetic four-form flux, respectively. The construction of these more general solutions makes essential use of the Chern-Simons or 'transgression' terms in the Bianchi identity or the equation of motion of the field strengths in the supergravity theories. We construct infinite new classes of explicit examples and for some of the type IIB solutions determine the central charge of the dual SCFTs. The type IIB solutions with non-vanishing three-form flux that we construct include a two-torus, and after two T-dualities and an S-duality, we obtain new AdS 3 solutions with only the NS fields being non-trivial.

Uterine cervix cancer treatment in IIB, IIIA and IIIB stages with external radiotherapy versus external radiotherapy and scintiscanning of low dose. ION SOLCA. Years 1998-2000

International Nuclear Information System (INIS)

Sanchez, Doris; Falquez, Roberto

2002-01-01

We realized study of retrospective accomplished in course of years 1998-2000, reviewing clinical charts of statistical department of ION SOLCA. We reviewed 544 cases in 1998, 603 patients in 1999, and 630 cases in 2000. In the radiotherapy service, 133 patients received treatment with external radiotherapy between February 1998 to February 1999 in IIB, IIIA, IIIB stages and only 80 patients were treated with external radiotherapy and scintiscanning of low dose rate in the same stages between March 1999 to March 2000. (The author)

Generalized N=1 orientifold compactifications and the Hitchin functionals

International Nuclear Information System (INIS)

Benmachiche, I.; Hamburg Univ.; Grimm, T.W.

2006-02-01

The four-dimensional N=1 supergravity theories arising in compactifications of type IIA and type IIB on generalized orientifold backgrounds with background fluxes are discussed. The Kaehler potentials are derived for reductions on SU(3) structure orientifolds and shown to consist of the logarithm of the two Hitchin functionals. These are functions of even and odd forms parameterizing the geometry of the internal manifold, the B-field and the dilaton. The superpotentials induced by background fluxes and the non-Calabi-Yau geometry are determined by a reduction of the type IIA and type IIB fermionic actions on SU(3) and generalized SU(3) x SU(3) manifolds. Mirror spaces of Calabi-Yau orientifolds with electric and part of the magnetic NS-NS fluxes are conjectured to be certain SU(3) x SU(3) structure manifolds. Evidence for this identification is provided by comparing the generalized type IIA and type IIB superpotentials. (orig.)

Reflection states in Ding-Iohara-Miki algebra and brane-web for D-type quiver

Science.gov (United States)

Bourgine, J.-E.; Fukuda, M.; Matsuo, Y.; Zhu, R.-D.

2017-12-01

Reflection states are introduced in the vertical and horizontal modules of the Ding-Iohara-Miki (DIM) algebra (quantum toroidal gl_1 ). Webs of DIM representations are in correspondence with ( p, q)-web diagrams of type IIB string theory, under the identification of the algebraic intertwiner of Awata, Feigin and Shiraishi with the refined topological vertex. Extending the correspondence to the vertical reflection states, it is possible to engineer the N=1 quiver gauge theory of D-type (with unitary gauge groups). In this way, the Nekrasov instanton partition function is reproduced from the evaluation of expectation values of intertwiners. This computation leads to the identification of the vertical reflection state with the orientifold plane of string theory. We also provide a translation of this construction in the Iqbal-Kozcaz-Vafa refined topological vertex formalism.

Supersymmetric solutions for non-relativistic holography

International Nuclear Information System (INIS)

Donos, Aristomenis; Gauntlett, Jerome P.

2009-01-01

We construct families of supersymmetric solutions of type IIB and D=11 supergravity that are invariant under the non-relativistic conformal algebra for various values of dynamical exponent z≥4 and z≥3, respectively. The solutions are based on five- and seven-dimensional Sasaki-Einstein manifolds and generalise the known solutions with dynamical exponent z=4 for the type IIB case and z=3 for the D=11 case, respectively. (orig.)

A new look at the Hawkins classification for talar neck fractures: which features of injury and treatment are predictive of osteonecrosis?

Science.gov (United States)

Vallier, Heather A; Reichard, Stephen G; Boyd, Alysse J; Moore, Timothy A

2014-02-05

Osteonecrosis and posttraumatic arthritis are common after talar neck fracture. We hypothesized that delay of definitive fixation would not increase the rate of osteonecrosis, but that the amount of initial fracture displacement, including subtalar and/or tibiotalar dislocations, would be predictive. We investigated the possibility of dividing the Hawkins type-II classification into subluxated (type-IIA) and dislocated (type-IIB) subtalar joint subtypes. The cases of eighty patients with eighty-one talar neck and/or body fractures who had a mean age of 36.7 years were reviewed. The fractures included two Hawkins type-I, forty-four type-II (twenty-one type-IIA and twenty-three type-IIB), thirty-two type-III, and three type-IV fractures. Open fractures occurred in twenty-four patients (30%). One deep infection, two nonunions, and two malunions occurred. After a mean of thirty months of follow-up, sixteen of sixty-five fractures developed osteonecrosis, but 44% of them revascularized without collapse. Osteonecrosis never occurred in fractures without subtalar dislocation (Hawkins type I and IIA), but 25% of Hawkins type-IIB patterns developed osteonecrosis (p = 0.03), and 41% of Hawkins type-III fractures developed osteonecrosis (p = 0.004). Osteonecrosis occurred after 30% of open fractures versus 21% of closed fractures (p = 0.55). Forty-six fractures were treated with urgent open reduction and internal fixation (ORIF) at a mean of 10.1 hours, primarily for open fractures or irreducible dislocations. With the numbers studied, the timing of reduction was not related to the development of osteonecrosis. Thirty-five patients had delayed ORIF (mean, 10.6 days), including ten with Hawkins type-IIB and ten with Hawkins type-III fractures initially reduced by closed methods, and one (5%) of the twenty developed osteonecrosis. Thirty-five patients (54%) developed posttraumatic arthritis, including 83% of those with an associated talar body fracture (p Hawkins type

In the realm of the geometric transitions

International Nuclear Information System (INIS)

Alexander, Stephon; Becker, Katrin; Becker, Melanie; Dasgupta, Keshav; Knauf, Anke; Tatar, Radu

2005-01-01

We complete the duality cycle by constructing the geometric transition duals in the type IIB, type I and heterotic theories. We show that in the type IIB theory the background on the closed string side is a Kaehler deformed conifold, as expected, even though the mirror type IIA backgrounds are non-Kaehler (both before and after the transition). On the other hand, the type I and heterotic backgrounds are non-Kaehler. Therefore, on the heterotic side these backgrounds give rise to new torsional manifolds that have not been studied before. We show the consistency of these backgrounds by verifying the torsional equation

Postnatal changes in electromyographic signals during piglet growth, and in relation to muscle fibre types

DEFF Research Database (Denmark)

Andersen, Ninette Kieme; Ravn, L.S.; Guy, J.H.

2008-01-01

This study uses non-invasive evoked surface electromyography (SEMG) to investigate postnatal muscle development in pigs, and to assess any correlation between recorded signal parameters and muscle fibre types in two different skeletal muscles. Four litters (n=43) of Large White x Landrace pigs were...... used. Evoked SEMG mesurements were taken on days 2, 5, 14, 26, 60 and 151 post partum from m. Longissimus dorsi (LD) and on days 14, 26, 60 and 151 post partum from m. Biceps femoris (BF). A third of each litter was slaughtered at days 27, 61 and 153 post partum. Biopsy samples for LD and BF were taken...... to categorize day 5 post partum, whilst for BF significant increases occurred from days 14 to 26 post partum. Fibre type development in both muscles showed a significant decrease in type IIA fibre number (Ptype IIB fibre number (P

Non-mass-like breast lesions at ultrasonography: Feature analysis and BI-RADS assessment

Energy Technology Data Exchange (ETDEWEB)

Ko, Kai-Hsiung [Department of Radiology, Tri-Service General Hospital, National Defense Medical Center, Taipei, Taiwan, ROC (China); Hsu, Hsian-He, E-mail: hsianhe@yahoo.com.tw [Department of Radiology, Tri-Service General Hospital, National Defense Medical Center, Taipei, Taiwan, ROC (China); Yu, Jyh-Cherng [Department of Surgery, Division of General Surgery, Tri-Service General Hospital, National Defense Medical Center, Taipei, Taiwan, ROC (China); Peng, Yi-Jen [Department of Pathology, Tri-Service General Hospital, National Defense Medical Center, Taipei, Taiwan, ROC (China); Tung, Ho-Jui [Department of Healthcare Administration, Asia University, Taichung, Taiwan, ROC (China); Chu, Chi-Ming [Section of Health Informatics, Institute of Public Health, National Defense Medical Center and University, Taipei, Taiwan, ROC (China); Chang, Tsun-Hou; Chang, Wei-Chou; Wu, Yu-Cheng; Lin, Yu-Pang; Hsu, Giu-Cheng [Department of Radiology, Tri-Service General Hospital, National Defense Medical Center, Taipei, Taiwan, ROC (China)

2015-01-15

Highlights: • The positive predictive value of an NML lesion on ultrasound ranges from 10 to 79%. • A sizable number of NML malignant lesions are pure DCIS or ILC. • Biopsy is indicated for histopathological diagnosis when an ultrasound NML lesion is recognized. - Abstract: Objective: To analyze the features of non-mass-like (NML) breast lesions on ultrasound (US) and determine their corresponding malignancy rate and to stratify these lesion patterns according to US BI-RADS categories. Materials and methods: One hundred sixty-four consecutive lesions were retrospectively classified into four types according to the US features, the corresponding positive predictive values (PPVs) were obtained. Clinical, imaging, and histopathological findings were reviewed. Results: Among the 164 lesions, 39 (24%) were classified as type Ia, 14 (8%) as type Ib, 39 (24%) as type IIa, 19 (12%) as type IIb, 19 (12%) as type III, and 34 (21%) as type IV. The PPVs for malignancy were 21% for type Ia, 79% for type Ib, 10% for type IIa, 58% for type IIb, 16% for type III, and 21% for type IV. All NML lesions were classified as BI-RADS category 4a (type IIa), 4b (type Ia, III and IV) and 4c (type Ib and IIb) according to their PPVs. There was a significantly higher frequency of malignancy among lesions of type Ib and type IIb compared with the other types (P < 0.01 for each). Lesions with associated calcifications, presence of abnormal axillary nodes, or a mammographic finding of suspected malignancy had a higher probability of malignancy (P < 0.05 for each). Conclusion: US is useful in clarifying the indication for biopsy of NML lesions. The types of US classifications used in our study establish reliable references for the NML patterns when stratified according to the BI-RADS categories.

Non-mass-like breast lesions at ultrasonography: Feature analysis and BI-RADS assessment

International Nuclear Information System (INIS)

Ko, Kai-Hsiung; Hsu, Hsian-He; Yu, Jyh-Cherng; Peng, Yi-Jen; Tung, Ho-Jui; Chu, Chi-Ming; Chang, Tsun-Hou; Chang, Wei-Chou; Wu, Yu-Cheng; Lin, Yu-Pang; Hsu, Giu-Cheng

2015-01-01

Highlights: • The positive predictive value of an NML lesion on ultrasound ranges from 10 to 79%. • A sizable number of NML malignant lesions are pure DCIS or ILC. • Biopsy is indicated for histopathological diagnosis when an ultrasound NML lesion is recognized. - Abstract: Objective: To analyze the features of non-mass-like (NML) breast lesions on ultrasound (US) and determine their corresponding malignancy rate and to stratify these lesion patterns according to US BI-RADS categories. Materials and methods: One hundred sixty-four consecutive lesions were retrospectively classified into four types according to the US features, the corresponding positive predictive values (PPVs) were obtained. Clinical, imaging, and histopathological findings were reviewed. Results: Among the 164 lesions, 39 (24%) were classified as type Ia, 14 (8%) as type Ib, 39 (24%) as type IIa, 19 (12%) as type IIb, 19 (12%) as type III, and 34 (21%) as type IV. The PPVs for malignancy were 21% for type Ia, 79% for type Ib, 10% for type IIa, 58% for type IIb, 16% for type III, and 21% for type IV. All NML lesions were classified as BI-RADS category 4a (type IIa), 4b (type Ia, III and IV) and 4c (type Ib and IIb) according to their PPVs. There was a significantly higher frequency of malignancy among lesions of type Ib and type IIb compared with the other types (P < 0.01 for each). Lesions with associated calcifications, presence of abnormal axillary nodes, or a mammographic finding of suspected malignancy had a higher probability of malignancy (P < 0.05 for each). Conclusion: US is useful in clarifying the indication for biopsy of NML lesions. The types of US classifications used in our study establish reliable references for the NML patterns when stratified according to the BI-RADS categories

FDG uptake heterogeneity in FIGO IIb cervical carcinoma does not predict pelvic lymph node involvement.

Science.gov (United States)

Brooks, Frank J; Grigsby, Perry W

2013-12-23

Many types of cancer are located and assessed via positron emission tomography (PET) using the 18F-fluorodeoxyglucose (FDG) radiotracer of glucose uptake. There is rapidly increasing interest in exploiting the intra-tumor heterogeneity observed in these FDG-PET images as an indicator of disease outcome. If this image heterogeneity is of genuine prognostic value, then it either correlates to known prognostic factors, such as tumor stage, or it indicates some as yet unknown tumor quality. Therefore, the first step in demonstrating the clinical usefulness of image heterogeneity is to explore the dependence of image heterogeneity metrics upon established prognostic indicators and other clinically interesting factors. If it is shown that image heterogeneity is merely a surrogate for other important tumor properties or variations in patient populations, then the theoretical value of quantified biological heterogeneity may not yet translate into the clinic given current imaging technology. We explore the relation between pelvic lymph node status at diagnosis and the visually evident uptake heterogeneity often observed in 18F-fluorodeoxyglucose positron emission tomography (FDG-PET) images of cervical carcinomas. We retrospectively studied the FDG-PET images of 47 node negative and 38 node positive patients, each having FIGO stage IIb tumors with squamous cell histology. Imaged tumors were segmented using 40% of the maximum tumor uptake as the tumor-defining threshold and then converted into sets of three-dimensional coordinates. We employed the sphericity, extent, Shannon entropy (S) and the accrued deviation from smoothest gradients (ζ) as image heterogeneity metrics. We analyze these metrics within tumor volume strata via: the Kolmogorov-Smirnov test, principal component analysis and contingency tables. We found no statistically significant difference between the positive and negative lymph node groups for any one metric or plausible combinations thereof. Additionally

FDG uptake heterogeneity in FIGO IIb cervical carcinoma does not predict pelvic lymph node involvement

International Nuclear Information System (INIS)

Brooks, Frank J; Grigsby, Perry W

2013-01-01

Many types of cancer are located and assessed via positron emission tomography (PET) using the 18F-fluorodeoxyglucose (FDG) radiotracer of glucose uptake. There is rapidly increasing interest in exploiting the intra-tumor heterogeneity observed in these FDG-PET images as an indicator of disease outcome. If this image heterogeneity is of genuine prognostic value, then it either correlates to known prognostic factors, such as tumor stage, or it indicates some as yet unknown tumor quality. Therefore, the first step in demonstrating the clinical usefulness of image heterogeneity is to explore the dependence of image heterogeneity metrics upon established prognostic indicators and other clinically interesting factors. If it is shown that image heterogeneity is merely a surrogate for other important tumor properties or variations in patient populations, then the theoretical value of quantified biological heterogeneity may not yet translate into the clinic given current imaging technology. We explore the relation between pelvic lymph node status at diagnosis and the visually evident uptake heterogeneity often observed in 18F-fluorodeoxyglucose positron emission tomography (FDG-PET) images of cervical carcinomas. We retrospectively studied the FDG-PET images of 47 node negative and 38 node positive patients, each having FIGO stage IIb tumors with squamous cell histology. Imaged tumors were segmented using 40% of the maximum tumor uptake as the tumor-defining threshold and then converted into sets of three-dimensional coordinates. We employed the sphericity, extent, Shannon entropy (S) and the accrued deviation from smoothest gradients (ζ) as image heterogeneity metrics. We analyze these metrics within tumor volume strata via: the Kolmogorov-Smirnov test, principal component analysis and contingency tables. We found no statistically significant difference between the positive and negative lymph node groups for any one metric or plausible combinations thereof. Additionally

Multiwavelength observations of the Type IIb supernova 2009mg

DEFF Research Database (Denmark)

Oates, S. R.; Bayless, A. J.; Stritzinger, M. D.

2012-01-01

-time temporal index of SN 2009mg, determined from 40 d post-explosion, is consistent with the decay rate of SN 1993J, but inconsistent with the decay of 56Co. This suggests leakage of γ-rays out of the ejecta and a stellar mass on the small side of the mass distribution. Our XRT non-detection provides an upper...

Comparative Outcomes Between Step-Cut Lengthening Calcaneal Osteotomy vs Traditional Evans Osteotomy for Stage IIB Adult-Acquired Flatfoot Deformity.

Science.gov (United States)

Saunders, Stuart M; Ellis, Scott J; Demetracopoulos, Constantine A; Marinescu, Anca; Burkett, Jayme; Deland, Jonathan T

2018-01-01

The forefoot abduction component of the flexible adult-acquired flatfoot can be addressed with lengthening of the anterior process of the calcaneus. We hypothesized that the step-cut lengthening calcaneal osteotomy (SLCO) would decrease the incidence of nonunion, lead to improvement in clinical outcome scores, and have a faster time to healing compared with the traditional Evans osteotomy. We retrospectively reviewed 111 patients (143 total feet: 65 Evans, 78 SLCO) undergoing stage IIB reconstruction followed clinically for at least 2 years. Preoperative and postoperative radiographs were analyzed for the amount of deformity correction. Computed tomography (CT) was used to analyze osteotomy healing. The Foot and Ankle Outcome Scores (FAOS) and lateral pain surveys were used to assess clinical outcomes. Mann-Whitney U tests were used to assess nonnormally distributed data while χ 2 and Fisher exact tests were used to analyze categorical variables (α = 0.05 significant). The Evans group used a larger graft size ( P lengthening. Level III, retrospective cohort study.

Generalized gravity from modified DFT

International Nuclear Information System (INIS)

Sakatani, Yuho; Uehara, Shozo; Yoshida, Kentaroh

2017-01-01

Recently, generalized equations of type IIB supergravity have been derived from the requirement of classical kappa-symmetry of type IIB superstring theory in the Green-Schwarz formulation. These equations are covariant under generalized T-duality transformations and hence one may expect a formulation similar to double field theory (DFT). In this paper, we consider a modification of the DFT equations of motion by relaxing a condition for the generalized covariant derivative with an extra generalized vector. In this modified double field theory (mDFT), we show that the flatness condition of the modified generalized Ricci tensor leads to the NS-NS part of the generalized equations of type IIB supergravity. In particular, the extra vector fields appearing in the generalized equations correspond to the extra generalized vector in mDFT. We also discuss duality symmetries and a modification of the string charge in mDFT.

Generalized gravity from modified DFT

Energy Technology Data Exchange (ETDEWEB)

Sakatani, Yuho [Department of Physics, Kyoto Prefectural University of Medicine,Kyoto 606-0823 (Japan); Fields, Gravity and Strings, CTPU,Institute for Basic Sciences, Daejeon 34047 (Korea, Republic of); Uehara, Shozo [Department of Physics, Kyoto Prefectural University of Medicine,Kyoto 606-0823 (Japan); Yoshida, Kentaroh [Department of Physics, Kyoto University,Kitashirakawa Oiwake-cho, Kyoto 606-8502 (Japan)

2017-04-20

Recently, generalized equations of type IIB supergravity have been derived from the requirement of classical kappa-symmetry of type IIB superstring theory in the Green-Schwarz formulation. These equations are covariant under generalized T-duality transformations and hence one may expect a formulation similar to double field theory (DFT). In this paper, we consider a modification of the DFT equations of motion by relaxing a condition for the generalized covariant derivative with an extra generalized vector. In this modified double field theory (mDFT), we show that the flatness condition of the modified generalized Ricci tensor leads to the NS-NS part of the generalized equations of type IIB supergravity. In particular, the extra vector fields appearing in the generalized equations correspond to the extra generalized vector in mDFT. We also discuss duality symmetries and a modification of the string charge in mDFT.

Searching for the Expelled Hydrogen Envelope in Type I Supernovae via Late-Time H α Emission

Energy Technology Data Exchange (ETDEWEB)

Vinko, J.; Silverman, J. M.; Wheeler, J. C.; MacQueen, P.; Marion, G. H. [Department of Astronomy, University of Texas at Austin, Austin, TX 78712 (United States); Pooley, D. [Department of Physics and Astronomy, Trinity University, One Trinity Place, San Antonio, TX 78212 (United States); Szalai, T. [Department of Optics and Quantum Electronics, University of Szeged, Dom ter 9, Szeged, 6720 (Hungary); Kelly, P. [Department of Astronomy, University of California at Berkeley, 501 Campbell Hall, Berkeley, CA 94720-3411 (United States); Sárneczky, K. [Konkoly Observatory, Research Centre for Astronomy and Earth Sciences, Hungarian Academy of Sciences, Konkoly Thege ut 15-17, Budapest, 1121 (Hungary)

2017-03-01

We report the first results from our long-term observational survey aimed at discovering late-time interaction between the ejecta of hydrogen-poor Type I supernovae (SNe I) and the hydrogen-rich envelope expelled from the progenitor star several decades/centuries before explosion. The expelled envelope, moving with a velocity of ∼10–100 km s{sup −1}, is expected to be caught up by the fast-moving SN ejecta several years/decades after explosion, depending on the history of the mass-loss process acting in the progenitor star prior to explosion. The collision between the SN ejecta and the circumstellar envelope results in net emission in the Balmer lines, especially H α . We look for signs of late-time H α emission in older SNe Ia/Ibc/IIb with hydrogen-poor ejecta via narrowband imaging. Continuum-subtracted H α emission has been detected for 13 point sources: 9 SN Ibc, 1 SN IIb, and 3 SN Ia events. Thirty-eight SN sites were observed on at least two epochs, from which three objects (SN 1985F, SN 2005kl, and SN 2012fh) showed significant temporal variation in the strength of their H α emission in our Direct Imaging Auxiliary Functions Instrument (DIAFI) data. This suggests that the variable emission is probably not due to nearby H ii regions unassociated with the SN and hence is an important additional hint that ejecta–circumstellar medium interaction may take place in these systems. Moreover, we successfully detected the late-time H α emission from the Type Ib SN 2014C, which was recently discovered as a strongly interacting SN in various (radio, infrared, optical, and X-ray) bands.

Predominant Dissemination of PVL-Negative CC89 MRSA with SCCmec Type II in Children with Impetigo in Japan

Directory of Open Access Journals (Sweden)

H. Kikuta

2011-01-01

Full Text Available Background. The ratio of CA-MRSA in children with impetigo has been increasing in Japan. Methods. Antimicrobial susceptibilities of 136 S. aureus isolates from children with impetigo were studied. Furthermore, molecular epidemiological analysis and virulence gene analysis were performed. Results. Of the 136 S. aureus isolates, 122 (89.7% were MSSA and 14 (10.3% were MRSA. Of the 14 MRSA strains, 11 belonged to CC89 (ST89, ST91, and ST2117 and carried diverse types of SCCmec: type II (IIb: 3 strains; unknown subtype: 4 strains, type IVa (2 strains, and unknown type (2 strains. The remaining three strains exhibited CC8 (ST-8-SCCmec type VIa, CC121 (ST121-SCCmec type V, and CC5 (ST5-nontypeable SCCmec element, respectively. None were lukS-PV-lukF-PV gene positive. Gentamicin- and clarithromycin-resistant strains were frequently found in both MRSA and MSSA. Conclusions. PVL-negative CC89-SCCmec type II strains are the most predominant strains among the CA-MRSA strains circulating in the community in Japan.

S-duality in Twistor Space

CERN Document Server

Alexandrov, Sergei

2012-01-01

In type IIB string compactifications on a Calabi-Yau threefold, the hypermultiplet moduli space $M_H$ must carry an isometric action of the modular group SL(2,Z), inherited from the S-duality symmetry of type IIB string theory in ten dimensions. We investigate how this modular symmetry is realized at the level of the twistor space of $M_H$, and construct a general class of SL(2,Z)-invariant quaternion-Kahler metrics with two commuting isometries, parametrized by a suitably covariant family of holomorphic transition functions. This family should include $M_H$ corrected by D3-D1-D(-1)-instantons (with fivebrane corrections ignored) and, after taking a suitable rigid limit, the Coulomb branch of five-dimensional N=2 gauge theories compactified on a torus, including monopole string instantons. These results allow us to considerably simplify the derivation of the mirror map between type IIA and IIB fields in the sector where only D1-D(-1)-instantons are retained.

S-duality in twistor space

Science.gov (United States)

Alexandrov, Sergei; Pioline, Boris

2012-08-01

In type IIB string compactifications on a Calabi-Yau threefold, the hypermultiplet moduli space {{M}_H} must carry an isometric action of the modular group SL(2 , {Z} ), inherited from the S-duality symmetry of type IIB string theory in ten dimensions. We investigate how this modular symmetry is realized at the level of the twistor space of {{M}_H} , and construct a general class of SL(2 , {Z} )-invariant quaternion-Kähler metrics with two commuting isometries, parametrized by a suitably covariant family of holomorphic transition functions. This family should include {{M}_H} corrected by D3-D1-D(-1)-instantons (with five-brane corrections ignored) and, after taking a suitable rigid limit, the Coulomb branch of five-dimensional {N} = {2} gauge theories compactified on a torus, including monopole string instantons. These results allow us to considerably simplify the derivation of the mirror map between type IIA and IIB fields in the sector where only D1-D(-1)-instantons are retained.

Clinical characteristics predict benefits from eptifibatide therapy during coronary stenting: insights from the Enhanced Suppression of the Platelet IIb/IIIa Receptor With Integrilin Therapy (ESPRIT) trial.

Science.gov (United States)

Puma, Joseph A; Banko, Lesan T; Pieper, Karen S; Sacchi, Terrence J; O'Shea, J Conor; Dery, Jean Pierre; Tcheng, James E

2006-02-21

In order to determine a differential benefit from treatment, we compared the long-term outcome of high-risk versus low-risk patients and evaluated survival free from death or myocardial infarction at one year. Newer anticoagulant strategies during percutaneous coronary intervention have necessitated a reanalysis of the role of intravenous GP IIb/IIIa inhibitors. The Enhanced Suppression of the Platelet IIb/IIIa Receptor with Integrilin Therapy trial randomized 2,064 patients undergoing nonurgent coronary stent implantation to eptifibatide or placebo. High-risk characteristics were defined as age >75 years, diabetes, elevated cardiac markers, ST-segment elevation myocardial infarction within 7 days, or unstable angina within 48 h of randomization. Age <5 years, absence of diabetes, and any other reason for admission were considered low risk characterstics. There were 1,018 patients in the high-risk group (50.8% eptifibatide, 49.2% placebo) and 1,045 patients in the low-risk group (50.0% eptifibatide, 50.0% placebo). Baseline demographics were similar in both groups except for more hypertension (63% vs. 55%, respectively), peripheral vascular disease (8.2% vs. 5.2%, respectively), prior stroke (5.5% vs. 3.2%, respectively), and female gender (33% vs. 22%, respectively) in the high-risk than the low-risk group. At one year, the composite end point of death or myocardial infarction occurred in 15.89% of placebo patients and 7.99% of eptifibatide patients in the high-risk group and 9.02% of the placebo and 8.11% of eptifibatide patients in the low-risk group. Although eptifibatide treatment improved outcomes for all patients, preprocedural clinical characteristics can define a subgroup of patients who may derive greatest benefit from its use during coronary stent placement.

Diversity and regulation of plant Ca2+ pumps: insights from expression in yeast

Science.gov (United States)

Sze, H.; Liang, F.; Hwang, I.; Curran, A. C.; Harper, J. F.; Evans, M. L. (Principal Investigator)

2000-01-01

The spatial and temporal regulation of calcium concentration in plant cells depends on the coordinate activities of channels and active transporters located on different organelles and membranes. Several Ca2+ pumps have been identified and characterized by functional expression of plant genes in a yeast mutant (K616). This expression system has opened the way to a genetic and biochemical characterization of the regulatory and catalytic features of diverse Ca2+ pumps. Plant Ca(2+)-ATPases fall into two major types: AtECA1 represents one of four or more members of the type IIA (ER-type) Ca(2+)-ATPases in Arabidopsis, and AtACA2 is one of seven or more members of the type IIB (PM-type) Ca(2+)-ATPases that are regulated by a novel amino terminal domain. Type IIB pumps are widely distributed on membranes, including the PM (plasma membrane), vacuole, and ER (endoplasmic reticulum). The regulatory domain serves multiple functions, including autoinhibition, calmodulin binding, and sites for modification by phosphorylation. This domain, however, is considerably diverse among several type IIB ATPases, suggesting that the pumps are differentially regulated. Understanding of Ca2+ transporters at the molecular level is providing insights into their roles in signaling networks and in regulating fundamental processes of cell biology.

Modeling and molecular dynamics of HPA-1a and -1b polymorphisms: effects on the structure of the β3 subunit of the αIIbβ3 integrin.

Directory of Open Access Journals (Sweden)

Vincent Jallu

Full Text Available The HPA-1 alloimmune system carried by the platelet integrin αIIbβ3 is the primary cause of alloimmune thrombocytopenia in Caucasians and the HPA-1b allele might be a risk factor for thrombosis. HPA-1a and -1b alleles are defined by a leucine and a proline, respectively, at position 33 in the β3 subunit. Although the structure of αIIbβ3 is available, little is known about structural effects of the L33P substitution and its consequences on immune response and integrin functions.A complete 3D model of the L33-β3 extracellular domain was built and a P33 model was obtained by in silico mutagenesis. We then performed molecular dynamics simulations. Analyses focused on the PSI, I-EGF-1, and I-EGF-2 domains and confirmed higher exposure of residue 33 in the L33 β3 form. These analyses also showed major structural flexibility of all three domains in both forms, but increased flexibility in the P33 β3 form. The L33P substitution does not alter the local structure (residues 33 to 35 of the PSI domain, but modifies the structural equilibrium of the three domains.These results provide a better understanding of HPA-1 epitopes complexity and alloimmunization prevalence of HPA-1a. P33 gain of structure flexibility in the β3 knee may explain the increased adhesion capacity of HPA-1b platelets and the associated thrombotic risk. Our study provides important new insights into the relationship between HPA-1 variants and β3 structure that suggest possible effects on the alloimmune response and platelet function.

Theories of central engine for long gamma-ray bursts

Science.gov (United States)

Nagataki, Shigehiro

2018-02-01

Long GRBs are the most powerful explosions in the universe since the Big Bang. At least, some fraction of long GRBs are born from the death of massive stars. Likewise, only some fraction of massive stars that satisfy additional special conditions explode as long GRBs associated with supernovae/hypernovae. In this paper, we discuss the explosion mechanism of long GRBs associated with hypernovae: ‘the central engine of long GRBs’. The central engine of long GRBs is very different from that of core-collapse supernovae, although the mechanism of the engine is still not firmly established. In this paper, we review theoretical studies of the central engine of long GRBs. First, we discuss possible progenitor stars. Then several promising mechanisms of the central engine—such as black hole and magnetar formation—will be reviewed. We will also mention some more exotic models. Finally, we describe prospects for future studies of the central engine of long GRBs.

External cobalt 60 irradiation alone for stage IIB carcinoma of the uterine cervix

International Nuclear Information System (INIS)

Lei, Z.Z.; He, F.Z.

1989-01-01

From 1964 to 1980, 97 patients with Stage IIb carcinoma of cervix uteri were treated by external 60Co irradiation alone. Of these 97 patients, 94 (96.9%) had squamous cell carcinoma. The parametrial extension of the lesion almost reached the pelvic wall in 73.2% and vaginal extension reached to the upper half of vaginal in 24.7% of the patients. A tumor dose of 60 Gy was given to the whole pelvis by a four field technic (opposing parallel AP and lateral portals) in 6-8 weeks. A booster dose of 10 Gy was delivered to the cervix by a pair of reduced opposing parallel AP portals or a perineal portal in a week. The doses delivered were equivalent to the Time-Dose-Fractionation (TDF) value of 110-130 at the center of pelvis and 90-110 in the whole pelvis. The 5-year survival rate for all 97 patients was 56.7%. It was 59.8% when those who died of other diseases were excluded. The prognosis of patients without residual tumor on the cervix and/or vagina was better than that with residual tumor (p less than 0.01). Thirty-seven patients died of cancer (23 died of recurrence, 8 of distant metastases, 2 of both, and 4 were lost before the fifth year). Of these 37 patients, 97.3% died within 3 years after initial treatment. During the radiation treatment, reactions were moderate. Late complications included 19 (19.6%) with mild cystitis and 16 (16.5%) with mild proctitis, 2 (2.7%) developed recto-vaginal fistula. These results were slightly poorer than those using intracavitary and external irradiation or the combination of preoperative irradiation plus surgery. Yet, for patients with extensions nearing the pelvic wall or with contra-indications to surgery or intracavitary radiotherapy, external irradiation alone is still of value

Exercise increases the plasma membrane content of the Na+ -K+ pump and its mRNA in rat skeletal muscles.

Science.gov (United States)

Tsakiridis, T; Wong, P P; Liu, Z; Rodgers, C D; Vranic, M; Klip, A

1996-02-01

Muscle fibers adapt to ionic challenges of exercise by increasing the plasma membrane Na+-K+ pump activity. Chronic exercise training has been shown to increase the total amount of Na+-K+ pumps present in skeletal muscle. However, the mechanism of adaptation of the Na+-K+ pump to an acute bout of exercise has not been determined, and it is not known whether it involves alterations in the content of plasma membrane pump subunits. Here we examine the effect of 1 h of treadmill running (20 m/min, 10% grade) on the subcellular distribution and expression of Na+-K+ pump subunits in rat skeletal muscles. Red type I and IIa (red-I/IIa) and white type IIa and IIb (white-IIa/IIb) hindlimb muscles from resting and exercised female Sprague-Dawley rats were removed for subcellular fractionation. By homogenization and gradient centrifugation, crude membranes and purified plasma membranes were isolated and subjected to gel electrophoresis and immunoblotting by using pump subunit-specific antibodies. Furthermore, mRNA was isolated from specific red type I (red-I) and white type IIb (white-IIb) muscles and subjected to Northern blotting by using subunit-specific probes. In both red-I/IIa and white-IIa/IIb muscles, exercise significantly raised the plasma membrane content of the alpha1-subunit of the pump by 64 +/- 24 and 55 +/- 22%, respectively (P < 0.05), and elevated the alpha2-polypeptide by 43 +/- 22 and 94 +/- 39%, respectively (P < 0.05). No significant effect of exercise could be detected on the amount of these subunits in an internal membrane fraction or in total membranes. In addition, exercise significantly increased the alpha1-subunit mRNA in red-I muscle (by 50 +/- 7%; P < 0.05) and the beta2-subunit mRNA in white-IIb muscles (by 64 +/- 19%; P < 0.01), but the alpha2- and beta1-mRNA levels were unaffected in this time period. We conclude that increased presence of alpha1- and alpha2-polypeptides at the plasma membrane and subsequent elevation of the alpha1- and beta2

Analysis of Radiotherapy Associated Factors in Stage IIb Carcinoma of Uterine Cervix

Energy Technology Data Exchange (ETDEWEB)

Moon, Chang Woo; Jeung, Tae Sig; Yum, Ha Yong [Kosin Medical College of Medicine, Pusan (Korea, Republic of)

1990-12-15

331 patients of stage IIb uterine cervix cancer treated by radiation alone at Kosin Medical Center between June 1980 and Dec. 1985 were analysed to determine parameters of radiotherapy associated to disease states. Survival rate was highest among the reported (82.8% for crude and 82.4% for disease free survival). Pelvic control rate in 6 weeks after the end of radiotherapy was 93.6% in the patients treated with ICR following total pelvic radiation and 71.6% with small field additional external irradiation. 5 year survival rate in those who achieved pelvic control was 98. 9% and 12.9% in those who had pelvic failure and/or metastasis after radiation. The survival rate figured maximal 88.5% with dosage of 7500-8500 cGy to point A with acceptable incidence of complications (4.9%) but without increasing survival above it and minimal 74.1% with dosage of less than 6500 cGy. The treatment failure was counted 18.7% (62 of 331 patients): Local failure 72. 6% ( 45 of 62 patients), locoregional failure 3.2% (2 of 62 patients) and distant failure 24% (15 of 62 patients). Late complications were found In 50 patients (15.1%) and 42% of them was rectal bleeding and stenosis. The dose of 8500 cGy to point A was found to be critical for complication and 70% of complications occurred above it and was more serious one such as fistula. Rectal complications were developed above rectal dose 6500 cGy and bladder complication above bladder dose 7500 cGy. Major cause of death was cachexia due to locoregional failure (73.7% of death), next was due to metastasis to lung, liver and bone, and only 3 patients died of complication of intestinal perforations and obstruction. In conclusion higher external radiation dose for a bulky uterine cervix and barrel shaped uterus was essential for local control.

Analysis of Radiotherapy Associated Factors in Stage IIb Carcinoma of Uterine Cervix

International Nuclear Information System (INIS)

Moon, Chang Woo; Jeung, Tae Sig; Yum, Ha Yong

1990-01-01

331 patients of stage IIb uterine cervix cancer treated by radiation alone at Kosin Medical Center between June 1980 and Dec. 1985 were analysed to determine parameters of radiotherapy associated to disease states. Survival rate was highest among the reported (82.8% for crude and 82.4% for disease free survival). Pelvic control rate in 6 weeks after the end of radiotherapy was 93.6% in the patients treated with ICR following total pelvic radiation and 71.6% with small field additional external irradiation. 5 year survival rate in those who achieved pelvic control was 98. 9% and 12.9% in those who had pelvic failure and/or metastasis after radiation. The survival rate figured maximal 88.5% with dosage of 7500-8500 cGy to point A with acceptable incidence of complications (4.9%) but without increasing survival above it and minimal 74.1% with dosage of less than 6500 cGy. The treatment failure was counted 18.7% (62 of 331 patients): Local failure 72. 6% ( 45 of 62 patients), locoregional failure 3.2% (2 of 62 patients) and distant failure 24% (15 of 62 patients). Late complications were found In 50 patients (15.1%) and 42% of them was rectal bleeding and stenosis. The dose of 8500 cGy to point A was found to be critical for complication and 70% of complications occurred above it and was more serious one such as fistula. Rectal complications were developed above rectal dose 6500 cGy and bladder complication above bladder dose 7500 cGy. Major cause of death was cachexia due to locoregional failure (73.7% of death), next was due to metastasis to lung, liver and bone, and only 3 patients died of complication of intestinal perforations and obstruction. In conclusion higher external radiation dose for a bulky uterine cervix and barrel shaped uterus was essential for local control

In vivo emergence of vicriviroc resistance in a human immunodeficiency virus type 1 subtype C-infected subject.

Science.gov (United States)

Tsibris, Athe M N; Sagar, Manish; Gulick, Roy M; Su, Zhaohui; Hughes, Michael; Greaves, Wayne; Subramanian, Mani; Flexner, Charles; Giguel, Françoise; Leopold, Kay E; Coakley, Eoin; Kuritzkes, Daniel R

2008-08-01

Little is known about the in vivo development of resistance to human immunodeficiency virus type 1 (HIV-1) CCR5 antagonists. We studied 29 subjects with virologic failure from a phase IIb study of the CCR5 antagonist vicriviroc (VCV) and identified one individual with HIV-1 subtype C who developed VCV resistance. Studies with chimeric envelopes demonstrated that changes within the V3 loop were sufficient to confer VCV resistance. Resistant virus showed VCV-enhanced replication, cross-resistance to another CCR5 antagonist, TAK779, and increased sensitivity to aminooxypentane-RANTES and the CCR5 monoclonal antibody HGS004. Pretreatment V3 loop sequences reemerged following VCV discontinuation, implying that VCV resistance has associated fitness costs.

THE TYPE IIb SUPERNOVA 2011dh FROM A SUPERGIANT PROGENITOR

International Nuclear Information System (INIS)

Bersten, Melina C.; Nomoto, Ken'ichi; Folatelli, Gastón; Maeda, Keiichi; Benvenuto, Omar G.; Ergon, Mattias; Sollerman, Jesper; Benetti, Stefano; Ochner, Paolo; Tomasella, Lina; Botticella, Maria Teresa; Fraser, Morgan; Kotak, Rubina

2012-01-01

A set of hydrodynamical models based on stellar evolutionary progenitors is used to study the nature of SN 2011dh. Our modeling suggests that a large progenitor star—with R ∼ 200 R ☉ —is needed to reproduce the early light curve (LC) of SN 2011dh. This is consistent with the suggestion that the yellow super-giant star detected at the location of the supernova (SN) in deep pre-explosion images is the progenitor star. From the main peak of the bolometric LC and expansion velocities, we constrain the mass of the ejecta to be ≈2 M ☉ , the explosion energy to be E = (6-10) × 10 50 erg, and the 56 Ni mass to be approximately 0.06 M ☉ . The progenitor star was composed of a helium core of 3-4 M ☉ and a thin hydrogen-rich envelope of ≈0.1M ☉ with a main-sequence mass estimated to be in the range of 12-15 M ☉ . Our models rule out progenitors with helium-core masses larger than 8 M ☉ , which correspond to M ZAMS ∼> 25M ☉ . This suggests that a single star evolutionary scenario for SN 2011dh is unlikely.

Identification of Structural and Immunity Genes of a Class IIb Bacteriocin Encoded in the Enterocin A Operon of Enterococcus faecium Strain MXVK29.

Science.gov (United States)

Escamilla-Martínez, E E; Cisneros, Y M Álvarez; Fernández, F J; Quirasco-Baruch, M; Ponce-Alquicira, E

2017-10-09

The Enterococcus faecium strain MXVK29, isolated from fermented sausages, produces a bacteriocin with a molecular mass of 3.5 kDa that belongs to the class of enterocins II.1, according to the terminal amino acid sequence, and has been identified as enterocin A. This bacteriocin is active against selected strains of Listeria, Staphylococcus, Pediococcus, and Enterococcus. In this study, we identified the genes adjacent to the structural gene for this bacteriocin, such as the immunity gene (entI) and the inducer gene (entF). Accessory genes for this bacteriocin, such as entK, entR, and entT, were identified as well, in addition to the orf2 and orf3, showing a high identity with class IIb peptides bacteriocins. The orf2 shows the consensus motif GxxxG, similar to those shown by bacteriocins such as PlnNC8α, EntCα, and Ent1071A, whereas orf3 shows a consensus motif SxxxS similar to that present in PlnNC8β (AxxxA). PlnNC8 is expressed only in bacterial cocultures, so there is the possibility that the expression of this two-peptide bacteriocin can be induced by a similar mechanism. So far, only the expression of enterocin A has been found in this strain; however, the presence of the genes ent29α and ent29β opens the possibility for further research on its induction, functionality, and origin. Although there are reports on this type of bacteriocin (EntX, EntC, and Ent1071) in other strains of E. faecium, no report exists yet on an Enterococcus strain producing two different classes of bacteriocin.

Role of Various Extractants in Removing Group-IIB Elements of Soils Incubated with EDTA

Directory of Open Access Journals (Sweden)

Tanmoy Karak

2004-01-01

Full Text Available This paper presents the results of an experimental investigation undertaken to evaluate different extractant solutions viz. HCl, Mg(NO32, and DTPA with the range of concentration from 0.001 to 0.1N after incubation with group-IIB metals (Zn, Cd, and Hg and EDTA to understand the capability to remove Zn, Cd, and Hg from soils. Two noncontaminated soils, one acidic (GHL and the other alkaline (KAP, in reaction were taken from an agricultural field of West Bengal, India for this investigation. Experiments were conducted on these two soils spiked with ZnII, CdII, and HgII in concentrations of 612, 321, and 215 mg/kg for soil GHL and 778, 298, and 157 mg/kg for soil KAP, respectively, which simulate typical electroplating waste contamination. The removal of Zn, Cd, and Hg in soil GHL within the range of HCl concentrations was 8.2–16.5, 12.2–19.1, and 4.3–6.9 whereas these were 6.5–7.6, 8.5–14.1, and 3.2–5.2 in soil KAP. The removal of Zn, Cd, and Hg in soil GHL within the range of Mg(NO32 concentrations were 12.2–28.5, 19.1–24.6, and 18.2–19.1 whereas these were 9.1–12.1, 8.3–12.1, and 10.6–48.1 in soil KAP. For DTPA extractant, the percent removal of metal was found to be significantly higher than the other two extractants, which corroborates that DTPA is a better extractant for soil cleaning.

The Number of Positive Pelvic Lymph Nodes and Multiple Groups of Pelvic Lymph Node Metastasis Influence Prognosis in Stage IA-IIB Cervical Squamous Cell Carcinoma

Directory of Open Access Journals (Sweden)

Yu Liu

2015-01-01

Full Text Available Background: Pelvic lymph node metastasis (LNM is an important prognostic factor in cervical cancer. Cervical squamous cell carcinoma accounts for approximately 75-80% of all cervical cancers. Analyses of the effects of the number of positive lymph nodes (LNs, unilateral versus bilateral pelvic LNM and a single group versus multiple groups of pelvic LNM on survival and recurrence of cervical squamous cell carcinoma are still lacking. The study aimed to analyze the effects of the number of positive pelvic LNs and a single group versus multiple groups of pelvic LNM on survival and recurrence. Methods: We performed a retrospective review of 296 patients diagnosed with Stage IA-IIB cervical squamous cell carcinoma who received extensive/sub-extensive hysterectomy with pelvic lymphadenectomy/pelvic LN sampling at Peking University People′s Hospital from November 2004 to July 2013. Ten clinicopathological variables were evaluated as risk factors for pelvic LNM: Age at diagnosis, gravidity, clinical stage, histological grade, tumor diameter, lymph-vascular space involvement (LVSI, depth of cervical stromal invasion, uterine invasion, parametrial invasion, and neoadjuvant chemotherapy. Results: The incidence of pelvic LNM was 20.27% (60/296 cases. Pelvic LNM (P = 0.00 was significantly correlated with recurrence. Pelvic LNM (P = 0.00, the number of positive pelvic LNs (P = 0.04 and a single group versus multiple groups of pelvic LNM (P = 0.03 had a significant influence on survival. Multivariate analysis revealed that LVSI (P = 0.00, depth of cervical stromal invasion (P = 0.00 and parametrial invasion (P = 0.03 were independently associated with pelvic LNM. Conclusions: Patients with pelvic LNM had a higher recurrence rate and poor survival outcomes. Furthermore, more than 2 positive pelvic LNs and multiple groups of pelvic LNM appeared to identify patients with worse survival outcomes in node-positive IA-IIB cervical squamous cell carcinoma. LVSI

Comparison of one-year outcomes following coronary artery stenting in diabetic versus nondiabetic patients (from the Enhanced Suppression of the Platelet IIb/IIIa Receptor With Integrilin Therapy [ESPRIT] Trial).

Science.gov (United States)

Labinaz, Marino; Madan, Mina; O'Shea, J O'Conor; Kilaru, Rakhi; Chin, Wai; Pieper, Karen; McGuire, Darren K; Saucedo, Jorge F; Talley, J David; Lui, Henry; Kitt, Michael M; Califf, Robert M; Tcheng, James T

2002-09-15

For patients undergoing nonurgent coronary stent implantation, blockade of the glycoprotein IIb/IIIa receptor with eptifibatide reduces the incidence of ischemic complications. We evaluated the interaction of eptifibatide with diabetes in patients who underwent this procedure by analyzing the 1-year outcomes of those enrolled in the Enhanced Suppression of the Platelet IIb/IIIa Receptor with Integrilin Therapy (ESPRIT) trial (466 diabetic and 1,595 nondiabetic patients). At 1 year, the composite end point of death, myocardial infarction (MI), or target vessel revascuarlization (TVR) was higher in diabetic patients (24.5% vs 18.4%; p = 0.008). At 1 year, eptifibatide had a similar effect on the composite end point of death, MI, or TVR in diabetic (hazards ratio [HR] 0.71, 95% confidence interval [CI] 0.49 to 1.04) and nondiabetic patients (HR 0.80, 95% CI 0.63 to 0.99). A similar treatment effect was also seen on death or MI in both groups. The 1-year mortality rate for diabetic patients assigned to placebo was 3.5% versus 1.3% for patients receiving eptifibatide (HR 0.37, 95% CI 0.10 to 1.41); the latter rate was similar to the mortality rate of 1.4% for nondiabetic patients in the eptifibatide group. However, eptifibatide did not have a significant effect on TVR in diabetic patients (HR 0.90, 95% CI 0.57 to 1.41). Our data suggest that treatment with eptifibatide is associated with a similar relative reduction in adverse ischemic complications in diabetic and nondiabetic patients undergoing coronary stent implantation. There is no evidence of a statistical interaction in the treatment effect of eptifibatide between patients with and without diabetes.

CALTECH CORE-COLLAPSE PROJECT (CCCP) OBSERVATIONS OF TYPE II SUPERNOVAE: EVIDENCE FOR THREE DISTINCT PHOTOMETRIC SUBTYPES

Energy Technology Data Exchange (ETDEWEB)

Arcavi, Iair; Gal-Yam, Avishay; Yaron, Ofer [Department of Particle Physics and Astrophysics, Weizmann Institute of Science, Rehovot 76100 (Israel); Cenko, S. Bradley; Becker, Adam B. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Fox, Derek B. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Leonard, Douglas C. [Department of Astronomy, San Diego State University, San Diego, CA 92182 (United States); Moon, Dae-Sik [Department of Astronomy and Astrophysics, University of Toronto, Toronto, ON M5S 3H4 (Canada); Sand, David J. [Las Cumbres Observatory Global Telescope Network, Santa Barbara, CA 93117 (United States); Soderberg, Alicia M. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Kiewe, Michael [Department of Physics, University of Wisconsin, Madison, WI 53706 (United States); Scheps, Raphael [King' s College, University of Cambridge, Cambridge CB2 1ST (United Kingdom); Birenbaum, Gali [12 Amos St, Ramat Chen, Ramat Gan 52233 (Israel); Chamudot, Daniel [20 Chen St, Petach Tikvah 49520 (Israel); Zhou, Jonathan, E-mail: iair.arcavi@weizmann.ac.il [101 Dunster Street, Box 398, Cambridge, MA 02138 (United States)

2012-09-10

We present R-band light curves of Type II supernovae (SNe) from the Caltech Core-Collapse Project (CCCP). With the exception of interacting (Type IIn) SNe and rare events with long rise times, we find that most light curve shapes belong to one of three apparently distinct classes: plateau, slowly declining, and rapidly declining events. The last class is composed solely of Type IIb SNe which present similar light curve shapes to those of SNe Ib, suggesting, perhaps, similar progenitor channels. We do not find any intermediate light curves, implying that these subclasses are unlikely to reflect variance of continuous parameters, but rather might result from physically distinct progenitor systems, strengthening the suggestion of a binary origin for at least some stripped SNe. We find a large plateau luminosity range for SNe IIP, while the plateau lengths seem rather uniform at approximately 100 days. As analysis of additional CCCP data goes on and larger samples are collected, demographic studies of core-collapse SNe will likely continue to provide new constraints on progenitor scenarios.

Isomer effect on the near-infrared electrochromism of anthraquinone imides

International Nuclear Information System (INIS)

Yao, Bin; Chen, Fengkun; Jiang, Hong; Zhang, Jie; Wan, Xinhua

2015-01-01

Graphical abstract: Display Omitted - Highlights: • Two pairs of unsubstituted isomers (Ia and Ib) and nitro-substituted isomers (IIa and IIb) of anthraquinone imides (AQIs), which are a unique type of cathodically-colouring NIR electrochromic materials bearing both quinone and imide moieties, were synthesized. • Isomer effect on the NIR electrochromism of n-type optoelectric materials was first approached. • A meaningful reference to design cathodically active NIR EC materials, in which the molecular planarity and the orientation of polar groups are two key elements must to be carefully considered, is provided. - Abstract: To deeply explore the interplay between molecular structure and near-infrared electrochromism of anthraquinone imides, two pairs of unsubstituted isomers (Ia and Ib) and nitro-substituted isomers (IIa and IIb) of anthraquinone imides were synthesized, in which the molecules Ia and IIa took more linear shapes than Ib and IIb. Cyclic voltammetry and spectroelectrochemistry were combined to investigate their electrochemical properties. Cyclic voltammetry showed that Ib and IIb revealed decreased first reduction potentials and low cyclic stability compared to their isomers, indicating that the isomerization weakened the stabilization effect. Upon one-electron reduction, both the absorption wavelengths and absorption intensities of radical anions were greatly dependent on the structures of isomers. The radical anions of Ia, IIa, and IIb illustrated NIR absorptions peaked at 820, 1260, and 1380 nm, respectively, but that of Ib exhibited only weak absorption in the visible region centered at 660 nm. Gaussian calculations suggested that the electrons were delocalized over the whole molecular skeletons of Ia and IIa radical anions, but the effective conjugation length was interrupted on the imide section in both Ib and IIb. The isomer effects on the effective conjugation length and electron density distribution were considered to rationalize the

Development and clinical application in arthritis of a new immunoassay for serum type IIA procollagen NH2 propeptide.

Science.gov (United States)

Rousseau, Jean-Charles; Sandell, Linda J; Delmas, Pierre D; Garnero, Patrick

2004-01-01

Type II collagen, the most abundant protein of cartilage matrix, is synthesized as a procollagen molecule including the N-(PIINP) and C-(PIICP) propeptides at each end. Type II procollagen is produced in two forms as the result of alternative RNA splicing. One form (IIA) includes and the other form (IIB) excludes a 69-amino acid cysteine-rich globular domain encoded by exon 2 in PIINP. During the process of synthesis, these N-propeptides are removed by specific proteases and released in the circulation, and their levels are believed to reflect type II collagen synthesis. In this chapter we describe the development of a specific enzyme-linked immunosorbent assay (ELISA) for the measurement of the IIA form of PIINP (PIIANP) in serum based on a polyclonal antibody raised against recombinant human exon 2 fusion protein of type II procollagen. We show that this ELISA is highly specific for circulating PIIANP and has adequate technical precision. In patients with knee osteoarthritis and rheumatoid arthritis, serum PIIANP was decreased by 53% (p type IIA collagen synthesis is altered in these arthritic diseases. The measurement of serum PIIANP may be useful for the clinical investigation of patients with joint diseases.

Phase II study of a trimodal preoperative treatment followed by radical surgery or radiotherapy in non-resectable cervical cancer ≥ Figo IIB

International Nuclear Information System (INIS)

Cho, C.; Gellermann, J.; Jungnickel, K.; Kuemmel, S.; Hildebrandt, B.; Wust, P

2005-01-01

Full text: Regional hyperthermia is combined with radiochemotherapy to achieve resectability in non-resectable cervical carcinoma. In a phase II study at the Charite Medical School approved by the institutionals ethical committee non-resectable cervical carcinoma of at least FIGO IIB were treated with radiochemotherapy combined with regional hyperthermia. The treatment concept comprises cisplatinum therapy of 40 mg/sqm body surface once weekly during regional hyperthermia supplementing radiation therapy of 5 x 1.8 Gy to a total dose of 45 - 50.4 Gy. A gynecological status and imaging is performed for evaluation of resectability of the tumor. If a tumor resection was not feasable radiation was completed to 59.4 - 63 Gy supplemented by 4 - 5 afterloading sessions. Regional hyperthermia was conducted with SIGMA 60 or SIGMA Eye applicator of the system BSD-2000, on average steady state temperatures between 40-41 o C were achieved over the therapeutic time. From 2000 to 2003 we recruited 30 patients. Acute toxicity was in the usual range (10-15 % grade ≥ 3). Two thirds were FIGO stage III/IV with tumor diameters > 6 cm. After treatment 20/30 (67 %) of the former inoperable cases were evaluated as resectable, 3 of these patients refused surgery. Of the remaining 17 cases 14 patients were R0-resected, 2 patients were R1-resected, and 1 patient had a positive paraaortal lymphnode. In 13/30 patients nonsurgical treatment was continued. Response was achieved in 23/30 patients (77 %), i.e. 14 resectable cases with downstaging and 9 partial remissions (PR) after hyperthermic radiochemotherapy with 45 - 50.4 Gy. Response correlated well with thermal parameters, in particular the mean temperature in the vaginal reference point. For the whole group a three year overall survival of 60 % was achieved together with a moderate late toxicity ≥ 3 in 4/30 patients (13 %). R0-resected patients have an excellent prognosis with a 3-year survival of 95 % and a late toxicity ≥ 3 below

Kinetics of improved 1,4-alpha-D-glucan glucohydrolase biosynthesis from a newly isolated Aspergillus oryzae IIB-6 and parameter significance analysis by 2-factorial design.

Science.gov (United States)

Fatima, Bilqees; Ali, Sikander

2012-01-01

Sixteen different mould cultures viz. Aspergillus, Alternaria, Arthroderma, Trichoderma, Fusarium, Penicillium, Rhizopus and Chochliobolus were isolated from the soil samples of Qatar by serial dilution method. The preliminary screening of isolates was done by selecting initial colonies showing relatively bigger zones of starch hydrolysis on nutrient agar plates. The isolates were then subjected to secondary screening by submerged fermentation (SmF). The 1,4-α-D-glucan glucohydrolase (GGH) activity ranged from 1.906-12.675 U/ml/min. The product yield was analysed in dependence of mycelial morphology, biomass level and protein content. The isolate Aspergillus oryzae llB-6 which gave maximum enzyme production was incubated in M3 medium containing 20 g/l starch, 10 g/l lactose, 8.5 g/l yeast extract, 6 g/l corn steep liquor (CSL), 1.2 g/l MgSO4.7H2O, 1.3 g/l NH4Cl, 0.6 g/l CaCl2.2H2O, pH 5 at 30±2°C and 200 rpm. On the basis of kinetic variables, notably Qp (0.058±0.01(a) U/g/h), Yp/s (0.308±0.03(ab) U/g) and qp (0.210±0.032(abc) U/g fungal biomass/h), A. oryzae IIB-6 was found to be a hyper producer of GGH (LSD 0.0345) compared to A. kawachii IIB-2. A noticeable enhancement in enzyme activity of over 30% was observed (13.917±1.01 U/ml/min) when the process parameters viz. cultural conditions (pH 5, incubation period 72 h) and nutritional requirements (6 g/l CSL, 9.5 g/l yeast extract, 10 g/l starch, 20 g/l lactose) were further optimized using a 2-factorial Plackett-Burman design. The model terms were found to be highly significant (HS, p≤0.05), indicating the potential utility of the culture (dof~3).

Radio observations reveal a smooth circumstellar environment around the extraordinary type Ib supernova 2012au

Energy Technology Data Exchange (ETDEWEB)

Kamble, Atish; Soderberg, Alicia M.; Margutti, Raffaella; Milisavljevic, Dan; Chakraborti, Sayan; Dittmann, Jason; Drout, Maria; Sanders, Nathan [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Chomiuk, Laura [Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Medvedev, Mikhail [The Department of Physics and Astronomy, University of Kansas, Lawrence, KS 66045 (United States); Chevalier, Roger [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904-4325 (United States); Chugai, Nikolai [Institute of Astronomy, Russian Academy of Sciences, Pyatnitskaya 48, 109017 Moscow (Russian Federation); Fransson, Claes [Department of Astronomy, The Oskar Klein Centre, Stockholm University, AlbaNova University Centre, SE-106 91 Stockholm (Sweden); Nakar, Ehud, E-mail: atish.vyas@gmail.com [Raymond and Beverly Sackler School of Physics and Astronomy, Tel Aviv University, Tel Aviv 69978 (Israel)

2014-12-10

We present extensive radio and X-ray observations of SN 2012au, an energetic, radio-luminous supernova of Type Ib that exhibits multi-wavelength properties bridging subsets of hydrogen-poor superluminous supernovae, hypernovae, and normal core-collapse supernovae. The observations closely follow models of synchrotron emission from a shock-heated circumburst medium that has a wind density profile (ρ∝r {sup –2}). We infer a sub-relativistic velocity for the shock wave v ≈ 0.2 c and a radius of r ≈ 1.4 × 10{sup 16}cm at 25 days after the estimated date of explosion. For a wind velocity of 1000 km s{sup –1}, we determine the mass-loss rate of the progenitor to be M-dot =3.6×10{sup −6} M{sub ⊙} yr{sup −1}, consistent with the estimates from X-ray observations. We estimate the total internal energy of the radio-emitting material to be E ≈ 10{sup 47} erg, which is intermediate to SN 1998bw and SN 2002ap. The evolution of the radio light curve of SN 2012au is in agreement with its interaction with a smoothly distributed circumburst medium and the absence of stellar shells ejected from previous outbursts out to r ≈ 10{sup 17} cm from the supernova site. We conclude that the bright radio emission from SN 2012au was not dissimilar from other core-collapse supernovae despite its extraordinary optical properties, and that the evolution of the SN 2012au progenitor star was relatively quiet, marked with a steady mass loss, during the final years preceding explosion.

Low-luminosity gamma-ray bursts as the sources of ultrahigh-energy cosmic ray nuclei

Science.gov (United States)

Zhang, B. Theodore; Murase, Kohta; Kimura, Shigeo S.; Horiuchi, Shunsaku; Mészáros, Peter

2018-04-01

Recent results from the Pierre Auger Collaboration have shown that the composition of ultrahigh-energy cosmic rays (UHECRs) becomes gradually heavier with increasing energy. Although gamma-ray bursts (GRBs) have been promising sources of UHECRs, it is still unclear whether they can account for the Auger results because of their unknown nuclear composition of ejected UHECRs. In this work, we revisit the possibility that low-luminosity GRBs (LL GRBs) act as the sources of UHECR nuclei and give new predictions based on the intrajet nuclear composition models considering progenitor dependencies. We find that the nuclear component in the jet can be divided into two groups according to the mass fraction of silicon nuclei, Si-free and Si-rich. Motivated by the connection between LL GRBs and transrelativistic supernovae, we also consider the hypernova ejecta composition. Then, we discuss the survivability of UHECR nuclei in the jet base and internal shocks of the jets, and show that it is easier for nuclei to survive for typical LL GRBs. Finally, we numerically propagate UHECR nuclei ejected from LL GRBs with different composition models and compare the resulting spectra and composition to Auger data. Our results show that both the Si-rich progenitor and hypernova ejecta models match the Auger data well, while the Si-free progenitor models have more difficulty in fitting the spectrum. We argue that our model is consistent with the newly reported cross-correlation between the UHECRs and starburst galaxies, since both LL GRBs and hypernovae are expected to be tracers of the star-formation activity. LL GRBs have also been suggested as the dominant origin of IceCube neutrinos in the PeV range, and the LL GRB origin of UHECRs can be critically tested by near-future multimessenger observations.

Adaptive functional specialisation of architectural design and fibre type characteristics in agonist shoulder flexor muscles of the llama, Lama glama.

Science.gov (United States)

Graziotti, Guillermo H; Chamizo, Verónica E; Ríos, Clara; Acevedo, Luz M; Rodríguez-Menéndez, J M; Victorica, C; Rivero, José-Luis L

2012-08-01

Like other camelids, llamas (Lama glama) have the natural ability to pace (moving ipsilateral limbs in near synchronicity). But unlike the Old World camelids (bactrian and dromedary camels), they are well adapted for pacing at slower or moderate speeds in high-altitude habitats, having been described as good climbers and used as pack animals for centuries. In order to gain insight into skeletal muscle design and to ascertain its relationship with the llama's characteristic locomotor behaviour, this study examined the correspondence between architecture and fibre types in two agonist muscles involved in shoulder flexion (M. teres major - TM and M. deltoideus, pars scapularis - DS and pars acromialis - DA). Architectural properties were found to be correlated with fibre-type characteristics both in DS (long fibres, low pinnation angle, fast-glycolytic fibre phenotype with abundant IIB fibres, small fibre size, reduced number of capillaries per fibre and low oxidative capacity) and in DA (short fibres, high pinnation angle, slow-oxidative fibre phenotype with numerous type I fibres, very sparse IIB fibres, and larger fibre size, abundant capillaries and high oxidative capacity). This correlation suggests a clear division of labour within the M. deltoideus of the llama, DS being involved in rapid flexion of the shoulder joint during the swing phase of the gait, and DA in joint stabilisation during the stance phase. However, the architectural design of the TM muscle (longer fibres and lower fibre pinnation angle) was not strictly matched with its fibre-type characteristics (very similar to those of the postural DA muscle). This unusual design suggests a dual function of the TM muscle both in active flexion of the shoulder and in passive support of the limb during the stance phase, pulling the forelimb to the trunk. This functional specialisation seems to be well suited to a quadruped species that needs to increase ipsilateral stability of the limb during the support

Adaptive functional specialisation of architectural design and fibre type characteristics in agonist shoulder flexor muscles of the llama, Lama glama

Science.gov (United States)

Graziotti, Guillermo H; Chamizo, Verónica E; Ríos, Clara; Acevedo, Luz M; Rodríguez-Menéndez, J M; Victorica, C; Rivero, José-Luis L

2012-01-01

Like other camelids, llamas (Lama glama) have the natural ability to pace (moving ipsilateral limbs in near synchronicity). But unlike the Old World camelids (bactrian and dromedary camels), they are well adapted for pacing at slower or moderate speeds in high-altitude habitats, having been described as good climbers and used as pack animals for centuries. In order to gain insight into skeletal muscle design and to ascertain its relationship with the llama’s characteristic locomotor behaviour, this study examined the correspondence between architecture and fibre types in two agonist muscles involved in shoulder flexion (M. teres major – TM and M. deltoideus, pars scapularis – DS and pars acromialis – DA). Architectural properties were found to be correlated with fibre-type characteristics both in DS (long fibres, low pinnation angle, fast-glycolytic fibre phenotype with abundant IIB fibres, small fibre size, reduced number of capillaries per fibre and low oxidative capacity) and in DA (short fibres, high pinnation angle, slow-oxidative fibre phenotype with numerous type I fibres, very sparse IIB fibres, and larger fibre size, abundant capillaries and high oxidative capacity). This correlation suggests a clear division of labour within the M. deltoideus of the llama, DS being involved in rapid flexion of the shoulder joint during the swing phase of the gait, and DA in joint stabilisation during the stance phase. However, the architectural design of the TM muscle (longer fibres and lower fibre pinnation angle) was not strictly matched with its fibre-type characteristics (very similar to those of the postural DA muscle). This unusual design suggests a dual function of the TM muscle both in active flexion of the shoulder and in passive support of the limb during the stance phase, pulling the forelimb to the trunk. This functional specialisation seems to be well suited to a quadruped species that needs to increase ipsilateral stability of the limb during the

Enterocin C, a class IIb bacteriocin produced by E. faecalis C901, a strain isolated from human colostrum.

Science.gov (United States)

Maldonado-Barragán, Antonio; Caballero-Guerrero, Belén; Jiménez, Esther; Jiménez-Díaz, Rufino; Ruiz-Barba, José L; Rodríguez, Juan M

2009-07-31

Enterocin C (EntC), a class IIb bacteriocin was purified from culture supernatants of Enterococcus faecalis C901, a strain isolated from human colostrum. Enterocin C consists of two distinct peptides, named EntC1 and EntC2, whose complementary action is required for full antimicrobial activity. The structural genes entC1 and entC2 encoding enterocins EntC1 and EntC2, respectively, and that encoding the putative immunity protein (EntCI) are located in the 9-kb plasmid pEntC, harboured by E. faecalis C901. The N-terminal sequence of both antimicrobial peptides revealed that EntC1 (4284 Da) is identical to Ent1071A, one of the two peptides that form enterocin 1071 (Ent1071), a bacteriocin produced by E. faecalis BFE 1071. In contrast, EntC2 (3867 Da) presents the non-polar alanine residue at position 17 (Ala(17)) instead of the polar threonine residue (Thr(17)) in Ent1071B, the second peptide constituting Ent1071. In spite of peptide similarities, EntC differs from Ent1071 in major aspects, including the complementary activity among its constitutive peptides and its wider inhibitory spectrum of activity. Different amphiphilic alpha-helical conformations between EntC2 and Ent1071B could explain both, acquired complementary activity and increased antimicrobial spectrum.

Alternate Explosions: Collapse and Accretion Events with Red Holes instead of Black Holes

OpenAIRE

Graber, James S.

1999-01-01

A red hole is "just like a black hole" except it lacks an event horizon and a singularity. As a result, a red hole emits much more energy than a black hole during a collapse or accretion event. We consider how a red hole solution can solve the "energy crisis" and power extremely energetic gamma ray bursts and hypernovae.

Morphology and histochemistry of primary flight muscles in ...

African Journals Online (AJOL)

preincubation staining protocol for myosin ATPase. The primary flight muscles, serratus ventralis included type I, type IIa and type IIb fibers. Type I fibers were highly oxidative, as stained dark for NADHTR. Type IIa fibers exhibited relatively weak staining properties for NADH-TR and SDH, indicating an intermediate oxidative ...

Spontaneous Intramuscular Hematomas of the Abdomen and Pelvis: A New Multilevel Algorithm to Direct Transarterial Embolization and Patient Management

Energy Technology Data Exchange (ETDEWEB)

Popov, Milen [Lausanne University Hospital, Department of Medicine (Switzerland); Sotiriadis, Charalampos; Gay, Frederique; Jouannic, Anne-Marie; Lachenal, Yann; Hajdu, Steven D.; Doenz, Francesco; Qanadli, Salah D., E-mail: salah.qanadli@chuv.ch [Lausanne University Hospital, Cardio-Thoracic and Vascular Unit, Department of Radiology (Switzerland)

2017-04-15

PurposeTo report our experience using a multilevel patient management algorithm to direct transarterial embolization (TAE) in managing spontaneous intramuscular hematoma (SIMH).Materials and MethodsFrom May 2006 to January 2014, twenty-seven patients with SIMH had been referred for TAE to our Radiology department. Clinical status and coagulation characteristics of the patients are analyzed. An algorithm integrating CT findings is suggested to manage SIMH. Patients were classified into three groups: Type I, SIMH with no active bleeding (AB); Type II, SIMH with AB and no muscular fascia rupture (MFR); and Type III, SIMH with MFR and AB. Type II is furthermore subcategorized as IIa, IIb and IIc. Types IIb, IIc and III were considered for TAE. The method of embolization as well as the material been used are described. Continuous variables are presented as mean ± SD. Categorical variables are reported as percentages. Technical success, clinical success, complications and 30-day mortality (d30 M) were analyzed.ResultsTwo patients (7.5%) had Type IIb, four (15%) Type IIc and 21 (77.5%) presented Type III. The detailed CT and CTA findings, embolization procedure and materials used are described. Technical success was 96% with a complication rate of 4%. Clinical success was 88%. The bleeding-related thirty-day mortality was 15% (all with Type III).ConclusionTAE is a safe and efficient technique to control bleeding that should be considered in selected SIMH as soon as possible. The proposed algorithm integrating CT features provides a comprehensive chart to select patients for TAE.Level of Evidence4.

Binding of thrombin-activated platelets to a fibrin scaffold through α(IIb)β₃ evokes phosphatidylserine exposure on their cell surface.

Science.gov (United States)

Brzoska, Tomasz; Suzuki, Yuko; Mogami, Hideo; Sano, Hideto; Urano, Tetsumei

2013-01-01

Recently, by employing intra-vital confocal microscopy, we demonstrated that platelets expose phosphatidylserine (PS) and fibrin accumulate only in the center of the thrombus but not in its periphery. To address the question how exposure of platelet anionic phospholipids is regulated within the thrombus, an in-vitro experiment using diluted platelet-rich plasma was employed, in which the fibrin network was formed in the presence of platelets, and PS exposure on the platelet surface was analyzed using Confocal Laser Scanning Microscopy. Almost all platelets exposed PS after treatment with tissue factor, thrombin or ionomycin. Argatroban abrogated fibrin network formation in all samples, however, platelet PS exposure was inhibited only in tissue factor- and thrombin-treated samples but not in ionomycin-treated samples. FK633, an α(IIb)β₃ antagonist, and cytochalasin B impaired platelet binding to the fibrin scaffold and significantly reduced PS exposure evoked by thrombin. Gly-Pro-Arg-Pro amide abrogated not only fibrin network formation, but also PS exposure on platelets without suppressing platelet binding to fibrin/fibrinogen. These results suggest that outside-in signals in platelets generated by their binding to the rigid fibrin network are essential for PS exposure after thrombin treatment.

Outcomes of patients with coronary artery perforation complicating percutaneous coronary intervention and correlations with the type of adjunctive antithrombotic therapy: pooled analysis from REPLACE-2, ACUITY, and HORIZONS-AMI trials.

Science.gov (United States)

Doll, Jacob A; Nikolsky, Eugenia; Stone, Gregg W; Mehran, Roxana; Lincoff, A Michael; Caixeta, Adriano; McLaurin, Brent; Cristea, Ecaterina; Fahy, Martin; Kesanakurthy, Vijaya; Lansky, Alexandra J

2009-10-01

The lack of a specific counteragent to bivalirudin may complicate the management of patients with coronary artery (CA) perforation during percutaneous coronary intervention (PCI). Assess outcomes of patients with CA perforation from three PCI trials comparing intravenous bivalirudin with provisional glycoprotein (GP) IIb/IIIa inhibition versus unfractionated heparin (UFH) plus GP IIb/IIIa. A pooled analysis of patients treated with PCI in three randomized trials including REPLACE-2, ACUITY, and HORIZONS-AMI. Among a total of 12,921 patients, CA perforation occurred in 35 patients (0.27%). By multivariable analysis, baseline creatinine clearance was the only independent predictor of CA perforation (per 10 mL/min decrease, odds ratio [95% confidence interval]= 1.28 [1.11, 1.47], P = 0.0007). At 30 days, patients with versus without CA perforation had significantly (all P values therapy of bivalirudin monotherapy was not associated with worse outcomes compared to treatment with UFH plus GP IIb/IIIa inhibitors.

String bit models for superstring

International Nuclear Information System (INIS)

Bergman, O.; Thorn, C.B.

1995-01-01

The authors extend the model of string as a polymer of string bits to the case of superstring. They mainly concentrate on type II-B superstring, with some discussion of the obstacles presented by not II-B superstring, together with possible strategies for surmounting them. As with previous work on bosonic string work within the light-cone gauge. The bit model possesses a good deal less symmetry than the continuous string theory. For one thing, the bit model is formulated as a Galilei invariant theory in (D - 2) + 1 dimensional space-time. This means that Poincare invariance is reduced to the Galilei subgroup in D - 2 space dimensions. Naturally the supersymmetry present in the bit model is likewise dramatically reduced. Continuous string can arise in the bit models with the formation of infinitely long polymers of string bits. Under the right circumstances (at the critical dimension) these polymers can behave as string moving in D dimensional space-time enjoying the full N = 2 Poincare supersymmetric dynamics of type II-B superstring

String bit models for superstring

Energy Technology Data Exchange (ETDEWEB)

Bergman, O.; Thorn, C.B.

1995-12-31

The authors extend the model of string as a polymer of string bits to the case of superstring. They mainly concentrate on type II-B superstring, with some discussion of the obstacles presented by not II-B superstring, together with possible strategies for surmounting them. As with previous work on bosonic string work within the light-cone gauge. The bit model possesses a good deal less symmetry than the continuous string theory. For one thing, the bit model is formulated as a Galilei invariant theory in (D {minus} 2) + 1 dimensional space-time. This means that Poincare invariance is reduced to the Galilei subgroup in D {minus} 2 space dimensions. Naturally the supersymmetry present in the bit model is likewise dramatically reduced. Continuous string can arise in the bit models with the formation of infinitely long polymers of string bits. Under the right circumstances (at the critical dimension) these polymers can behave as string moving in D dimensional space-time enjoying the full N = 2 Poincare supersymmetric dynamics of type II-B superstring.

Stability and electronic properties of groups IIB to VB metal ions in unusual oxidation states and the 2S /SUB 1/2/ electronic state in lithium borate glasses

International Nuclear Information System (INIS)

Aleksandrov, A.I.; Bubnov, N.N.; Kraevskii, S.L.; Prokof'ev, A.I.; Raspertova, Z.I.; Solinov, V.F.

1986-01-01

The authors study lithium borate glasses containing groups IIB to VB metal oxides. Chemically pure reagents were used to synthesize the glasses which were subjected to gamma-rays at 77 and 300 K with doses of up to 100 kR. The EST spectra were recorded on a Varian E-12 spectrometer in the 3 cm CW frequency region with a 100 kHz magnetic field modulation. It was established that after gamma-irradiation at 77 and 300 K of the lithium borate glass system containing up to 10% of cadmium, tin, thalium, and lead oxides, additional ESR lines arise in the free electron g factor region. The authors have determined the missing ESR spectra for nonactivated lithium borate glasses by studying glasses with additions of Zn, Ge, and Sb oxides

Runaway in the landscape

International Nuclear Information System (INIS)

Becker, Katrin; Becker, Melanie; Walcher, Johannes

2007-01-01

We consider flux compactifications of type IIB string theory on the mirror of a rigid Calabi-Yau. In special cases, these models are dual to the type IIA flux vacua with runaway direction in flux space. We show that new weak coupling AdS solutions can be found for large complex structure, while Minkowski solutions with all moduli stabilized are confined to be at strong coupling. The existence of these solutions, as found in a previous work, is nevertheless guaranteed by a nonrenormalization theorem of the type IIB flux superpotential. Based on our results, we are led to the conjecture that supersymmetric runaway directions in flux space are always accompanied by a spectrum of moduli masses reaching down to the AdS scale. This could be violated in a nonsupersymmetric situation

Analysis of prognostic factors in stage IIB-IVA cervical carcinoma treated with radiation therapy: value of computed tomography

International Nuclear Information System (INIS)

Ogino, Ichiro; Okamoto, Naoyuki; Andoh, Kazuo; Kitamura, Tatsuo; Okajima, Hiroyuki; Matsubara, Sho

1997-01-01

Purpose: To define the influence of the tumor size measured by computed tomography (CT) and lymph node involvement detected by CT in patients treated with radiation therapy for Stage IIB-IVA carcinoma of intact uterine cervix. Methods and Materials: This was a retrospective analysis of 233 patients with uterine cervical cancer managed with both external irradiation and high-dose-rate intracavitary brachytherapy (HDR-ICR) at Kanagawa Cancer Center. The results were analyzed for the end points of absolute survival (AS), disease-free survival (DFS), pelvic control (PC), and central control (CC). The parameters of stage, CT-measured anterior-posterior (AP) cervix size, and CT-detected lymph node metastases were evaluated using univariate and multivariate analysis. Results: The stage, AP cervix size, and lymph node involvement were significant pretreatment factors in univariate analysis with respect to AS, DFS, PC, and CC. Multivariate analysis confirmed that significant risk was associated with certain prognostic parameters. Those in terms of AS, in order of decreasing significance, were lymph node involvement, AP cervix size, age, and total HDR-ICR dose. When DFS was studied, lymph node involvement and AP cervix size were demonstrated to have a significant effect. Stage and lymph node involvement significantly affected PC. Conclusion: Because the International Federation of Gynecological Obstetrics staging system fails to incorporate important prognostic information about tumor volume and lymph node involvement, CT-detected lymph node metastases as well as CT-measured cervix size should be determined as complementary additional prognostic measures

Penrose limits, pp waves, and deformed M2-branes

International Nuclear Information System (INIS)

Cvetic, M.; Lue, H.; Pope, C.N.

2004-01-01

Motivated by the recent discussions of the Penrose limit of AdS 5 xS 5 , we examine a more general class of supersymmetric pp-wave solutions of the type IIB theory, with a larger number of nonvanishing structures in the self-dual 5-form. One of the pp-wave solutions can be obtained as a Penrose limit of a D3-D3 intersection. In addition to 16 standard supersymmetries these backgrounds always allow for supernumerary supersymmetries. The latter are in one-to-one correspondence with the linearly realized world-sheet supersymmetries of the corresponding exactly solvable type IIB string action. The pp-waves provide new examples where supersymmetries will survive in a T-duality transformation on the x + coordinate. The T-dual solutions can be lifted to give supersymmetric deformed M2-branes in D=11. The deformed M2-brane is dual to a three-dimensional field theory whose renormalization group flow runs from the conformal fixed point in the infrared regime to a nonconformal theory as the energy increases. At a certain intermediate energy scale there is a phase transition associated with a naked singularity of the M2-brane. In the ultraviolet limit the theory is related by T duality to an exactly solvable massive type IIB string theory

Characterizing and evaluating the expression of the type IIb sodium-dependent phosphate cotransporter (slc34a2) gene and its potential influence on phosphorus utilization efficiency in yellow catfish (Pelteobagrus fulvidraco).

Science.gov (United States)

Chen, Pei; Tang, Qin; Wang, Chunfang

2016-02-01

A sodium-dependent phosphate cotransporter gene, NaPi-IIb (slc34a2), was isolated from yellow catfish (Pelteobagrus fulvidraco) intestine through homology cloning and the rapid amplification of cDNA ends. The full-length cDNA of slc34a2 consisted of 2326 bp with an open reading frame encoding 621 amino acids, a 160-bp 5' untranslated region, and a 300-bp 3' untranslated region. The deduced amino acid sequence showed 79.0 and 70.9% sequence identity to Astyanax mexicanus and Pundamilia nyererei, respectively. The membrane-spanning domains based on the hydrophilic and hydrophobic properties of the deduced amino acids were predicted, and results showed that the putative protein had eight transmembrane domains, with the intracellular NH2 and COOH termini. Two functional regions including first intracellular loop and third extracellular loop as well as the six N-glycosylation sites in second extracellular loop were found. The slc34a2 mRNA in the tested tissues was examined through semiquantitative reverse transcription polymerase chain reaction and quantitative real-time PCR, with the highest level found in the anterior intestine, followed by the posterior and middle intestines. The slc34a2 mRNA expression in the whole intestine under different dietary phosphorus (P) treatments was detected using qPCR. The results showed that the slc34a2 expression levels in the low-P groups (0.33 and 0.56%) were significantly higher (p < 0.05) than levels in the sufficient-P (0.81%) and high-P (1.15, 1.31, and 1.57%) groups. High expression of slc34a2 mRNA in low-P groups stimulated P utilization efficiency, indicating the close relationship between genotype and phenotype in yellow catfish. In contrast with conventional strategies (formula and feeding strategies), this study provided another possible approach by using molecular techniques to increase the P utilization in yellow catfish.

The first ICRANet catalog of binary-driven hypernovae

Directory of Open Access Journals (Sweden)

Pisani G. B.

2018-01-01

Thanks to this novel theoretical and observational understanding, it was possible for ICRANet scientists to build the firstst BdHNe catalog, composed by the 345 BdHNe identified up to the end of 2016.

Altered fibre types in gastrocnemius muscle of high wheel-running selected mice with mini-muscle phenotypes.

Science.gov (United States)

Guderley, Helga; Joanisse, Denis R; Mokas, Sophie; Bilodeau, Geneviève M; Garland, Theodore

2008-03-01

Selective breeding of mice for high voluntary wheel running has favoured characteristics that facilitate sustained, aerobically supported activity, including a "mini-muscle" phenotype with markedly reduced hind limb muscle mass, increased mass-specific activities of oxidative enzymes, decreased % myosin heavy chain IIb, and, in the medial gastrocnemius, reduced twitch speed, reduced mass-specific isotonic power, and increased fatigue resistance. To evaluate whether selection has altered fibre type expression in mice with either "mini" or normal muscle phenotypes, we examined fibre types of red and white gastrocnemius. In both the medial and lateral gastrocnemius, the mini-phenotype increased activities of oxidative enzymes and decreased activities of glycolytic enzymes. In red muscle samples, the mini-phenotype markedly changed fibre types, with the % type I and type IIA fibres and the surface area of type IIA fibres increasing; in addition, mice from selected lines in general had an increased % type IIA fibres and larger type I fibres as compared with mice from control lines. White muscle samples from mini-mice showed dramatic structural alterations, with an atypical distribution of extremely small, unidentifiable fibres surrounded by larger, more oxidative fibres than normally present in white muscle. The increased proportion of oxidative fibres and these atypical small fibres together may explain the reduced mass and increased mitochondrial enzyme activities in mini-muscles. These and previous results demonstrate that extension of selective breeding beyond the time when the response of the selected trait (i.e. distance run) has levelled off can still modify the mechanistic underpinnings of this behaviour.

Does Skeletal Muscle Mass Influence Breast Cancer? Evaluating Mammary Tumorigenesis and Progression Genetically Hyper-Muscular Mice

National Research Council Canada - National Science Library

Zimmers, Teresa

2006-01-01

.... Mice lacking the skeletal muscle-specific muscle growth inhibitor myostatin and mice expressing a dominant negative form of the myostatin receptor, Activin Receptor Type IIB, display heightened muscle mass...

Binding of Thrombin-Activated Platelets to a Fibrin Scaffold through αIIbβ3 Evokes Phosphatidylserine Exposure on Their Cell Surface

Science.gov (United States)

Brzoska, Tomasz; Suzuki, Yuko; Mogami, Hideo; Sano, Hideto; Urano, Tetsumei

2013-01-01

Recently, by employing intra-vital confocal microscopy, we demonstrated that platelets expose phosphatidylserine (PS) and fibrin accumulate only in the center of the thrombus but not in its periphery. To address the question how exposure of platelet anionic phospholipids is regulated within the thrombus, an in-vitro experiment using diluted platelet-rich plasma was employed, in which the fibrin network was formed in the presence of platelets, and PS exposure on the platelet surface was analyzed using Confocal Laser Scanning Microscopy. Almost all platelets exposed PS after treatment with tissue factor, thrombin or ionomycin. Argatroban abrogated fibrin network formation in all samples, however, platelet PS exposure was inhibited only in tissue factor- and thrombin-treated samples but not in ionomycin-treated samples. FK633, an αIIbβ3 antagonist, and cytochalasin B impaired platelet binding to the fibrin scaffold and significantly reduced PS exposure evoked by thrombin. Gly-Pro-Arg-Pro amide abrogated not only fibrin network formation, but also PS exposure on platelets without suppressing platelet binding to fibrin/fibrinogen. These results suggest that outside-in signals in platelets generated by their binding to the rigid fibrin network are essential for PS exposure after thrombin treatment. PMID:23383331

Binding of thrombin-activated platelets to a fibrin scaffold through α(IIbβ₃ evokes phosphatidylserine exposure on their cell surface.

Directory of Open Access Journals (Sweden)

Tomasz Brzoska

Full Text Available Recently, by employing intra-vital confocal microscopy, we demonstrated that platelets expose phosphatidylserine (PS and fibrin accumulate only in the center of the thrombus but not in its periphery. To address the question how exposure of platelet anionic phospholipids is regulated within the thrombus, an in-vitro experiment using diluted platelet-rich plasma was employed, in which the fibrin network was formed in the presence of platelets, and PS exposure on the platelet surface was analyzed using Confocal Laser Scanning Microscopy. Almost all platelets exposed PS after treatment with tissue factor, thrombin or ionomycin. Argatroban abrogated fibrin network formation in all samples, however, platelet PS exposure was inhibited only in tissue factor- and thrombin-treated samples but not in ionomycin-treated samples. FK633, an α(IIbβ₃ antagonist, and cytochalasin B impaired platelet binding to the fibrin scaffold and significantly reduced PS exposure evoked by thrombin. Gly-Pro-Arg-Pro amide abrogated not only fibrin network formation, but also PS exposure on platelets without suppressing platelet binding to fibrin/fibrinogen. These results suggest that outside-in signals in platelets generated by their binding to the rigid fibrin network are essential for PS exposure after thrombin treatment.

Trans and surface membrane bound zervamicin IIB: 13C-MAOSS-NMR at high spinning speed

International Nuclear Information System (INIS)

Raap, J.; Hollander, J.; Ovchinnikova, T. V.; Swischeva, N. V.; Skladnev, D.; Kiihne, S.

2006-01-01

Interactions between 15 N-labelled peptides or proteins and lipids can be investigated using membranes aligned on a thin polymer film, which is rolled into a cylinder and inserted into the MAS-NMR rotor. This can be spun at high speed, which is often useful at high field strengths. Unfortunately, substrate films like commercially available polycarbonate or PEEK produce severe overlap with peptide and protein signals in 13 C-MAOSS NMR spectra. We show that a simple house hold foil support allows clear observation of the carbonyl, aromatic and C α signals of peptides and proteins as well as the ester carbonyl and choline signals of phosphocholine lipids. The utility of the new substrate is validated in applications to the membrane active peptide zervamicin IIB. The stability and macroscopic ordering of thin PC10 bilayers was compared with that of thicker POPC bilayers, both supported on the household foil. Sidebands in the 31 P-spectra showed a high degree of alignment of both the supported POPC and PC10 lipid molecules. Compared with POPC, the PC10 lipids are slightly more disordered, most likely due to the increased mobilities of the shorter lipid molecules. This mobility prevents PC10 from forming stable vesicles for MAS studies. The 13 C-peptide peaks were selectively detected in a 13 C-detected 1 H-spin diffusion experiment. Qualitative analysis of build-up curves obtained for different mixing times allowed the transmembrane peptide in PC10 to be distinguished from the surface bound topology in POPC. The 13 C-MAOSS results thus independently confirms previous findings from 15 N spectroscopy [Bechinger, B., Skladnev, D.A., Ogrel, A., Li, X., Rogozhkina, E.V., Ovchinnikova, T.V., O'Neil, J.D.J. and Raap, J. (2001) Biochemistry, 40, 9428-9437]. In summary, application of house hold foil opens the possibility of measuring high resolution 13 C-NMR spectra of peptides and proteins in well ordered membranes, which are required to determine the secondary and

Preoperative concomitant radio chemotherapy in bulky carcinoma of the cervix: Institut Curie experience; Chimioradiotherapie concomitante preoperatoire dans les carcinomes du col uterin de stades IB2 a IIB: experience de l'Institut Curie

Energy Technology Data Exchange (ETDEWEB)

Kirova, Y.M.; Bourhaleb, Z.; Campitelli, M.; De la Rochefordiere, A. [Institut Curie, Groupe de Gynecologie, Service d' Oncologie et de Radiotherapie, 75 - Paris (France); Alran, S.; Fourchotte, V. [Institut Curie, Groupe de Gynecologie, Service de Chirurgie, 75 - Paris (France); Plancher, C. [Institut Curie, Groupe de Gynecologie, Service de Biostatistique, 75 - Paris (France); Beuzeboc, P.; Cottu, P. [Institut Curie, Groupe de Gynecologie, Service d' Oncologie Medicale, 75 - Paris (France); Petrow, P. [Institut Curie, Groupe de Gynecologie, Service de Radiologie, 75 - Paris (France); Cremoux, P. de; Sastre-Garau, X. [Institut Curie, Groupe de Pathologie, Service de Radiologie, 75 - Paris (France)

2009-07-15

Purpose: To evaluate the treatment results of patients (pts) with Figo stage IB2, IIA, IIB cervical carcinoma (C.C.) treated with preoperative radio chemotherapy, followed by extended radical hysterectomy. Patients and methods: Retrospective study of 148 women treated to the Curie Institute for operable Figo Stage IB2 to IIB, biopsy proved C.C.. Among them, 70 pts, median age 46 years, were treated using the same regimen associating primary radio cis-platinum based chemotherapy,intracavitary LDR brachytherapy, followed by extended radical hysterectomy. Kaplan-Meier estimates were used to draw survival curves. Comparisons of survival distribution were assessed by the log-rank test. Results: Complete histological local-regional response was obtained in 56% of the pts (n = 39). Residual macroscopic or microscopic disease in the cervix was observed in 28 pts (40%). All but one had in situ microscopic residual C.C.. Lateral residual disease in the parametria was also present in nine pts, all with residual C.C.. Pelvic lymph nodes were free from microscopic disease in 56 pts (80%). Eight of 55 (11%) radiological N0 patients had microscopic nodal involvement, as compared to 6/15 (40%) radiological N1 (p = 0.03). Seventeen pts (25%) had residual cervix disease but negative nodes. After median follow-up of 40 months (range, 8-141), 38/70 patients (54.1%) are still alive and free of disease, six (8.6%) alive with disease, and 11 (15.8%) patients were lost for follow-up but free of disease. Conclusion: The treatment of locally advanced C.C. needs a new multidisciplinary diagnostic and treatment approach using new therapeutic arms to improve the survival and treatment tolerance among women presenting this disease. (authors)

Lineage Analysis of Circulating Trypanosoma cruzi Parasites and Their Association with Clinical Forms of Chagas Disease in Bolivia

Science.gov (United States)

del Puerto, Ramona; Nishizawa, Juan Eiki; Kikuchi, Mihoko; Iihoshi, Naomi; Roca, Yelin; Avilas, Cinthia; Gianella, Alberto; Lora, Javier; Gutierrez Velarde, Freddy Udalrico; Renjel, Luis Alberto; Miura, Sachio; Higo, Hiroo; Komiya, Norihiro; Maemura, Koji; Hirayama, Kenji

2010-01-01

Background The causative agent of Chagas disease, Trypanosoma cruzi, is divided into 6 Discrete Typing Units (DTU): Tc I, IIa, IIb, IIc, IId and IIe. In order to assess the relative pathogenicities of different DTUs, blood samples from three different clinical groups of chronic Chagas disease patients (indeterminate, cardiac, megacolon) from Bolivia were analyzed for their circulating parasites lineages using minicircle kinetoplast DNA polymorphism. Methods and Findings Between 2000 and 2007, patients sent to the Centro Nacional de Enfermedades Tropicales for diagnosis of Chagas from clinics and hospitals in Santa Cruz, Bolivia, were assessed by serology, cardiology and gastro-intestinal examinations. Additionally, patients who underwent colonectomies due to Chagasic magacolon at the Hospital Universitario Japonés were also included. A total of 306 chronic Chagas patients were defined by their clinical types (81 with cardiopathy, 150 without cardiopathy, 100 with megacolon, 144 without megacolon, 164 with cardiopathy or megacolon, 73 indeterminate and 17 cases with both cardiopathy and megacolon). DNA was extracted from 10 ml of peripheral venous blood for PCR analysis. The kinetoplast minicircle DNA (kDNA) was amplified from 196 out of 306 samples (64.1%), of which 104 (53.3%) were Tc IId, 4 (2.0%) Tc I, 7 (3.6%) Tc IIb, 1 (0.5%) Tc IIe, 26 (13.3%) Tc I/IId, 1 (0.5%) Tc I/IIb/IId, 2 (1.0%) Tc IIb/d and 51 (25.9%) were unidentified. Of the 133 Tc IId samples, three different kDNA hypervariable region patterns were detected; Mn (49.6%), TPK like (48.9%) and Bug-like (1.5%). There was no significant association between Tc types and clinical manifestations of disease. Conclusions None of the identified lineages or sublineages was significantly associated with any particular clinical manifestations in the chronic Chagas patients in Bolivia. PMID:20502516

Geometric transitions, flops and non-Kahler manifolds: II

International Nuclear Information System (INIS)

Becker, Melanie; Dasgupta, Keshav; Katz, Sheldon; Knauf, Anke; Tatar, Radu

2006-01-01

We continue our study of geometric transitions in type II and heterotic theories. In type IIB theory we discuss an F-theory setup which clarifies many of our earlier assumptions and allows us to study gravity duals of N=1 gauge theories with arbitrary global symmetry group G. We also point out the subtle differences between global and local metrics, and show that in many cases the global descriptions are far more complicated than discussed earlier. We determine the full global description in type I/heterotic theory. In type IIA, our analysis gives rise to a local non-Kahler metric whose global description involves a particular orientifold action with gauge fluxes localised on branes. We are also able to identify the three form fields that allow for a smooth flop in the M-theory lift. We briefly discuss the issues of generalized complex structures in type IIB theory and possible half-twisted models in the heterotic duals of our type II models. In a companion paper we will present details on the topological aspects of these models

Immunogenicity and safety evaluation of bivalent types 1 and 3 oral poliovirus vaccine by comparing different poliomyelitis vaccination schedules in China: A randomized controlled non-inferiority clinical trial.

Science.gov (United States)

Qiu, Jingjun; Yang, Yunkai; Huang, Lirong; Wang, Ling; Jiang, Zhiwei; Gong, Jian; Wang, Wei; Wang, Hongyan; Guo, Shaohong; Li, Chanjuan; Wei, Shuyuan; Mo, Zhaojun; Xia, Jielai

2017-06-03

The type 2 component of the oral poliovirus vaccine is targeted for global withdrawal through a switch from the trivalent oral poliovirus vaccine (tOPV) to a bivalent oral poliovirus vaccine (bOPV). The switch is intended to prevent paralytic polio caused by circulating vaccine-derived poliovirus type 2. We aimed to assess the immunogenicity and safety profile of 6 vaccination schedules with different sequential doses of inactivated poliovirus vaccine (IPV), tOPV, or bOPV. A randomized controlled trial was conducted in China in 2015. Healthy newborn babies randomly received one of the following 6 vaccination schedules: cIPV-bOPV-bOPV(I-B-B), cIPV-tOPV-tOPV(I-T-T), cIPV-cIPV-bOPV(I-I-B), cIPV-cIPV-tOPV(I-I-T), cIPV-cIPV-cIPV(I-I-I), or tOPV-tOPV-tOPV(T-T-T). Doses were administered sequentially at 4-6 week intervals after collecting baseline blood samples. Patients were proactively followed up for observation of adverse events after the first dose and 30 days after all doses. The primary study objective was to investigate the immunogenicity and safety profile of different vaccine schedules, evaluated by seroconversion, seroprotection and antibody titer against poliovirus types 1, 2, and 3 in the per-protocol population. Of 600 newborn babies enrolled, 504 (84.0%) were included in the per-protocol population. For type 1 poliovirus, the differences in the seroconversion were 1.17% (95% CI = -2.74%, 5.08%) between I-B-B and I-T-T and 0.00% (95% CI: -6.99%, 6.99%) between I-I-B and I-I-T; for type 3 poliovirus, differences in the seroconversion were 3.49% (95% CI: -1.50%, 8.48%) between I-B-B and I-T-T and -2.32% (95% CI: -5.51%, 0.86%) between I-I-B and I-I-T. The non-inferiority conclusion was achieved in both poliovirus type 1 and 3 with the margin of -10%. Of 24 serious adverse events reported, no one was vaccine-related. The vaccination schedules with bOPV followed by one or 2 doses of IPV were recommended to substitute for vaccinations involving tOPV without

RNA sequencing reveals a slow to fast muscle fiber type transition after olanzapine infusion in rats.

Directory of Open Access Journals (Sweden)

Christopher J Lynch

Full Text Available Second generation antipsychotics (SGAs, like olanzapine, exhibit acute metabolic side effects leading to metabolic inflexibility, hyperglycemia, adiposity and diabetes. Understanding how SGAs affect the skeletal muscle transcriptome could elucidate approaches for mitigating these side effects. Male Sprague-Dawley rats were infused intravenously with vehicle or olanzapine for 24h using a dose leading to a mild hyperglycemia. RNA-Seq was performed on gastrocnemius muscle, followed by alignment of the data with the Rat Genome Assembly 5.0. Olanzapine altered expression of 1347 out of 26407 genes. Genes encoding skeletal muscle fiber-type specific sarcomeric, ion channel, glycolytic, O2- and Ca2+-handling, TCA cycle, vascularization and lipid oxidation proteins and pathways, along with NADH shuttles and LDH isoforms were affected. Bioinformatics analyses indicate that olanzapine decreased the expression of slower and more oxidative fiber type genes (e.g., type 1, while up regulating those for the most glycolytic and least metabolically flexible, fast twitch fiber type, IIb. Protein turnover genes, necessary to bring about transition, were also up regulated. Potential upstream regulators were also identified. Olanzapine appears to be rapidly affecting the muscle transcriptome to bring about a change to a fast-glycolytic fiber type. Such fiber types are more susceptible than slow muscle to atrophy, and such transitions are observed in chronic metabolic diseases. Thus these effects could contribute to the altered body composition and metabolic disease olanzapine causes. A potential interventional strategy is implicated because aerobic exercise, in contrast to resistance exercise, can oppose such slow to fast fiber transitions.

SN 2011hs

DEFF Research Database (Denmark)

Bufano, F.; Pignata, G.; Bersten, M.

2014-01-01

Observations spanning a large wavelength range, from X-ray to radio, of the Type IIb supernova 2011hs are presented, covering its evolution during the first year after explosion. The optical light curve presents a narrower shape and a fainter luminosity at peak than previously observed for Type I...

NAVAIR Progress in Assessing, Validating and Implementing Non-Chromate Primers (Briefing charts)

Science.gov (United States)

2011-02-09

logistics for any new coating or coating system NAVAIR Application Areas for Hexavalent Chromium Alternatives: Status Components/ Structure... Hexavalent chromium alternatives Sacrificial Coating Post Treatment MIL-A-8625 Anodize Avionics/ Electronics Magnesium/Titanium Conversion Aluminum Anodizing...Aluminum Pretreatment Type IC Seal Type IIB Seal Type II Seal Phosphating Rinse (Aluminum)Rinse (Steel) Cadmium Zinc-Nickel Aluminum Bonding Chrome

Clot retraction is mediated by factor XIII-dependent fibrin-αIIbβ3-myosin axis in platelet sphingomyelin-rich membrane rafts.

Science.gov (United States)

Kasahara, Kohji; Kaneda, Mizuho; Miki, Toshiaki; Iida, Kazuko; Sekino-Suzuki, Naoko; Kawashima, Ikuo; Suzuki, Hidenori; Shimonaka, Motoyuki; Arai, Morio; Ohno-Iwashita, Yoshiko; Kojima, Soichi; Abe, Mitsuhiro; Kobayashi, Toshihide; Okazaki, Toshiro; Souri, Masayoshi; Ichinose, Akitada; Yamamoto, Naomasa

2013-11-07

Membrane rafts are spatially and functionally heterogenous in the cell membrane. We observed that lysenin-positive sphingomyelin (SM)-rich rafts are identified histochemically in the central region of adhered platelets where fibrin and myosin are colocalized on activation by thrombin. The clot retraction of SM-depleted platelets from SM synthase knockout mouse was delayed significantly, suggesting that platelet SM-rich rafts are involved in clot retraction. We found that fibrin converted by thrombin translocated immediately in platelet detergent-resistant membrane (DRM) rafts but that from Glanzmann's thrombasthenic platelets failed. The fibrinogen γ-chain C-terminal (residues 144-411) fusion protein translocated to platelet DRM rafts on thrombin activation, but its mutant that was replaced by A398A399 at factor XIII crosslinking sites (Q398Q399) was inhibited. Furthermore, fibrin translocation to DRM rafts was impaired in factor XIII A subunit-deficient mouse platelets, which show impaired clot retraction. In the cytoplasm, myosin translocated concomitantly with fibrin translocation into the DRM raft of thrombin-stimulated platelets. Furthermore, the disruption of SM-rich rafts by methyl-β-cyclodextrin impaired myosin activation and clot retraction. Thus, we propose that clot retraction takes place in SM-rich rafts where a fibrin-αIIbβ3-myosin complex is formed as a primary axis to promote platelet contraction.

Differential expression of P-type ATPases in intestinal epithelial cells: Identification of putative new atp1a1 splice-variant

International Nuclear Information System (INIS)

Rocafull, Miguel A.; Thomas, Luz E.; Barrera, Girolamo J.; Castillo, Jesus R. del

2010-01-01

P-type ATPases are membrane proteins that couple ATP hydrolysis with cation transport across the membrane. Ten different subtypes have been described. In mammalia, 15 genes of P-type ATPases from subtypes II-A, II-B and II-C, that transport low-atomic-weight cations (Ca 2+ , Na + , K + and H + ), have been reported. They include reticulum and plasma-membrane Ca 2+ -ATPases, Na + /K + -ATPase and H + /K + -ATPases. Enterocytes and colonocytes show functional differences, which seem to be partially due to the differential expression of P-type ATPases. These enzymes have 9 structural motifs, being the phosphorylation (E) and the Mg 2+ ATP-binding (H) motifs the most preserved. These structural characteristics permitted developing a Multiplex-Nested-PCR (MN-PCR) for the simultaneous identification of different P-type ATPases. Thus, using MN-PCR, seven different cDNAs were cloned from enterocytes and colonocytes, including SERCA3, SERCA2, Na + /K + -ATPase α1-isoform, H + /K + -ATPase α2-isoform, PMCA1, PMCA4 and a cDNA-fragment that seems to be a new cassette-type splice-variant of the atp1a1 gen. PMCA4 in enterocytes and H + /K + -ATPase α2-isoform in colonocytes were differentially expressed. This cell-specific expression pattern is related with the distinctive enterocyte and colonocyte functions.

Effect of glycoprotein IIb/IIIa receptor inhibition on angiographic complications during percutaneous coronary intervention in the ESPRIT trial.

Science.gov (United States)

Blankenship, J C; Tasissa, G; O'Shea, J C; Iliadis, E A; Bachour, F A; Cohen, D J; Lui, H K; Mann, T; Cohen, E; Tcheng, J E

2001-09-01

We sought to determine whether eptifibatide decreases the incidence of in-laboratory angiographic complications and to determine the relationship of angiographically evident complications to elevations of creatine kinase-MB (CK-MB) enzyme levels during percutaneous coronary intervention. In the Enhanced Suppression of the Platelet IIb/IIIa Receptor with Integrilin Therapy (ESPRIT) trial, eptifibatide during coronary intervention was associated with decreased ischemic complications at 48 h and 30 days. Patients (n = 2,064) were randomized to placebo versus eptifibatide (two 180 microg/kg boluses 10 min apart and as a continuous infusion of 2 microg/kg per min) during percutaneous coronary stenting. Angiographic complications including major dissection, distal embolization, residual thrombus, abrupt closure, residual stenosis >50% and side-branch occlusion were prospectively recorded by the operator. Creatine kinase-MB levels were measured after the procedure and every 6 h thereafter. The incidence of angiographic complications and CK-MB elevation was determined for eptifibatide versus placebo groups. Eptifibatide-treated patients demonstrated nonsignificant trends toward fewer angiographic complications (10 vs. 12% for placebo patients, p = 0.13) and, for patients with angiographic complications, fewer subsequent CK-MB elevations (43 vs. 50% for placebo patients, p = 0.31). In patients without any angiographic complications, the incidence of CK-MB elevation >3 times the normal was 7% with placebo and 4% with eptifibatide (p = 0.003). Eptifibatide during nonurgent coronary stent intervention only minimally (and insignificantly) reduces the incidence of angiographic complications and subsequent CK-MB elevations in patients developing an angiographic complication. The greater effect is to reduce myocardial infarction in patients undergoing otherwise uneventful coronary stent implantation as well as in the overall study population.

Does the parasite-mediated selection drive the MHC class IIB diversity in wild populations of European chub (Squalius cephalus)?

Science.gov (United States)

Seifertová, Mária; Jarkovský, Jiří; Šimková, Andrea

2016-04-01

The genes of major histocompatibility complex (MHC) provide an excellent opportunity to study host-parasite relationships because they are expected to evolve in response to parasites and variation in parasite communities. In this study, we investigated the potential role of parasite-mediated selection acting on MHC class IIB (DAB) genes in European chub (Squalius cephalus) natural populations. We found significant differences between populations in metazoan parasites, neutral and adaptive genetic diversities. The analyses based on pairwise data revealed that populations with dissimilar MHC allelic profiles were geographically distant populations with significantly different diversity in microsatellites and a dissimilar composition of parasite communities. The results from the generalized estimating equations method (GEE) on the level of individuals revealed that metazoan parasite load in European chub was influenced by the diversity of DAB alleles as well as by the diversity of neutral genetic markers and host traits reflecting condition and immunocompetence. The multivariate co-inertia analysis showed specific associations between DAB alleles and parasite species. DAB1-like alleles were more involved in associations with ectoparasites, while DAB3-like alleles were positively associated with endoparasites which could suggest potential differences between DAB genes caused by different selection pressure. Our study revealed that parasite-mediated selection is not the only variable affecting MHC diversity in European chub; however, we strongly support the role of neutral processes as the main driver of DAB diversity across populations. In addition, our study contributes to the understanding of the evolution of MHC genes in wild living fish.

On SYM theory and all order bulk singularity structures of BPS strings in type II theory

Science.gov (United States)

Hatefi, Ehsan

2018-06-01

The complete forms of the S-matrix elements of a transverse scalar field, two world volume gauge fields, and a Potential Cn-1 Ramond-Ramond (RR) form field are investigated. In order to find an infinite number of t , s , (t + s + u)-channel bulk singularity structures of this particular mixed open-closed amplitude, we employ all the conformal field theory techniques to , exploring all the entire correlation functions and all order α‧ contact interactions to these supersymmetric Yang-Mills (SYM) couplings. Singularity and contact term comparisons with the other symmetric analysis, and are also carried out in detail. Various couplings from pull-Back of branes, Myers terms and several generalized Bianchi identities should be taken into account to be able to reconstruct all order α‧ bulk singularities of type IIB (IIA) superstring theory. Finally, we make a comment on how to derive without any ambiguity all order α‧ contact terms of this S-matrix which carry momentum of RR in transverse directions.

Effect of chronic ethanol ingestion and exercise training on skeletal muscle in rat.

Science.gov (United States)

Vila, L; Ferrando, A; Voces, J; Cabral de Oliveira, C; Prieto, J G; Alvarez, A I

2001-09-01

The aim of this study was to investigate the interactive effects of exercise training and chronic ethanol consumption on metabolism, capillarity, and myofibrillar composition in rat limb muscles. Male Wistar rats were treated in separate groups as follows: non exercised-control; ethanol (15%) in animals' drinking water for 12 weeks; exercise training in treadmill and ethanol administration plus exercise for 12 weeks. Ethanol administration decreased capillarity and increased piruvate kinase and lactate dehydrogenase activities in white gastrocnemius; in plantaris muscle, ethanol increased citrate synthase activity and decreased cross-sectional area of type I, IIa, and IIb fibres. Exercise increased capillarity in all four limb muscles and decreased type I fibre area in plantaris. The decreased capillarity effect induced by ethanol in some muscles, was ameliorated when alcohol was combined with exercise. While alcoholic myopathy affects predominantly type IIb fibres, ethanol administration and aerobic exercise in some cases can affect type I and type IIa fibre areas. The exercise can decrease some harmful effects produced by ethanol in the muscle, including the decrease in the fibre area and capillary density.

Comparison of calculated and direct low density lipoprotein ...

African Journals Online (AJOL)

. Methods: The clinical performance of the two methods was evaluated by analysing 211 fresh plasma samples from fasting adult patients. The samples were divided into four groups-normolipidaemic; and Types IIa, IIb and IV hyperlipidaemias.

Equine endometrial fibrosis correlates with 11beta-HSD2, TGF-beta1 and ACE activities.

Science.gov (United States)

Ganjam, V K; Evans, T J

2006-03-27

Endometrial periglandular fibrosis (EPF) contributes to embryonic and fetal loss in mares. Equine EPF correlates inversely with conception and successful gestation. In the modified Kenney endometrial biopsy classification system, EPF categories I, IIA, IIB, and III correspond to minimal, mild, moderate, and severe fibrosis (+/-inflammation), respectively. Paraffin sections of biopsy specimens were stained with H&E, and picrosirius red (specific for fibrillar collagens types I and III), to determine %EPCVF. Endometrial ACE-binding activity, TGF-beta1 and 11beta-HSD2 activities were also measured. Ultrastructural changes in EPF categories IIB and III endometria strongly suggested myofibroblastic transformation. ACE-binding activity was highest in EPF category IIB; however, endometrial TGF-beta1 and 11beta-HSD2 activities were significantly correlated to the severity of EPF (P<0.05). We conclude that, locally generated angiotensin II initiates the expression of TGF-beta1 resulting in myofibroblastic transformation. 11Beta-HSD2 in concert appears to modulate the severity of endometrial fibrosis.

Shock interactions between Sgr A East and its environments

International Nuclear Information System (INIS)

Lee, Sungho; Pak, Soojong; Geballe, T R; Lee, Sang-Gak; Davis, Christopher J; Choi, Minho; Minh, Y C; Herrnstein, Robeson M; Ho, Paul T P

2006-01-01

We have surveyed the interaction regions between Sgr A East and the surrounding molecular clouds in the H 2 1-0 S(l) (2.1218 μm) line emission. The resulting data cube shows the distribution of the H 2 emission both in space (with a resolution of about 2 arcsec) and in velocity (with a resolution of about 18 km s -1 ). Our data are compared with NH 3 (3,3) data from radio observations to investigate the gas kinematics. Based on the H 2 1-0 S(l) line's intensity, its ratio to H 2 2 - 1 S(1), and its gas kinematics, we conclude that the emitting H 2 is excited by strong molecular shocks. We estimate shock velocities (≅ 100 km s -1 ) by comparing the H 2 line profles with those of NH 3 , and derive an initial explosion energy of 0.2 - 4 x 10 53 ergs. Such a high energy excludes a single normal supernova for the origin of Sgr A East. We examine other hypotheses, including the tidal disruption of a star by the supermassive black hole (Sgr A*), multiple supernovae, and a hypernova. We suggest that a hypernova, which is believed to originate from a collapsar or microquasar, is the most probable origin

A phase IIb trial of vorinostat in combination with lenalidomide and dexamethasone in patients with multiple myeloma refractory to previous lenalidomide-containing regimens.

Science.gov (United States)

Sanchez, Larysa; Vesole, David H; Richter, Joshua R; Biran, Noa; Bilotti, Elizabeth; McBride, Laura; Anand, Palka; Ivanovski, Kristin; Siegel, David S

2017-02-01

Clinical trials of vorinostat, a Class I/II histone deacetylase inhibitor, in combination with proteasome inhibitors and immunomodulatory agents have shown activity in relapsed/refractory multiple myeloma. This phase IIb, open-label, single-institution study evaluated the efficacy of vorinostat in combination with lenalidomide and dexamethasone in lenalidomide-refractory patients. Patients were considered lenalidomide-refractory if they had no clinical response (vorinostat 400 mg days 1-7 and 15-21, lenalidomide 25 mg days 1-21, and dexamethasone 40 mg days 1, 8, 15 and 22 in 28-day cycles. Twenty-five patients were enrolled, median age was 65 years and patients had received a median of 5 prior regimens. The overall response rate was 24% (6 partial responses) and clinical benefit rate (≥stable disease) was 80%. Median time to a partial response was 1·9 months and median duration of response was 3·3 months. Median progression-free survival was 5·3 months. Most common grade 3/4 adverse events were neutropenia (48%), thrombocytopenia (32%), anaemia (20%) and gastrointestinal toxicities (16%). In this heavily pre-treated population, vorinostat in combination with lenalidomide and dexamethasone was active in lenalidomide-refractory patients. © 2016 John Wiley & Sons Ltd.

Lepton family symmetries for neutrino masses and mixing

Indian Academy of Sciences (India)

from the fact that any symmetry defined in the basis (νe,νµ,ντ ) is automatically applicable to ... Compare this first theory of everything to today's contender, i.e. string ... is dual to heterotic SO(32), Type IIA is dual to heterotic E8 × E8, and Type IIB.

Tofacitinib for induction and maintenance therapy of Crohn's disease: results of two phase IIb randomised placebo-controlled trials.

Science.gov (United States)

Panés, Julian; Sandborn, William J; Schreiber, Stefan; Sands, Bruce E; Vermeire, Séverine; D'Haens, Geert; Panaccione, Remo; Higgins, Peter D R; Colombel, Jean-Frederic; Feagan, Brian G; Chan, Gary; Moscariello, Michele; Wang, Wenjin; Niezychowski, Wojciech; Marren, Amy; Healey, Paul; Maller, Eric

2017-06-01

Tofacitinib is an oral, small-molecule Janus kinase inhibitor that is being investigated for IBD. We evaluated the efficacy and safety of tofacitinib for induction and maintenance treatment in patients with moderate-to-severe Crohn's disease (CD). We conducted two randomised, double-blind, placebo-controlled, multicentre phase IIb studies. Adult patients with moderate-to-severe CD were randomised to receive induction treatment with placebo, tofacitinib 5 or 10 mg twice daily for 8 weeks. Those achieving clinical response-100 or remission were re-randomised to maintenance treatment with placebo, tofacitinib 5 or 10 mg twice daily for 26 weeks. Primary endpoints were clinical remission at the end of the induction study, and clinical response-100 or remission at the end of the maintenance study. 180/280 patients randomised in the induction study were enrolled in the maintenance study. At week 8 of induction, the proportion of patients with clinical remission was 43.5% and 43.0% with 5 and 10 mg twice daily, respectively, compared with 36.7% in the placebo group (p=0.325 and 0.392 for 5 and 10 mg twice daily vs placebo). At week 26 of maintenance, the proportion of patients with clinical response-100 or remission was 55.8% with tofacitinib 10 mg twice daily compared with 39.5% with tofacitinib 5 mg twice daily and 38.1% with placebo (p=0.130 for 10 mg twice daily vs placebo). Compared with placebo, the change in C-reactive protein from baseline was statistically significant (ptofacitinib. NCT01393626 and NCT01393899. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

HYPERCRITICAL ACCRETION, INDUCED GRAVITATIONAL COLLAPSE, AND BINARY-DRIVEN HYPERNOVAE

Energy Technology Data Exchange (ETDEWEB)

Fryer, Chris L. [CCS-2, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Rueda, Jorge A.; Ruffini, Remo [ICRANet, Piazza della Repubblica 10, I-65122 Pescara (Italy)

2014-10-01

The induced gravitational collapse (IGC) paradigm has been successfully applied to the explanation of the concomitance of gamma-ray bursts (GRBs) with supernovae (SNe) Ic. The progenitor is a tight binary system composed of a carbon-oxygen (CO) core and a neutron star (NS) companion. The explosion of the SN leads to hypercritical accretion onto the NS companion, which reaches the critical mass, hence inducing its gravitational collapse to a black hole (BH) with consequent emission of the GRB. The first estimates of this process were based on a simplified model of the binary parameters and the Bondi-Hoyle-Lyttleton accretion rate. We present here the first full numerical simulations of the IGC phenomenon. We simulate the core-collapse and SN explosion of CO stars to obtain the density and ejection velocity of the SN ejecta. We follow the hydrodynamic evolution of the accreting material falling into the Bondi-Hoyle surface of the NS all the way up to its incorporation in the NS surface. The simulations go up to BH formation when the NS reaches the critical mass. For appropriate binary parameters, the IGC occurs in short timescales ∼10{sup 2}-10{sup 3} s owing to the combined effective action of the photon trapping and the neutrino cooling near the NS surface. We also show that the IGC scenario leads to a natural explanation for why GRBs are associated only with SNe Ic with totally absent or very little helium.

Engagement of αIIbβ3 (GPIIb/IIIa) with ανβ3 Integrin Mediates Interaction of Melanoma Cells with Platelets

Science.gov (United States)

Lonsdorf, Anke S.; Krämer, Björn F.; Fahrleitner, Manuela; Schönberger, Tanja; Gnerlich, Stephan; Ring, Sabine; Gehring, Sarah; Schneider, Stefan W.; Kruhlak, Michael J.; Meuth, Sven G.; Nieswandt, Bernhard; Gawaz, Meinrad; Enk, Alexander H.; Langer, Harald F.

2012-01-01

A mutual relationship exists between metastasizing tumor cells and components of the coagulation cascade. The exact mechanisms as to how platelets influence blood-borne metastasis, however, remain poorly understood. Here, we used murine B16 melanoma cells to observe functional aspects of how platelets contribute to the process of hematogenous metastasis. We found that platelets interfere with a distinct step of the metastasis cascade, as they promote adhesion of melanoma cells to the endothelium in vitro under shear conditions. Constitutively active platelet receptor GPIIb/IIIa (integrin αIIbβ3) expressed on Chinese hamster ovary cells promoted melanoma cell adhesion in the presence of fibrinogen, whereas blocking antibodies to aνβ3 integrin on melanoma cells or to GPIIb/IIIa significantly reduced melanoma cell adhesion to platelets. Furthermore, using intravital microscopy, we observed functional platelet-melanoma cell interactions, as platelet depletion resulted in significantly reduced melanoma cell adhesion to the injured vascular wall in vivo. Using a mouse model of hematogenous metastasis to the lung, we observed decreased metastasis of B16 melanoma cells to the lung by treatment with a mAb blocking the aν subunit of aνβ3 integrin. This effect was significantly reduced when platelets were depleted in vivo. Thus, the engagement of GPIIb/IIIa with aνβ3 integrin interaction mediates tumor cell-platelet interactions and highlights how this interaction is involved in hematogenous tumor metastasis. PMID:22102277

Geometry from Gauge Theory

International Nuclear Information System (INIS)

Correa, Diego H.; Silva, Guillermo A.

2008-01-01

We discuss how geometrical and topological aspects of certain (1/2)-BPS type IIB geometries are captured by their dual operators in N = 4 Super Yang-Mills theory. The type IIB solutions are characterized by arbitrary droplet pictures in a plane and we consider, in particular, axially symmetric droplets. The 1-loop anomalous dimension of the dual gauge theory operators probed with single traces is described by some bosonic lattice Hamiltonians. These Hamiltonians are shown to encode the topology of the droplets. In appropriate BMN limits, the Hamiltonians spectrum reproduces the spectrum of near-BPS string excitations propagating along each of the individual edges of the droplet. We also study semiclassical regimes for the Hamiltonians. For droplets having disconnected constituents, the Hamiltonian admits different complimentary semiclassical descriptions, each one replicating the semiclassical description for closed strings extending in each of the constituents

BPS dynamics of the triple (p,q) string junction

International Nuclear Information System (INIS)

Rey, S.-J.; Yee, J.-T.

1998-01-01

We study the dynamics of the triple junction of (p,q) strings in type IIB string theory. We probe the tension and mass density of (p,q) strings by studying harmonic fluctuations of the triple junction. We show that they agree perfectly with the BPS formula provided a suitable geometric interpretation of the junction is given. We provide a precise statement of the BPS limit and force-balance property. At weak coupling and sufficiently dense limit, we argue that a (p,q) string embedded in the string network is a 'wiggly string', whose low-energy dynamics can be described via a renormalization group evolved, smooth effective non-relativistic string. We also suggest the possibility that, upon type IIB strings being promoted to the M-theory membrane, there can exist 'evanescent' bound-states at the triple junction in the continuum. (orig.)

Muscle glycogen depletion patterns during draught work in Standardbred horses.

Science.gov (United States)

Gottlieb, M

1989-03-01

Muscle fibre recruitment was investigated during draught loaded exercise by studying glycogen depletion patterns from histochemical stains of muscle biopsies from the gluteus and semitendinosus muscles. Three Standardbred trotters performed several intervals of draught loaded exercise on a treadmill with 34 kp at a trot (7 m/sec) and with 34 and 80 kp, respectively at a walk (2m/sec). Exercise was continued until the horses were unwilling to continue. Glycogen depletion was seen in all three fibre types when trotting with 34 kp for 5 or 10 mins. When an equal weight resistance was pulled at a walk, glycogen depletion was first seen in type I fibres only, then followed by a small percentage of type IIA fibres after at least 1 h. When 80 kp was pulled at a walk both type I and IIA fibres showed glycogen depletion, and after at least 30 mins exercise a small percentage of type IIB fibres was also depleted. These results indicate that the muscle fibres are depleted, in order, from type I through IIA to IIB as the intensity or duration of draught work increases.

Differential expression of P-type ATPases in intestinal epithelial cells: Identification of putative new atp1a1 splice-variant

Energy Technology Data Exchange (ETDEWEB)

Rocafull, Miguel A., E-mail: mrocaful@ivic.ve [Lab. Fisiologia Molecular, Centro de Biofisica y Bioquimica, Instituto Venezolano de Investigaciones Cientificas (IVIC), Apartado 20632, Caracas 1020-A (Venezuela, Bolivarian Republic of); Thomas, Luz E.; Barrera, Girolamo J.; Castillo, Jesus R. del [Lab. Fisiologia Molecular, Centro de Biofisica y Bioquimica, Instituto Venezolano de Investigaciones Cientificas (IVIC), Apartado 20632, Caracas 1020-A (Venezuela, Bolivarian Republic of)

2010-01-01

P-type ATPases are membrane proteins that couple ATP hydrolysis with cation transport across the membrane. Ten different subtypes have been described. In mammalia, 15 genes of P-type ATPases from subtypes II-A, II-B and II-C, that transport low-atomic-weight cations (Ca{sup 2+}, Na{sup +}, K{sup +} and H{sup +}), have been reported. They include reticulum and plasma-membrane Ca{sup 2+}-ATPases, Na{sup +}/K{sup +}-ATPase and H{sup +}/K{sup +}-ATPases. Enterocytes and colonocytes show functional differences, which seem to be partially due to the differential expression of P-type ATPases. These enzymes have 9 structural motifs, being the phosphorylation (E) and the Mg{sup 2+}ATP-binding (H) motifs the most preserved. These structural characteristics permitted developing a Multiplex-Nested-PCR (MN-PCR) for the simultaneous identification of different P-type ATPases. Thus, using MN-PCR, seven different cDNAs were cloned from enterocytes and colonocytes, including SERCA3, SERCA2, Na{sup +}/K{sup +}-ATPase {alpha}1-isoform, H{sup +}/K{sup +}-ATPase {alpha}2-isoform, PMCA1, PMCA4 and a cDNA-fragment that seems to be a new cassette-type splice-variant of the atp1a1 gen. PMCA4 in enterocytes and H{sup +}/K{sup +}-ATPase {alpha}2-isoform in colonocytes were differentially expressed. This cell-specific expression pattern is related with the distinctive enterocyte and colonocyte functions.

Preoperative radium therapy and radical hysterectomy in the treatment of cervical cancer stage IB, IIA, and initial IIB.; Radiumterapia pre-operatoria e histerectomia radical no tratamento do cancer do colo uterino IB, IIA e IIB inicial

Energy Technology Data Exchange (ETDEWEB)

Salum, Resalla; Lopes, Edison R.; Souza, Maria A.H. de [Faculdade de Medicina do Triangulo Mineiro, Uberaba, MG (Brazil). Hospital Escola

1995-07-01

Patients with IB, IIa and in initial IIb cervical cancer were randomized for combined therapy, consisting of one or two radium insertion followed by Wertheim Meigs operation performed 40 days later. We look for the early and late complications of the treatment, residual cancer after radiotherapy and survival without recurrence. The project begin in 1965 and ended in 1986. All the operations were done by one of the investigators and 116 patients were analysed. The age ranged from 21 to 75 years with an average of 4.18 years. During the operations 31 (26.72%) patients needed 1.500 cc or greater amount of blood transfusion and we have 3 iliac veins lesions. Managing the ureters, we do our best to leave the posterior fascia as intact as possible. Post operative complications ranged from minor (fever, localised pelvic infections, temporary popliteal nerve paralysis) to evisceration (3 patients) deep venous thrombosis (3 patients) and two early urinary fistulas. Late complications were seen in patients submitted to sequential teletherapy irradiation. One uretrovaginal fistula occurred 10 month after treatment, another one, 7 years later and the third one 24 years later. One patient develop hydronefrosis and enterocolite after 7.000 rads of teletherapy and another one rectovaginal fistula 13 years after initial therapy. The shortening of the vagina making impossible the intercourse was seen in 7 patients. By the histological examination, the cervix was sterilized in 73.3 % of the patients. Residual cancer was found according the original size of the tumour and the stage of the disease. Studying different combinations between the existence of residual cervical cancer with positive or negative limphnodes and making a correlation with survival, we found the critical points is to have positive cervix and positive lymphonodes. The five years survival (life table methodology) for stage 1 lesion was 96%; stage II, 67%. At ten years survival was slighted different. With positive

Fiscal Year 1986 Department of Energy authorization (basic research programs). Volume II-B. Hearing before the Subcommittee on Energy Development and Applications of the Committee on Science and Technology, US House of Representatives, Ninety-Ninth Congress, First Session, February 28, 1985

International Nuclear Information System (INIS)

Anon.

1985-01-01

Volume II-B of the hearing record contains Appendix 3 and Appendix 4 of Volume II-A. Appendix 3 provides supporting materials on the accomplishments and project summaries of the various departments under the Office of Basic Energy Sciences. This includes DOE supported work in engineering, chemistry, biology, mathematics, geology, and the energy sciences. Appendix 4 provides summaries of DOE supported work on high energy physics, which investigates the nature of matter and the behavior of matter and energy. Over 90% of the funding for this work comes from DOE, which is responsible for national planning in the effort to develop accelerator facilities, the superconducting super collider, and other physics programs

Risk reductions for cardiovascular disease with pravastatin treatment by dyslipidemia phenotype: a post hoc analysis of the MEGA Study.

Science.gov (United States)

Nishiwaki, Masato; Ikewaki, Katsunori; Ayaori, Makoto; Mizuno, Kyoichi; Ohashi, Yasuo; Ohsuzu, Fumitaka; Ishikawa, Toshitsugu; Nakamura, Haruo

2013-03-01

The beneficial effect of statins for cardiovascular disease (CVD) prevention has been well established. However, the effectiveness among different phenotypes of dyslipidemia has not been confirmed. We evaluated the effect of pravastatin on the incidence of CVD in relation to the phenotype of dyslipidemia. The MEGA Study evaluated the effect of low-dose pravastatin on primary prevention of CVD in 7832 Japanese patients, who were randomized to diet alone or diet plus pravastatin and followed for more than 5 years. These patients were classified into phenotype IIa (n=5589) and IIb (n=2041) based on the electrophoretic pattern for this post hoc analysis. In the diet group there was no significant difference in the incidence of coronary heart disease (CHD), stroke, CVD, and total mortality between the two phenotypes. Phenotype IIb patients, compared to phenotype IIa, had lower levels of high-density lipoprotein cholesterol (HDL-C) and a significantly higher incidence of CVD in relation to a low HDL-C level (dyslipidemia. Significant risk reductions were observed for CHD by 38% (p=0.04) and CVD by 31% (p=0.02) in type IIa dyslipidemia but not in phenotype IIb. Pravastatin therapy provided significant risk reductions for CHD and CVD in patients with phenotype IIa dyslipidemia, but not in those with phenotype IIb dyslipidemia. Copyright © 2012 Japanese College of Cardiology. Published by Elsevier Ltd. All rights reserved.

Fibrocystic disease of the breast: Analysis of sonographic findings with histopathologic correlation

Energy Technology Data Exchange (ETDEWEB)

Shin, Kyoung Suk; Kim, Chung Hyun; Lee, Chung Keun; Oh, Young Ran; Cho, June Sik; Rhee, Byung Chull; Kang, Dong Wook [Chungnam National University College of Medicine, Daejeon (Korea, Republic of)

1994-12-15

To evaluate the sonographic findings of fibrocystic disease with histopathologic correlation, we retrospectively analyzed the sonographic findings and pathologic findings of 48 cases with histopathologically proven fibrocystic disease. The sonographic pattern of the lesions were classified into type I (ill define disoechoic lesion), Type IIa (ill defined hypoechoic lesion with heterogeneity), Type IIb (ill defined hypoechoiclesion with nodularities), Type III (mass lesion with thick or thin boundary echoes). The pathologic feature was classified into stromal hyperplasia, mixed, proliferative and fibroadenomatosis patterns. In sonographic type I,stromal hyperplasia and mixed patterns were seen in 77% and 23% , respectively. In sonographic Type IIa, stromal hyperplasia, mixed and proliferative patterns were seen in 57%, 29% and 14%, respectively. In sonographic TypeIIb, stromal hyperplasia and mixed patterns were seen in 17% and 83%, respectively. In sonographic type III, stromal hyperplasia, mixed, proliferative and fire-and-brimstone patterns were seen in 10%, 23%,13% and 54%, respectively.In conclusion, the sonographic findings of fibrocystic disease were variable and were not correlated good with histopathologic patterns. Sonography might to be helpful in the diagnosis of fibrocystic disease in conjunction with other imaging modalities in cases with Type I or Type II sonographic patterns. However, in cases with Type III patterns, biopsy should be performed to differentiate them from other benign or malignant masses

Fibrocystic disease of the breast: Analysis of sonographic findings with histopathologic correlation

International Nuclear Information System (INIS)

Shin, Kyoung Suk; Kim, Chung Hyun; Lee, Chung Keun; Oh, Young Ran; Cho, June Sik; Rhee, Byung Chull; Kang, Dong Wook

1994-01-01

To evaluate the sonographic findings of fibrocystic disease with histopathologic correlation, we retrospectively analyzed the sonographic findings and pathologic findings of 48 cases with histopathologically proven fibrocystic disease. The sonographic pattern of the lesions were classified into type I (ill define disoechoic lesion), Type IIa (ill defined hypoechoic lesion with heterogeneity), Type IIb (ill defined hypoechoiclesion with nodularities), Type III (mass lesion with thick or thin boundary echoes). The pathologic feature was classified into stromal hyperplasia, mixed, proliferative and fibroadenomatosis patterns. In sonographic type I,stromal hyperplasia and mixed patterns were seen in 77% and 23% , respectively. In sonographic Type IIa, stromal hyperplasia, mixed and proliferative patterns were seen in 57%, 29% and 14%, respectively. In sonographic TypeIIb, stromal hyperplasia and mixed patterns were seen in 17% and 83%, respectively. In sonographic type III, stromal hyperplasia, mixed, proliferative and fire-and-brimstone patterns were seen in 10%, 23%,13% and 54%, respectively.In conclusion, the sonographic findings of fibrocystic disease were variable and were not correlated good with histopathologic patterns. Sonography might to be helpful in the diagnosis of fibrocystic disease in conjunction with other imaging modalities in cases with Type I or Type II sonographic patterns. However, in cases with Type III patterns, biopsy should be performed to differentiate them from other benign or malignant masses

Insight into the recognition, binding, and reactivity of catalytic metallodrugs targeting stem loop IIb of hepatitis C IRES RNA.

Science.gov (United States)

Bradford, Seth S; Ross, Martin James; Fidai, Insiya; Cowan, James A

2014-06-01

The complex Cu-GGHYrFK-amide (1-Cu) was previously reported as a novel metallotherapeutic that catalytically inactivates stem loop IIb (SLIIb) of the hepatitis C virus (HCV) internal ribosomal entry site (IRES) RNA and demonstrates significant antiviral activity in a cellular HCV replicon assay. Herein we describe additional studies focused on understanding the cleavage mechanism as well as the relationship of catalyst configuration to structural recognition and site-selective cleavage of the structured RNA motif. These are advanced by use of a combination of MALDI-TOF mass spectrometry, melting temperature determinations, and computational analysis to develop a structural model for binding and reactivity toward SLIIb of the IRES RNA. In addition, the binding, reactivity, and structural chemistry of the all-D-amino acid form of this metallopeptide, complex 2-Cu, are reported and compared with those of complex 1-Cu. In vitro RNA binding and cleavage assays for complex 2-Cu show a KD value of 76 ± 3 nM, and Michaelis-Menten parameters of kcat =0.14 ± 0.01 min(-1) and KM =7.9 ± 1.2 μM, with a turnover number exceeding 40. In a luciferase-based cellular replicon assay Cu-GGhyrfk-amide shows activity similar to that of the 1-Cu parent peptide, with an IC50 value of 1.9 ± 0.4 μM and cytotoxicity exceeding 100 μM. RT-PCR experiments confirm a significant decrease in HCV RNA levels in replicon assays for up to nine days when treated with complex 1-Cu in three-day dosing increments. This study shows the influence that the α-carbon stereocenter has for this new class of compounds, while detailed mass spectrometry and computational analyses provide new insight into the mechanisms of recognition, binding, and reactivity. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

On the scarcity of weak coupling in the string landscape

Science.gov (United States)

Halverson, James; Long, Cody; Sung, Benjamin

2018-02-01

We study the geometric requirements on a threefold base for the corresponding F-theory compactification to admit a weakly-coupled type IIB limit. We examine both the standard Sen limit and a more restrictive limit, and determine conditions sufficient for their non-existence for both toric bases and more general algebraic bases. In a large ensemble of geometries generated by base changing resolutions we derive an upper bound on the frequency with which a weak-coupling limit may occur, and find that such limits are extremely rare. Our results sharply quantify the widely held notion that the vast number of weakly-coupled IIB vacua is but a tiny fraction of the landscape.

Improvement of Endurance Based on Muscle Fiber-Type Composition by Treatment with Dietary Apple Polyphenols in Rats.

Directory of Open Access Journals (Sweden)

Wataru Mizunoya

Full Text Available A recent study demonstrated a positive effect of apple polyphenol (APP intake on muscle endurance of young-adult animals. While an enhancement of lipid metabolism may be responsible, in part, for the improvement, the contributing mechanisms still need clarification. Here we show that an 8-week intake of 5% (w/w APP in the diet, up-regulates two features related to fiber type: the ratio of myosin heavy chain (MyHC type IIx/IIb and myoglobin protein expression in plantaris muscle of 9-week-old male Fischer F344 rats compared to pair-fed controls (P < 0.05. Results were demonstrated by our SDS-PAGE system specialized for MyHC isoform separation and western blotting of whole muscles. Animal-growth profiles (food intake, body-weight gain, and internal-organ weights did not differ between the control and 5% APP-fed animals (n = 9/group. Findings may account for the increase in fatigue resistance of lower hind limb muscles, as evidenced by a slower decline in the maximum isometric planter-flexion torque generated by a 100-s train of electrical stimulation of the tibial nerve. Additionally, the fatigue resistance was lower after 8 weeks of a 0.5% APP diet than after 5% APP, supporting an APP-dose dependency of the shift in fiber-type composition. Therefore, the present study highlights a promising contribution of dietary APP intake to increasing endurance based on fiber-type composition in rat muscle. Results may help in developing a novel strategy for application in animal sciences, and human sports and age-related health sciences.

Differentiation and fiber type-specific activity of a muscle creatine kinase intronic enhancer

Directory of Open Access Journals (Sweden)

Tai Phillip WL

2011-07-01

Full Text Available Abstract Background Hundreds of genes, including muscle creatine kinase (MCK, are differentially expressed in fast- and slow-twitch muscle fibers, but the fiber type-specific regulatory mechanisms are not well understood. Results Modulatory region 1 (MR1 is a 1-kb regulatory region within MCK intron 1 that is highly active in terminally differentiating skeletal myocytes in vitro. A MCK small intronic enhancer (MCK-SIE containing a paired E-box/myocyte enhancer factor 2 (MEF2 regulatory motif resides within MR1. The SIE's transcriptional activity equals that of the extensively characterized 206-bp MCK 5'-enhancer, but the MCK-SIE is flanked by regions that can repress its activity via the individual and combined effects of about 15 different but highly conserved 9- to 24-bp sequences. ChIP and ChIP-Seq analyses indicate that the SIE and the MCK 5'-enhancer are occupied by MyoD, myogenin and MEF2. Many other E-boxes located within or immediately adjacent to intron 1 are not occupied by MyoD or myogenin. Transgenic analysis of a 6.5-kb MCK genomic fragment containing the 5'-enhancer and proximal promoter plus the 3.2-kb intron 1, with and without MR1, indicates that MR1 is critical for MCK expression in slow- and intermediate-twitch muscle fibers (types I and IIa, respectively, but is not required for expression in fast-twitch muscle fibers (types IIb and IId. Conclusions In this study, we discovered that MR1 is critical for MCK expression in slow- and intermediate-twitch muscle fibers and that MR1's positive transcriptional activity depends on a paired E-box MEF2 site motif within a SIE. This is the first study to delineate the DNA controls for MCK expression in different skeletal muscle fiber types.

(NS5-brane, D5-brane, D3-brane) bound state, open D3-brane, open D5-brane limits, and SL(2,Z) duality

International Nuclear Information System (INIS)

Mitra, Indranil; Roy, Shibaji

2002-01-01

We generalize the nonthreshold bound state in type IIB supergravity of the form (NS5-brane, D5-brane, D3-brane) constructed by the present authors [J. High Energy Phys. 02, 026 (2001)] to a nonzero asymptotic value of the axion (χ 0 ). We identify the decoupling limits corresponding to both the open D3-brane theory and open D5-brane theory for this supergravity solution as expected. However, we do not find any noncommutative Yang-Mills theory (NCYM) limit for this solution in the presence of NS5-branes. We then study the SL(2,Z) duality symmetry of type IIB theory for both open D3-brane (OD3) limit and open D5-brane (OD5) limit. We find that for OD3 theory, a generic SL(2,Z) duality always gives another OD3 theory irrespective of the value of χ 0 being rational or not. This indicates that OD3 theory is self-dual. But, under a special set of SL(2,Z) transformations for which χ 0 is rational, OD3 theory goes over to a (5+1)-dimensional NCYM theory and these two theories in this case are related to each other by strong-weak duality symmetry. On the other hand, for OD5 theory, a generic SL(2,Z) duality gives another OD5 theory if χ 0 is irrational, but when χ 0 is rational it gives the little string theory limit indicating that OD5 theory is S dual to the type IIB little string theory

Layers of root nouns in Germanic

DEFF Research Database (Denmark)

Hansen, Bjarne Simmelkjær Sandgaard

2017-01-01

The root-noun declension became productive in early Germanic, containing (I) inherited root nouns, (IIa) original substrate or loan words, and transitions from other declensions in (IIb) Proto-Germanic and (III) North Germanic. As ablaut was abolished, the inherited type would display ablaut grades...

The Interaction of Src Kinase with beta 3 Integrin Tails : A Potential Therapeutic Target in Thrombosis and Cancer

NARCIS (Netherlands)

Huveneers, Stephan; Danen, Erik H. J.

2010-01-01

Activation of Src family kinases is an important event downstream of integrin adhesion signaling in many cell types. A particularly intriguing connection between an integrin and a Src family kinase was first discovered in platelets, where the selective direct interaction of alpha IIb beta 3

Single-fiber myosin heavy chain polymorphism during postnatal development: modulation by hypothyroidism

Science.gov (United States)

di Maso, N. A.; Caiozzo, V. J.; Baldwin, K. M.

2000-01-01

The primary objective of this study was to follow the developmental time course of myosin heavy chain (MHC) isoform transitions in single fibers of the rodent plantaris muscle. Hypothyroidism was used in conjunction with single-fiber analyses to better describe a possible linkage between the neonatal and fast type IIB MHC isoforms during development. In contrast to the general concept that developmental MHC isoform transitions give rise to muscle fibers that express only a single MHC isoform, the single-fiber analyses revealed a very high degree of MHC polymorphism throughout postnatal development. In the adult state, MHC polymorphism was so pervasive that the rodent plantaris muscles contained approximately 12-15 different pools of fibers (i.e., fiber types). The degree of polymorphism observed at the single-fiber level made it difficult to determine specific developmental schemes analogous to those observed previously for the rodent soleus muscle. However, hypothyroidism was useful in that it confirmed a possible link between the developmental regulation of the neonatal and fast type IIB MHC isoforms.

On the Induced Gravitational Collapse

Directory of Open Access Journals (Sweden)

M. Becerra Laura

2018-01-01

Full Text Available The induced gravitational collapse (IGC paradigm has been applied to explain the long gamma ray burst (GRB associated with type Ic supernova, and recently the Xray flashes (XRFs. The progenitor is a binary systems of a carbon-oxygen core (CO and a neutron star (NS. The CO core collapses and undergoes a supernova explosion which triggers the hypercritical accretion onto the NS companion (up to 10-2 M⊙s-1. For the binary driven hypernova (BdHNe, the binary system is enough bound, the NS reach its critical mass, and collapse to a black hole (BH with a GRB emission characterized by an isotropic energy Eiso > 1052 erg. Otherwise, for binary systems with larger binary separations, the hypercritical accretion onto the NS is not sufficient to induced its gravitational collapse, a X-ray flash is produced with Eiso < 1052 erg. We’re going to focus in identify the binary parameters that limits the BdHNe systems with the XRFs systems.

[Clinical significance of early percutaneous coronary intervention in patients with Braunwald III-B type unstable angina pectoris].

Science.gov (United States)

Nozaki, Katsuhiro; Nakao, Koichi; Horiuchi, Kenji; Kasanuki, Hiroshi; Honda, Takashi

2003-06-01

To assess the efficacy of early invasive strategy for the treatment of Braunwald III-B type unstable angina pectoris. This study included 573 consecutive patients of whom 267 underwent percutaneous coronary intervention (PCI) (312 lesions). The patients were divided into two groups, 95 treated with the early invasive strategy of coronary angiography within 24 hr of admission (Group PCI-I) and the remaining 172 treated with the early conservative strategy of coronary angiography 24 hr after admission (Group PCI-C). No significant differences were noted in the baseline characteristics of the two groups except for ST segment elevation on electrocardiography at presentation, which occurred significantly less frequently in Group PCI-C (36.8% vs 8.1%, p strategy for unstable angina pectoris were almost equivalent to those of the early conservative strategy, despite more frequent ST segmental elevation at admission in Group PCI-I. These findings suggest that the early invasive strategy for unstable angina pectoris may be acceptable even in the current Japanese clinical setting without the use of GP IIb/IIIa receptor antagonist, low molecular weight heparin or clopidogrel.

Preoperative radium therapy and radical hysterectomy in the treatment of cervical cancer stage IB, IIA, and initial IIB

International Nuclear Information System (INIS)

Salum, Resalla; Lopes, Edison R.; Souza, Maria A.H. de

1995-01-01

Patients with IB, IIa and in initial IIb cervical cancer were randomized for combined therapy, consisting of one or two radium insertion followed by Wertheim Meigs operation performed 40 days later. We look for the early and late complications of the treatment, residual cancer after radiotherapy and survival without recurrence. The project begin in 1965 and ended in 1986. All the operations were done by one of the investigators and 116 patients were analysed. The age ranged from 21 to 75 years with an average of 4.18 years. During the operations 31 (26.72%) patients needed 1.500 cc or greater amount of blood transfusion and we have 3 iliac veins lesions. Managing the ureters, we do our best to leave the posterior fascia as intact as possible. Post operative complications ranged from minor (fever, localised pelvic infections, temporary popliteal nerve paralysis) to evisceration (3 patients) deep venous thrombosis (3 patients) and two early urinary fistulas. Late complications were seen in patients submitted to sequential teletherapy irradiation. One uretrovaginal fistula occurred 10 month after treatment, another one, 7 years later and the third one 24 years later. One patient develop hydronefrosis and enterocolite after 7.000 rads of teletherapy and another one rectovaginal fistula 13 years after initial therapy. The shortening of the vagina making impossible the intercourse was seen in 7 patients. By the histological examination, the cervix was sterilized in 73.3 % of the patients. Residual cancer was found according the original size of the tumour and the stage of the disease. Studying different combinations between the existence of residual cervical cancer with positive or negative limphnodes and making a correlation with survival, we found the critical points is to have positive cervix and [positive lymphonodes. The five years survival (life table methodology) for stage 1 lesion was 96%; stage II, 67%. At ten years survival was slighted different. With positive

The nature of interactions between tissue-type plasminogen activator and platelets

International Nuclear Information System (INIS)

Torr, S.R.; Winters, K.J.; Santoro, S.A.; Sobel, B.E.

1990-01-01

To elucidate interactions responsible for inhibition of aggregation of platelets in platelet-rich plasma (PRP) harvested from whole blood preincubated with t-PA, experiments were performed with PRP and washed platelets under diverse conditions of preincubation. Both ADP and collagen induced aggregation were inhibited in PRP unless aprotinin had been added to the preincubated whole blood concomitantly with t-PA. However, in washed platelets prepared after the same exposure aggregation was intact. When washed platelets were supplemented with fibrinogen degradation products (FDPs) in concentrations simulating those in whole blood preincubated with t-PA, aggregation induced with either ADP or collagen was inhibited. Thus, the inhibition in PRP depended on generation of FDPs by activated plasminogen. The functional integrity of surface glycoprotein (GP) IIb/IIIa receptors in washed platelets was documented by autoradiography after SDS-PAGE of surface labeled GPs and by fibrinogen binding despite preincubation of the whole blood or washed platelets themselves with t-PA and plasminogen as long as exogenous calcium (greater than or equal to 0.1 microM) was present. In contrast, when calcium was absent, the platelet GP IIb/IIIa receptor was rendered susceptible to degradation by plasmin, and aggregation was inhibited by preincubation at 37 degrees C even if aprotinin was present when aggregation was being assayed. These observations reconcile disparate results in the literature from studies in vivo and in vitro by demonstrating that inhibition of aggregation of platelets in PRP and in whole blood reflects indirect effects of plasminogen activation rather than direct effects of t-PA or plasmin on the platelets themselves

New endodontic obturation systems and their interfacial bond strength with intraradicular dentine - ex vivo studies.

Science.gov (United States)

Pawińska, M; Kierklo, A; Tokajuk, G; Sidun, J

2011-01-01

To comparatively evaluate adhesive properties of selected root canal fillings through the measurement of the material-dentine interfacial bond strength. Fifty extracted single-rooted human teeth with one canal each were prepared using Hero instruments to size 30.04. Teeth were divided into four subgroups depending on the root canal filling material and the method of obturation: Resilon/Epiphany - a thermoplastic method (IA), Resilon/Epiphany - a matching single-point method (IB), gutta-percha/Roeko Seal Automix - a thermoplastic method (IIA) and gutta-percha/Roeko Seal Automix - a matching single-point method (IIB). The obturated roots were cut perpendicular to the long axis to create 1.7 mm thick slices. The bond strength was measured for each test slice with push -out testing machine. The highest push-out bond strength was registered in subgroup IB (3.98 ± 1.33 MPa). Significantly lower bond strength was observed in subgroups IA (0.50 ± 0.24 MPa), IIA (0.33 ± 0.18 MPa) and IIB (0.08 ± 0.03 MPa) (pmaterial-dentine interfacial bond strength values were observed between IA and IIA, IA and IIB, IIA and IIB subgroups (p > 0.05). The push-out bond strength of the material-dentine interface was dependent on the type of material used and the root canal filling technique. The R/E system exhibited better adhesion ability to intraradicular dentine than G/RSA. The highest bond strength was observed for Resilon/Epiphany introduced with the single-cone technique.

The spinorial method of classifying supersymmetric backgrounds

NARCIS (Netherlands)

Gran, U.; Gutowski, J.; Papadopoulos, G.; Roest, D.

2006-01-01

We review how the classification of all supersymmetric backgrounds of IIB supergravity can be reduced to the evaluation of the Killing spinor equations and their integrability conditions, which contain the field equations, on five types of spinors. This is an extension of the work [hep-th/0503046

Molecules and dust in Cassiopeia A

DEFF Research Database (Denmark)

Biscaro, Chiara; Cherchneff, Isabelle

2016-01-01

We study the dust evolution in the supernova remnant Cassiopeia A. We follow the processing of dust grains that formed in the Type II-b supernova ejecta by modelling the sputtering of grains. The dust is located in dense ejecta clumps that are crossed by the reverse shock. We also investigate......-rich clumps that correspond to the outermost carbon-rich ejecta zone. We consider the various dust components that form in the supernova, several reverse shock velocities and inter-clump gas temperatures, and derive grain-size distributions and masses for the dust as a function of time. Both non...... and size, and the shock velocity in the clump. A Type II-b SN forms small grains that are sputtered within the clumps and in the inter-clump medium. For Cas A, silicate grains do not survive thermal sputtering in the inter-clump medium, while alumina, silicon carbide, and carbon dust may survive...

Fixing D7-brane positions by F-theory fluxes

International Nuclear Information System (INIS)

Braun, A.P.; Hebecker, A.; Luedeling, C.; Valandro, R.

2009-01-01

To do realistic model building in type IIB supergravity, it is important to understand how to fix D7-brane positions by the choice of fluxes. More generally, F-theory model building requires the understanding of how fluxes determine the singularity structure (and hence gauge group and matter content) of the compactification. We analyse this problem in the simple setting of M-theory on K3xK3. Given a certain flux which is consistent with the F-theory limit, we can explicitly derive the positions at which D7 branes or stacks of D7 branes are stabilised. The analysis is based on a parameterization of the moduli space of type IIB string theory on T 2 /Z 2 (including D7-brane positions) in terms of the periods of integral cycles of M-theory on K3. This allows us, in particular, to select a specific desired gauge group by the choice of flux numbers.

Active and adaptive Legionella CRISPR-Cas reveals a recurrent challenge to the pathogen.

Science.gov (United States)

Rao, Chitong; Guyard, Cyril; Pelaz, Carmen; Wasserscheid, Jessica; Bondy-Denomy, Joseph; Dewar, Ken; Ensminger, Alexander W

2016-10-01

Clustered regularly interspaced short palindromic repeats with CRISPR-associated gene (CRISPR-Cas) systems are widely recognized as critical genome defense systems that protect microbes from external threats such as bacteriophage infection. Several isolates of the intracellular pathogen Legionella pneumophila possess multiple CRISPR-Cas systems (type I-C, type I-F and type II-B), yet the targets of these systems remain unknown. With the recent observation that at least one of these systems (II-B) plays a non-canonical role in supporting intracellular replication, the possibility remained that these systems are vestigial genome defense systems co-opted for other purposes. Our data indicate that this is not the case. Using an established plasmid transformation assay, we demonstrate that type I-C, I-F and II-B CRISPR-Cas provide protection against spacer targets. We observe efficient laboratory acquisition of new spacers under 'priming' conditions, in which initially incomplete target elimination leads to the generation of new spacers and ultimate loss of the invasive DNA. Critically, we identify the first known target of L. pneumophila CRISPR-Cas: a 30 kb episome of unknown function whose interbacterial transfer is guarded against by CRISPR-Cas. We provide evidence that the element can subvert CRISPR-Cas by mutating its targeted sequences - but that primed spacer acquisition may limit this mechanism of escape. Rather than generally impinging on bacterial fitness, this element drives a host specialization event - with improved fitness in Acanthamoeba but a reduced ability to replicate in other hosts and conditions. These observations add to a growing body of evidence that host range restriction can serve as an existential threat to L. pneumophila in the wild. © 2016 The Authors Cellular Microbiology Published by John Wiley & Sons Ltd.

A Phase I/Ib Study of Enzalutamide Alone and in Combination with Endocrine Therapies in Women with Advanced Breast Cancer.

Science.gov (United States)

Schwartzberg, Lee S; Yardley, Denise A; Elias, Anthony D; Patel, Manish; LoRusso, Patricia; Burris, Howard A; Gucalp, Ayca; Peterson, Amy C; Blaney, Martha E; Steinberg, Joyce L; Gibbons, Jacqueline A; Traina, Tiffany A

2017-08-01

Purpose: Several lines of evidence support targeting the androgen signaling pathway in breast cancer. Enzalutamide is a potent inhibitor of androgen receptor signaling. Preclinical data in estrogen-expressing breast cancer models demonstrated activity of enzalutamide monotherapy and enhanced activity when combined with various endocrine therapies (ET). Enzalutamide is a strong cytochrome P450 3A4 (CYP3A4) inducer, and ETs are commonly metabolized by CYP3A4. The pharmacokinetic (PK) interactions, safety, and tolerability of enzalutamide monotherapy and in combination with ETs were assessed in this phase I/Ib study. Experimental Design: Enzalutamide monotherapy was assessed in dose-escalation and dose-expansion cohorts of patients with advanced breast cancer. Additional cohorts examined effects of enzalutamide on anastrozole, exemestane, and fulvestrant PK in patients with estrogen receptor-positive/progesterone receptor-positive (ER + /PgR + ) breast cancer. Results: Enzalutamide monotherapy ( n = 29) or in combination with ETs ( n = 70) was generally well tolerated. Enzalutamide PK in women was similar to prior data on PK in men with prostate cancer. Enzalutamide decreased plasma exposure to anastrozole by approximately 90% and exemestane by approximately 50%. Enzalutamide did not significantly affect fulvestrant PK. Exposure of exemestane 50 mg/day given with enzalutamide was similar to exemestane 25 mg/day alone. Conclusions: These results support a 160 mg/day enzalutamide dose in women with breast cancer. Enzalutamide can be given in combination with fulvestrant without dose modifications. Exemestane should be doubled from 25 mg/day to 50 mg/day when given in combination with enzalutamide; this combination is being investigated in a randomized phase II study in patients with ER + /PgR + breast cancer. Clin Cancer Res; 23(15); 4046-54. ©2017 AACR . ©2017 American Association for Cancer Research.

Fiscal year 1985 Department of Energy authorization (high-energy and nuclear physics). Volume II-B. Hearing before the Subcommittee on Energy Development and Applications of the Committee on Science and Technology, US House of Representatives, Ninety-Eighth Congress, Second Session, February 22, 1984

International Nuclear Information System (INIS)

Anon.

1984-01-01

Volume II-B of the DOE authorization hearings for fiscal year 1985 covers testimony on high-energy and nuclear physics programs. The volume opens with a continuation of Appendix I, which contains questions directed at Dr. Alvin Trivelpiece and his responses on research at several laboratories and four construction projects. The latter include general plant projects, the Continuous Electron Beam Accelerator Facility, the Tandem/AGS Heavy Ion Transfer Line, and the University Accelerator Upgrade at the University of Washington and Yale. Two 1983 DOE/National Science Foundation reports make up Appendix II. The volume concludes with the text of the 1985 budget request for $746,105,000 and a breakdown of line item expenditures

Extreme explosions supernovae, hypernovae, magnetars, and other unusual cosmic blasts

CERN Document Server

Stevenson, David S

2013-01-01

What happens at the end of the life of massive stars? At one time we thought all these stars followed similar evolutionary paths. However, new discoveries have shown that things are not quite that simple. This book focuses on the extreme -the most intense, brilliant and peculiar- of astronomical explosions. It features highly significant observational finds that push the frontiers of astronomy and astrophysics, particularly as before these objects were only predicted in theory.  This book is for those who want the latest information and ideas about the most dramatic and unusual explosions dete

Evaluation of Electrical Impedance as a Biomarker of Myostatin Inhibition in Wild Type and Muscular Dystrophy Mice.

Directory of Open Access Journals (Sweden)

Benjamin Sanchez

Full Text Available Non-invasive and effort independent biomarkers are needed to better assess the effects of drug therapy on healthy muscle and that affected by muscular dystrophy (mdx. Here we evaluated the use of multi-frequency electrical impedance for this purpose with comparison to force and histological parameters.Eight wild-type (wt and 10 mdx mice were treated weekly with RAP-031 activin type IIB receptor at a dose of 10 mg kg-1 twice weekly for 16 weeks; the investigators were blinded to treatment and disease status. At the completion of treatment, impedance measurements, in situ force measurements, and histology analyses were performed.As compared to untreated animals, RAP-031 wt and mdx treated mice had greater body mass (18% and 17%, p 70 Hz, but not in the mdx animals. In contrast, maximum force normalized by muscle mass was unchanged in the wt animals and lower in the mdx animals by 21% (p < 0.01. Similarly, myofiber size was only non-significantly higher in treated versus untreated animals (8% p = 0.44 and 12% p = 0.31 for wt and mdx animals, respectively.Our findings demonstrate electrical impedance of muscle reproduce the functional and histological changes associated with myostatin pathway inhibition and do not reflect differences in muscle size or volume. This technique deserves further study in both animal and human therapeutic trials.

Antioxidant and immunological activities of polysaccharides from Gentiana scabra Bunge roots.

Science.gov (United States)

Wang, Zhanyong; Wang, Chenyu; Su, Tingting; Zhang, Jing

2014-11-04

Two polysaccharide fractions, GSP I-a and GSP II-b, were isolated from Gentiana scabra Bunge roots. Both GSP I-a and GSP II-b comprised seven monosaccharides: fructose, mannose, rhamnose, galacturonic acid, glucose, galactose, and fucose. Ultraviolet and infrared analyses show that GSP I-a and GSP II-b are proteoglycans. In vitro evaluation of the antioxidant activity suggests that GSP I-a and GSP II-b scavenge 1,1-diphenyl-2-picrylhydrazyl radicals. However, the scavenging activity of the latter is stronger than that of the former. GSP I-a and GSP II-b have relatively low reducing powers and scavenging activities toward superoxide anions and hydroxyls. GSP I-a and GSP II-b significantly increase lymphocyte proliferation when lipopolysaccharide is used as a mitogen for lymphocytes, but only GSP I-a can significantly increase lymphocyte proliferation within the test-dosage range when concanavalin A is used as a mitogen. Copyright © 2014 Elsevier Ltd. All rights reserved.

[Comparison between Endoscopic Therapy and Medical Therapy in Peptic Ulcer Patients with Adherent Clot: A Multicenter Prospective Observational Cohort Study].

Science.gov (United States)

Kim, Si Hye; Jung, Jin Tae; Kwon, Joong Goo; Kim, Eun Young; Lee, Dong Wook; Jeon, Seong Woo; Park, Kyung Sik; Lee, Si Hyung; Park, Jeong Bae; Ha, Chang Yoon; Park, Youn Sun

2015-08-01

The optimal management of bleeding peptic ulcer with adherent clot remains controversial. The purpose of this study was to compare clinical outcome between endoscopic therapy and medical therapy. We also evaluated the risk factors of rebleeding in Forrest type IIB peptic ulcer. Upper gastrointestinal (UGI) bleeding registry data from 8 hospitals in Korea between February 2011 and December 2013 were reviewed and categorized according to the Forrest classification. Patients with acute UGI bleeding from peptic ulcer with adherent clots were enrolled. Among a total of 1,101 patients diagnosed with peptic ulcer bleeding, 126 bleedings (11.4%) were classified as Forrest type IIB. Of the 126 patients with adherent clots, 84 (66.7%) received endoscopic therapy and 42 (33.3%) were managed with medical therapy alone. The baseline characteristics of patients in two groups were similar except for higher Glasgow Blatchford Score and pre-endoscopic Rockall score in medical therapy group. Bleeding related mortality (1.2% vs.10%; p=0.018) and all cause mortality (3.7% vs. 20.0%; p=0.005) were significantly lower in the endoscopic therapy group. However, there was no difference between endoscopic therapy and medical therapy regarding rebleeding (7.1% vs. 9.5%; p=0.641). In multivariate analysis, independent risk factors of rebleeding were previous medication with aspirin and/or NSAID (OR, 13.1; p=0.025). In patients with Forrest type IIB peptic ulcer bleeding, endoscopic therapy was associated with a significant reduction in bleeding related mortality and all cause mortality compared with medical therapy alone. Important risk factor of rebleeding was use of aspirin and/or NSAID.

Morphometry, ultrastructure, myosin isoforms, and metabolic capacities of the "mini muscles" favoured by selection for high activity in house mice.

Science.gov (United States)

Guderley, Helga; Houle-Leroy, Philippe; Diffee, Gary M; Camp, Dana M; Garland, Theodore

2006-07-01

Prolonged selective breeding of mice (Mus musculus) for high levels of voluntary wheel running has favoured an unusual phenotype ("mini muscles"), apparently caused by a single Mendelian recessive allele, in which most hind-limb muscles are markedly reduced in mass, but have increased mass-specific activities of mitochondrial enzymes. We examined whether these changes reflect changes in fibre size, number or ultrastructure in normal and "mini-muscle" mice within the two (of four) selectively bred lines (lab designations L3 and L6) that exhibit the phenotype at generations 26 and 27. In both lines, the gastrocnemius and plantaris muscles are smaller in mass (by >50% and 20%, respectively) in affected individuals. The mass-specific activities of mitochondrial enzymes in the gastrocnemius and plantaris muscles were increased in the mini phenotype in both lines, with stronger effects in the gastrocnemius muscle. In the gastrocnemius, the % myosin heavy chain (MHC) IIb was reduced by 50% in L3 and by 30% in L6, whereas the % MHC IIa and I were higher, particularly in L3. Fibre number in the plantaris muscle did not significantly differ between mini and normal muscles, although muscle mass was a significant positive correlate of fibre number. Small fibres were more abundant in mini than normal muscles in L3. Mitochondrial volume density was significantly higher in mini than normal muscle fibres in L3, but not in L6. Microscopy revealed a surprising attribute of the mini muscles: an abundance of small, minimally differentiated, myofibril-containing cells positioned in a disorderly fashion, particularly in the surface layer. We hypothesise that these unusual cells may be satellite cells or type IIb fibres that did not complete their differentiation. Together, these observations suggest that mice with the mini phenotype have reduced numbers of type IIb fibres in many of their hind-limb muscles, leading to a decrease in mass and an increase in mass-specific aerobic capacity

Influence of injection of Chinese botulinum toxin type A on the histomorphology and myosin heavy chain composition of rat gastrocnemius muscles.

Science.gov (United States)

Hong, Bin; Chen, Min; Hu, Xing-yue

2013-11-01

Botulinum toxin type A (BoNT/A) is a metalloprotease that blocks synaptic transmission via the cleavage of a synaptosomal-associated protein of 25 kDa (SNAP-25). It has gained widespread use as a treatment for cerebral palsy and skeletal muscle hypertrophy. In China, Chinese botulinum toxin type A (CBTX-A), a type of BoNT/A, is in widespread clinical use. However, the changes in the morphological and biochemical properties of treated muscles and in remote muscles from the CBTX-A injection site are relatively unknown. Therefore, we investigated the changes in histomorphology and myosin heavy chain (MyHC) isoform composition and distribution in rat gastrocnemius muscles after intramuscular injection of CBTX-A. The weakness of the injected muscles was assessed periodically to identify their functional deficiency. Muscle slices were stained with hematoxylin-eosin (HE) and adenosine triphosphatase (ATPase). MyHC isoform composition was analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) to uncover changes in morphological and biochemical properties. Our findings demonstrate that following injection of CBTX-A 5 U into rat gastrocnemius muscles, shifts in MyHC isoform composition emerged on the third day after injection and peaked in the fourth week. The composition remained distinctly different from that of the control group after the twelfth week. More specifically, there was a decrease in the proportion of the type IIb isoform and an increase in the proportions of type IIx, type IIa, and type I isoforms. Data revealed that CBTX-A led to a shift in MyHC composition towards slower isoforms and that the MyHC composition remained far from normal six months after a single injection. However, no noticeable remote muscle weakness was induced.

Constraints on the Progenitor System of SN 2016gkg from a Comprehensive Statistical Analysis

Science.gov (United States)

Sravan, Niharika; Marchant, Pablo; Kalogera, Vassiliki; Margutti, Raffaella

2018-01-01

Type IIb supernovae (SNe) present a unique opportunity for understanding the progenitors of stripped-envelope SNe because the stellar progenitor of several SNe IIb have been identified in pre-explosion images. In this paper, we use Bayesian inference and a large grid of non-rotating solar-metallicity single and binary stellar models to derive the associated probability distributions of single and binary progenitors of the SN IIb 2016gkg using existing observational constraints. We find that potential binary star progenitors have smaller pre-SN hydrogen-envelope and helium-core masses than potential single-star progenitors typically by 0.1 M ⊙ and 2 M ⊙, respectively. We find that, a binary companion, if present, is a main-sequence or red-giant star. Apart from this, we do not find strong constraints on the nature of the companion star. We demonstrate that the range of progenitor helium-core mass inferred from observations could help improve constraints on the progenitor. We find that the probability that the progenitor of SN 2016gkg was a binary is 22% when we use constraints only on the progenitor luminosity and effective temperature. Imposing the range of pre-SN progenitor hydrogen-envelope mass and radius inferred from SN light curves, the probability that the progenitor is a binary increases to 44%. However, there is no clear preference for a binary progenitor. This is in contrast to binaries being the currently favored formation channel for SNe IIb. Our analysis demonstrates the importance of statistical inference methods to constrain progenitor channels.

Significance of prophylactic para-aortic lymph node irradiation in the postoperatic treatment of the cervical cancer. Relationship between prognosis and lymph node metastasis

Energy Technology Data Exchange (ETDEWEB)

Kumano, Machiko; Arita, Shigehiro; Ishida, Osamu; Murano, Yoshihiko; Sumita, Mitsugu; Okumura, Masahiko; Nanbu, Hidekazu [Kinki Univ., Osaka-Sayama, Osaka (Japan). School of Medicine

1995-12-01

Between 1976 and 1989, 163 patients were treated by postoperative radiotherapy for cervical cancer stage Ib and IIb. Before irradiation for the whole pelvis, a total dose of 50 Gy was given in 5 weeks. Cumulative 5-year survival rates according to the number of pelvic lymph node metastasis were 100% for Ib L{sub 1} (one node involvement) in 10 patients, 60% for Ib L{sub 2} {up_arrow} (two or more involved) in 10, 73% for IIb L{sub 1} in 23, 78% for IIb L{sub 2} in 9, 47% for IIb L{sub 3} {up_arrow} in 18. The first recurrent sites of stage Ib were distant organ via lymphatic routes in 3 patients and hematogenous routes in 2. IIb were via lymphatic routes in 10 patients, hematogenous routes in 10, and regional recurrence in 6. After introduced para-aortic node irradiation, the pelvic plus para-aortic irradiation delivered 45 Gy in 5 weeks for two or more lymph nodes involvement. The cumulative 5-year survival rates were 100% for Ib L{sub 1} in 10 patients, 100% for Ib L{sub 2} in 7, 65% for Ib L{sub 3} {up_arrow} in 9, 82% for IIb L{sub 1} in 17, 68% for IIb L{sub 2} in 27, and 48% for IIb L{sub 3} {up_arrow} in 23. The first recurrent sites for Ib with introduction of para-aortic node irradiation were distant organs via lymphatic routes in 1 patient and hematogenous routes in 2, and the sites for IIb were via lymphatic routes in 10, hematogenous 7, peritonitis carcinomatous 1, and in the pelvic field of 6. Late effects developed in 3 (19%) of Ib and 19 (29%) of IIb. Side effects increased with prophylactic para-aortic node irradiation. No significant difference was observed in survival rates between pelvic and pelvic plus para-aortic node irradiation group. (S.Y.).

Functionalized Magnetic Resonance Contrast Agent Selectively Binds to Glycoprotein IIb/IIIa on Activated Human Platelets under Flow Conditions and Is Detectable at Clinically Relevant Field Strengths

Directory of Open Access Journals (Sweden)

Constantin von zur Mühlen

2008-03-01

Full Text Available Recent progress in molecular magnetic resonance imaging (MRI provides the opportunity to image cells and cellular receptors using microparticles of iron oxide (MPIOs. However, imaging targets on vessel walls remains challenging owing to the quantity of contrast agents delivered to areas of interest under shear stress conditions. We evaluated ex vivo binding characteristics of a functional MRI contrast agent to ligand-induced binding sites (LIBSs on activated glycoprotein IIb/IIIa receptors of human platelets, which were lining rupture-prone atherosclerotic plaques and could therefore facilitate detection of platelet-mediated pathology in atherothrombotic disease. MPIOs were conjugated to anti-LIBS single-chain antibodies (LIBS-MPIO or control antibodies (control MPIO. Ex vivo binding to human platelet-rich clots in a dose-dependent manner was confirmed on a 3 T clinical MRI scanner and by histology (p < .05 for LIBS-MPIO vs control MPIO. By using a flow chamber setup, significant binding of LIBS-MPIO to a platelet matrix was observed under venous and arterial flow conditions, but not for control MPIO (p < .001. A newly generated MRI contrast agent detects activated human platelets at clinically relevant magnetic field strengths and binds to platelets under venous and arterial flow conditions, conveying high payloads of contrast to specific molecular targets. This may provide the opportunity to identify vulnerable, rupture-prone atherosclerotic plaques via noninvasive MRI.

Gauge and gravitational anomalies in D=4 N=1 orientifolds.

NARCIS (Netherlands)

S Scrucca, C.; Serone, M.

1999-01-01

We analyze in detail the cancellation of U(1)-gauge and U(1)-gravitational anomalies in certain D=4 N=1 Type IIB orientifolds, from a string theory point of view. We verify the proposal that these anomalies are cancelled by a Green-Schwarz mechanism involving only twisted RR fields.By factorizing

[New varieties of lateral metatarsophalangeal dislocations of the great toe].

Science.gov (United States)

Bousselmame, N; Rachid, K; Lazrak, K; Galuia, F; Taobane, H; Moulay, I

2001-04-01

We report seven cases of traumatic dislocation of the great toe, detailing the anatomy, the mechanism of injury and the radiographic diagnosis. We propose an additional classification based on three hereto unreported cases. Between october 1994 and october 1997, we treated seven patients with traumatic dislocation of the first metatarso-phalangeal joint of the great toe. There were six men and one woman, mean age 35 years (range 24 - 44 years). Dislocation was caused by motor vehicle accidents in four cases and by falls in three. Diagnosis was made on anteroposterior, lateral and medial oblique radiographs. According to Jahss' classification, there was one type I and three type IIB dislocations. There was also one open lateral dislocation and two dorsomedial dislocations. Only these dorsomedial dislocations required open reduction, done via a dorsal approach. Mean follow-up was 17.5 months (range 9 - 24 months) in six cases. One patient was lost to follow-up. The outcome was good in six cases and poor in one (dorsomedial dislocation). Dislocation of the first metatarso-phalangeal joint of the great toe is an uncommon injury. In 1980, Jahss reported two cases and reviewed three others described in the literature. He proposed three types of dislocation based on the feasibility of closed reduction (type I, II and IIB). In 1991, Copeland and Kanat reported a unique case in which there was an association of IIA and IIB lesions. They proposed an addition to the classification (type IIC). In 1994, Garcia Mata et al. reported another case which had not been described by Jahss and proposed another addition. All dislocations reported to date have been sagittal dislocations. Pathological alteration of the collateral ligaments has not been previously reported. In our experience, we have seen one case of open lateral dislocation due, at surgical exploration, to medial ligament rupture and two cases of dorsomedial dislocation due, at surgical exploration, to lateral ligament

Design and synthesis of novel platelet fibrinogen receptor antagonists with 2H-1,4-benzoxazine-3(4H)-one scaffold. A systematic study.

Science.gov (United States)

Anderluh, Marko; Cesar, Jozko; Stefanic, Petra; Kikelj, Danijel; Janes, Damjan; Murn, Jernej; Nadrah, Kristina; Tominc, Mojca; Addicks, Elisabeth; Giannis, Athanassios; Stegnar, Mojca; Dolenc, Marija Sollner

2005-01-01

New platelet glycoprotein IIb/IIIa (GP IIb/IIIa, integrin alpha(IIb)beta3) antagonists were prepared on a 2H-1,4-benzoxazine-3(4H)-one scaffold. Their anti-aggregatory activities in human platelet rich plasma and their affinity towards alpha(IIb)beta3 and alpha(V)beta3 integrins were assessed. Various substitution positions and side chain variations were studied. In contrast to the generally accepted model, compounds containing ethyl esters as aspartate mimetics were in general more active than the corresponding free acids. We suggest an explanation for the observed behaviour of these new compounds.

Moduli stabilization in non-geometric backgrounds

International Nuclear Information System (INIS)

Becker, Katrin; Becker, Melanie; Vafa, Cumrun; Walcher, Johannes

2007-01-01

Type II orientifolds based on Landau-Ginzburg models are used to describe moduli stabilization for flux compactifications of type II theories from the world-sheet CFT point of view. We show that for certain types of type IIB orientifolds which have no Kaehler moduli and are therefore intrinsically non-geometric, all moduli can be explicitly stabilized in terms of fluxes. The resulting four-dimensional theories can describe Minkowski as well as anti-de Sitter vacua. This construction provides the first string vacuum with all moduli frozen and leading to a 4D Minkowski background

Distribution of flux vacua around singular points in Calabi-Yau moduli space

International Nuclear Information System (INIS)

Eguchi, Tohru; Tachikawa, Yuji

2006-01-01

We study the distribution of type-IIB flux vacua in the moduli space near various singular loci, e.g. conifolds, ADE singularities on P 1 , Argyres-Douglas point etc, using the Ashok-Douglas density det (R+ω). We find that the vacuum density is integrable around each of them, irrespective of the type of the singularities. We study in detail an explicit example of an Argyres-Douglas point embedded in a compact Calabi-Yau manifold

The scales of brane nucleation processes

International Nuclear Information System (INIS)

Alwis, S.P. de

2007-01-01

The scales associated with Brown-Teitelboim-Bousso-Polchinski processes of brane nucleation, which result in changes of the flux parameters and the number of D-branes, are discussed in the context of type IIB models with all moduli stabilized. It is argued that such processes are unlikely to be described by effective field theory

IIA/B, Wound and Wrapped

International Nuclear Information System (INIS)

Danielsson, Ulf H.; Guijosa, Alberto; Kruczenski, Martin

2000-01-01

We examine the T-duality relation between 1+1 NCOS and the DLCQ limit of type IIA string theory. We show that, as long as there is a compact dimension, one can meaningfully define an 'NCOS' limit of IIB/A string theory even in the absence of D-branes (and even if there is no B-field). This yields a theory of closed strings with strictly positive winding, which is T-dual to DLCQ IIA/B without any D-branes. We call this the Type IIB/A Wound String Theory. The existence of decoupled sectors can be seen directly from the energy spectrum, and mirrors that of the DLCQ theory. It becomes clear then that all of the different p+1 NCOS theories are simply different states of this single Wound IIA/B theory which contain D-branes. We study some of the properties of this theory. In particular, we show that upon toroidal compactification, Wound string theory is U-dual to various Wrapped Brane theories which contain OM theory and the ODp theories as special states. (author)

Building an explicit de Sitter

Energy Technology Data Exchange (ETDEWEB)

Louis, Jan [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik; Hamburg Univ. (Germany). Zentrum fuer Mathematische Physik; Rummel, Markus; Valandro, Roberto [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik; Westphal, Alexander [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany). Gruppe Theorie

2012-11-15

We construct an explicit example of a de Sitter vacuum in type IIB string theory that realizes the proposal of Kaehler uplifting. As the large volume limit in this method depends on the rank of the largest condensing gauge group we carry out a scan of gauge group ranks over the Kreuzer-Skarke set of toric Calabi-Yau threefolds. We find large numbers of models with the largest gauge group factor easily exceeding a rank of one hundred. We construct a global model with Kaehler uplifting on a two-parameter model on CP{sup 4}{sub 11169}, by an explicit analysis from both the type IIB and F-theory point of view. The explicitness of the construction lies in the realization of a D7 brane configuration, gauge flux and RR and NS flux choices, such that all known consistency conditions are met and the geometric moduli are stabilized in a metastable de Sitter vacuum with spontaneous GUT scale supersymmetry breaking driven by an F-term of the Kaehler moduli.

Building an explicit de Sitter

International Nuclear Information System (INIS)

Louis, Jan; Hamburg Univ.; Rummel, Markus; Valandro, Roberto; Westphal, Alexander

2012-11-01

We construct an explicit example of a de Sitter vacuum in type IIB string theory that realizes the proposal of Kaehler uplifting. As the large volume limit in this method depends on the rank of the largest condensing gauge group we carry out a scan of gauge group ranks over the Kreuzer-Skarke set of toric Calabi-Yau threefolds. We find large numbers of models with the largest gauge group factor easily exceeding a rank of one hundred. We construct a global model with Kaehler uplifting on a two-parameter model on CP 4 11169 , by an explicit analysis from both the type IIB and F-theory point of view. The explicitness of the construction lies in the realization of a D7 brane configuration, gauge flux and RR and NS flux choices, such that all known consistency conditions are met and the geometric moduli are stabilized in a metastable de Sitter vacuum with spontaneous GUT scale supersymmetry breaking driven by an F-term of the Kaehler moduli.

Genome-scale multilocus microsatellite typing of Trypanosoma cruzi discrete typing unit I reveals phylogeographic structure and specific genotypes linked to human infection.

Directory of Open Access Journals (Sweden)

Martin S Llewellyn

2009-05-01

Full Text Available Trypanosoma cruzi is the most important parasitic infection in Latin America and is also genetically highly diverse, with at least six discrete typing units (DTUs reported: Tc I, IIa, IIb, IIc, IId, and IIe. However, the current six-genotype classification is likely to be a poor reflection of the total genetic diversity present in this undeniably ancient parasite. To determine whether epidemiologically important information is "hidden" at the sub-DTU level, we developed a 48-marker panel of polymorphic microsatellite loci to investigate population structure among 135 samples from across the geographic distribution of TcI. This DTU is the major cause of resurgent human disease in northern South America but also occurs in silvatic triatomine vectors and mammalian reservoir hosts throughout the continent. Based on a total dataset of 12,329 alleles, we demonstrate that silvatic TcI populations are extraordinarily genetically diverse, show spatial structuring on a continental scale, and have undergone recent biogeographic expansion into the southern United States of America. Conversely, the majority of human strains sampled are restricted to two distinct groups characterised by a considerable reduction in genetic diversity with respect to isolates from silvatic sources. In Venezuela, most human isolates showed little identity with known local silvatic strains, despite frequent invasion of the domestic setting by infected adult vectors. Multilocus linkage indices indicate predominantly clonal parasite propagation among all populations. However, excess homozygosity among silvatic strains and raised heterozygosity among domestic populations suggest that some level of genetic recombination cannot be ruled out. The epidemiological significance of these findings is discussed.

Preoperative Concurrent Radiation Therapy and Chemotherapy for Bulky Stage IB2, IIA, and IIB Carcinoma of the Uterine Cervix With Proximal Parametrial Invasion

International Nuclear Information System (INIS)

Huguet, Florence; Cojocariu, Oana-Maria; Levy, Pierre; Lefranc, Jean-Pierre; Darai, Emile; Jannet, Denis; Ansquer, Yan; Lhuillier, Pierre-Eugene; Benifla, Jean-Louis; Seince, Nathalie; Touboul, Emmanuel

2008-01-01

Purpose: To evaluate toxicity, local tumor control, and survival after preoperative chemoradiation for operable bulky cervical carcinoma. Methods and Materials: Between December 1991 and July 2006, 92 patients with operable bulky stage IB2, IIA, and IIB cervical carcinoma without pelvic or para-aortic nodes on pretreatment imaging were treated. Treatment consisted of preoperative external beam pelvic radiation therapy (EBRT) and concomitant chemotherapy (CT) during the first and fourth weeks of radiation combining 5-fluorouracil and cisplatin. The pelvic radiation dose was 40.5 Gy over 4.5 weeks. EBRT was followed by low-dose rate uterovaginal brachytherapy with a total dose of 20 Gy in 62 patients. After a median rest period of 44 days, all patients underwent Class II modified radical hysterectomy with bilateral pelvic lymphadenectomy. Thirty patients who had not received preoperative uterovaginal brachytherapy underwent postoperative low-dose-rate vaginal brachytherapy at a dose of 20 Gy. The mean follow-up was 46 months. Results: Pathologic residual tumor was observed in 43 patients. After multivariate analysis, additional preoperative uterovaginal brachytherapy was the single significant predictive factor for pathologic complete response rate (p = 0.019). The 2- and 5-year disease-free survival (DFS) rates were 80.4% and 72.2%, respectively. Pathologic residual cervical tumor was the single independent factor decreasing the probability of DFS (p = 0.020). Acute toxicities were moderate. Two severe ureteral complications requiring surgical intervention were observed. Conclusions: Concomitant chemoradiation followed by surgery for operable bulky stage I-II cervical carcinoma without clinical lymph node involvement can be used with acceptable toxicity. Pathologic complete response increases the probability of DFS

Involvement of P-glycoprotein and multidrug resistance associated protein 1 in the transport of tanshinone IIB, a primary active diterpenoid quinone from the roots of Salvia miltiorrhiza, across the blood-brain barrier.

Science.gov (United States)

Zhou, Zhi-Wei; Chen, Xiao; Liang, Jun; Yu, Xi-Yong; Wen, Jing-Yuan; Zhou, Shu-Feng

2007-08-01

Tanshinone IIB (TSB) is a major constituent of Salvia miltiorrhiza, which is widely used in treatment of cardiovascular and central nervous system (CNS) diseases such as coronary heart disease and stroke. This study aimed to investigate the role of various drug transporters in the brain penetration of TSB using several in vitro and in vivo mouse and rat models. The uptake and efflux of TSB in rat primary microvascular endothelial cells (RBMVECs) were ATP-dependent and significantly altered in the presence of a P-glycoprotein (P-gp) or multidrug resistance associated protein (Mrp1/2) inhibitor. A polarized transport of TSB was found in RBMVEC monolayers with facilitated efflux from the abluminal to luminal side. Addition of a P-gp inhibitor (e.g. verapamil) in both abluminal and luminal sides attenuated the polarized transport. In an in situ rat brain perfusion model, TSB crossed the blood-brain barrier (BBB) and blood-cerebrospinal fluid barrier at a greater rate than that for sucrose, and the brain penetration was increased in the presence of a P-gp or Mrp1/2 inhibitor. The brain levels of TSB were only about 30% of that in the plasma and it could be increased to up to 72% of plasma levels when verapamil, quinidine, or probenecid was co-administered in rats. The entry of TSB to CNS increased by 67-97% in rats subjected to middle cerebral artery occlusion or treatment with the neurotoxin, quinolinic acid, compared to normal rats. Furthermore, The brain levels of TSB in mdr1a(-/-) and mrp1(-/-) mice were 28- to 2.6-fold higher than those in the wild-type mice. TSB has limited brain penetration through the BBB due to the contribution of P-gp and to a lesser extent of Mrp1 in rodents. Further studies are needed to confirm whether these corresponding transporters in humans are involved in limiting the penetration of TSB across the BBB and the clinical relevance.

Small field axion inflation with sub-Planckian decay constant

Energy Technology Data Exchange (ETDEWEB)

Kadota, Kenji [Center for Theoretical Physics of the Universe, Institute for Basic Science,Daejeon 305-811 (Korea, Republic of); Kobayashi, Tatsuo [Department of Physics, Hokkaido University,Sapporo 060-0810 (Japan); Oikawa, Akane [Department of Physics, Waseda University,Tokyo 169-8555 (Japan); Omoto, Naoya [Department of Physics, Hokkaido University,Sapporo 060-0810 (Japan); Otsuka, Hajime [Department of Physics, Waseda University,Tokyo 169-8555 (Japan); Tatsuishi, Takuya H. [Department of Physics, Hokkaido University,Sapporo 060-0810 (Japan)

2016-10-10

We study an axion inflation model recently proposed within the framework of type IIB superstring theory, where we pay a particular attention to a sub-Planckian axion decay constant. Our axion potential can lead to the small field inflation with a small tensor-to-scalar ratio, and a typical reheating temperature can be as low as GeV.

Platelet glycoprotein IIb/IIIa integrin blockade with eptifibatide in coronary stent intervention: the ESPRIT trial: a randomized controlled trial.

Science.gov (United States)

O'Shea, J C; Hafley, G E; Greenberg, S; Hasselblad, V; Lorenz, T J; Kitt, M M; Strony, J; Tcheng, J E

2001-05-16

The Enhanced Suppression of the Platelet IIb/IIIa Receptor with Integrilin Therapy (ESPRIT) trial showed the efficacy of adjunctive, double-bolus eptifibatide therapy in reducing ischemic complications of nonurgent coronary stent implantation at 48 hours and at 30 days. To determine whether the beneficial effects of eptifibatide persist at 6 months after treatment. Follow-up study of a randomized, double-blind, placebo-controlled, crossover-permitted trial conducted from June 1999 through February 2000. Ninety-two tertiary care centers in the United States and Canada. A total of 2064 patients scheduled to undergo nonurgent percutaneous coronary intervention with stent implantation. Patients were randomly assigned to receive placebo or eptifibatide (two 180-microg/kg boluses 10 minutes apart and continuous infusion of 2.0 microg/kg per minute), started immediately before stent implantation and continued for 18 to 24 hours. Complete follow-up data were available for 988 (95.0%) of 1040 patients given eptifibatide and 977 (95.4%) of 1024 patients given placebo. Composite rates of death or myocardial infarction (MI); death, MI, or target vessel revascularization; and their individual components 6 months after enrollment, compared between the 2 groups. By 6 months, the composite end point of death or MI had occurred in 7.5% of eptifibatide-treated patients and in 11.5% of placebo-treated patients (hazard ratio [HR], 0.63; 95% confidence interval [CI], 0.47-0.84; P =.002). The composite of death, MI, or target vessel revascularization was 14.2% in eptifibatide-treated patients vs 18.3% in placebo-treated patients (HR, 0.75; 95% CI, 0.60-0.93; P =.008). Most of this benefit accrued early (<48 hours after initiation of therapy) and was maintained through 6 months. Six-month mortality in the eptifibatide group was 0.8% vs 1.4% in the placebo group (HR, 0.56; 95% CI, 0.24-1.34; P =.19) and target vessel revascularization occurred in 8.6% of the eptifibatide group vs 9.4% of

Determination of lumbosacral transitional vertebrae in kidney urinary bladder x-ray films in the Saudi population

Directory of Open Access Journals (Sweden)

Khalid G. Khashoggi

2017-08-01

Full Text Available Objectives: To investigated the rate of occurrence of lumbosacral transitional vertebrae (LSTV, spinal variant, in kidney urinary bladder (KUB plain radiographs in a Saudi population. Methods: Between January 2012 to January 2015, KUB plain films obtained from patients at King Abdulaziz University Hospital, Jeddah, Saudi Arabia, were reviewed, and the presence or absence of LSTV was documented and classified as incomplete or complete. Patients who had evidence of spinal surgery that would obscure the view were excluded. Results: A total of 2078 patients underwent KUB examinations during the study period; LSTV anomalies were detected in 158 of these. Sacralization was present in 153 (96.8% of this cohort, while lumbarization was present in 5 (3.2%. A total of 136 (86.1% of the sacralized segments were of the incomplete type, whereas 17 (10.7% were complete. Of the lumbarized vertebrae, 3 (1.8% were incomplete, and 2 (1.2% were complete. The most frequent type in men was type Ib (28.5% for sacralized segments, and type IIb for lumbarized segments (0.6%. In women, type Ia was the most common form of sacralized segments (11.3% and type IIb was the most common form of lumbarized segments (2.8%. Conclusion: The prevalence of LSTV in Saudi patients is 7.6%, with a higher incidence of sacralization than lumbarization. Further studies with larger sample sizes and longer follow-up time are needed to demonstrate the clinical significance thereof.

Small Lesion Size Is Associated with Sleep-Related Epilepsy in Focal Cortical Dysplasia Type II

Directory of Open Access Journals (Sweden)

Bo Jin

2018-02-01

Full Text Available ObjectiveTo investigate the neuroimaging and clinical features associated with sleep-related epilepsy (SRE in patients with focal cortical dysplasia (FCD type II.MethodsPatients with histopathologically proven FCD type II were included from three epilepsy centers. SRE was defined according to the video EEG findings and seizure history. Cortical surface reconstruction and volume calculation were performed using FreeSurfer. The lesions were manually delineated on T1 volumetric MRI using the ITK-SNAP software. The lesion volumes were normalized by the intracranial volume of each patient. The lesions were classified as small or large by placing a threshold based on quantitative (whether the lesion was detected on MRI report and qualitative (volume criteria.ResultsA total of 77 consecutive patients were included. Of them, 36 had SRE and 41 had non-SRE. An earlier age of epilepsy onset, high seizure frequency, regional interictal EEG findings, and favorable surgical outcome were characteristic in both groups. Small lesions were defined as those having a volume <3,217 mm3. In total, 60.9% of the patients with SRE (25/41 had small FCD lesion, which was significantly higher than the non-SRE group (9/34, 26.5%, p = 0.005. Small lesion size was the only predictor significantly associated with SRE in the overall type II group by multivariate analyses (p = 0.016. Although the proportion of patients who had frontal FCD and SRE was higher than non-frontal FCD (54.5 vs. 27.3%, p = 0.043, the relationship between SRE and lesion location was not confirmed by multivariate analysis. Thalamic volume and seizure semiology were not statistically different between the SRE and non-SRE group. The significant association between lesion size and SRE was reproducible in type IIb and IIa subgroups.SignificanceSRE is common in patients with FCD type II. Small FCD type II lesions are significantly associated with SRE. Although our findings cannot be applied to

Classification of supersymmetric backgrounds of string theory

International Nuclear Information System (INIS)

Gran, U.; Gutowski, J.; Papadopoulos, G.; Roest, D.

2007-01-01

We review the recent progress made towards the classification of supersymmetric solutions in ten and eleven dimensions with emphasis on those of IIB supergravity. In particular, the spinorial geometry method is outlined and adapted to nearly maximally supersymmetric backgrounds. We then demonstrate its effectiveness by classifying the maximally supersymmetric IIB G-backgrounds and by showing that N=31 IIB solutions do not exist. (Abstract Copyright [2007], Wiley Periodicals, Inc.)

THE CHEMICAL EVOLUTION OF PHOSPHORUS

International Nuclear Information System (INIS)

Jacobson, Heather R.; Thanathibodee, Thanawuth; Frebel, Anna; Roederer, Ian U.; Cescutti, Gabriele; Matteucci, Francesca

2014-01-01

Phosphorus is one of the few remaining light elements for which little is known about its nucleosynthetic origin and chemical evolution, given the lack of optical absorption lines in the spectra of long-lived FGK-type stars. We have identified a P I doublet in the near-ultraviolet (2135/2136 Å) that is measurable in stars of low metallicity. Using archival Hubble Space Telescope-Space Telescope Imaging Spectrograph spectra, we have measured P abundances in 13 stars spanning –3.3 ≤ [Fe/H] ≤ -0.2, and obtained an upper limit for a star with [Fe/H] ∼ -3.8. Combined with the only other sample of P abundances in solar-type stars in the literature, which spans a range of –1 ≤ [Fe/H] ≤ +0.2, we compare the stellar data to chemical evolution models. Our results support previous indications that massive-star P yields may need to be increased by a factor of a few to match stellar data at all metallicities. Our results also show that hypernovae were important contributors to the P production in the early universe. As P is one of the key building blocks of life, we also discuss the chemical evolution of the important elements to life, C-N-O-P-S, together

GIANT H II REGIONS IN M101. I. X-RAY ANALYSIS OF HOT GAS

International Nuclear Information System (INIS)

Sun Wei; Chen Yang; Feng Li; Chu, You-Hua; Chen, C.-H. Rosie; Wang, Q. Daniel; Li Jiangtao

2012-01-01

We performed a Chandra X-ray study of three giant H II regions (GHRs), NGC 5461, NGC 5462, and NGC 5471, in the spiral galaxy M101. The X-ray spectra of the three GHRs all contain a prominent thermal component with a temperature of ∼0.2 keV. In NGC 5461, the spatial distribution of the soft ( 52 erg, is consistent with a hypernova origin. In addition, a bright source in the field of NGC 5462 has been identified as a background active galactic nucleus, instead of a black hole X-ray binary in M101.

Distribution of SCCmec-associated phenol-soluble modulin in staphylococci.

LENUS (Irish Health Repository)

Monecke, Stefan

2012-04-01

The recently described phenol-soluble modulin PSM-mec was detected in Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus fleuretti, Staphylococcus hominis, Staphylococcus pseudintermedius, Staphylococcus saprophyticus, Staphylococcus simulans and Staphylococcus vitulinus from different hosts (humans, goats, dogs, cats, pigs, cattle and turkeys). It was identified in isolates harbouring SCCmec types II, IIA, IIB, IID, III, VIII and in some irregular or truncated elements.

From big crunch to big bang: A quantum string cosmology perspective

International Nuclear Information System (INIS)

Maharana, Jnanadeva

2002-01-01

The scenario that the Universe contracts towards a big crunch and then undergoes a transition to an expanding universe is envisaged in the quantum string cosmology approach. The Wheeler-DeWitt (WDW) equation is solved exactly for an exponential dilaton potential. An S-duality invariant cosmological effective action for type IIB theory is considered to derive classical solutions and solve WDW equations

Neumann and Neumann-Rosochatius integrable systems from membranes on AdS4 x S7

International Nuclear Information System (INIS)

Bozhilov, Plamen

2007-01-01

It is known that large class of classical string solutions in the type IIB AdS 5 x S 5 background is related to the Neumann and Neumann-Rosochatius integrable systems, including spiky strings and giant magnons. It is also interesting if these integrable systems can be associated with some membrane configurations in M-theory. We show here that this is indeed the case by presenting explicitly several types of membrane embedding in AdS 4 x S 7 with the searched properties

Superstring amplitudes and contact interactions

International Nuclear Information System (INIS)

Greensite, J.

1987-08-01

We show that scattering amplitudes computed from light-cone superstring field theory are divergent at tree level. The divergences can be eliminated, and supersymmetry restored, by the addition of certain counter terms to the light-cone Hamiltonian. These counter terms have the form of local contact interactions, whose existence we had previously deduced on grounds of vacuum stability, and closure of the super-Poincare algebra. The quartic contact interactions required in Type I and Type IIB superstring theories are constructed in detail. (orig.)

Pre-potential in the AdS{sub 5}×S{sup 5} type IIB superspace

Energy Technology Data Exchange (ETDEWEB)

Poláček, Martin; Siegel, Warren [C.N. Yang Institute for Theoretical Physics, State University of New York,100 Nicolls Rd., Stony Brook, NY 11794-3840 (United States)

2017-01-16

We found the pre-potential in the superspace with AdS{sub 5} × S{sup 5} background. The pre-potential appears as part of the vielbeins, without derivatives. In both subspaces (AdS{sub 5} and S{sup 5}) we used Poincaré coordinates. We picked one bulk coordinate in AdS{sub 5} and one bulk coordinate in S{sup 5} to define the space-cone gauge. Such space-cone gauge destroys the bulk Lorentz covariance. However, it still preserves boundary Lorentz covariance (and gives projective superspace) SO(3,1)⊗SO(4) and so symmetries of boundary CFT are manifest.

Protein tyrosine nitration in chronic intramuscular parasitism: immunohistochemical evaluation of relationships between nitration, and fiber type-specific responses to infection

Directory of Open Access Journals (Sweden)

Ted H. Elsasser

2011-05-01

Full Text Available The present study was conducted to determine whether preferential muscle catabolism [psoas major (PM > rectus femoris (RF] observed during the chronic intramuscular stage of Sarcocystis cruzi infection could be associated with the pathological consequences of increased protein tyrosine nitration in fibers characteristically more metabolically active due to higher mitochondrial density. Holstein calves were assigned to control (C, or S. cruzi-infected (I groups, n=5/group. Calves were euthanized on day 63 of infection. Samples of RF and PM were prepared for metabolic fiber typing (MFT: slow oxidative, SO – Type I; fast oxidative glycolytic, FOG - Type IIa; fast glycolytic, FG – Type IIb, fiber area, and immunohistochemical localization of fast myosin heavy chain 2a and 2b, nitrotyrosine (NT, and mitochondrial Complex V ATP-synthase. MFT analysis documented that PM contained twice the number of SO fibers compared to RF (32 v 16%, P<0.002. SO and FOG fibers (Both higher in mitochondrial density than FG fibers in both PM and RF were significantly smaller in area in I calves with mean FG areas not different between C and I. Muscle NT content (Western blot of myofibrillar protein fraction increased with infection; NT was immunohistochemically localized into three distinct patterns in fibers: i sparse fiber staining, ii dense punctuate intrafiber staining, and iii pericystic staining. By image analysis, the greatest punctuate intrafiber pixel density of NT was associated with SO fibers from I calves with the NT colocalizing with mitochondrial Complex V – F1F0 ATP synthase. More fibers were positive for the colocalization in PM than RF (P<0.04. The data are consistent with the concept that fibers rich in mitochondria possessing more inherent oxidative energy capacity generate more nitrated proteins than glycolytic fibers and as such are more affected by the proinflammatory response to infections like Sarcocystosis.

Tuning and backreaction in F-term axion monodromy inflation

Directory of Open Access Journals (Sweden)

Arthur Hebecker

2015-05-01

Full Text Available We continue the development of axion monodromy inflation, focusing in particular on the backreaction of complex structure moduli. In our setting, the shift symmetry comes from a partial large complex structure limit of the underlying type IIB orientifold or F-theory fourfold. The coefficient of the inflaton term in the superpotential has to be tuned small to avoid conflict with Kähler moduli stabilisation. To allow such a tuning, this coefficient necessarily depends on further complex structure moduli. At large values of the inflaton field, these moduli are then in danger of backreacting too strongly. To avoid this, further tunings are necessary. In weakly coupled type IIB theory at the orientifold point, implementing these tunings appears to be difficult if not impossible. However, fourfolds or models with mobile D7-branes provide enough structural freedom. We calculate the resulting inflaton potential and study the feasibility of the overall tuning given the limited freedom of the flux landscape. Our preliminary investigations suggest that, even imposing all tuning conditions, the remaining choice of flux vacua can still be large enough for such models to provide a promising path to large-field inflation in string theory.

Geometric transitions on non-Kaehler manifolds

International Nuclear Information System (INIS)

Knauf, A.

2007-01-01

We study geometric transitions on the supergravity level using the basic idea of an earlier paper (M. Becker et al., 2004), where a pair of non-Kaehler backgrounds was constructed, which are related by a geometric transition. Here we embed this idea into an orientifold setup. The non-Kaehler backgrounds we obtain in type IIA are non-trivially fibered due to their construction from IIB via T-duality with Neveu-Schwarz flux. We demonstrate that these non-Kaehler manifolds are not half-flat and show that a symplectic structure exists on them at least locally. We also review the construction of new non-Kaehler backgrounds in type I and heterotic theory. They are found by a series of T- and S-duality and can be argued to be related by geometric transitions as well. A local toy model is provided that fulfills the flux equations of motion in IIB and the torsional relation in heterotic theory, and that is consistent with the U-duality relating both theories. For the heterotic theory we also propose a global solution that fulfills the torsional relation because it is similar to the Maldacena-Nunez background. (Abstract Copyright [2007], Wiley Periodicals, Inc.)

(E)-4-Methyl-N-((quinolin-2-yl)ethylidene)aniline as ligand for IIB supramolecular complexes: synthesis, structure, aggregation-induced emission enhancement and application in PMMA-doped hybrid material.

Science.gov (United States)

Wang, Ani; Fan, Ruiqing; Dong, Yuwei; Chen, Wei; Song, Yang; Wang, Ping; Hao, Sue; Liu, Zhigang; Yang, Yulin

2016-12-20

Judicious structural design employing 2-quinolinecarboxaldehyde and 4-methylaniline was used to generate the Schiff base ligand (E)-4-methyl-N-((quinolin-2-yl)ethylidene)aniline (L). Five IIB complexes, namely, [ZnLCl 2 ] (1), [ZnL(NO 3 ) 2 ] (2), [ZnL(OAc) 2 ] 3 (3), [CdL(OAc) 2 ] 3 (4), and [HgLCl 2 ] (5) have been synthesized based on L. Single-crystal X-ray diffraction analysis indicates that complexes 1, 3 and 4 exhibit 3D networks, whereas 2 and 5 form 2D layers and 1D chains, respectively. TD-DFT calculations show a good correlation with the UV-vis absorption assigned to π → π* intraligand transitions. Furthermore, complexes 1-5 displayed strong greenish luminescent emissions (518-524 nm) in the aggregate state but weak emissions in solution (aggregation-induced emission enhancement), which may be due to the existence of C-HCl/O hydrogen bonding and ππ stacking interactions, resulting in restriction of intramolecular rotation (RIR). Variable-concentration 1 H NMR studies suggested that the aggregates undergo intramolecular changes in conformation due to intermolecular interactions. Moreover, the emission intensity and lifetime exhibited obvious increases induced by mechanical grinding and temperature reduction, which were also attributed to AIEE properties. Subsequently, complex 1 was incorporated into poly(methyl methacrylate) (PMMA), whereby 1-PMMA exhibited enhanced emission intensity (20-fold increase in comparison with that of 1), which offers opportunities for use in plastic greenhouses to increase leaf photosynthesis.

Spines vs. microspines: an overview of the sculpture exine in selected basal and derived Asteraceae with focus on Asteroideae.

Science.gov (United States)

Tellería, María C

2017-11-01

This study presents a detailed examination of the echinate and microechinate sculpturing in relation to the size of pollen grains in 31 selected species of Asteraceae belonging to the subfamilies Barnadesioideae, Mutisioideae, Carduoideae and Asteroideae. The aims were to recognize sculpturing patterns, under LM and SEM, within large and small pollen of both basal and derived species and to explore the features that could have taxonomic value to apply in palynological disciplines. The detailed examination of the exine surface showed both the relevance and limits of sculptural patterns for taxonomy. Under LM, the microechinate sculpture gave little taxonomic information, whereas in the echinate sculpture, three exine types and two subtypes were recognized. Type I included microechinate exine, which is commonly present in large pollen grains of the basal lineages. Types II (subtypes IIa and IIb) and III included echinate and smaller pollen grains. In these types, spines were always regularly arranged and, were characterized by the length, shape, tip, perforations and distribution. Type IIa included more or less conical spines usually with a distended base, less than 4 µm in length, present in species of different tribes like Astereae, Eupatorieae, Helenieae, Gnaphalieae, Senecioideae and Heliantheae to a lesser extent. Type IIb includes slender spines with narrower bases, longer than 4 µm, present in species of Coreopsideae, Heliantheae, Tageteae and Eupatorieae to a lesser extent. Type III included spines with swollen base, blunt tip and perforations over their entire surface. This type was present in only one of the basal species-Carduus thoermeri-and in one species of the derived tribe Helenieae, Gaillardia megapotamica. Probably, this is due to evolutionary convergence.

The Power of M Theory

OpenAIRE

Schwarz, John H.

1995-01-01

A proposed duality between type IIB superstring theory on R^9 X S^1 and a conjectured 11D fundamental theory (``M theory'') on R^9 X T^2 is investigated. Simple heuristic reasoning leads to a consistent picture relating the various p-branes and their tensions in each theory. Identifying the M theory on R^{10} X S^1 with type IIA superstring theory on R^{10}, in a similar fashion, leads to various relations among the p-branes of the IIA theory.

Chondrocyte activity is increased in psoriatic arthritis and axial spondyloarthritis

DEFF Research Database (Denmark)

Gudmann, Natasja Stæhr; Munk, Heidi Lausten; Christensen, Anne Friesgaard

2016-01-01

. There is a need for biomarkers reflecting core disease pathways for diagnosis and disease mapping. Pro-C2 reflects mature cartilage collagen type IIB formation, while C-Col10 represents turnover of type X collagen, which is exclusively expressed by hypertrophic chondrocytes. The objectives of this study were......SpA undergoing TNFi treatment may reflect that hypertrophic chondrocytes in axSpA are targeted by TNFi. ROC curve analysis showed a diagnostic potential for Pro-C2 in axSpA and PsA....

The supergravity fields for a D-brane with a travelling wave from string amplitudes

International Nuclear Information System (INIS)

Black, William; Russo, Rodolfo; Turton, David

2010-01-01

We calculate the supergravity fields sourced by a D-brane with a null travelling wave from disk amplitudes in type IIB string theory compactified on T 4 xS 1 . The amplitudes reproduce all the non-trivial features of the previously known two-charge supergravity solutions in the D-brane/momentum duality frame, providing a direct link between the microscopic bound states and their macroscopic descriptions.

Family Caregiver Palliative Care Intervention in Supporting Caregivers of Patients With Stage II-IV Gastrointestinal, Gynecologic, Urologic and Lung Cancers

Science.gov (United States)

2018-02-12

Healthy Subject; Localized Transitional Cell Cancer of the Renal Pelvis and Ureter; Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter; Psychosocial Effects of Cancer and Its Treatment; Recurrent Bladder Cancer; Recurrent Cervical Cancer; Recurrent Colon Cancer; Recurrent Gastric Cancer; Recurrent Ovarian Epithelial Cancer; Recurrent Ovarian Germ Cell Tumor; Recurrent Pancreatic Cancer; Recurrent Rectal Cancer; Recurrent Renal Cell Cancer; Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter; Recurrent Urethral Cancer; Recurrent Uterine Sarcoma; Regional Transitional Cell Cancer of the Renal Pelvis and Ureter; Stage II Bladder Cancer; Stage II Renal Cell Cancer; Stage II Urethral Cancer; Stage IIA Cervical Cancer; Stage IIA Colon Cancer; Stage IIA Gastric Cancer; Stage IIA Ovarian Epithelial Cancer; Stage IIA Ovarian Germ Cell Tumor; Stage IIA Pancreatic Cancer; Stage IIA Rectal Cancer; Stage IIA Uterine Sarcoma; Stage IIB Cervical Cancer; Stage IIB Colon Cancer; Stage IIB Gastric Cancer; Stage IIB Ovarian Epithelial Cancer; Stage IIB Ovarian Germ Cell Tumor; Stage IIB Pancreatic Cancer; Stage IIB Rectal Cancer; Stage IIB Uterine Sarcoma; Stage IIC Colon Cancer; Stage IIC Ovarian Epithelial Cancer; Stage IIC Ovarian Germ Cell Tumor; Stage IIC Rectal Cancer; Stage III Bladder Cancer; Stage III Pancreatic Cancer; Stage III Renal Cell Cancer; Stage III Urethral Cancer; Stage IIIA Cervical Cancer; Stage IIIA Colon Cancer; Stage IIIA Gastric Cancer; Stage IIIA Ovarian Epithelial Cancer; Stage IIIA Ovarian Germ Cell Tumor; Stage IIIA Rectal Cancer; Stage IIIA Uterine Sarcoma; Stage IIIB Cervical Cancer; Stage IIIB Colon Cancer; Stage IIIB Gastric Cancer; Stage IIIB Ovarian Epithelial Cancer; Stage IIIB Ovarian Germ Cell Tumor; Stage IIIB Rectal Cancer; Stage IIIB Uterine Sarcoma; Stage IIIC Colon Cancer; Stage IIIC Gastric Cancer; Stage IIIC Ovarian Epithelial Cancer; Stage IIIC Ovarian Germ Cell Tumor; Stage IIIC Rectal Cancer; Stage IIIC

Conservation of the human integrin-type beta-propeller domain in bacteria.

Directory of Open Access Journals (Sweden)

Bhanupratap Chouhan

Full Text Available Integrins are heterodimeric cell-surface receptors with key functions in cell-cell and cell-matrix adhesion. Integrin α and β subunits are present throughout the metazoans, but it is unclear whether the subunits predate the origin of multicellular organisms. Several component domains have been detected in bacteria, one of which, a specific 7-bladed β-propeller domain, is a unique feature of the integrin α subunits. Here, we describe a structure-derived motif, which incorporates key features of each blade from the X-ray structures of human αIIbβ3 and αVβ3, includes elements of the FG-GAP/Cage and Ca(2+-binding motifs, and is specific only for the metazoan integrin domains. Separately, we searched for the metazoan integrin type β-propeller domains among all available sequences from bacteria and unicellular eukaryotic organisms, which must incorporate seven repeats, corresponding to the seven blades of the β-propeller domain, and so that the newly found structure-derived motif would exist in every repeat. As the result, among 47 available genomes of unicellular eukaryotes we could not find a single instance of seven repeats with the motif. Several sequences contained three repeats, a predicted transmembrane segment, and a short cytoplasmic motif associated with some integrins, but otherwise differ from the metazoan integrin α subunits. Among the available bacterial sequences, we found five examples containing seven sequential metazoan integrin-specific motifs within the seven repeats. The motifs differ in having one Ca(2+-binding site per repeat, whereas metazoan integrins have three or four sites. The bacterial sequences are more conserved in terms of motif conservation and loop length, suggesting that the structure is more regular and compact than those example structures from human integrins. Although the bacterial examples are not full-length integrins, the full-length metazoan-type 7-bladed β-propeller domains are present, and

A Wolf-Rayet-Like Progenitor of SN 2013cu from Spectral Observations of a Stellar Wind

Science.gov (United States)

Gal-Yam, Avishay; Arcavi, I.; Ofek, E. O.; Ben-Ami, S.; Cenko, S. B.; Kasliwal, M. M.; Cao, Y.; Yaron, O.; Tal, D.; Silverman, J. M.;

Preoperative multidetector CT manifestations of perigastric lymph nodes in patients with early gastric cancer and pN0

Energy Technology Data Exchange (ETDEWEB)

Kang, Jung Hyun; Yu, Jeong Sik; Chung, Jae Joon; Lim, Joo Hee; Cho, Eun Suk; Kim, Ki Whang [Dept. of Radiology, Yonsei University College of Medicine, Gangnam Severance Hospital, Seoul (Korea, Republic of)

2013-11-15

To find the determinant of lymph node (LN) manifestations on preoperative multidetector CT (MDCT) in early gastric cancer (EGC) patients with pN0. One hundred and eighty-six consecutive patients with pT1pN0, the largest perigastric LN on preoperative MDCT, were categorized into two groups according to 8 different parameters [short (SD) and long diameter (LD) 4/6/8 mm, average attenuation 100 Hounsfield unit, short-to-long diameter-ratio (SLR) 0.7], and correlated with the size, gross type, depth of invasion and microscopic type of their primary lesions by the chi-square test and multiple logistic regression analysis. When the primary lesion was larger than 3 cm, the LNs were larger in 4 parameters (SD or LD, 4/6 mm; p < 0.05); gross type IIb patients showed smaller LNs in 5 parameters (SD 4/6 mm, LD 4/6/8 mm; p < 0.05); and patients with microscopically-undifferentiated lesions showed larger LNs in SD 4 mm or LD 8 mm by the chi-square test and multiple logistic regression analysis. The depth of invasion showed no significant difference in LN size. No factors revealed significant difference in LN attenuation or SLR. Benign regional LN enlargement is more frequent in EGC patients with larger size primary lesions or lesion with poor microscopic differentiation. However, this condition is less frequent in gross type IIb patients.

The protein C omega-loop substitution Asn2Ile is associated with reduced protein C anticoagulant activity.

LENUS (Irish Health Repository)

Preston, Roger J S

2012-02-01

We report a kindred with heritable protein C (PC) deficiency in which two siblings with severe thrombosis showed a composite type I and IIb PC deficiency phenotype, identified using commercial PC assays (proband: PC antigen 42 u\\/dl, amidolytic activity 40 u\\/dl, anticoagulant activity 9 u\\/dl). The independent PROC nucleotide variations c.669C>A (predictive of Ser181Arg) and c.131C>T (predictive of Asn2Ile) segregated with the type I and type IIb PC deficiency phenotypes respectively, but co-segregated in the siblings with severe thrombosis. Soluble thrombomodulin (sTM)-mediated inhibition of plasma thrombin generation from an individual with PC-Asn2Ile was lower (endogenous thrombin potential (ETP) 56 +\\/- 1% that of ETP determined without sTM) than control plasma (ETP 15 +\\/- 2%) indicating reduced PC anticoagulant activity. Recombinant APC-Asn2Ile exhibited normal amidolytic activity but impaired anticoagulant activity. Protein S (PS)-dependent anticoagulant activity of recombinant APC-Asn2Ile and binding of recombinant APC-Asn2Ile to endothelial protein C receptor (EPCR) were reduced compared to recombinant wild-type APC. Asn2 lies within the omega-loop of the PC\\/APC Gla domain and this region is critical for calcium-induced folding and subsequent interactions with anionic phospholipids, EPCR and PS. The disruption of these interactions in this naturally-occurring PC variant highlights their collective importance in mediating APC anticoagulant activity in vivo.

Star formation rate in Holmberg IX dwarf galaxy

Directory of Open Access Journals (Sweden)

Anđelić M.M.

2011-01-01

Full Text Available In this paper we use previously determined Hα fluxes for dwarf galaxy Holmberg IX (Arbutina et al. 2009 to calculate star formation rate (SFR in this galaxy. We discuss possible contaminations of Hα flux and, for the first time, we take into account optical emission from supernova remnants (SNRs as a possible source of contamination of Hα flux. Derived SFR for Holmberg IX is 3:4 x 10-4M.yr-1. Our value is lower then in previous studies, due to luminous shock-heated source M&H 9-10, possible hypernova remnant, which we excluded from the total Hα flux in our calculation of SFR.

Prepotential, Mirror Map and F-Theory on K3

CERN Document Server

Lerche, W.

1998-01-01

We compute certain one-loop corrections to F^4 couplings of the heterotic string compactified on T^2, and show that they can be characterized by holomorphic prepotentials. We then discuss how some of these couplings can be obtained in F-theory, or more precisely from 7-brane geometry in type IIB language. We in particular study theories with E_8 x E_8 and SO(8)^4 gauge symmetry, on certain one-dimensional sub-spaces of the moduli space that correspond to constant IIB coupling. For these theories, the relevant geometry can be mapped to Riemann surfaces. Physically, the computations amount to non-trivial tests of the basic F-theory -- heterotic duality in eight dimensions. Mathematically, they mean to associate holomorphic 5-point couplings of the form (del_t)^5 G = sum[ g_l l^5 q^l/(1-q^l) ] to K3 surfaces. This can be seen as a novel manifestation of the mirror map, acting here between open and closed string sectors.

Comparison of muscle fibre characteristics and production traits among offspring from Meishan dams mated to different sires

Directory of Open Access Journals (Sweden)

Ki-Chang Hong

2010-01-01

Full Text Available This study evaluated how various porcine sires affected muscle fibre characteristics, with respect to production traits. Sires from Berkshire, Duroc, Meishan, and Yorkshire pigs were mated to Meishan dams (BM, DM, MM, and YM offspring, respectively. A total of 96 pigs were evaluated for muscle fibre characteristics and production traits. The progeny from Duroc and Yorkshire sires had the greatest number of total fibres (P<0.05 and exhibited less backfat thickness (P<0.001 and larger loin muscle areas (P<0.05 than BM pigs. The DM and BM crossbreds showed higher marbling (P<0.01, and colour scores (P<0.05, as well as lower shear force scores (P<0.001. The MM pigs had greater proportional area of type IIb muscle fibres (P<0.05, and also displayed higher drip loss (P<0.01, higher lightness (P<0.001, and a greater incidence of PSE pork (pale, soft, and exudative; 25% than DM, BM, and YM. These results showed that a greater number of total muscle fibres without increasing the cross sectional area of fibres improved lean meat production, and that a lower proportion of type IIb fibres was associated with better meat quality. For these reasons, the Duroc sire × Meishan dam crossbreed emerged as the most appropriate mating type examined herein to simultaneously enhance both lean meat production and meat quality.

5-Fluorouracil, leucovorin, and oxaliplatin (mFOLFOX6) plus sunitinib or bevacizumab as first-line treatment for metastatic colorectal cancer: a randomized Phase IIb study

Science.gov (United States)

Hecht, J Randolph; Mitchell, Edith P; Yoshino, Takayuki; Welslau, Manfred; Lin, Xun; Chow Maneval, Edna; Paolini, Jolanda; Lechuga, Maria Jose; Kretzschmar, Albrecht

2015-01-01

Background Sunitinib is an oral inhibitor of tyrosine kinase receptors implicated in tumor proliferation, angiogenesis, and metastasis. In this randomized, multicenter, open-label Phase IIb study, sunitinib plus mFOLFOX6 (oxaliplatin plus leucovorin plus 5-fluorouracil) was compared with bevacizumab plus mFOLFOX6 as first-line therapy in patients with metastatic colorectal cancer. Methods Patients were stratified by performance status, baseline lactate dehydrogenase level, and prior adjuvant treatment, and randomized 1:1 to receive sunitinib 37.5 mg/day for 4 weeks on and 2 weeks off plus mFOLFOX6 every 2 weeks or bevacizumab 5 mg/kg every 2 weeks plus mFOLFOX6 every 2 weeks. The primary endpoint was progression-free survival. Secondary endpoints included objective response rate, overall survival, safety, and quality of life. Results Enrollment was closed early following accrual of 191 patients, based on an interim analysis showing an inferior trend in the primary progression-free survival efficacy endpoint for sunitinib. Ninety-six patients were randomized to sunitinib plus mFOLFOX6 and 95 to bevacizumab plus mFOLFOX6. Median progression-free survival was 9.3 months and 15.4 months, respectively, but the objective response rate was similar between the study arms. Median overall survival was 23.7 months and 34.1 months, respectively. Dose reductions and interruptions were more common with sunitinib. Hematologic toxicity was more common in the sunitinib arm. Conclusion While the results of the sunitinib arm are comparable with those of previously reported FOLFOX combinations, the sunitinib-based combination was associated with more toxicity than that observed with bevacizumab and mFOLFOX6. The bevacizumab arm had an unexpectedly good outcome, and was much better than that seen in the Phase III trials. Combination therapy with sunitinib plus mFOLFOX6 is not recommended for patients with metastatic colorectal cancer. PMID:26109878

5-Fluorouracil, leucovorin, and oxaliplatin (mFOLFOX6) plus sunitinib or bevacizumab as first-line treatment for metastatic colorectal cancer: a randomized Phase IIb study

International Nuclear Information System (INIS)

Hecht, J Randolph; Mitchell, Edith P; Yoshino, Takayuki; Welslau, Manfred; Lin, Xun; Chow Maneval, Edna; Paolini, Jolanda; Lechuga, Maria Jose; Kretzschmar, Albrecht

2015-01-01

Sunitinib is an oral inhibitor of tyrosine kinase receptors implicated in tumor proliferation, angiogenesis, and metastasis. In this randomized, multicenter, open-label Phase IIb study, sunitinib plus mFOLFOX6 (oxaliplatin plus leucovorin plus 5-fluorouracil) was compared with bevacizumab plus mFOLFOX6 as first-line therapy in patients with metastatic colorectal cancer. Patients were stratified by performance status, baseline lactate dehydrogenase level, and prior adjuvant treatment, and randomized 1:1 to receive sunitinib 37.5 mg/day for 4 weeks on and 2 weeks off plus mFOLFOX6 every 2 weeks or bevacizumab 5 mg/kg every 2 weeks plus mFOLFOX6 every 2 weeks. The primary endpoint was progression-free survival. Secondary endpoints included objective response rate, overall survival, safety, and quality of life. Enrollment was closed early following accrual of 191 patients, based on an interim analysis showing an inferior trend in the primary progression-free survival efficacy endpoint for sunitinib. Ninety-six patients were randomized to sunitinib plus mFOLFOX6 and 95 to bevacizumab plus mFOLFOX6. Median progression-free survival was 9.3 months and 15.4 months, respectively, but the objective response rate was similar between the study arms. Median overall survival was 23.7 months and 34.1 months, respectively. Dose reductions and interruptions were more common with sunitinib. Hematologic toxicity was more common in the sunitinib arm. While the results of the sunitinib arm are comparable with those of previously reported FOLFOX combinations, the sunitinib-based combination was associated with more toxicity than that observed with bevacizumab and mFOLFOX6. The bevacizumab arm had an unexpectedly good outcome, and was much better than that seen in the Phase III trials. Combination therapy with sunitinib plus mFOLFOX6 is not recommended for patients with metastatic colorectal cancer

Myosin heavy chain composition of single fibres from m. biceps brachii of male body builders

DEFF Research Database (Denmark)

Klitgaard, H; Zhou, M.-Y.; Richter, Erik

1990-01-01

The myosin heavy chain (MHC) composition of single fibres from m. biceps brachii of young sedentary men (28 +/- 0.4 years, mean +/- SE, n = 4) and male body builders (25 +/- 2.0 years, n = 4) was analysed with a sensitive one-dimensional electrophoretic technique. Compared with sedentary men...... expression of MHC isoforms within histochemical type II fibres of human skeletal muscle with body building. Furthermore, in human skeletal muscle differences in expression of MHC isoforms may not always be reflected in the traditional histochemical classification of types I, IIa, IIb and IIc fibres....

Spiked instantons from intersecting D-branes

Directory of Open Access Journals (Sweden)

Nikita Nekrasov

2017-01-01

Full Text Available The moduli space of spiked instantons that arises in the context of the BPS/CFT correspondence [22] is realised as the moduli space of classical vacua, i.e. low-energy open string field configurations, of a certain stack of intersecting D1-branes and D5-branes in Type IIB string theory. The presence of a constant B-field induces an interesting dynamics involving the tachyon condensation.

Maximally minimal preons in four dimensions

International Nuclear Information System (INIS)

Grover, Jai; Gutowski, Jan B; Sabra, Wafic

2007-01-01

Killing spinors of N = 2, D = 4 supergravity are examined using the spinorial geometry method, in which spinors are written as differential forms. By making use of methods developed in Gran et al (2007 J. High Energy Phys. JHEP 02(2007)044 (Preprint hep-th/0606049)) to analyse preons in type IIB supergravity, we show that there are no simply connected solutions preserving exactly 3/4 of the supersymmetry

Management strategies in antithrombotic therapy

National Research Council Canada - National Science Library

Lincoff, A. Michael; Messerli, Adrian W; Askari, Arman

2007-01-01

... in the management of non-st-elevation ACS 4.5 GP IIb/IIIa inhibitors in the management of acute STEMI 4.6 Safety of GP IIb/IIIa inhibitors 4.7 Summary 77 77 78 80 87 91 94 96 Chapter 5 Unfractionated Hepa...

Superstrings in type IIB R-R plane-wave in semi-light-cone gauge and conformal invariance

International Nuclear Information System (INIS)

Mukhopadhyay, Partha

2009-01-01

We reconsider the analysis done by Kazama and Yokoi in arXiv:0801.1561 (hep-th). We find that although the right vacuum of the theory is the one associated to massless normal ordering (MNO), phase space normal ordering (PNO) plays crucial role in the analysis in the following way. While defining the quantum energy-momentum (EM) tensor one needs to take into account the field redefinition relating the space-time field and the corresponding world-sheet coupling. We argue that for a simple off-shell ansatz for the background this field redefinition can be taken to be identity if the interaction term is ordered according to PNO. This definition reproduces the correct physical spectrum when the background is on-shell. We further show that the right way to extract the effective equation of motion from the Virasoro anomaly is to first order the anomaly terms according to PNO at a finite regularization parameter ε and then take the ε → 0 limit. This prescription fixes an ambiguity in taking the limit for certain bosonic and fermionic contributions to the Virasoro anomaly and is the natural one to consider given the above definition of the EM tensor.

The exceptional generalised geometry of supersymmetric AdS flux backgrounds

Energy Technology Data Exchange (ETDEWEB)

Ashmore, Anthony [Merton College, University of Oxford,Merton Street, Oxford, OX1 4JD (United Kingdom); Mathematical Institute, University of Oxford, Andrew Wiles Building,Woodstock Road, Oxford, OX2 6GG (United Kingdom); Petrini, Michela [Sorbonne Université, UPMC Paris 06, UMR 7589,LPTHE, 75005 Paris (France); Waldram, Daniel [Department of Physics, Imperial College London,Prince Consort Road, London, SW7 2AZ (United Kingdom)

2016-12-29

We analyse generic AdS flux backgrounds preserving eight supercharges in D=4 and D=5 dimensions using exceptional generalised geometry. We show that they are described by a pair of globally defined, generalised structures, identical to those that appear for flat flux backgrounds but with different integrability conditions. We give a number of explicit examples of such “exceptional Sasaki-Einstein” backgrounds in type IIB supergravity and M-theory. In particular, we give the complete analysis of the generic AdS{sub 5} M-theory backgrounds. We also briefly discuss the structure of the moduli space of solutions. In all cases, one structure defines a “generalised Reeb vector” that generates a Killing symmetry of the background corresponding to the R-symmetry of the dual field theory, and in addition encodes the generic contact structures that appear in the D=4 M-theory and D=5 type IIB cases. Finally, we investigate the relation between generalised structures and quantities in the dual field theory, showing that the central charge and R-charge of BPS wrapped-brane states are both encoded by the generalised Reeb vector, as well as discussing how volume minimisation (the dual of a- and F-maximisation) is encoded.

Fluxes, hierarchies, and metastable vacua in supersymmetric field theories

Energy Technology Data Exchange (ETDEWEB)

Bruemmer, F.

2008-02-06

This thesis concerns topics both in low-energy effective field theories from type IIB superstring flux compactifications and in four-dimensional, rigidly supersymmetric gauge theories. We introduce flux compactifications with so-called ''warped throat'' regions, which lead to large hierarchies of scales in the effective four-dimensional theory. The correspondence between a particular such throat and a five-dimensional Randall-Sundrum-like model is established. We shown how certain string-theoretic features of the compactification, such as moduli stabilization by fluxes or the presence of an unstabilized Kaehler modulus, are incorporated in the five-dimensional picture. The KKLT construction for metastable de Sitter vacua is reviewed, as well as some possible modifications involving spontaneous F-term supersymmetry breaking. For KKLT-like models with their hidden sector localized inside a throat, the mediation of supersymmetry breaking to the visible sector is investigated. We review the mechanism of mixed modulus-anomaly mediation, and show that there can be additional equally important gravity-mediated contributions. We finally turn to the ISS model of metastable dynamical supersymmetry breaking in four dimensions, and present a renormalizable extension which generates a large hierarchy naturally. We also recapitulate how the ISS model may be obtained from a type IIB superstring model. (orig.)

Fluxes, hierarchies, and metastable vacua in supersymmetric field theories

International Nuclear Information System (INIS)

Bruemmer, F.

2008-01-01

This thesis concerns topics both in low-energy effective field theories from type IIB superstring flux compactifications and in four-dimensional, rigidly supersymmetric gauge theories. We introduce flux compactifications with so-called ''warped throat'' regions, which lead to large hierarchies of scales in the effective four-dimensional theory. The correspondence between a particular such throat and a five-dimensional Randall-Sundrum-like model is established. We shown how certain string-theoretic features of the compactification, such as moduli stabilization by fluxes or the presence of an unstabilized Kaehler modulus, are incorporated in the five-dimensional picture. The KKLT construction for metastable de Sitter vacua is reviewed, as well as some possible modifications involving spontaneous F-term supersymmetry breaking. For KKLT-like models with their hidden sector localized inside a throat, the mediation of supersymmetry breaking to the visible sector is investigated. We review the mechanism of mixed modulus-anomaly mediation, and show that there can be additional equally important gravity-mediated contributions. We finally turn to the ISS model of metastable dynamical supersymmetry breaking in four dimensions, and present a renormalizable extension which generates a large hierarchy naturally. We also recapitulate how the ISS model may be obtained from a type IIB superstring model. (orig.)

Organization of the BcgI restriction-modification protein for the cleavage of eight phosphodiester bonds in DNA

Science.gov (United States)

Smith, Rachel M.; Marshall, Jacqueline J. T.; Jacklin, Alistair J.; Retter, Susan E.; Halford, Stephen E.; Sobott, Frank

2013-01-01

Type IIB restriction-modification systems, such as BcgI, feature a single protein with both endonuclease and methyltransferase activities. Type IIB nucleases require two recognition sites and cut both strands on both sides of their unmodified sites. BcgI cuts all eight target phosphodiester bonds before dissociation. The BcgI protein contains A and B polypeptides in a 2:1 ratio: A has one catalytic centre for each activity; B recognizes the DNA. We show here that BcgI is organized as A2B protomers, with B at its centre, but that these protomers self-associate to assemblies containing several A2B units. Moreover, like the well known FokI nuclease, BcgI bound to its site has to recruit additional protomers before it can cut DNA. DNA-bound BcgI can alternatively be activated by excess A subunits, much like the activation of FokI by its catalytic domain. Eight A subunits, each with one centre for nuclease activity, are presumably needed to cut the eight bonds cleaved by BcgI. Its nuclease reaction may thus involve two A2B units, each bound to a recognition site, with two more A2B units bridging the complexes by protein–protein interactions between the nuclease domains. PMID:23147005

T4 fibrations over Calabi–Yau two-folds and non-Kähler manifolds in string theory

Directory of Open Access Journals (Sweden)

Hai Lin

2016-08-01

Full Text Available We construct a geometric model of eight-dimensional manifolds and realize them in the context of type II string theory. These eight-manifolds are constructed by non-trivial T4 fibrations over Calabi–Yau two-folds. These give rise to eight-dimensional non-Kähler Hermitian manifolds with SU(4 structure. The eight-manifold is also a circle fibration over a seven-dimensional G2 manifold with skew torsion. The eight-manifolds of this type appear as internal manifolds with SU(4 structure in type IIB string theory with F3 and F7 fluxes. These manifolds have generalized calibrated cycles in the presence of fluxes.

Diagenesis of amorphous organic matter as an essential aspect of genesis and alteration of tabular-type uranium-vanadium deposits, Colorado Plateau

International Nuclear Information System (INIS)

Spirakis, C.S.; Hansley, P.L.

1987-01-01

Organic matter was the key to the initial concentration of uranium and vanadium (during the sulfate reduction stage of early diagenesis) in all sandstone-hosted, tabular deposits in the Morrison Formation, Colorado Plateau. In deposits rich in amorphous organic matter, as are many in the Grants uranium region (GUR), diagenesis did not proceed beyond sulfate reduction. In contrast, in organic-poor, chlorite deposits of the Henry Mountains district, 13 C- and 18 O-enriched dolomites preserve evidence of a subsequent methanogenic stage. In these and similar organic-poor deposits in the Slick Rock district and in parts of the GUR, aluminosilicate dissolution (including a distinctive, organic-acid-induced etching of garnets) and growth of coarse-grained coffinite, albite, ankerite, and chlorite suggest diagenesis reached the organic acid stage. Temperature and thermal maturation indicators (vitrinite reflectance, type IIb chlorite, ordered illite/smectite, and fluid inclusion data) are consistent with temperatures of organic-acid stage diagenesis (∼ 100 0 C). The localization of these alterations in and around organic-poor, clay-rich ore; the similarities in type and sequence of these alterations to the normal alteration of organic-bearing sediments; the alteration of iron-titanium oxides (attributed to the action of soluble organic complexes) around both organic-rich and organic-poor deposits; and the gradation from organic-rich to organic-poor, chlorite-rich deposits (in GUR) suggest that (1) amorphous organic matter was involved in the genesis of all of these deposits and (2) differences among deposits may reflect varying degrees of diagenesis of the organic matter

Insights into long-lasting protection induced by RTS,S/AS02A malaria vaccine: further results from a phase IIb trial in Mozambican children.

Directory of Open Access Journals (Sweden)

Caterina Guinovart

Full Text Available The pre-erythrocytic malaria vaccine RTS,S/AS02A has shown to confer protection against clinical malaria for at least 21 months in a trial in Mozambican children. Efficacy varied between different endpoints, such as parasitaemia or clinical malaria; however the underlying mechanisms that determine efficacy and its duration remain unknown. We performed a new, exploratory analysis to explore differences in the duration of protection among participants to better understand the protection afforded by RTS,S.The study was a Phase IIb double-blind, randomized controlled trial in 2022 children aged 1 to 4 years. The trial was designed with two cohorts to estimate vaccine efficacy against two different endpoints: clinical malaria (cohort 1 and infection (cohort 2. Participants were randomly allocated to receive three doses of RTS,S/AS02A or control vaccines. We did a retrospective, unplanned sub-analysis of cohort 2 data using information collected for safety through the health facility-based passive case detection system. Vaccine efficacy against clinical malaria was estimated over the first six-month surveillance period (double-blind phase and over the following 12 months (single-blind phase, and analysis was per-protocol. Adjusted vaccine efficacy against first clinical malaria episodes in cohort 2 was of 35.4% (95% CI 4.5-56.3; p = 0.029 over the double-blind phase and of 9.0% (-30.6-36.6; p = 0.609 during the single-blind phase.Contrary to observations in cohort 1, where efficacy against clinical malaria did not wane over time, in cohort 2 the efficacy decreases with time. We hypothesize that this reduced duration of protection is a result of the early diagnosis and treatment of infections in cohort 2 participants, preventing sufficient exposure to asexual-stage antigens. On the other hand, the long-term protection against clinical disease observed in cohort 1 may be a consequence of a prolonged exposure to low-dose blood-stage asexual parasitaemia

Orbifold matrix models and fuzzy extra dimensions

CERN Document Server

Chatzistavrakidis, Athanasios; Zoupanos, George

2011-01-01

We revisit an orbifold matrix model obtained as a restriction of the type IIB matrix model on a Z_3-invariant sector. An investigation of its moduli space of vacua is performed and issues related to chiral gauge theory and gravity are discussed. Modifications of the orbifolded model triggered by Chern-Simons or mass deformations are also analyzed. Certain vacua of the modified models exhibit higher-dimensional behaviour with internal geometries related to fuzzy spheres.

Motivations for AdS/QCD from 10D supergravity solutions

International Nuclear Information System (INIS)

De Paula, Wayne

2016-01-01

We discuss some attempts for the construction of gravity duals of QCD-like theories. It is analysed some properties of solutions of 10D Type IIB supergravity theory that attempt to be dual to N= 1 gauge theories, in particular the solutions that belong to Papadoulos-Tseytlin ansatz. We argue that one could obtain 5D effective theories from 10d solutions and it motivates the use of phenomenological AdS/QCD models. (paper)

Towards natural inflation in string theory

International Nuclear Information System (INIS)

Ben-Dayan, Ido; Pedro, Francisco G.; Westphal, Alexander

2014-07-01

We provide type IIB string embeddings of two axion variants of natural inflation. We use a combination of RR 2 form axions as the inflaton field and have its potential generated by non perturbative effects in the superpotential. Besides giving rise to inflation, the models developed take into account the stabilization of the compact space, both in the KKLT and large volume scenario regimes, an essential condition for any semi-realistic model of string inflation.

Supernovae from massive stars with extended tenuous envelopes

Science.gov (United States)

Dessart, Luc; Yoon, Sung-Chul; Livne, Eli; Waldman, Roni

2018-04-01

Massive stars with a core-halo structure are interesting objects for stellar physics and hydrodynamics. Using simulations for stellar evolution, radiation hydrodynamics, and radiative transfer, we study the explosion of stars with an extended and tenuous envelope (i.e. stars in which 95% of the mass is contained within 10% or less of the surface radius). We consider both H-rich supergiant and He-giant progenitors resulting from close-binary evolution and dying with a final mass of 2.8-5 M⊙. An extended envelope causes the supernova (SN) shock to brake and a reverse shock to form, sweeping core material into a dense shell. The shock-deposited energy, which suffers little degradation from expansion, is trapped in ejecta layers of moderate optical depth, thereby enhancing the SN luminosity at early times. With the delayed 56Ni heating, we find that the resulting optical and near-IR light curves all exhibit a double-peak morphology. We show how an extended progenitor can explain the blue and featureless optical spectra of some Type IIb and Ib SNe. The dense shell formed by the reverse shock leads to line profiles with a smaller and near-constant width. This ejecta property can explain the statistically narrower profiles of Type IIb compared to Type Ib SNe, as well as the peculiar Hα profile seen in SN 1993J. At early times, our He-giant star explosion model shows a high luminosity, a blue colour, and featureless spectra reminiscent of the Type Ib SN 2008D, suggesting a low-mass progenitor.

Cosmic Connections:. from Cosmic Rays to Gamma Rays, Cosmic Backgrounds and Magnetic Fields

Science.gov (United States)

Kusenko, Alexander

2013-12-01

Combined data from gamma-ray telescopes and cosmic-ray detectors have produced some new surprising insights regarding intergalactic and galactic magnetic fields, as well as extragalactic background light. We review some recent advances, including a theory explaining the hard spectra of distant blazars and the measurements of intergalactic magnetic fields based on the spectra of distant sources. Furthermore, we discuss the possible contribution of transient galactic sources, such as past gamma-ray bursts and hypernova explosions in the Milky Way, to the observed ux of ultrahigh-energy cosmicrays nuclei. The need for a holistic treatment of gamma rays, cosmic rays, and magnetic fields serves as a unifying theme for these seemingly unrelated phenomena.

Sporadic ganglioneuromatosis of esophagogastric junction in a patient with gastro-esophageal reflux disorder and intestinal metaplasia.

Science.gov (United States)

Siderits, Richard; Hanna, Iman; Baig, Zahid; Godyn, Janusz-J

2006-12-28

A 58-year-old female with a recurrent history of upper abdominal pain and intermittent dysphagia underwent endoscopic evaluation that demonstrated an irregular and nodular esophago-gastric (EG) junction and grade I erosive esophagitis. Biopsies showed prominent intestinal metaplasia of Barrett's type without dysplasia, chronic inflammation and multiple aggregates of large cells within the mucosal lamina propria, some with spindle shaped nuclei. Immunohistochemistry stains for keratins AE-1/AE-3 were negative, while S-100 and NSE were positive. This, together with routine stains, was diagnostic for mucosal ganglioneuromatosis. The background of chronic inflammation with intestinal type metaplasia was consistent with long-term reflux esophagitis. No evidence of achalasia was seen. Biopsies of gastric antrum and fundus were unremarkable, without ganglioneural proliferation. Colonoscopy was unremarkable. No genetic syndromes were identified in the patient including familial adenomatous polyposis and multiple endocrine neoplasia type IIb (MEN IIb). Iansoprazole (Prevacid) was started by oral administration each day with partial relief of symptoms. Subsequent esophagogastroscopy repeated at 4 mo showed normal appearing EG junction. Esophageal manometry revealed a mild non-specific lower esophageal motility disorder. Mild motor dysfunction is seen with gastro-esophageal reflux disease (GERD) and we feel that the demonstration of localized ganglioneuromatosis was not likely related etiologically. In the absence of findings that might suggest neural hypertrophy, such as achalasia, the nodular mucosal irregularity seen with this instance of ganglioneuromatosis may, however, have exacerbated the patient's reflux.

Extended Cancer Education for Longer-Term Survivors in Primary Care for Patients With Stage I-II Breast or Prostate Cancer or Stage I-III Colorectal Cancer

Science.gov (United States)

2017-11-15

Stage I Breast Cancer; Stage I Colorectal Cancer AJCC v6 and v7; Stage I Prostate Cancer; Stage IA Breast Cancer; Stage IB Breast Cancer; Stage II Breast Cancer; Stage II Colorectal Cancer AJCC v7; Stage II Prostate Cancer; Stage IIA Breast Cancer; Stage IIA Colorectal Cancer AJCC v7; Stage IIA Prostate Cancer; Stage IIB Breast Cancer; Stage IIB Colorectal Cancer AJCC v7; Stage IIB Prostate Cancer; Stage IIC Colorectal Cancer AJCC v7; Stage III Colorectal Cancer AJCC v7; Stage IIIA Colorectal Cancer AJCC v7; Stage IIIB Colorectal Cancer AJCC v7; Stage IIIC Colorectal Cancer AJCC v7

Supersymmetric AdS3, AdS2 and bubble solutions

International Nuclear Information System (INIS)

Gauntlett, Jerome P.; Waldram, Daniel; Kim, Nakwoo

2007-01-01

We present new supersymmetric AdS 3 solutions of type IIB supergravity and AdS 2 solutions of D = 11 supergravity. The former are dual to conformal field theories in two dimensions with N = (0, 2) supersymmetry while the latter are dual to conformal quantum mechanics with two supercharges. Our construction also includes AdS 2 solutions of D = 11 supergravity that have non-compact internal spaces which are dual to three-dimensional N = 2 superconformal field theories coupled to point-like defects. We also present some new bubble-type solutions, corresponding to BPS states in conformal theories, that preserve four supersymmetries

Supersymmetry Constraints and String Theory on K3

Energy Technology Data Exchange (ETDEWEB)

Lin, Ying-Hsuan; Shao, Shu-Heng [Jefferson Physical Laboratory, Harvard University,Cambridge, MA 02138 (United States); Wang, Yifan [Center for Theoretical Physics, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Yin, Xi [Jefferson Physical Laboratory, Harvard University,Cambridge, MA 02138 (United States)

2015-12-22

We study supervertices in six dimensional (2,0) supergravity theories, and derive supersymmetry non-renormalization conditions on the 4- and 6-derivative four-point couplings of tensor multiplets. As an application, we obtain exact non-perturbative results of such effective couplings in type IIB string theory compactified on K3 surface, extending previous work on type II/heterotic duality. The weak coupling limit thereof, in particular, gives certain integrated four-point functions of half-BPS operators in the nonlinear sigma model on K3 surface, that depend nontrivially on the moduli, and capture worldsheet instanton contributions.

6d string chains

Science.gov (United States)

Gadde, Abhijit; Haghighat, Babak; Kim, Joonho; Kim, Seok; Lockhart, Guglielmo; Vafa, Cumrun

2018-02-01

We consider bound states of strings which arise in 6d (1,0) SCFTs that are realized in F-theory in terms of linear chains of spheres with negative self-intersections 1,2, and 4. These include the strings associated to N small E 8 instantons, as well as the ones associated to M5 branes probing A and D type singularities in M-theory or D5 branes probing ADE singularities in Type IIB string theory. We find that these bound states of strings admit (0,4) supersymmetric quiver descriptions and show how one can compute their elliptic genera.

Toric Lego: A method for modular model building

CERN Document Server

Balasubramanian, Vijay; García-Etxebarria, Iñaki

2010-01-01

Within the context of local type IIB models arising from branes at toric Calabi-Yau singularities, we present a systematic way of joining any number of desired sectors into a consistent theory. The different sectors interact via massive messengers with masses controlled by tunable parameters. We apply this method to a toy model of the minimal supersymmetric standard model (MSSM) interacting via gauge mediation with a metastable supersymmetry breaking sector and an interacting dark matter sector. We discuss how a mirror procedure can be applied in the type IIA case, allowing us to join certain intersecting brane configurations through massive mediators.

Different effects of ERβ and TROP2 expression in Chinese patients with early-stage colon cancer.

Science.gov (United States)

Fang, Yu-Jing; Wang, Guo-Qiang; Lu, Zhen-Hai; Zhang, Lin; Li, Ji-Bin; Wu, Xiao-Jun; Ding, Pei-Rong; Ou, Qing-Jian; Zhang, Mei-Fang; Jiang, Wu; Pan, Zhi-Zhong; Wan, De-Sen

2012-12-01

Estrogen receptor beta (ERβ) and TROP2 expressed in colon carcinoma and might play an important role there. We explored the relationship of ERβ and TROP2 expression with the prognosis of early-stage colon cancer. ERβ and TROP2 levels were assessed by immunohistochemistry in normal mucosa and tumoral tissues from 220 Chinese patients with T(3)N(0)M(0) (stage IIa) and T(4)N(0)M(0) (stage IIb) colon cancer in the Cancer Center, Sun Yat-sen University, who underwent curative surgical resection between 1995 and 2003. The Cox proportional hazards regression model was applied to analyze the overall survival (OS) data, and the ROC curve, Kaplan-Meier estimate, log rank test, and Jackknife method were used to show the effect of ERβ and TROP2 expression at different stages of cancer. The 5-year survival rates were not significantly different between the patients with stage IIa and stage IIb colon cancer (83 vs. 80 %, respectively). The high expression of ERβ was related to decreasing OS in stage IIa and stage IIb colon cancer, while the high expression of TROP2 was related to decreasing OS in stage IIb colon cancer. The expression of ERβ and TROP2 has tumor-suppressive and tumor-promoting effect in stage IIa and stage IIb colon cancer, respectively.

Safety, immunogenicity and duration of protection of the RTS,S/AS02(D malaria vaccine: one year follow-up of a randomized controlled phase I/IIb trial.

Directory of Open Access Journals (Sweden)

Pedro Aide

2010-11-01

Full Text Available The RTS,S/AS02(D vaccine has been shown to have a promising safety profile, to be immunogenic and to confer protection against malaria in children and infants.We did a randomized, controlled, phase I/IIb trial of RTS,S/AS02(D given at 10, 14 and 18 weeks of age staggered with routine immunization vaccines in 214 Mozambican infants. The study was double-blind until the young child completed 6 months of follow-up over which period vaccine efficacy against new Plasmodium falciparum infections was estimated at 65.9% (95% CI 42.6-79.8, p<0.0001. We now report safety, immunogenicity and estimated efficacy against clinical malaria up to 14 months after study start. Vaccine efficacy was assessed using Cox regression models. The frequency of serious adverse events was 32.7% in the RTS,S/AS02(D and 31.8% in the control group. The geometric mean titers of anti-circumsporozoite antibodies declined from 199.9 to 7.3 EU/mL from one to 12 months post dose three of RTS,S/AS02(D, remaining 15-fold higher than in the control group. Vaccine efficacy against clinical malaria was 33% (95% CI: -4.3-56.9, p = 0.076 over 14 months of follow-up. The hazard rate of disease per 2-fold increase in anti-CS titters was reduced by 84% (95% CI 35.1-88.2, p = 0.003.The RTS,S/AS02(D malaria vaccine administered to young infants has a good safety profile and remains efficacious over 14 months. A strong association between anti-CS antibodies and risk of clinical malaria has been described for the first time. The results also suggest a decrease of both anti-CS antibodies and vaccine efficacy over time.ClinicalTrials.gov NCT00197028.

Effect of operator and institutional volume on clinical outcomes after percutaneous coronary interventions performed in Canada and the United States: a brief report from the Enhanced Suppression of the Platelet glycoprotein IIb/IIIa Receptor with Integrilin Therapy (ESPRIT) study.

Science.gov (United States)

Madan, Mina; Nikhil, Janarthan; Hellkamp, Anne S; Pieper, Karen S; Labinaz, Marino; Cohen, E A; Buller, Christopher E; Cantor, Warren J; Seidelin, Peter; Ducas, John; Carere, Ronald G; Natarajan, Madhu K; O'Shea, J Conor; Tcheng, James E

2009-08-01

The Enhanced Suppression of the Platelet glycoprotein IIb/IIIa Receptor with Integrilin Therapy (ESPRIT) trial compared the use of eptifibatide with placebo in 2064 coronary intervention patients. It was previously reported that Canadian patients had reduced rates of 30-day and one-year death, myocardial infarction (MI) or target vessel revascularization (TVR) compared with patients in the United States (US). To examine whether operator or institutional volume differences explain the regional variation in clinical outcome. Each site received an operator and institutional volume survey. Fifty-seven sites (62%) returned complete data on 1338 patients. In this smaller cohort, Canadian patients had reduced rates of 30-day and one-year death, MI or TVR compared with US patients (6.3% versus 10.3% and 14.9% versus 20.1%, respectively; PESPRIT study, institutional volume was associated with a modest reduction in risk of death, MI or TVR over short- and long-term follow-up periods. The Canadian and US investigators and institutions selected in ESPRIT had similar annual procedural volumes. Therefore, volume variables did not explain the differential risk of clinical events observed for patients enrolled in the two countries.

Introduction to superstring theory

International Nuclear Information System (INIS)

Nunez, Carmen

2009-01-01

This is a very basic introduction to the AdS/CFT correspondence. The first lecture motivates the duality between gauge theories and gravity/string theories. The next two lectures introduce the bosonic and supersymmetric string theories. The fourth lecture is devoted to study Dp-branes and finally, in the fifth lecture I discuss the two worlds: N=4 SYM in 3+1 flat dimensions and type IIB superstrings in AdS 5 x S5. (author)

Introduction to superstring theory

Energy Technology Data Exchange (ETDEWEB)

Nunez, Carmen [Instituto de Astronomia y Fisica del Espacio, Buenos Aires (Argentina)], e-mail: carmen@iafe.uba.ar

2009-07-01

This is a very basic introduction to the AdS/CFT correspondence. The first lecture motivates the duality between gauge theories and gravity/string theories. The next two lectures introduce the bosonic and supersymmetric string theories. The fourth lecture is devoted to study Dp-branes and finally, in the fifth lecture I discuss the two worlds: N=4 SYM in 3+1 flat dimensions and type IIB superstrings in AdS{sub 5} x S5. (author)

Regulation of pathogenicity in hop stunt viroid-related group II citrus viroids.

Science.gov (United States)

Reanwarakorn, K; Semancik, J S

1998-12-01

Nucleotide sequences were determined for two hop stunt viroid-related Group II citrus viroids characterized as either a cachexia disease non-pathogenic variant (CVd-IIa) or a pathogenic variant (CVd-IIb). Sequence identity between the two variants of 95.6% indicated a conserved genome with the principal region of nucleotide difference clustered in the variable (V) domain. Full-length viroid RT-PCR cDNA products were cloned into plasmid SP72. Viroid cDNA clones as well as derived RNA transcripts were transmissible to citron (Citrus medica L.) and Luffa aegyptiaca Mill. To determine the locus of cachexia pathogenicity as well as symptom expression in Luffa, chimeric viroid cDNA clones were constructed from segments of either the left terminal, pathogenic and conserved (T1-P-C) domains or the conserved, variable and right terminal (C-V-T2) domains of CVd-IIa or CVd-IIb in reciprocal exchanges. Symptoms induced by the various chimeric constructs on the two bioassay hosts reflected the differential response observed with CVd-IIa and -IIb. Constructs with the C-V-T2 domains region from clone-IIa induced severe symptoms on Luffa typical of CVd-IIa, but were non-symptomatic on mandarin as a bioassay host for the cachexia disease. Constructs with the same region (C-V-T2) from the clone-IIb genome induced only mild symptoms on Luffa, but produced a severe reaction on mandarin, as observed for CVd-IIb. Specific site-directed mutations were introduced into the V domain of the CVd-IIa clone to construct viroid cDNA clones with either partial or complete conversions to the CVd-IIb sequence. With the introduction of six site-specific changes into the V domain of the clone-IIa genome, cachexia pathogenicity was acquired as well as a moderation of severe symptoms on Luffa.

Untitled

Indian Academy of Sciences (India)

the K.m becomes > 0, thus enabling the crack to extend in the subsequent loading cycle. 3.2b FCG mechanism during stage IIb. At the transition point from stage IIa to. IIb, the monotonic plastic zone size (MPZ) increases sharply. This results in microplastic instability produced by change in the degree of plastic constraint, ...

76 FR 34145 - Safety Zone, Barrier Testing Operations, Chicago Sanitary and Ship Canal, Romeoville, IL

Science.gov (United States)

2011-06-13

...-AA00 Safety Zone, Barrier Testing Operations, Chicago Sanitary and Ship Canal, Romeoville, IL AGENCY.... Construction on Barrier IIB has been completed. Operational and safety testing was conducted in February 2011... dispersal barrier IIA and IIB. This safety zone will be enforced daily from 7 a.m. to 11 a.m. and from 1 p.m...

Analysis of transcriptional isoforms of collagen types IX, II, and I in the developing avian cornea by competitive polymerase chain reaction.

Science.gov (United States)

Fitch, J M; Gordon, M K; Gibney, E P; Linsenmayer, T F

1995-01-01

The genes for the alpha 1(IX), alpha 1(II), and alpha 2(I) collagen chains can give rise to different isoforms of mRNA, generated by alternative promotor usage [for alpha 1(IX) and alpha 2(I)] or alternative splicing [for alpha 1(II)]. In this study, we employed competitive reverse transcriptase PCR to quantitate the amounts of transcriptional isoforms for these genes in the embryonic avian cornea from its inception (about 3 1/2 days of development) to 11 days. In order to compare values at different time points, the results were normalized to those obtained for the "housekeeping" enzyme, glycerol-3-phosphate dehydrogenase (G3PDH). These values were compared to those obtained from other tissues (anterior optic cup and cartilage) that synthesize different combinations of the collagen isoforms. We found that, in the cornea, transcripts from the upstream promotor of alpha 1(IX) collagen (termed "long IX") were predominant at stage 18-20 (about 3 1/2 days), but then fell rapidly, and remained at a low level. By 5 days (just before stromal swelling) the major mRNA isoform of alpha 1(IX) was from the downstream promoter (termed "short IX"). The relative amount of transcript for the short form of type IX collagen rose to a peak at about 6 days of development, and then declined. Throughout this period, the predominant transcriptional isoform of the collagen type II gene was IIA (i.e., containing the alternatively spliced exon 2). This indicates that the molecules of type II collagen that are assembled into heterotypic fibrils with type I collagen possess, at least transiently, an amino-terminal globular domain similar to that found in collagen types I, III, and V. For type I, the "bone/tendon" mRNA isoform of the alpha 2(I) collagen gene was predominant; transcripts from the downstream promotor were at basal levels. In other tissues expressing collagen types IX and II, long IX was expressed predominantly with the IIA form in the anterior optic cup at stage 22/23; in 14 1

Analysis of AVS-penogram in 3000 impotent patients

Energy Technology Data Exchange (ETDEWEB)

Minn, Young Guy; Choi, Hyung Ki [Yonsei University College of Medicine, Seoul (Korea, Republic of)

1994-09-01

Audio visual simulation penogram(AVS-penogram) is used as a screening method for evaluation of erectile dysfunction. In this study, 3000 patients were evaluated from Dec. 1986 to Dec. 1992 and finally diagnosed by comprehensive diagnostic methods. The patients were classified according to AVS-penogram curves into 4 types and correlated with the patient`s final diagnosis. For 800 patients who were evaluated with combined AVS-penogram and NPT monitoring, compatibility ratios between psychogenic and organic group were compared. After correlating each of the curve type with the patients and comparing erotic and nocturnal erection, following results were obtained. 1. The mean age of the patients was 41.25 years. 2. The overall rate of final diagnosis were 57.5%, 14.3%, 8.9% in psychogenic, arteriogenic and veogenic impotence. 3. Type I group was proved as psychogenic impotence in 87% of the patients. 4. Type IIA group was proved as organic impotence in 79% of the patients and most of them had neurogenic and arteriogenic impotence. 5. Type IIB group was proved as psychogenic impotence in 51%, organic impotence in 49% of the patients. Among the organic impotence group, most of them had arteriogenic, venogenic and neurogenic impotence. The difference of both group was statically insignificant. 6. Type IIC group was proved as psychogenic impotence in 39%, organic impotence in 61% of the patients. Further studies are needed for sub-classification of both groups. 7. The compatibility ratio of the AVS-penogram and NPTM was 85.9% in psychogenic group with normal finding in both tests and 44.7% in organic group with abnormal finding in both tests. In conclusion, AVS-penogram is a primary diagnostic method in screening impotent patients and type I is regarded as psychogenic impotence. In Type IIB and IIC, sub-classification of curve type is needed for differential diagnosis between psychogenic and organic impotence. (Abstract Truncated)

Supersymmetric 3-branes on smooth ALE manifolds with flux

International Nuclear Information System (INIS)

Bertolini, M.; Campos, V.L.; Ferretti, G.; Fre, P.; Salomonson, P.; Trigiante, M.

2001-01-01

We construct a new family of classical BPS solutions of type IIB supergravity describing 3-branes transverse to a 6-dimensional space with topology R 2 xALE. They are characterized by a non-trivial flux of the supergravity 2-forms through the homology 2-cycles of a generic smooth ALE manifold. Our solutions have two Killing spinors and thus preserve N=2 supersymmetry. They are expressed in terms of a quasi harmonic function H (the 'warp factor'), whose properties we study in the case of the simplest ALE, namely the Eguchi-Hanson manifold. The equation for H is identified as an instance of the confluent Heun equation. We write explicit power series solutions and solve the recurrence relation for the coefficients, discussing also the relevant asymptotic expansions. While, as in all such N=2 solutions, supergravity breaks down near the brane, the smoothing out of the vacuum geometry has the effect that the warp factor is regular in a region near the cycle. We interpret the behavior of the warp factor as describing a three-brane charge 'smeared' over the cycle and consider the asymptotic form of the geometry in that region, showing that conformal invariance is broken even when the complex type IIB 3-form field strength is assumed to vanish. We conclude with a discussion of the basic features of the gauge theory dual

Vaccine Therapy With or Without Sirolimus in Treating Patients With NY-ESO-1 Expressing Solid Tumors

Science.gov (United States)

2016-10-03

Anaplastic Astrocytoma; Anaplastic Oligoastrocytoma; Anaplastic Oligodendroglioma; Estrogen Receptor Negative; Estrogen Receptor Positive; Glioblastoma; Hormone-Resistant Prostate Cancer; Metastatic Prostate Carcinoma; Metastatic Renal Cell Cancer; Recurrent Adult Brain Neoplasm; Recurrent Bladder Carcinoma; Recurrent Breast Carcinoma; Recurrent Colorectal Carcinoma; Recurrent Esophageal Carcinoma; Recurrent Gastric Carcinoma; Recurrent Hepatocellular Carcinoma; Recurrent Lung Carcinoma; Recurrent Melanoma; Recurrent Ovarian Carcinoma; Recurrent Prostate Carcinoma; Recurrent Renal Cell Carcinoma; Recurrent Uterine Corpus Carcinoma; Resectable Hepatocellular Carcinoma; Sarcoma; Stage IA Breast Cancer; Stage IA Ovarian Cancer; Stage IA Uterine Corpus Cancer; Stage IB Breast Cancer; Stage IB Ovarian Cancer; Stage IB Uterine Corpus Cancer; Stage IC Ovarian Cancer; Stage II Uterine Corpus Cancer; Stage IIA Breast Cancer; Stage IIA Lung Carcinoma; Stage IIA Ovarian Cancer; Stage IIB Breast Cancer; Stage IIB Esophageal Cancer; Stage IIB Lung Carcinoma; Stage IIB Ovarian Cancer; Stage IIB Skin Melanoma; Stage IIC Ovarian Cancer; Stage IIC Skin Melanoma; Stage IIIA Breast Cancer; Stage IIIA Esophageal Cancer; Stage IIIA Lung Carcinoma; Stage IIIA Ovarian Cancer; Stage IIIA Skin Melanoma; Stage IIIA Uterine Corpus Cancer; Stage IIIB Breast Cancer; Stage IIIB Esophageal Cancer; Stage IIIB Ovarian Cancer; Stage IIIB Skin Melanoma; Stage IIIB Uterine Corpus Cancer; Stage IIIC Breast Cancer; Stage IIIC Esophageal Cancer; Stage IIIC Ovarian Cancer; Stage IIIC Skin Melanoma; Stage IIIC Uterine Corpus Cancer; Stage IV Bladder Urothelial Carcinoma; Stage IV Esophageal Cancer; Stage IV Ovarian Cancer; Stage IV Prostate Cancer; Stage IV Skin Melanoma; Stage IVA Uterine Corpus Cancer; Stage IVB Uterine Corpus Cancer

Theoretical models for supernovae

International Nuclear Information System (INIS)

Woosley, S.E.; Weaver, T.A.

1981-01-01

The results of recent numerical simulations of supernova explosions are presented and a variety of topics discussed. Particular emphasis is given to (i) the nucleosynthesis expected from intermediate mass (10sub solar less than or equal to M less than or equal to 100 Msub solar) Type II supernovae and detonating white dwarf models for Type I supernovae, (ii) a realistic estimate of the γ-line fluxes expected from this nucleosynthesis, (iii) the continued evolution, in one and two dimensions, of intermediate mass stars wherein iron core collapse does not lead to a strong, mass-ejecting shock wave, and (iv) the evolution and explosion of vary massive stars M greater than or equal to 100 Msub solar of both Population I and III. In one dimension, nuclear burning following a failed core bounce does not appear likely to lead to a supernova explosion although, in two dimensions, a combination of rotation and nuclear burning may do so. Near solar proportions of elements from neon to calcium and very brilliant optical displays may be created by hypernovae, the explosions of stars in the mass range 100 M/sub solar/ to 300 M/sub solar/. Above approx. 300 M/sub solar/ a black hole is created by stellar collapse following carbon ignition. Still more massive stars may be copious producers of 4 He and 14 N prior to their collapse on the pair instability

SARCOPENIA: DESIGNING PHASE IIB TRIALS

Science.gov (United States)

CHUMLEA, WM.C.; CESARI, M.; EVANS, W.J.; FERRUCCI, L.; FIELDING, R.A.; PAHOR, M.; STUDENSKI, S.; VELLAS, B.

2012-01-01

Sarcopenia is the age-related involuntary loss of skeletal muscle mass and functionality that can lead to the development of disability, frailty and increased health care costs. The development of interventions aimed at preventing and/or treating sarcopenia is complex, requiring the adoption of assumptions and standards that are not well established scientifically or clinically. A number of investigators and clinicians (both from academia and industry) met in Rome (Italy) in 2009 to develop a consensus definition of sarcopenia. Subsequently, in Albuquerque (New Mexico, USA) in 2010, the same group met again to consider the complex issues necessary for designing Phase II clinical trials for sarcopenia. Current clinical trial data indicate that fat-free mass (FFM) parameters are responsive to physical activity/nutritional treatment modalities over short time periods, but pharmacological trials of sarcopenia have yet to show significant efficacy. In order to conduct a clinical trial within a reasonable time frame, groups that model or display accelerated aging and loss of FFM are necessary. Few studies have used acceptable designs for testing treatment effects, sample sizes or primary outcomes that could provide interpretable findings or effects across studies. Dual energy x ray absorptiometry (DXA) is the measure of choice for assessing FFM, but sufficient time is needed for changes to be detected accurately and reliably. A tool set that would allow clinical, basic and epidemiological research on sarcopenia to advance rapidly toward diagnosis and treatment phases should be those reflecting function and strength. PMID:21623466

Alterations in Muscle Mass and Contractile Phenotype in Response to Unloading Models: Role of Transcriptional/Pretranslational Mechanisms

Directory of Open Access Journals (Sweden)

Kenneth M Baldwin

2013-10-01

Full Text Available Skeletal muscle is the largest organ system in mammalian organisms providing postural control and movement patterns of varying intensity. Through evolution, skeletal muscle fibers have evolved into three phenotype clusters defined as a muscle unit which consists of all muscle fibers innervated by a single motoneuron linking varying numbers of fibers of similar phenotype. This fundamental organization of the motor unit reflects the fact that there is a remarkable interdependence of gene regulation between the motoneurons and the muscle mainly via activity-dependent mechanisms. These fiber types can be classified via the primary type of myosin heavy chain (MHC gene expressed in the motor unit. Four MHC gene encoded proteins have been identified in striated muscle: slow type I MHC and three fast MHC types, IIa, IIx, and IIb. These MHCs dictate the intrinsic contraction speed of the myofiber with the type I generating the slowest and IIb the fastest contractile speed. Over the last ~35 years, a large body of knowledge suggests that altered loading state cause both fiber atrophy/wasting and a slow to fast shift in the contractile phenotype in the target muscle(s. Hence, this review will examine findings from three different animal models of unloading: 1 space flight (SF, i.e., microgravity; 2 hindlimb suspension (HS, a procedure that chronically eliminates weight bearing of the lower limbs; and 3 spinal cord isolation (SI, a surgical procedure that eliminates neural activation of the motoneurons and associated muscles while maintaining neurotrophic motoneuron-muscle connectivity. The collective findings demonstrate: 1 all three models show a similar pattern of fiber atrophy with differences mainly in the magnitude and kinetics of alteration; 2 transcriptional/pretranslational processes play a major role in both the atrophy process and phenotype shifts; and 3 signaling pathways impacting these alterations appear to be similar in each of the models

Renal pathological implications in type 2 diabetes mellitus patients with renal involvement.

Science.gov (United States)

Li, Li; Zhang, Xiuhui; Li, Zhicheng; Zhang, Rui; Guo, Ruikun; Yin, Qinghua; Yang, Lichuan; Yue, Rongzheng; Su, Baihai; Huang, Songmin; Xu, Huan; He, Cijiang; Liu, Fang

2017-01-01

To investigate the renal pathological implications in type 2 diabetes mellitus patients with renal involvement. A total of 328 type 2 diabetes mellitus (T2DM) patients with renal involvement who underwent a renal biopsy and received follow-up for at least one year were recruited in our study. The patients were divided into the diabetic nephropathy (DN), non-diabetic renal disease (NDRD), and NDRD superimposed on DN groups based on the pathological diagnosis. Renal outcomes were defined by the initiation of renal replacement therapy or doubling of the serum creatinine. Kaplan-Meier analysis was used to compare renal survival, and Cox proportional hazard analysis was used to determine the predictors of renal outcomes in the DN group. Renal biopsy findings revealed that 188 patients (57.32%) had pure DN, 121 patients (36.89%) had NDRD alone, and 19 patients (5.79%) had NDRD superimposed on DN. The most frequent subclassification of NDRD was membranous nephropathy (MN). Compared with the NDRD and NDRD superimposed on DN groups, patients with pure DN had poorer renal function and lower renal survival rates. In the DN group, the five-year renal survival rates of glomerular classes of I, IIa, IIb, III and IV were 100%, 84.62%, 60%, 47.5% and 33.33%, respectively. Multivariate Cox proportional hazard analysis showed that the glomerular lesions, proteinuria and serum creatinine were independent risk factors for renal outcomes, while interstitial fibrosis/inflammation and arteriolar hyalinosis were not independently associated with renal outcomes in the DN group. Making an accurate pathologic diagnosis by renal biopsy is crucial for diabetes mellitus (DM) patients with renal involvement. The findings of our present study indicated that patients with pure DN had poorer renal outcomes than patients with NDRD or NDRD superimposed on DN. The classification of glomerular lesions, proteinuria and serum creatinine were independent risk factors for renal outcomes in the DN group

Bivalirudin Started during Emergency Transport for Primary PCI

DEFF Research Database (Denmark)

Steg, Philippe Gabriel; van 't Hof, Arnoud; Hamm, Christian W

2013-01-01

Bivalirudin, as compared with heparin and glycoprotein IIb/IIIa inhibitors, has been shown to reduce rates of bleeding and death in patients undergoing primary percutaneous coronary intervention (PCI). Whether these benefits persist in contemporary practice characterized by prehospital initiation...... of treatment, optional use of glycoprotein IIb/IIIa inhibitors and novel P2Y12 inhibitors, and radial-artery PCI access use is unknown....

D1/D5 systems in N=4 string theories

International Nuclear Information System (INIS)

Gava, Edi; Hammou, Amine B.; Morales, Jose F.; Narain, Kumar S.

2001-01-01

We propose CFT descriptions of the D1/D5 system in a class of freely acting Z 2 orbifolds/orientifolds of type IIB theory, with sixteen unbroken supercharges. The CFTs describing D1/D5 systems involve N=(4,4) or N=(4,0) sigma models on (R 3 xS 1 xT 4 x(T 4 ) N /S N )/Z 2 , where the action of Z 2 is diagonal and its precise nature depends on the model. We also discuss D1(D5)-brane states carrying non-trivial Kaluza-Klein charges, which correspond to excitations of two-dimensional CFTs of the type (R 3 xS 1 xT 4 ) N /S N xZ 2 N . The resulting multiplicities for two-charge bound states are shown to agree with the predictions of U-duality. We raise a puzzle concerning the multiplicities of three-charge systems, which is generically present in all vacuum configurations with sixteen unbroken supercharges studied so far, including the more familiar type IIB on K3 case: the constraints put on BPS counting formulae by U-duality are apparently in contradiction with any CFT interpretation. We argue that the presence of RR backgrounds appearing in the symmetric product CFT may provide a resolution of this puzzle. Finally, we show that the whole tower of D-instanton corrections to certain 'BPS saturated couplings' in the low energy effective actions match with the corresponding one-loop threshold corrections on the dual fundamental string side

Pathological problems of cancer of the uterine cervix

International Nuclear Information System (INIS)

Ohmi, Kazuo

1981-01-01

Cancers of the uterine cervix were classified for prediction of radiosensitivity. They were classified into two types: radioresistant type (R-type), in which the cancer was predominated by the properties of adenocarcinoma and was radioresistant, and radiosensitive type (S-type) in all others. In preoperatively irradiated cases of stage IIb cancer of uterine cervix, 84% of R-type cases showed viable cancer cells, and 84% of S-type cases showed tumor disappearance. In cases of radiotherapy in a period 1965 - 70, 69% of stage II cases and 70% of stage III cases of R-type showed disease progress; for S-type, 88% of stage II and 77% of stage III cases had tumor control. In stage III cases given radiotherapy alone in 1971 and 1972 after the histological features were examined, 82% of R-type cases showed tumor recurrence and 77% of S-type cases had disease control. Problems in the classification and assessment were discussed. (Chiba, N.)

The effect of radiation dose on mouse skeletal muscle remodeling

International Nuclear Information System (INIS)

Hardee, Justin P.; Puppa, Melissa J.; Fix, Dennis K.; Gao, Song; Hetzler, Kimbell L.; Bateman, Ted A.; Carson, James A.

2014-01-01

The purpose of this study was to determine the effect of two clinically relevant radiation doses on the susceptibility of mouse skeletal muscle to remodeling. Alterations in muscle morphology and regulatory signaling were examined in tibialis anterior and gastrocnemius muscles after radiation doses that differed in total biological effective dose (BED). Female C57BL/6 (8-wk) mice were randomly assigned to non-irradiated control, four fractionated doses of 4 Gy (4x4 Gy; BED 37 Gy), or a single 16 Gy dose (16 Gy; BED 100 Gy). Mice were sacrificed 2 weeks after the initial radiation exposure. The 16 Gy, but not 4x4 Gy, decreased total muscle protein and RNA content. Related to muscle regeneration, both 16 Gy and 4x4 Gy increased the incidence of central nuclei containing myofibers, but only 16 Gy increased the extracellular matrix volume. However, only 4x4 Gy increased muscle 4-hydroxynonenal expression. While both 16 Gy and 4x4 Gy decreased IIB myofiber mean cross-sectional area (CSA), only 16 Gy decreased IIA myofiber CSA. 16 Gy increased the incidence of small diameter IIA and IIB myofibers, while 4x4 Gy only increased the incidence of small diameter IIB myofibers. Both treatments decreased the frequency and CSA of low succinate dehydrogenase activity (SDH) fibers. Only 16 Gy increased the incidence of small diameter myofibers having high SDH activity. Neither treatment altered muscle signaling related to protein turnover or oxidative metabolism. Collectively, these results demonstrate that radiation dose differentially affects muscle remodeling, and these effects appear to be related to fiber type and oxidative metabolism

Posterior tibial tendon insufficiency results at different stages.

Science.gov (United States)

Deland, Jonathan T; Page, Alexandra; Sung, Il-Hoon; O'Malley, Martin J; Inda, David; Choung, Steven

2006-09-01

The results of surgical treatment of posterior tibial tendon insufficiency (PTTI) may be different at different stages of the disease. No single study has compared the results at different stages. This comparison can be helpful to the patient and physician if the patient asks "What if I wait and the disease progresses, how will my results be different?" A preliminary study comparing results for stage IIa, stage IIb (advanced stage II), and stage III was performed followed by a larger study comparing IIa and IIb with 26 and 22 patients, respectively. American Orthopaedic Foot and Ankle Society (AOFAS) outcome scores as well as radiographs and functional questions were used. Nearly all patients, regardless of stage, felt they were helped by surgical treatment. However, the lowest AOFAS score was in stage III, the most advanced stage investigated in this study. In comparing stage IIa and IIb patients, stage IIb patients had a statistically higher incidence of lateral discomfort. Although statistically significant differences were not found in all comparisons, this study suggests that the results of surgical treatment for PTTI declines with increasing stage or severity of disease.

Calcium-binding proteins from human platelets

International Nuclear Information System (INIS)

Gogstad, G.O.; Krutnes, M.B.; Solum, N.O.

1983-01-01

Calcium-binding platelet proteins were examined by crossed immunoelectrophoresis of solubilized platelets against antibodies to whole platelets followed by incubation of the immunoplates with 45 Ca 2 + and autoradiography. When the immunoplates had been pretreated with EDTA at pH 9.0 in order to remove divalent cations, three immunoprecipitates were markedly labelled with 45 Ca 2 + . These corresponded to the glycoprotein IIb-IIIa complex, glycoprotein Ia and a presently unidentified antigen termed G18. These antigens were membrane-bound and surface-oriented. When an excess of EDTA was introduced in the incubation media the results revealed that the glycoprotein IIb-IIIa complex and antigen G18, but not glycoprotein Ia, contained sites with a stronger affinity for calcium than has EDTA at pH 7.4 Immunoprecipitates of the separate glycoproteins IIb and IIIa both bound calcium in the same manner as the glycoprotein IIb-IIIa complex. As another approach, platelet-rich plasma was incubated with 45 Ca 2 + prior to crossed immunoelectrophoresis of the solubilized platelets. A single immunoprecipitate was wekly labelled. This did not correspond to any of the immunoprecipitates which were visible after staining with Coomassie blue. The labelling of this antigen was markedly increased when the platelt-rich plasma had been preincubated with EDTA and in this case a weak labelling of the glycoprotein IIB-IIIa precipitate also became apparent. No increased incorporation of calcium occured in any of these immunoprecipitates when the platelets were aggregated with ADP in the presence of 45 Ca 2 + . (orig.)

The structure of pyogenecin immunity protein, a novel bacteriocin-like immunity protein from streptococcus pyogenes.

Energy Technology Data Exchange (ETDEWEB)

Chang, C.; Coggill, P.; Bateman, A.; Finn, R.; Cymborowski, M.; Otwinowski, Z.; Minor, W.; Volkart, L.; Joachimiak, A.; Wellcome Trust Sanger Inst.; Univ. of Virginia; UT Southwestern Medical Center

2009-12-17

Many Gram-positive lactic acid bacteria (LAB) produce anti-bacterial peptides and small proteins called bacteriocins, which enable them to compete against other bacteria in the environment. These peptides fall structurally into three different classes, I, II, III, with class IIa being pediocin-like single entities and class IIb being two-peptide bacteriocins. Self-protective cognate immunity proteins are usually co-transcribed with these toxins. Several examples of cognates for IIa have already been solved structurally. Streptococcus pyogenes, closely related to LAB, is one of the most common human pathogens, so knowledge of how it competes against other LAB species is likely to prove invaluable. We have solved the crystal structure of the gene-product of locus Spy-2152 from S. pyogenes, (PDB: 2fu2), and found it to comprise an anti-parallel four-helix bundle that is structurally similar to other bacteriocin immunity proteins. Sequence analyses indicate this protein to be a possible immunity protein protective against class IIa or IIb bacteriocins. However, given that S. pyogenes appears to lack any IIa pediocin-like proteins but does possess class IIb bacteriocins, we suggest this protein confers immunity to IIb-like peptides. Combined structural, genomic and proteomic analyses have allowed the identification and in silico characterization of a new putative immunity protein from S. pyogenes, possibly the first structure of an immunity protein protective against potential class IIb two-peptide bacteriocins. We have named the two pairs of putative bacteriocins found in S. pyogenes pyogenecin 1, 2, 3 and 4.

Restoration of pharyngeal dilator muscle force in dystrophin-deficient (mdx) mice following co-treatment with neutralizing interleukin-6 receptor antibodies and urocortin 2.

Science.gov (United States)

Burns, David P; Rowland, Jane; Canavan, Leonie; Murphy, Kevin H; Brannock, Molly; O'Malley, Dervla; O'Halloran, Ken D; Edge, Deirdre

2017-09-01

What is the central question of this study? We previously reported impaired upper airway dilator muscle function in the mdx mouse model of Duchenne muscular dystrophy (DMD). Our aim was to assess the effect of blocking interleukin-6 receptor signalling and stimulating corticotrophin-releasing factor receptor 2 signalling on mdx sternohyoid muscle structure and function. What is the main finding and its importance? The interventional treatment had a positive inotropic effect on sternohyoid muscle force, restoring mechanical work and power to wild-type values, reduced myofibre central nucleation and preserved the myosin heavy chain type IIb fibre complement of mdx sternohyoid muscle. These data might have implications for development of pharmacotherapies for DMD with relevance to respiratory muscle performance. The mdx mouse model of Duchenne muscular dystrophy shows evidence of impaired pharyngeal dilator muscle function. We hypothesized that inflammatory and stress-related factors are implicated in airway dilator muscle dysfunction. Six-week-old mdx (n = 26) and wild-type (WT; n = 26) mice received either saline (0.9% w/v) or a co-administration of neutralizing interleukin-6 receptor antibodies (0.2 mg kg -1 ) and corticotrophin-releasing factor receptor 2 agonist (urocortin 2; 30 μg kg -1 ) over 2 weeks. Sternohyoid muscle isometric and isotonic contractile function was examined ex vivo. Muscle fibre centronucleation and muscle cellular infiltration, collagen content, fibre-type distribution and fibre cross-sectional area were determined by histology and immunofluorescence. Muscle chemokine content was examined by use of a multiplex assay. Sternohyoid peak specific force at 100 Hz was significantly reduced in mdx compared with WT. Drug treatment completely restored force in mdx sternohyoid to WT levels. The percentage of centrally nucleated muscle fibres was significantly increased in mdx, and this was partly ameliorated after drug treatment. The areal

{sup 18}F-FDG-PET/CT for systemic staging of patients with newly diagnosed ER-positive and HER2-positive breast cancer

Energy Technology Data Exchange (ETDEWEB)

Ulaner, Gary A.; Castillo, Raychel [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); Wills, Jonathan [Memorial Sloan Kettering Cancer Center, Department of Information Systems, New York, NY (United States); Goenen, Mithat; Goldman, Debra A. [Memorial Sloan Kettering Cancer Center, Department of Epidemiology and Biostatistics, New York, NY (United States)

2017-08-15

This study assesses {sup 18}F-FDG-PET/CT for patients with newly diagnosed estrogen receptor-positive/human epidermal growth factor receptor-negative (ER+/HER2-) and human epidermal growth factor receptor-positive (HER2+) breast cancer. In this Institutional Review Board-approved retrospective study, our Healthcare Information System was screened for patients with ER+/HER2- and HER2+ breast cancer who underwent {sup 18}F-FDG-PET/CT prior to systemic or radiation therapy. The initial stage was determined from mammography, ultrasound, magnetic resonance imaging, and/or surgery.{sup 18}F-FDG-PET/CT was evaluated to identify unsuspected extra-axillary regional nodal and distant metastases. The proportion of patients upstaged overall and stratified by stage and receptor phenotypes was calculated along with confidence intervals (CI). A total of 238 patients with ER+/HER2- and 245 patients with HER2+ who met inclusion criteria were evaluated. For patients with ER+/HER2-breast cancer, {sup 18}F-FDG-PET/CT revealed unsuspected distant metastases in 3/71 (4%) initial stage IIA, 13/95 (14%) stage IIB, and 15/57 (26%) stage III. For patients with HER2+ breast cancer, {sup 18}F-FDG-PET/CT revealed unsuspected distant metastases in 3/72 (4%) initial stage IIA, 13/93 (14%) stage IIB, and 13/59 (22%) stage III. The overall upstaging rate for IIB was 14% (95% confidence interval (CI): 9-20%). {sup 18}F-FDG-PET/CT revealed distant metastases in 14% (95% CI: 9-20%) of patients with stage IIB ER+/HER2- and HER2+ breast cancer, which is similar to upstaging rates previously seen in patients with stage IIB triple-negative breast cancer (15%, 95% CI: 9-24%). The detection of unsuspected distant metastases in these patients alters treatment and prognosis. NCCN guidelines should consider adding patients with stage IIB breast cancer for consideration of systemic staging with {sup 18}F-FDG-PET/CT at the time of initial diagnosis. (orig.)

Patterns of evolution of MHC class II genes of crows (Corvus suggest trans-species polymorphism

Directory of Open Access Journals (Sweden)

John A. Eimes

2015-03-01

Full Text Available A distinguishing characteristic of genes that code for the major histocompatibility complex (MHC is that alleles often share more similarity between, rather than within species. There are two likely mechanisms that can explain this pattern: convergent evolution and trans-species polymorphism (TSP, in which ancient allelic lineages are maintained by balancing selection and retained by descendant species. Distinguishing between these two mechanisms has major implications in how we view adaptation of immune genes. In this study we analyzed exon 2 of the MHC class IIB in three passerine bird species in the genus Corvus: jungle crows (Corvus macrorhynchos japonensis American crows (C. brachyrhynchos and carrion crows (C. corone orientalis. Carrion crows and American crows are recently diverged, but allopatric, sister species, whereas carrion crows and jungle crows are more distantly related but sympatric species, and possibly share pathogens linked to MHC IIB polymorphisms. These patterns of evolutionary divergence and current geographic ranges enabled us to test for trans-species polymorphism and convergent evolution of the MHC IIB in crows. Phylogenetic reconstructions of MHC IIB sequences revealed several well supported interspecific clusters containing all three species, and there was no biased clustering of variants among the sympatric carrion crows and jungle crows. The topologies of phylogenetic trees constructed from putatively selected sites were remarkably different than those constructed from putatively neutral sites. In addition, trees constructed using non-synonymous substitutions from a continuous fragment of exon 2 had more, and generally more inclusive, supported interspecific MHC IIB variant clusters than those constructed from the same fragment using synonymous substitutions. These phylogenetic patterns suggest that recombination, especially gene conversion, has partially erased the signal of allelic ancestry in these species. While

Non-Muscle Myosin II Isoforms Have Different Functions in Matrix Rearrangement by MDA-MB-231 Cells.

Directory of Open Access Journals (Sweden)

Bridget Hindman

Full Text Available The role of a stiffening extra-cellular matrix (ECM in cancer progression is documented but poorly understood. Here we use a conditioning protocol to test the role of nonmuscle myosin II isoforms in cell mediated ECM arrangement using collagen constructs seeded with breast cancer cells expressing shRNA targeted to either the IIA or IIB heavy chain isoform. While there are several methods available to measure changes in the biophysical characteristics of the ECM, we wanted to use a method which allows for the measurement of global stiffness changes as well as a dynamic response from the sample over time. The conditioning protocol used allows the direct measurement of ECM stiffness. Using various treatments, it is possible to determine the contribution of various construct and cellular components to the overall construct stiffness. Using this assay, we show that both the IIA and IIB isoforms are necessary for efficient matrix remodeling by MDA-MB-231 breast cancer cells, as loss of either isoform changes the stiffness of the collagen constructs as measured using our conditioning protocol. Constructs containing only collagen had an elastic modulus of 0.40 Pascals (Pa, parental MDA-MB-231 constructs had an elastic modulus of 9.22 Pa, while IIA and IIB KD constructs had moduli of 3.42 and 7.20 Pa, respectively. We also calculated the cell and matrix contributions to the overall sample elastic modulus. Loss of either myosin isoform resulted in decreased cell stiffness, as well as a decrease in the stiffness of the cell-altered collagen matrices. While the total construct modulus for the IIB KD cells was lower than that of the parental cells, the IIB KD cell-altered matrices actually had a higher elastic modulus than the parental cell-altered matrices (4.73 versus 4.38 Pa. These results indicate that the IIA and IIB heavy chains play distinct and non-redundant roles in matrix remodeling.

Neoadjuvant letrozole in postmenopausal estrogen and/or progesterone receptor positive breast cancer: A phase IIb/III trial to investigate optimal duration of preoperative endocrine therapy

International Nuclear Information System (INIS)

Krainick-Strobel, Ute E; Lichtenegger, Werner; Wallwiener, Diethelm; Tulusan, Augustinus H; Jänicke, Fritz; Bastert, Gunther; Kiesel, Ludwig; Wackwitz, Birgit; Paepke, Stefan

2008-01-01

In recent years, preoperative volume reduction of locally advanced breast cancers, resulting in higher rates of breast-conserving surgery (BCS), has become increasingly important also in postmenopausal women. Clinical interest has come to center on the third-generation nonsteroidal aromatase inhibitors (AIs), including letrozole, for such neoadjuvant endocrine treatment. This usually lasts 3–4 months and has been extended to up to 12 months, but optimal treatment duration has not been fully established. This study was designed as a multicenter, open-label, single-arm, exploratory phase IIb/III clinical trial of letrozole 2.5 mg, one tablet daily, for 4–8 months. The primary objective was to investigate the effect of neoadjuvant treatment duration on tumor regression and BCS eligibility to identify optimal treatment duration. Tumor regression (by clinical examination, mammography, and ultrasound), shift towards BCS eligibility, and safety assessments were the main outcome measures. Standard parametric and nonparametric descriptive statistics were performed. Letrozole treatment was received by 32 of the enrolled 33 postmenopausal women (median (range): 67.0 (56–85) years) with unilateral, initially BCS-ineligible primary breast cancer (clinical stage ≥ T2, N0, M0). Letrozole treatment duration in the modified intent-to-treat (ITT; required 4 months' letrozole treatment) analysis population (29 patients) was 4 months in 14 patients and > 4 months in 15 patients. The respective per-protocol (PP) subgroup sizes were 14 and 11. The majority of partial or complete responses were observed at 4 months, though some beneficial responses occurred during prolonged letrozole treatment. Compared with baseline, median tumor size in the ITT population was reduced by 62.5% at Month 4 and by 70.0% at final study visit (Individual End). Similarly, in the PP population, respective reductions were 64.0% and 67.0%. Whereas initially all patients were mastectomy candidates

The ABCDEFG of Little Strings

OpenAIRE

Haouzi, Nathan; Kozçaz, Can

2017-01-01

Starting from type IIB string theory on an $ADE$ singularity, the (2,0) little string arises when one takes the string coupling $g_s$ to 0. In this setup, we give a unified description of the codimension-two defects of the little string, for any simple Lie algebra ${\\mathfrak{g}}$. Geometrically, these are D5 branes wrapping 2-cycles of the singularity. Equivalently, the defects are specified by a certain set of weights of $^L {\\mathfrak{g}}$, the Langlands dual of ${\\mathfrak{g}}$. As a firs...

Quantizing String Theory in AdS_5 X S^5: Beyond the pp-Wave

OpenAIRE

Callan, Jr., Curtis G.; Lee, Hok Kong; McLoughlin, Tristan; Schwarz, John H.; Swanson, Ian; Wu, Xinkai

2003-01-01

In a certain kinematic limit, where the effects of spacetime curvature (and other background fields) greatly simplify, the light-cone gauge world-sheet action for a type IIB superstring on AdS_5 x S^5 reduces to that of a free field theory. It has been conjectured by Berenstein, Maldacena, and Nastase that the energy spectrum of this string theory matches the dimensions of operators in the appropriately defined large R-charge large-N_c sector of N=4 supersymmetric Yang--Mills theory in four d...

A Technique of Distal Clavicle Fracture Fixation Using The Tightrope Procedure

Directory of Open Access Journals (Sweden)

CJ Soh

2011-11-01

Full Text Available We present here a technique of fracture stabilization using the Tightrope procedure in a patient with a widely displaced Neer type IIB distal clavicle fracture. The Tightrope system, typically used for stabilization of acromioclavicular joint dislocation, has not been widely described for distal clavicle fractures. The patient achieved satisfactory results after surgery; we feel that this technique is appealing as it is simple, reproducible and avoids the complications associated with extensive metalwork. This technique may also appeal to the arthroscopic surgeon.

Electronic Monitoring Device of Patient-Reported Outcomes and Function in Improving Patient-Centered Care in Patients With Gastrointestinal Cancer Undergoing Surgery

Science.gov (United States)

2018-03-05

Stage I Adult Liver Cancer; Stage I Colorectal Cancer; Stage IA Gastric Cancer; Stage IA Pancreatic Cancer; Stage IB Gastric Cancer; Stage IB Pancreatic Cancer; Stage II Adult Liver Cancer; Stage IIA Colorectal Cancer; Stage IIA Gastric Cancer; Stage IIA Pancreatic Cancer; Stage IIB Colorectal Cancer; Stage IIB Gastric Cancer; Stage IIB Pancreatic Cancer; Stage IIC Colorectal Cancer; Stage III Pancreatic Cancer; Stage IIIA Adult Liver Cancer; Stage IIIA Colorectal Cancer; Stage IIIA Gastric Cancer; Stage IIIB Adult Liver Cancer; Stage IIIB Colorectal Cancer; Stage IIIB Gastric Cancer; Stage IIIC Adult Liver Cancer; Stage IIIC Colorectal Cancer; Stage IIIC Gastric Cancer; Stage IV Gastric Cancer; Stage IVA Colorectal Cancer; Stage IVA Liver Cancer; Stage IVA Pancreatic Cancer; Stage IVB Colorectal Cancer; Stage IVB Liver Cancer; Stage IVB Pancreatic Cancer

PET-MRI in Diagnosing Patients With Colon or Rectal Cancer

Science.gov (United States)

2015-11-25

Recurrent Colon Cancer; Recurrent Rectal Cancer; Stage IIA Colon Cancer; Stage IIA Rectal Cancer; Stage IIB Colon Cancer; Stage IIB Rectal Cancer; Stage IIC Colon Cancer; Stage IIC Rectal Cancer; Stage IIIA Colon Cancer; Stage IIIA Rectal Cancer; Stage IIIB Colon Cancer; Stage IIIB Rectal Cancer; Stage IIIC Colon Cancer; Stage IIIC Rectal Cancer; Stage IVA Colon Cancer; Stage IVA Rectal Cancer; Stage IVB Colon Cancer; Stage IVB Rectal Cancer

Exactly marginal deformations from exceptional generalised geometry

Energy Technology Data Exchange (ETDEWEB)

Ashmore, Anthony [Merton College, University of Oxford,Merton Street, Oxford, OX1 4JD (United Kingdom); Mathematical Institute, University of Oxford,Andrew Wiles Building, Woodstock Road, Oxford, OX2 6GG (United Kingdom); Gabella, Maxime [Institute for Advanced Study,Einstein Drive, Princeton, NJ 08540 (United States); Graña, Mariana [Institut de Physique Théorique, CEA/Saclay,91191 Gif-sur-Yvette (France); Petrini, Michela [Sorbonne Université, UPMC Paris 05, UMR 7589, LPTHE,75005 Paris (France); Waldram, Daniel [Department of Physics, Imperial College London,Prince Consort Road, London, SW7 2AZ (United Kingdom)

2017-01-27

We apply exceptional generalised geometry to the study of exactly marginal deformations of N=1 SCFTs that are dual to generic AdS{sub 5} flux backgrounds in type IIB or eleven-dimensional supergravity. In the gauge theory, marginal deformations are parametrised by the space of chiral primary operators of conformal dimension three, while exactly marginal deformations correspond to quotienting this space by the complexified global symmetry group. We show how the supergravity analysis gives a geometric interpretation of the gauge theory results. The marginal deformations arise from deformations of generalised structures that solve moment maps for the generalised diffeomorphism group and have the correct charge under the generalised Reeb vector, generating the R-symmetry. If this is the only symmetry of the background, all marginal deformations are exactly marginal. If the background possesses extra isometries, there are obstructions that come from fixed points of the moment maps. The exactly marginal deformations are then given by a further quotient by these extra isometries. Our analysis holds for any N=2 AdS{sub 5} flux background. Focussing on the particular case of type IIB Sasaki-Einstein backgrounds we recover the result that marginal deformations correspond to perturbing the solution by three-form flux at first order. In various explicit examples, we show that our expression for the three-form flux matches those in the literature and the obstruction conditions match the one-loop beta functions of the dual SCFT.

Locking plate and fibular strut-graft augmentation in the reconstruction of unicameral bone cyst of proximal femur in the paediatric population.

Science.gov (United States)

Jamshidi, Khodamorad; Mirkazemi, Masoud; Izanloo, Azra; Mirzaei, Alireza

2018-01-01

Several therapeutic strategies have been used for managing unicameral bone cyst (UBC) of the proximal femur. However, there is insufficient evidence to support one treatment over another, and the optimal treatment is controversial. This study aims at describing our experience with surgical reconstruction of paediatric UBCs of the proximal femur using a proximal locking plate and fibular strut allograft. In total, 14 consecutive paediatric patients with Dormans types IB (four cases) and IIB (10 cases) UBC were assessed. Mean patient age was 8.6 ± 2.3 years, and mean follow-up period was 41.7 ± 29.8 months. Six patients (42.8%) were referred with a pathologic fracture. Clinical/radiological outcome and complication rates were evaluated at the final follow-up session. No cysts were Capanna's class III (recurrence) or IV (no response). Complete healing (Capanna's class I) was seen in ten cysts, while four other cysts healed with residual radiolucent areas (Capanna's class II). Mean healing period was 14.1 ± 5.1 (9-24 months). One patient had superficial infection, one heterotopic ossification, and one mild coxa vara, and mean Musculoskeletal Tumor Society (MSTS) score was 99.5%. According to our results, locking plate and fibular strut graft in Dormans classification types IB and IIB results in a favorable outcome in managing UBC of the proximal femur in the paediatric population.

Time course of myosin heavy chain transitions in neonatal rats: importance of innervation and thyroid state

Science.gov (United States)

Adams, G. R.; McCue, S. A.; Zeng, M.; Baldwin, K. M.

1999-01-01

During the postnatal period, rat limb muscles adapt to weight bearing via the replacement of embryonic (Emb) and neonatal (Neo) myosin heavy chains (MHCs) by the adult isoforms. Our aim was to characterize this transition in terms of the six MHC isoforms expressed in skeletal muscle and to determine the importance of innervation and thyroid hormone status on the attainment of the adult MHC phenotype. Neonatal rats were made hypothyroid via propylthiouracil (PTU) injection. In normal and PTU subgroups, leg muscles were unilaterally denervated at 15 days of age. The MHC profiles of plantaris (PLN) and soleus (Sol) muscles were determined at 7, 14, 23, and 30 days postpartum. At day 7, the Sol MHC profile was 55% type I, 30% Emb, and 10% Neo; in the PLN, the pattern was 60% Neo and 25% Emb. By day 30 the Sol and PLN had essentially attained an adult MHC profile in the controls. PTU augmented slow MHC expression in the Sol, whereas in the PLN it markedly repressed IIb MHC by retaining neonatal MHC expression. Denervation blunted the upregulation of IIb in the PLN and of Type I in the Sol and shifted the pattern to greater expression of IIa and IIx MHCs in both muscles. In contrast to previous observations, these findings collectively suggest that both an intact thyroid and innervation state are obligatory for the attainment of the adult MHC phenotype, particularly in fast-twitch muscles.

Can follow-up controls improve the confidence of MR of the breast? A retrospective analysis of follow-up MR images of the breast

International Nuclear Information System (INIS)

Betsch, A.; Arndt, E.; Stern, W.; Claussen, C.D.; Mueller-Schimpfle, M.; Wallwiener, D.

2001-01-01

Purpose: To assess the change in diagnostic confidence between first and follow-up dynamic MR examination of the breast (MRM). Methods: The reports of a total of 175 MRM in 77 patients (mean age 50 years; 36-76) with 98 follow-up MRM were analyzed. All examinations were performed as a dynamic study (Gd-DTPA, 0.16 mmol/kg; 6-7 repetitive studies). The change in diagnostic confidence was retrospectively classified as follows: Controlled lesion vanished during follow-up (category I); diagnostic confidence increases during follow-up (II), more likely benign (IIa), more suspicious (IIb); no difference in diagnostic confidence (III). Long-term follow-up over an average of four years was obtained for 57 patients with category IIa/III findings. Results: In 98 follow-up examinations, only two lesions vanished (2%). In 77/98 cases a category IIa lesion was diagnosed, in 11 cases a category IIb lesion. In 8 cases (8%) there was no change in diagnostic confidence during follow-up. Lesions in category IIb underwent biopsy in 10/11 cases, in one case long-term follow-up proved a completely regredient inflammatory change. In 8/11 suspicious findings (IIb) a malignant tumor was detected. The mean time interval between first and follow-up MRM was 8 months for I-IIb lesions, and 4 months for category III lesions. In the longterm follow-up two patients with a category II a lesion developed a carcinoma in a different breast area after four and five years. Conclusion: MRM follow up increases the diagnostic confidence if the time interval is adequate (>4 months). A persistently or increasingly suspicious finding warrants biopsy. (orig.) [de

A review of gamma ray bursts

CERN Document Server

Rees, Martin J

2000-01-01

Gamma-ray bursts, an enigma for more than 25 years, are now coming into focus. They involve extraordinary power outputs, and highly relativistic dynamics. The 'trigger' involves stellar-mass compact objects. The most plausible progenitors, ranging from neutron star binary mergers to collapsars (sometimes called 'hypernovae') eventually lead to the formation of a black hole with a torus of hot neutron-density material around it, the extractable energy being up to 10 sup 5 sup 4 ergs. Magnetic fields may exceed 10 sup 1 sup 5 G and particles may be accelerated up to > or approx. 10 sup 2 sup 0 eV. Details of the afterglow may be easier to understand than the initial trigger. Bursts at very high redshift can be astronomically-important as probes of the distant universe.

High-intensity interval and endurance training are associated with divergent skeletal muscle adaptations in a rodent model of hypertension.

Science.gov (United States)

Holloway, Tanya M; Bloemberg, Darin; da Silva, Mayne L; Quadrilatero, Joe; Spriet, Lawrence L

2015-06-01

Skeletal muscle is extremely adaptable to a variety of metabolic challenges, as both traditional moderate-intensity endurance (ET) and high-intensity interval training (HIIT) increases oxidative potential in a coordinated manner. Although these responses have been clearly demonstrated in healthy individuals, it remains to be determined whether both produce similar responses in the context of hypertension, one of the most prevalent and costly diseases worldwide. Therefore, in the current study, we used the Dahl sodium-sensitive rat, a model of hypertension, to determine the molecular responses to 4 wk of either ET or HIIT in the red (RG) and white gastrocnemius (WG) muscles. In the RG, both ET and HIIT increased the content of electron transport chain proteins and increased succinate dehydrogenase (SDH) content in type I fibers. Although both intensities of exercise shifted fiber type in RG (increased IIA, decreased IIX), only HIIT was associated with a reduction in endothelial nitric oxide synthase and an increase in HIF-1α proteins. In the WG, both ET and HIIT increased markers of the electron transport chain; however, HIIT decreased SDH content in a fiber-specific manner. ET increased type IIA, decreased IIB fibers, and increased capillarization, while, in contrast, HIIT increased the percentage of IIB fibers, decreased capillary-to-fiber ratios, decreased endothelial nitric oxide synthase, and increased hypoxia inducible factor-1α (HIF-1α) protein. Altogether, these data show that unlike in healthy animals, ET and HIIT have divergent effects in the skeletal muscle of hypertensive rats. This suggests ET may be optimal at improving the oxidative capacity of skeletal muscle in animals with hypertension. Copyright © 2015 the American Physiological Society.

Exceptional groups from open strings

International Nuclear Information System (INIS)

Gaberdiel, M.R.; Zwiebach, B.

1998-01-01

We consider type IIB theory compactified on a two-sphere in the presence of mutually non-local 7-branes. The BPS states associated with the gauge vectors of exceptional groups are seen to arise from open strings connecting the 7-branes, and multi-pronged open strings capable of ending on more than two 7-branes. These multi-pronged strings are built from open string junctions that arise naturally when strings cross 7-branes. The different string configurations can be multiplied as traditional open strings, and are shown to generate the structure of exceptional groups. (orig.)

Large N elliptic genus and AdS/CFT Correspondence

International Nuclear Information System (INIS)

Boer, Jan de

1998-01-01

According to one of Maldacena's dualities, type IIB string theory on AdS 3 x S 3 x K3 is equivalent to a certain N = (4, 4) superconformal field theory. In this note we compute the elliptic genus of the boundary theory in the supergravity approximation. A finite quantity is obtained once we introduce a particular exclusion principle. In the regime where the supergravity approximation is reliable, we find exact agreement with the elliptic genus of a sigma model with target space K3 N /S N

Aspects of space-time dualities

CERN Document Server

Giveon, Amit

1996-01-01

Duality groups of Abelian gauge theories on four manifolds and their reduction to two dimensions are considered. The duality groups include elements that relate different space-times in addition to relating different gauge-coupling matrices. We interpret (some of) such dualities as the geometrical symmetries of compactified theories in higher dimensions. In particular, we consider compactifications of a (self-dual) 2-form in 6-D, and compactifications of a self-dual 4-form in 10-D. Relations with a self-dual superstring in 6-D and with the type IIB superstring are discussed.

Systèmes fortement couplés en dualité jauge/gravité

OpenAIRE

Vanel , Thomas

2014-01-01

As an introduction, we present the original formulation of the AdS/CFT correspondence, between N = 4 Super Yang-Mills theory with gauge group SU(N) and type IIB string theory on AdS5 x S5. In a first part, we show how the ingredients of the AdS/CFT correspondence can be applied in a phenomenological way to study strongly correlated systems of fermions and present two fundamental models, the electron star and the holographic superconductor. We construct a holographic model for the study of Bos...

Disappearance of the Supergiant Progenitor of SN 2011dh in M51

Science.gov (United States)

Van Dyk, Schuyler D.; Filippenko, Alexei V.; Fox, Ori; Kelly, Patrick; Smith, Nathan

2013-03-01

We report that in Hubble Space Telescope (HST) Wide Field Camera 3 (WFC3) observations at F555W and F814W with the UVIS channel, conducted on 2013 March 2 UT as part of our Cycle 20 Snapshot program GO-13029 (PI: A. Filippenko), we have discovered that the yellow supergiant star, identified by Van Dyk et al. (2011, ApJ, 741, L28) and Maund et al. (2011, MNRAS, 739, L37) at the position of the Type IIb SN 2011dh in M51, has vanished.

Towards universal axion inflation and reheating in string theory

Directory of Open Access Journals (Sweden)

Ralph Blumenhagen

2014-09-01

Full Text Available The recent BICEP2 measurements of B-modes indicate a large tensor-to-scalar ratio in inflationary cosmology, which points towards trans-Planckian evolution of the inflaton. We propose possible string-theory realizations thereof. Schemes for natural and axion monodromy inflation are presented in the framework of the type IIB large volume scenario. The inflaton in both cases is given by the universal axion and its potential is generated by F-terms. Our models are shown to feature a natural mechanism for inflaton decay into predominantly Standard Model particles.

Universality and clustering in 1 + 1 dimensional superstring-bit models

International Nuclear Information System (INIS)

Bergman, O.; Thorn, C.B.

1996-01-01

We construct a 1+1 dimensional superstring-bit model for D=3 Type IIB superstring. This low dimension model escapes the problem encountered in higher dimension models: (1) It possesses full Galilean supersymmetry; (2) For noninteracting Polymers of bits, the exactly soluble linear superpotential describing bit interactions is in a large universality class of superpotentials which includes ones bounded at spatial infinity; (3) The latter are used to construct a superstring-bit model with the clustering properties needed to define an S-matrix for closed polymers of superstring-bits

Accidental Kähler moduli inflation

International Nuclear Information System (INIS)

Maharana, Anshuman; Rummel, Markus; Sumitomo, Yoske

2015-01-01

We study a model of accidental inflation in type IIB string theory where inflation occurs near the inflection point of a small Kähler modulus. A racetrack structure helps to alleviate the known concern that string-loop corrections may spoil Kähler Moduli Inflation unless having a significant suppression via the string coupling or a special brane setup. Also, the hierarchy of gauge group ranks required for the separation between moduli stabilization and inflationary dynamics is relaxed. The relaxation becomes more significant when we use the recently proposed D-term generated racetrack model

Chemotaxonomy of heterocystous cyanobacteria using FAME profiling as species markers.

Science.gov (United States)

Shukla, Ekta; Singh, Satya Shila; Singh, Prashant; Mishra, Arun Kumar

2012-07-01

The fatty acid methyl ester (FAME) analysis of the 12 heterocystous cyanobacterial strains showed different fatty acid profiling based on the presence/absence and the percentage of 13 different types of fatty acids. The major fatty acids viz. palmitic acid (16:0), hexadecadienoic acid (16:2), stearic acid (18:0), oleic acid (18:1), linoleic (18:2), and linolenic acid (18:3) were present among all the strains except Cylindrospermum musicola where oleic acid (18:1) was absent. All the strains showed high levels of polyunsaturated fatty acid (PUFAs; 41-68.35%) followed by saturated fatty acid (SAFAs; 1.82-40.66%) and monounsaturated fatty acid (0.85-24.98%). Highest percentage of PUFAs and essential fatty acid (linolenic acid; 18:3) was reported in Scytonema bohnerii which can be used as fatty acid supplement in medical and biotechnological purpose. The cluster analysis based on FAME profiling suggests the presence of two distinct clusters with Euclidean distance ranging from 0 to 25. S. bohnerii of cluster I was distantly related to the other strains of cluster II. The genotypes of cluster II were further divided into two subclusters, i.e., IIa with C. musicola showing great divergence with the other genotypes of IIb which was further subdivided into two groups. Subsubcluster IIb(1) was represented by a genotype, Anabaena sp. whereas subsubcluster IIb(2) was distinguished by two groups, i.e., one group having significant similarity among their three genotypes showed distant relation with the other group having closely related six genotypes. To test the validity of the fatty acid profiles as a marker, cluster analysis has also been generated on the basis of morphological attributes. Our results suggest that FAME profiling might be used as species markers in the study of polyphasic approach based taxonomy and phylogenetic relationship.

Application of Variable-Number Tandem-Repeat Typing To Discriminate Ralstonia solanacearum Strains Associated with English Watercourses and Disease Outbreaks

Science.gov (United States)

Bryant, Ruth; Bew, Janice; Conyers, Christine; Stones, Robert; Alcock, Michael; Elphinstone, John

2013-01-01

Variable-number tandem-repeat (VNTR) analysis was used for high-resolution discrimination among Ralstonia solanacearum phylotype IIB sequevar 1 (PIIB-1) isolates and further evaluated for use in source tracing. Five tandem-repeat-containing loci (comprising six tandem repeats) discriminated 17 different VNTR profiles among 75 isolates from potato, geranium, bittersweet (Solanum dulcamara), tomato, and the environment. R. solanacearum isolates from crops at three unrelated outbreak sites where river water had been used for irrigation had distinct VNTR profiles that were shared with PIIB-1 isolates from infected bittersweet growing upriver of each site. The VNTR profiling results supported the implication that the source of R. solanacearum at each outbreak was contaminated river water. Analysis of 51 isolates from bittersweet growing in river water at different locations provided a means to evaluate the technique for studying the epidemiology of the pathogen in the environment. Ten different VNTR profiles were identified among bittersweet PIIB-1 isolates from the River Thames. Repeated findings of contiguous river stretches that produced isolates that shared single VNTR profiles supported the hypothesis that the pathogen had disseminated from infected bittersweet plants located upriver. VNTR profiles shared between bittersweet isolates from two widely separated Thames tributaries (River Ray and River Colne) suggested they were independently contaminated with the same clonal type. Some bittersweet isolates had VNTR profiles that were shared with potato isolates collected outside the United Kingdom. It was concluded that VNTR profiling could contribute to further understanding of R. solanacearum epidemiology and assist in control of future disease outbreaks. PMID:23892739

Prognostic stratification of patients with T3N1M0 non-small cell lung cancer: which phase should it be?

Science.gov (United States)

Kilicgun, Ali; Tanriverdi, Ozgur; Turna, Akif; Metin, Muzaffer; Sayar, Adnan; Solak, Okan; Urer, Nur; Gurses, Atilla

2012-06-01

In the 1997 revision of the TNM staging system for lung cancer, patients with T3N0M0 disease were moved from stage IIIA to stage IIB since these patients have a better prognosis. Despite this modification, the local lymph node metastasis remained the most important prognostic factor in patients with lung cancer. The present study aimed to evaluate the prognosis of patients with T3N1 disease as compared with that of patients with stages IIIA and IIB disease. During 7-year period, 313 patients with non-small cell lung cancer (297 men, 16 women) who had resection were enrolled. The patients were staged according the 2007 revision of Lung Cancer Staging by American Joint Committee on Cancer. The Kaplan-Meier statistics was used for survival analysis, and comparisons were made using Cox proportional hazard method. The 5-year survival of patients with stage IIIA disease excluding T3N1 patients was 40%, whereas the survival of the patients with stage IIB disease was 66% at 5 years. The 5-year survival rates of stage III T3N1 patients (single-station N1) was found to be higher than those of patients with stage IIIA disease (excluding pT3N1 patients, P = 0.04), while those were found to be similar with those of patients with stage IIB disease (P = 0.4). Survival of the present cohort of patients with T3N1M0 disease represented the survival of IIB disease rather than IIIA non-small cell lung cancer. Further studies are needed to suggest further revisions in the recent staging system regarding T3N1MO disease.

A National-Level Validation of the New American Joint Committee on Cancer 8th Edition Subclassification of Stage IIA and B Anal Squamous Cell Cancer.

Science.gov (United States)

Goffredo, Paolo; Garancini, Mattia; Robinson, Timothy J; Frakes, Jessica; Hoshi, Hisakazu; Hassan, Imran

2018-06-01

The 8th edition of the American Joint Committee on Cancer (AJCC) updated the staging system of anal squamous cell cancer (ASCC) by subdividing stage II into A (T2N0M0) and B (T3N0M0) based on a secondary analysis of the RTOG 98-11 trial. We aimed to validate this new subclassification utilizing two nationally representative databases. The National Cancer Database (NCDB) [2004-2014] and the Surveillance, Epidemiology, and End Results (SEER) database [1988-2013] were queried to identify patients with stage II ASCC. A total of 6651 and 2579 stage IIA (2-5 cm) and 1777 and 641 stage IIB (> 5 cm) patients were identified in the NCDB and SEER databases, respectively. Compared with stage IIB patients, stage IIA patients within the NCDB were more often females with fewer comorbidities. No significant differences were observed between age, race, receipt of chemotherapy and radiation, and mean radiation dose. Demographic, clinical, and pathologic characteristics were comparable between patients in both datasets. The 5-year OS was 72% and 69% for stage IIA versus 57% and 50% for stage IIB in the NCDB and SEER databases, respectively (p  5 cm) in the general ASCC population. AJCC stage IIB patients represent a higher risk category that should be targeted with more aggressive/novel therapies.

General anesthesia plus ilioinguinal nerve block versus spinal anesthesia for ambulatory inguinal herniorrhapy

Directory of Open Access Journals (Sweden)

Lucía Vizcaíno-Martínez

2014-01-01

Full Text Available Objective: The aim was to evaluate general anesthesia (GA plus ilioinguinal nerve block (IIB versus spinal anesthesia (SA in patients scheduled for ambulatory inguinal hernia repair regarding pain management, anesthesia recovery and reducing potential complications. Materials and Methods: A double-blind, prospective, randomized, controlled study in patients American Society of Anesthesiologists I-III randomized into two groups: GA plus IIB group, induction of anesthesia with propofol, maintenance with sevoflurane, airway management with laryngeal mask allowing spontaneous ventilation and ultrasound-guided IIB; SA group, patients who underwent spinal block with 2% mepivacaine. The study variables were pain intensity, assessed by visual analog scale, analgesic requirements until hospital discharge, time to ambulation and discharge, postoperative complications-related to both techniques and satisfaction experienced. Results: Thirty-two patients were enrolled; 16 patients in each group. The differences regarding pain were statistically significant at 2 h of admission (P < 0.001 and at discharge (P < 0.001 in favor of the GA plus ilioinguinal block group. In addition in this group, analgesic requirements were lower than SA group (P < 0.001, with times of ambulation and discharge significantly shorter. The SA group had a higher tendency to develop complications and less satisfaction. Conclusion: General anesthesia plus IIB is better than SA regarding postoperative analgesia, time to mobilization and discharge, side-effect profile and satisfaction experienced by the patients.

Ghost D-branes

International Nuclear Information System (INIS)

Okuda, Takuya; Takayanagi, Tadashi

2006-01-01

We define a ghost D-brane in superstring theories as an object that cancels the effects of an ordinary D-brane. The supergroups U(N|M) and OSp(N/M) arise as gauge symmetries in the supersymmetric world-volume theory of D-branes and ghost D-branes. A system with a pair of D-brane and ghost D-brane located at the same location is physically equivalent to the closed string vacuum. When they are separated, the system becomes a new brane configuration. We generalize the type I/heterotic duality by including n ghost D9-branes on the type I side and by considering the heterotic string whose gauge group is OSp(32+2n/2n). Motivated by the type IIB S-duality applied to D9- and ghost D9-branes, we also find type II-like closed superstrings with U(n/n) gauge symmetry

FDG uptake heterogeneity in FIGO IIb cervical carcinoma does not predict pelvic lymph node involvement

OpenAIRE

Brooks, Frank J; Grigsby, Perry W

2013-01-01

Translational relevance Many types of cancer are located and assessed via positron emission tomography (PET) using the 18F-fluorodeoxyglucose (FDG) radiotracer of glucose uptake. There is rapidly increasing interest in exploiting the intra-tumor heterogeneity observed in these FDG-PET images as an indicator of disease outcome. If this image heterogeneity is of genuine prognostic value, then it either correlates to known prognostic factors, such as tumor stage, or it indicates some as yet unkn...

Holographic entanglement entropy of surface defects

International Nuclear Information System (INIS)

Gentle, Simon A.; Gutperle, Michael; Marasinou, Chrysostomos

2016-01-01

We calculate the holographic entanglement entropy in type IIB supergravity solutions that are dual to half-BPS disorder-type surface defects in N=4 supersymmetric Yang-Mills theory. The entanglement entropy is calculated for a ball-shaped region bisected by a surface defect. Using the bubbling supergravity solutions we also compute the expectation value of the defect operator. Combining our result with the previously-calculated one-point function of the stress tensor in the presence of the defect, we adapt the calculation of Lewkowycz and Maldacena http://dx.doi.org/10.1007/JHEP05(2014)025 to obtain a second expression for the entanglement entropy. Our two expressions agree up to an additional term, whose possible origin and significance is discussed.

Holographic entanglement entropy of surface defects

Energy Technology Data Exchange (ETDEWEB)

Gentle, Simon A.; Gutperle, Michael; Marasinou, Chrysostomos [Department of Physics and Astronomy, University of California,Los Angeles, CA 90095 (United States)

2016-04-12

We calculate the holographic entanglement entropy in type IIB supergravity solutions that are dual to half-BPS disorder-type surface defects in N=4 supersymmetric Yang-Mills theory. The entanglement entropy is calculated for a ball-shaped region bisected by a surface defect. Using the bubbling supergravity solutions we also compute the expectation value of the defect operator. Combining our result with the previously-calculated one-point function of the stress tensor in the presence of the defect, we adapt the calculation of Lewkowycz and Maldacena http://dx.doi.org/10.1007/JHEP05(2014)025 to obtain a second expression for the entanglement entropy. Our two expressions agree up to an additional term, whose possible origin and significance is discussed.

RG cascades in hyperbolic quiver gauge theories

International Nuclear Information System (INIS)

Ahl Laamara, R.; Ait Ben Haddou, M.; Belhaj, A.; Drissi, L.B.; Saidi, E.H.

2004-01-01

In this paper, we provide a general classification of supersymmatric QFT4s into three basic sets: ordinary, affine and indefinite classes. The last class, which has not been enough explored in literature, is shown to share most of properties of ordinary and affine super-QFT4s. This includes, amongst others, its embedding in type II string on local Calabi-Yau threefolds. We give realizations of these supersymmetric QFT4s as D-brane world volume gauge theories. A special interest is devoted to hyperbolic subset for its peculiar features and for the role it plays in type IIB background with non-zero axion. We also study RG flows and duality cascades in case of hyperbolic quiver theories. Comments regarding the full indefinite sector are made

Holomorphic couplings in non-perturbative string compactifications

International Nuclear Information System (INIS)

Klevers, Denis Marco

2011-06-01

In this thesis we present an analysis of several aspects of four-dimensional, non-perturbative N = 1 compactifications of string theory. Our focus is on the study of brane dynamics and their effective physics as encoded in the holomorphic couplings of the low-energy N=1 effective action, most prominently the superpotential W. The thesis is divided into three parts. In part one we derive the effective action of a spacetime-filling D5-brane in generic Type IIB Calabi-Yau orientifold compactifications. In the second part we invoke tools from string dualities, namely from F-theory, heterotic/F-theory duality and mirror symmetry, for a more elaborate study of the dynamics of (p, q) 7-branes and heterotic five-branes. In this context we demonstrate exact computations of the complete perturbative effective superpotential, both due to branes and background fluxes. Finally, in the third part we present a novel geometric description of five-branes in Type IIB and heterotic M-theory Calabi-Yau compactifications via a non-Calabi-Yau threefold Z 3 , that is canonically constructed from the original five-brane and Calabi-Yau threefold Z 3 via a blow-up. We exploit the use of the blow-up threefold Z 3 as a tool to derive open-closed Picard-Fuchs differential equations, that govern the complete effective brane and flux superpotential. In addition, we present first evidence to interpret Z 3 as a flux compactification dual to the original five-brane by defining an SU(3)-structure on Z 3 , that is generated dynamically by the five-brane backreaction. (orig.)

Investigation into the factors that influence inverse bulging effect during sheet hydro-mechanical deep drawing

Directory of Open Access Journals (Sweden)

Lang Lihui

2015-01-01

Full Text Available The factors that influence inverse bulging effect during sheet hydro-mechanical deep drawing are especially researched in this paper. According to the different inverse bulging process, two modes can be singled: the initial inverse bulging (IIB and the local inverse bulging (LIB. IIB includes two parameters: inverse bulging height ratio (HIb/t and inverse bulging pressure ratio (PIb/t. LIB is influenced by IIB and has a direct relationship with liquid chamber pressure in the forming process. The optimal inverse bulging parameters of hemispherical bottom cylindrical part and flat bottom cylindrical part are obtained by numerical simulation. Process parameters including the clearance between the punch and the blank holder and the blank holder entrance radius that have a large influence on inverse bulging effect are optimized, so as to make inverse bulging effect behave better in hydroforming process. Finally, the accuracy of the numerical simulation results was verified by experiments.

Fluorescence Imaging In Vivo at Wavelengths beyond 1500 nm.

Science.gov (United States)

Diao, Shuo; Blackburn, Jeffrey L; Hong, Guosong; Antaris, Alexander L; Chang, Junlei; Wu, Justin Z; Zhang, Bo; Cheng, Kai; Kuo, Calvin J; Dai, Hongjie

2015-12-01

Compared to imaging in the visible and near-infrared regions below 900 nm, imaging in the second near-infrared window (NIR-II, 1000-1700 nm) is a promising method for deep-tissue high-resolution optical imaging in vivo mainly owing to the reduced scattering of photons traversing through biological tissues. Herein, semiconducting single-walled carbon nanotubes with large diameters were used for in vivo fluorescence imaging in the long-wavelength NIR region (1500-1700 nm, NIR-IIb). With this imaging agent, 3-4 μm wide capillary blood vessels at a depth of about 3 mm could be resolved. Meanwhile, the blood-flow speeds in multiple individual vessels could be mapped simultaneously. Furthermore, NIR-IIb tumor imaging of a live mouse was explored. NIR-IIb imaging can be generalized to a wide range of fluorophores emitting at up to 1700 nm for high-performance in vivo optical imaging. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Narrowband Hα Imaging of Old Hydrogen-deficient Supernovae

Science.gov (United States)

Pooley, David A.; Vinko, Jozsef; Silverman, Jeffrey M.; Wheeler, J. Craig Craig; Szalai, Tamas; MacQueen, Phillip; Marion, Howie H.; Sárneczky, Krisztián

2017-06-01

We report results from our long-term observational survey aimed at discovering late-time interaction between the ejecta of hydrogen-deficient Type I supernovae and the hydrogen-rich envelope expelled from the progenitor star several decades to centuries before explosion. The expelled envelope, moving with a velocity of ˜10-100 km/s, is expected to be caught up by the fast-moving SN ejecta several years to decades after explosion depending on the history of the mass-loss process acting in the progenitor star prior to explosion. The collision between the SN ejecta and the circumstellar envelope results in net emission in the Balmer-lines, especially in Hα. For the past three years, we have been using the Direct Imaging Auxiliary Functions Instrument (DIAFI) on the 2.7m Harlan J. Smith Telescope at McDonald Observatory to look for signs of late-time Hα emission in older Type Ia/Ibc/IIb SNe having hydrogen-poor ejecta, via narrow-band imaging. Continuum-subtracted Hα emission has been detected for 13 point sources: 9 SN Ibc, 1 SN IIb and 3 SN Ia events. Thirty-eight SN sites were observed on at least two epochs, from which three objects (SN 1985F, SN 2005kl, SN 2012fh) showed significant temporal variation in the strength of their Hα emission in our DIAFI data. This suggests that the variable emission is probably not due to nearby HII regions, and hence is an important additional hint that ejecta-CSM interaction may take place in these systems. Moreover, we successfully detected the late-time Hα emission from the Type Ib SN 2014C, which was recently discovered as a strongly interacting SN in other wavebands.

Relating double field theory to the scalar potential of N=2 gauged supergravity

Energy Technology Data Exchange (ETDEWEB)

Blumenhagen, Ralph [Max-Planck-Institut für Physik (Werner-Heisenberg-Institut), Föhringer Ring 6, München, 80805 (Germany); Font, Anamaria [Max-Planck-Institut für Physik (Werner-Heisenberg-Institut), Föhringer Ring 6, München, 80805 (Germany); Arnold Sommerfeld Center for Theoretical Physics, LMU,Theresienstr. 37, München, 80333 (Germany); Plauschinn, Erik [Arnold Sommerfeld Center for Theoretical Physics, LMU,Theresienstr. 37, München, 80333 (Germany)

2015-12-18

The double field theory action in the flux formulation is dimensionally reduced on a Calabi-Yau three-fold equipped with non-vanishing type IIB geometric and non-geometric fluxes. First, we rewrite the metric-dependent reduced DFT action in terms of quantities that can be evaluated without explicitly knowing the metric on the Calabi-Yau manifold. Second, using properties of special geometry we obtain the scalar potential of N=2 gauged supergravity. After an orientifold projection, this potential is consistent with the scalar potential arising from the flux-induced superpotential, plus an additional D-term contribution.

Warped Kähler potentials and fluxes

International Nuclear Information System (INIS)

Martucci, Luca

2017-01-01

The four-dimensional effective theory for type IIB warped flux compactifications proposed in https://www.doi.org/10.1007/JHEP03(2015)067 is completed by taking into account the backreaction of the Kähler moduli on the three-form fluxes. The only required modification consists in a flux-dependent contribution to the chiral fields parametrising the Kähler moduli. The resulting supersymmetric effective theory satisfies the no-scale condition and consistently combines previous partial results present in the literature. Similar results hold for M-theory warped compactifications on Calabi-Yau fourfolds, whose effective field theory and Kähler potential are also discussed.

Warped Kähler potentials and fluxes

Energy Technology Data Exchange (ETDEWEB)

Martucci, Luca [Dipartimento di Fisica ed Astronomia “Galileo Galilei' ,Università di Padova & I.N.F.N. Sezione di Padova,Via Marzolo 8, 35131 Padova (Italy)

2017-01-13

The four-dimensional effective theory for type IIB warped flux compactifications proposed in https://www.doi.org/10.1007/JHEP03(2015)067 is completed by taking into account the backreaction of the Kähler moduli on the three-form fluxes. The only required modification consists in a flux-dependent contribution to the chiral fields parametrising the Kähler moduli. The resulting supersymmetric effective theory satisfies the no-scale condition and consistently combines previous partial results present in the literature. Similar results hold for M-theory warped compactifications on Calabi-Yau fourfolds, whose effective field theory and Kähler potential are also discussed.

Dual of big bang and big crunch

International Nuclear Information System (INIS)

Bak, Dongsu

2007-01-01

Starting from the Janus solution and its gauge theory dual, we obtain the dual gauge theory description of the cosmological solution by the procedure of double analytic continuation. The coupling is driven either to zero or to infinity at the big-bang and big-crunch singularities, which are shown to be related by the S-duality symmetry. In the dual Yang-Mills theory description, these are nonsingular as the coupling goes to zero in the N=4 super Yang-Mills theory. The cosmological singularities simply signal the failure of the supergravity description of the full type IIB superstring theory

Factors affecting the minimum capital cost of a tokamak reactor

International Nuclear Information System (INIS)

Hancox, R.

1981-01-01

The Mk IIA Culham conceptual tokamak reactor design is a 2500 MWe steady-state reactor developed on the basis of a cost optimisation. A revised 1200 MWe conceptual design, the Mk IIB, used a lower wall loading and lower thermodynamic efficiency. A detailed costing of the Mk IIB design, however, showed it to have an unacceptably high capital cost. Since this high cost is a common characteristic of many fusion reactor designs, the cost optimisation of the Mk II design has been reconsidered. (author)

Genetically different isolates of Trypanosoma cruzi elicit different infection dynamics in raccoons (Procyon lotor) and Virginia opossums (Didelphis virginiana).

Science.gov (United States)

Roellig, Dawn M; Ellis, Angela E; Yabsley, Michael J

2009-12-01

Trypanosoma cruzi is a genetically and biologically diverse species. In the current study we determined T. cruzi infection dynamics in two common North American reservoirs, Virginia opossums (Didelphis virginiana) and raccoons (Procyon lotor). Based on previous molecular and culture data from naturally-exposed animals, we hypothesised that raccoons would have a longer patent period than opossums, and raccoons would be competent reservoirs for both genotypes T. cruzi I (TcI) and TcIIa, while opossums would only serve as hosts for TcI. Individuals (n=2 or 3) of each species were inoculated with 1x10(6) culture-derived T. cruzi trypomastigotes of TcIIa (North American (NA) - raccoon), TcI (NA - opossum), TcIIb (South American - human), or both TcI and TcIIa. Parasitemias in opossums gradually increased and declined rapidly, whereas parasitemias peaked sooner in raccoons and they maintained relatively high parasitemia for 5weeks. Raccoons became infected with all three T. cruzi strains, while opossums only became infected with TcI and TcIIb. Although opossums were susceptible to TcIIb, infection dynamics were dramatically different compared with TcI. Opossums inoculated with TcIIb seroconverted, but parasitemia duration was short and only detectable by PCR. In addition, raccoons seroconverted sooner (3-7days post inoculation) than opossums (10days post inoculation). These data suggest that infection dynamics of various T. cruzi strains can differ considerably in different wildlife hosts.

Refinement Types for TypeScript

OpenAIRE

Vekris, Panagiotis; Cosman, Benjamin; Jhala, Ranjit

2016-01-01

We present Refined TypeScript (RSC), a lightweight refinement type system for TypeScript, that enables static verification of higher-order, imperative programs. We develop a formal core of RSC that delineates the interaction between refinement types and mutability. Next, we extend the core to account for the imperative and dynamic features of TypeScript. Finally, we evaluate RSC on a set of real world benchmarks, including parts of the Octane benchmarks, D3, Transducers, and the TypeScript co...

Refining types using type guards in TypeScript

NARCIS (Netherlands)

de Wolff, Ivo Gabe; Hage, J.

2017-01-01

We discuss two adaptations of the implementation of type guards and narrowing in the TypeScript compiler. The first is an improvement on the original syntax-directed implementation, and has now replaced the original one in the TypeScript compiler. It is specifically suited for the scenario in which

Brane orbits

CERN Document Server

Bergshoeff, Eric A; Riccioni, Fabio

2012-01-01

We complete the classification of half-supersymmetric branes in toroidally compactified IIA/IIB string theory in terms of representations of the T-duality group. As a by-product we derive a last wrapping rule for the space-filling branes. We find examples of T-duality representations of branes in lower dimensions, suggested by supergravity, of which none of the component branes follow from the reduction of any brane in ten-dimensional IIA/IIB string theory. We discuss the constraints on the charges of half-supersymmetric branes, determining the corresponding T-duality and U-duality orbits.

One-loop stabilization of the fuzzy four-sphere via softly broken SUSY

Energy Technology Data Exchange (ETDEWEB)

Steinacker, Harold C. [Faculty of Physics, University of Vienna,Boltzmanngasse 5, A-1090 Vienna (Austria)

2015-12-17

We describe a stabilization mechanism for fuzzy S{sub N}{sup 4} in the Euclidean IIB matrix model due to vacuum energy in the presence of a positive mass term. The one-loop effective potential for the radius contains an attractive contribution attributed to supergravity, while the mass term induces a repulsive contribution for small radius due to SUSY breaking. This leads to a stabilization of the radius. The mechanism should be pertinent to recent results on the genesis of 3+1-dimensional space-time in the Minkowskian IIB model.

MCMII and the TriP chip

Energy Technology Data Exchange (ETDEWEB)

Juan Estrada et al.

2003-12-19

We describe the development of the electronics that will be used to read out the Fiber Tracker and Preshower detectors in Run IIb. This electronics is needed for operation at 132ns bunch crossing, and may provide a measurement of the z coordinate of the Fiber Tracker hits when operating at 396ns bunch crossing. Specifically, we describe the design and preliminary tests of the Trip chip, MCM IIa, MCM IIb and MCM IIc. This document also serves as a user manual for the Trip chip and the MCM.

Type Classes for Lightweight Substructural Types

Directory of Open Access Journals (Sweden)

Edward Gan

2015-02-01

Full Text Available Linear and substructural types are powerful tools, but adding them to standard functional programming languages often means introducing extra annotations and typing machinery. We propose a lightweight substructural type system design that recasts the structural rules of weakening and contraction as type classes; we demonstrate this design in a prototype language, Clamp. Clamp supports polymorphic substructural types as well as an expressive system of mutable references. At the same time, it adds little additional overhead to a standard Damas-Hindley-Milner type system enriched with type classes. We have established type safety for the core model and implemented a type checker with type inference in Haskell.

Safety and efficacy of dolutegravir in treatment-experienced subjects with raltegravir-resistant HIV type 1 infection: 24-week results of the VIKING Study.

Science.gov (United States)

Eron, Joseph J; Clotet, Bonaventura; Durant, Jacques; Katlama, Christine; Kumar, Princy; Lazzarin, Adriano; Poizot-Martin, Isabelle; Richmond, Gary; Soriano, Vincent; Ait-Khaled, Mounir; Fujiwara, Tamio; Huang, Jenny; Min, Sherene; Vavro, Cindy; Yeo, Jane

2013-03-01

Dolutegravir (DTG; S/GSK1349572), a human immunodeficiency virus type 1 (HIV-1) integrase inhibitor, has limited cross-resistance to raltegravir (RAL) and elvitegravir in vitro. This phase IIb study assessed the activity of DTG in HIV-1-infected subjects with genotypic evidence of RAL resistance. Subjects received DTG 50 mg once daily (cohort I) or 50 mg twice daily (cohort II) while continuing a failing regimen (without RAL) through day 10, after which the background regimen was optimized, when feasible, for cohort I, and at least 1 fully active drug was mandated for cohort II. The primary efficacy end point was the proportion of subjects on day 11 in whom the plasma HIV-1 RNA load decreased by ≥0.7 log(10) copies/mL from baseline or was <400 copies/mL. A rapid antiviral response was observed. More subjects achieved the primary end point in cohort II (23 of 24 [96%]), compared with cohort I (21 of 27 [78%]) at day 11. At week 24, 41% and 75% of subjects had an HIV-1 RNA load of <50 copies/mL in cohorts I and II, respectively. Further integrase genotypic evolution was uncommon. Dolutegravir had a good, similar safety profile with each dosing regimen. Dolutegravir 50 mg twice daily with an optimized background provided greater and more durable benefit than the once-daily regimen. These data are the first clinical demonstration of the activity of any integrase inhibitor in subjects with HIV-1 resistant to RAL.

Results of a 5-Week Schedule of Modern Total Skin Electron Beam Radiation Therapy

Energy Technology Data Exchange (ETDEWEB)

Morris, Stephen Lloyd, E-mail: stephen.morris@gstt.nhs.uk [St Johns Institute of Dermatology, Guys and St Thomas Hospital, London (United Kingdom); McGovern, Mark; Bayne, Sally; Wain, Mary; Child, Fiona; Whittaker, Sean [St Johns Institute of Dermatology, Guys and St Thomas Hospital, London (United Kingdom)

2013-08-01

Purpose: To report the outcomes of a 5-week schedule of total skin electron beam radiation therapy (TSEB) for mycosis fungoides (MF). Methods: Over 5 years, 41 patients with confirmed MF were treated with a modern TSEB technique delivering 30 Gy in 20 fractions over 5 weeks to the whole skin surface. Data were collected prospectively and entered into the skin tumor unit research database. Skin modified skin weighted assessment tool score data were collected to determine response, duration of response, survival, and toxicity. The outcomes were analyzed according to the patient's stage before TSEB, prognostic factors, and adjuvant treatments. Results: Seventeen patients were stage 1B, 19 were stage IIB, 3 were stage III, and 2 were stage IV. The overall response rate was 95%, with a complete response rate of 51%. Seventy-six percent of patients had relapsed at median follow-up of 18 months. The median time to relapse was 12 months, to systemic therapy was 15 months, and to modified skin weighted assessment tool progression above baseline was 44 months. The complete response rate was 59% in stage IB and 47% in stage IIB patients. The median time to skin relapse was longer in stage IB compared with stage IIB, 18 months versus 9 months. The median time to systemic therapy was longer in stage IB compared with stage IIB, >56 months versus 8 months. The median overall survival was 35 months: >56 months for stage IB, 25 months for stage IIB, 46 months for stage III, and 23.5 months for stage IV. Fifteen patients received adjuvant psoralen + ultraviolet A treatment with no difference seen in the time to relapse. Conclusions: This 5-week schedule of TSEB for MF has a high response rate with comparable duration of response to other regimens. Future studies are needed to find adjuvant and combination treatments to improve the duration of response.

Partial transformation from fast to slow muscle fibers induced by deafferentation of capsaicin-sensitive muscle afferents.

Science.gov (United States)

Brunetti, O; Barazzoni, A M; Della Torre, G; Clavenzani, P; Pettorossi, V E; Bortolami, R

1997-11-01

Mechanical and histochemical characteristics of the lateral gastrocnemius (LG) muscle of the rat were examined 21 days after capsaicin injection into the LG muscle. The capsaicin caused a decrease in generation rate of twitch and tetanic tension and an increase in fatigue resistance of LG muscle. The histochemical muscle fiber profile evaluated by myosin adenosine triphosphatase and reduced nicotinamide adenine dinucleotide tetrazolium reductase methods showed an increase of type I and IIC fibers and a decrease of the type IIB in whole muscle, and a decrease of the IIA, IIX fibers in the red part accompanied by their increase in the white part. Therefore the capsaicin treatment, which selectively eliminated fibers belonging to the III and IV groups of muscle afferents, induced muscle fiber transformation from fast contracting fatiguing fibers to slowly contracting nonfatiguing ones.

Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

Science.gov (United States)

Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

2006-02-01

Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

On the use of abciximab in percutaneous coronary intervention

DEFF Research Database (Denmark)

Iversen, Allan

2011-01-01

Introduction: The present thesis ´On the use of abciximab in percutaneous coronary intervention´ is based on 6 papers concerning the glycoprotein IIb/IIIa inhibitor, abciximab. The thesis is divided into 2 sections. One section concerning a randomized trial comparing intracoronary (IC) with intra......Introduction: The present thesis ´On the use of abciximab in percutaneous coronary intervention´ is based on 6 papers concerning the glycoprotein IIb/IIIa inhibitor, abciximab. The thesis is divided into 2 sections. One section concerning a randomized trial comparing intracoronary (IC...... (ACS). Optimal administration route of abciximab. A randomized study Background: The glycoprotein IIb/IIIa inhibitor, abciximab, is used as an adjuvant anti-platelet therapy in PCI-treated patients suffering from ACS. A subgroup of patients with ACS is those with STEMI treated with p...... confer an even more beneficial effect. Firstly, we searched the literature on the subject and found that no large-scaled randomized trials had been published. Most data were derived from small studies evaluating non-clinical endpoints or were of retrospective design. This overview is published...

Eta Carinae: A Demanding Mistress

Science.gov (United States)

Gull, Theodore

2012-01-01

In the 1840's a southern star, Eta Argus, brightened to rival Sirius for nearly a decade, then faded. Today, we see the Homunculus, an hourglass figure with tutu, a dusty shell exceeding 12 solar masses expanding outward at 500 km/s. Many observers have systematically studied the massive binary total shrouded by interacting winds and its ejecta. More recently 3-D wind-wind collision models have begun to explain the extended structures resolved by Hubble Space Telescope. Now Herschel Space Observatory infrared scans are revealing wind interaction emissions and complex molecules left over from the dust that formed out of gas originally overabundant in nitrogen and greatly-depleted in oxygen and carbon. Many questions remain to be answered: What is the dust that formed in the 1840s event? What are the end states of the two massive companions ... SN, GRB, Hypernova? and When

Holomorphic couplings in non-perturbative string compactifications

Energy Technology Data Exchange (ETDEWEB)

Klevers, Denis Marco

2011-06-15

In this thesis we present an analysis of several aspects of four-dimensional, non-perturbative N = 1 compactifications of string theory. Our focus is on the study of brane dynamics and their effective physics as encoded in the holomorphic couplings of the low-energy N=1 effective action, most prominently the superpotential W. The thesis is divided into three parts. In part one we derive the effective action of a spacetime-filling D5-brane in generic Type IIB Calabi-Yau orientifold compactifications. In the second part we invoke tools from string dualities, namely from F-theory, heterotic/F-theory duality and mirror symmetry, for a more elaborate study of the dynamics of (p, q) 7-branes and heterotic five-branes. In this context we demonstrate exact computations of the complete perturbative effective superpotential, both due to branes and background fluxes. Finally, in the third part we present a novel geometric description of five-branes in Type IIB and heterotic M-theory Calabi-Yau compactifications via a non-Calabi-Yau threefold Z{sub 3}, that is canonically constructed from the original five-brane and Calabi-Yau threefold Z{sub 3} via a blow-up. We exploit the use of the blow-up threefold Z{sub 3} as a tool to derive open-closed Picard-Fuchs differential equations, that govern the complete effective brane and flux superpotential. In addition, we present first evidence to interpret Z{sub 3} as a flux compactification dual to the original five-brane by defining an SU(3)-structure on Z{sub 3}, that is generated dynamically by the five-brane backreaction. (orig.)

Type inference for correspondence types

DEFF Research Database (Denmark)

Hüttel, Hans; Gordon, Andy; Hansen, Rene Rydhof

2009-01-01

We present a correspondence type/effect system for authenticity in a π-calculus with polarized channels, dependent pair types and effect terms and show how one may, given a process P and an a priori type environment E, generate constraints that are formulae in the Alternating Least Fixed......-Point (ALFP) logic. We then show how a reasonable model of the generated constraints yields a type/effect assignment such that P becomes well-typed with respect to E if and only if this is possible. The formulae generated satisfy a finite model property; a system of constraints is satisfiable if and only...... if it has a finite model. As a consequence, we obtain the result that type/effect inference in our system is polynomial-time decidable....

Differences in survival between colon and rectal cancer from SEER data.

Science.gov (United States)

Lee, Yen-Chien; Lee, Yen-Lin; Chuang, Jen-Pin; Lee, Jenq-Chang

2013-01-01

Little is known about colorectal cancer or colon and rectal cancer. Are they the same disease or different diseases? The aim of this epidemiology study was to compare the features of colon and rectal cancer by using recent national cancer surveillance data. Data included colorectal cancer (1995-2008) from the Surveillance, Epidemiology, and End Results Program (SEER) database. Only adenocarcinoma was included for analysis. A total of 372,130 patients with a median follow-up of 32 months were analyzed. Mean survival of patients with the same stage of colon and rectal cancer was evaluated. Around 35% of patients had stage information. Among them, colon cancer patients had better survival than those with rectal cancer, by a margin of 4 months in stage IIB. In stage IIIC and stage IV, rectal cancer patients had better survival than colon cancer patients, by about 3 months. Stage IIB colorectal cancer patients had a poorer prognosis than those with stage IIIA and IIIB colorectal cancer. After adjustment of age, sex and race, colon cancer patients had better survival than rectal cancer of stage IIB, but in stage IIIC and IV, rectal cancer patients had better survival than colon cancer. The study is limited by its retrospective nature. This was a population-based study. The prognosis of rectal cancer was not worse than that of colon cancer. Local advanced colorectal cancer had a poorer prognosis than local regional lymph node metastasis. Stage IIB might require more aggressive chemotherapy, and no less than that for stage III.

Ring relations and mirror map from branes

Energy Technology Data Exchange (ETDEWEB)

Assel, Benjamin [Theoretical Physics Department, CERN,CH-1211 Geneva 23 (Switzerland)

2017-03-29

We study the space of vacua of three-dimensional N=4 theories from a novel approach building on the type IIB brane realization of the theory and in which the insertion of local chiral operators in the path integral is obtained from integrating out light modes in appropriate brane setups. Most of our analysis focuses on abelian quiver theories which can be realized as the low-energy theory of D3-D5-NS5 brane arrays. Their space of vacua contains a Higgs branch, parametrized by the vevs of half-BPS meson operators, and a Coulomb branch, parametrized by the vevs of half-BPS monopole operators. We show that the Higgs operators are inserted by adding F1 strings and D3 branes, while Coulomb operators are inserted by adding D1 strings and D3 branes, with specific orientations, to the initial brane setup of the theory. This approach has two main advantages. First the ring relations describing the Higgs and Coulomb branches can be derived by looking at specific brane setups with multiple interpretations in terms of operator insertions. This provides a new derivation of the Coulomb branch quantum relations. Secondly the map between the Higgs and Coulomb operators of mirror dual theories can be derived in a trivial way from IIB S-duality.

Balloon cells associated with granule cell dispersion in the dentate gyrus in hippocampal sclerosis.

Science.gov (United States)

Thom, M; Martinian, L; Caboclo, L O; McEvoy, A W; Sisodiya, S M

2008-06-01

Granule cell dispersion (GCD) is a common finding in hippocampal sclerosis in patients with intractable focal epilepsy. It is considered to be an acquired, post-developmental rather than a pre-existing abnormality, involving dispersion of either mature or newborn neurones, but the precise factors regulating it and its relationship to seizures are unknown. We present two cases of GCD with associated CD34-immunopositive balloon cells, a cell phenotype associated with focal cortical dysplasia type IIB, considered to be a developmental cortical lesion promoting epilepsy. This observation opens up the debate regarding the origin of balloon cells and CD34 expression and their temporal relationship to seizures.

One-loop Yukawa Couplings in Local Models

CERN Document Server

Conlon, Joseph P; Palti, Eran; 10.1007

2010-01-01

We calculate the one-loop Yukawa couplings and threshold corrections for supersymmetric local models of branes at singularities in type IIB string theory. We compute the corrections coming both from wavefunction and vertex renormalisation. The former comes in the IR from conventional field theory running and in the UV from threshold corrections that cause it to run from the winding scale associated to the full Calabi-Yau volume. The vertex correction is naively absent as it appears to correspond to superpotential renormalisation. However, we find that while the Wilsonian superpotential is not renormalised there is a physical vertex correction in the 1PI action associated to light particle loops.

F-theory uplifts and GUTs

International Nuclear Information System (INIS)

Blumenhagen, Ralph; Jurke, Benjamin; Grimm, Thomas W.; Weigand, Timo

2009-01-01

We study the F-theory uplift of Type IIB orientifold models on compact Calabi-Yau threefolds containing divisors which are del Pezzo surfaces. We consider two examples defined via del Pezzo transitions of the quintic. The first model has an orientifold projection leading to two disjoint O7-planes and the second involution acts via an exchange of two del Pezzo surfaces. The two uplifted fourfolds are generically singular with minimal gauge enhancements over a divisor and, respectively, a curve in the non-Fano base. We study possible further degenerations of the elliptic fiber leading to F-theory GUT models based on subgroups of E 8 .

The scale of inflation in the landscape

International Nuclear Information System (INIS)

Pedro, F.G.; Westphal, A.

2013-03-01

We determine the frequency of regions of small-field inflation in the Wigner landscape as an approximation to random supergravities/type IIB flux compactifications. We show that small-field inflation occurs exponentially more often than large-field inflation The power of primordial gravitational waves from inflation is generically tied to the scale of inflation. For small-field models this is below observational reach. However, we find small-field inflation to be dominated by the highest inflationary energy scales compatible with a sub-Planckian field range. Hence, we expect a typical tensor-to-scalar ratio r∝O(10 -3 ) currently undetectable in upcoming CMB measurements.

On operator mixing in N=4 SYM

International Nuclear Information System (INIS)

Bianchi, Massimo; Eden, Burkhard; Rossi, Giancarlo; Stanev, Yassen S.

2002-01-01

We resolve the mixing of the scalar operators of naive dimension 4 belonging to the representation 20' of the SU(4) R-symmetry in N=4 SYM. We compute the order g 2 corrections to their anomalous dimensions and show the absence of instantonic contributions thereof. Ratios of the resulting expressions are irrational numbers, even in the large N limit where, however, we observe the expected decoupling of double-trace operators from single-trace ones. We briefly comment on the generalizations of our results required in order to make contact with the double scaling limit of the theory conjectured to be holographically dual to type IIB superstring on a pp-wave

One-loop Yukawa couplings in local models

International Nuclear Information System (INIS)

Conlon, Joseph P.; Goodsell, Mark; Palti, Eran

2010-07-01

We calculate the one-loop Yukawa couplings and threshold corrections for supersymmetric local models of branes at singularities in type IIB string theory. We compute the corrections coming both from wavefunction and vertex renormalisation. The former comes in the IR from conventional field theory running and in the UV from threshold corrections that cause it to run from the winding scale associated to the full Calabi-Yau volume. The vertex correction is naively absent as it appears to correspond to superpotential renormalisation. However, we find that while the Wilsonian superpotential is not renormalised there is a physical vertex correction in the 1PI action associated to light particle loops. (orig.)

The scale of inflation in the landscape

Energy Technology Data Exchange (ETDEWEB)

Pedro, F.G.; Westphal, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany). Theory Group

2013-03-15

We determine the frequency of regions of small-field inflation in the Wigner landscape as an approximation to random supergravities/type IIB flux compactifications. We show that small-field inflation occurs exponentially more often than large-field inflation The power of primordial gravitational waves from inflation is generically tied to the scale of inflation. For small-field models this is below observational reach. However, we find small-field inflation to be dominated by the highest inflationary energy scales compatible with a sub-Planckian field range. Hence, we expect a typical tensor-to-scalar ratio r{proportional_to}O(10{sup -3}) currently undetectable in upcoming CMB measurements.

One-loop Yukawa couplings in local models

Energy Technology Data Exchange (ETDEWEB)

Conlon, Joseph P. [Rudolf Peierls Center for Theoretical Physics, Oxford (United Kingdom); Balliol College, Oxford (United Kingdom); Goodsell, Mark [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Palti, Eran [Centre de Physique Theorique, Ecole Polytechnique, CNRS, Palaiseau (France)

2010-07-15

We calculate the one-loop Yukawa couplings and threshold corrections for supersymmetric local models of branes at singularities in type IIB string theory. We compute the corrections coming both from wavefunction and vertex renormalisation. The former comes in the IR from conventional field theory running and in the UV from threshold corrections that cause it to run from the winding scale associated to the full Calabi-Yau volume. The vertex correction is naively absent as it appears to correspond to superpotential renormalisation. However, we find that while the Wilsonian superpotential is not renormalised there is a physical vertex correction in the 1PI action associated to light particle loops. (orig.)

String theory duals of Lifshitz–Chern–Simons gauge theories

International Nuclear Information System (INIS)

Balasubramanian, Koushik; McGreevy, John

2012-01-01

We propose candidate gravity duals for a class of non-Abelian z = 2 Lifshitz Chern–Simons (LCS) gauge theories studied by Mulligan, Kachru and Nayak. These are nonrelativistic gauge theories in 2+1 dimensions in which parity and time-reversal symmetries are explicitly broken by the presence of a Chern–Simons term. We show that these field theories can be realized as deformations of DLCQ N=4 super Yang–Mills theory. Using the holographic dictionary, we identify the bulk fields of type IIB supergravity that are dual to these deformations. The geometries describing the groundstates of the non-Abelian LCS gauge theories realized here exhibit a mass gap. (paper)

Sequestering in string theory

International Nuclear Information System (INIS)

Kachru, Shamit; McAllister, Liam; Sundrum, Raman

2007-01-01

We study sequestering, a prerequisite for flavor-blind supersymmetry breaking in several high-scale mediation mechanisms, in compactifications of type IIB string theory. We find that although sequestering is typically absent in unwarped backgrounds, strongly warped compactifications do readily sequester. The AdS/CFT dual description in terms of conformal sequestering plays an important role in our analysis, and we establish how sequestering works both on the gravity side and on the gauge theory side. We pay special attention to subtle compactification effects that can disrupt sequestering. Our result is a step toward realizing an appealing pattern of soft terms in a KKLT compactification

Expanding (3+1)-dimensional universe from a lorentzian matrix model for superstring theory in (9+1) dimensions.

Science.gov (United States)

Kim, Sang-Woo; Nishimura, Jun; Tsuchiya, Asato

2012-01-06

We reconsider the matrix model formulation of type IIB superstring theory in (9+1)-dimensional space-time. Unlike the previous works in which the Wick rotation was used to make the model well defined, we regularize the Lorentzian model by introducing infrared cutoffs in both the spatial and temporal directions. Monte Carlo studies reveal that the two cutoffs can be removed in the large-N limit and that the theory thus obtained has no parameters other than one scale parameter. Moreover, we find that three out of nine spatial directions start to expand at some "critical time," after which the space has SO(3) symmetry instead of SO(9).

Superstring interactions in a pp-wave background II

International Nuclear Information System (INIS)

Spradlin, Marcus; Volovich, Anastasia

2003-01-01

In type-IIB light-cone superstring field theory, the cubic interaction has two pieces: a delta-functional overlap and an operator inserted at the interaction point. In this paper we extend our earlier work by computing the matrix elements of this operator in the oscillator basis of pp-wave string theory for all μ p +α '. By evaluating these matrix elements for large μ p +α ', we check a recent conjecture relating matrix elements of the light-cone string field theory hamiltonian (with prefactor) to certain three-point functions of BMN operators in the gauge theory. We also make several predictions for gauge theory. (author)

Explicit formulas for Neumann coefficients in the plane-wave geometry

International Nuclear Information System (INIS)

He Yanghui; Schwarz, John H.; Spradlin, Marcus; Volovich, Anastasia

2003-01-01

We obtain explicit formulas for the Neumann coefficients and associated quantities that appear in the three-string vertex for type IIB string theory in a plane-wave background, for any value of the mass parameter μ. The derivation involves constructing the inverse of a certain infinite-dimensional matrix, in terms of which the Neumann coefficients previously had been written only implicitly. We derive asymptotic expansions for large μ and find unexpectedly simple results, which are valid to all orders in 1/μ. Using BMN duality, these give predictions for certain gauge theory quantities to all orders in the modified 't Hooft coupling λ ' . A specific example is presented

Agonist muscle adaptation accompanied by antagonist muscle atrophy in the hindlimb of mice following stretch-shortening contraction training.

Science.gov (United States)

Rader, Erik P; Naimo, Marshall A; Ensey, James; Baker, Brent A

2017-02-02

The vast majority of dynamometer-based animal models for investigation of the response to chronic muscle contraction exposure has been limited to analysis of isometric, lengthening, or shortening contractions in isolation. An exception to this has been the utilization of a rat model to study stretch-shortening contractions (SSCs), a sequence of consecutive isometric, lengthening, and shortening contractions common during daily activity and resistance-type exercise. However, the availability of diverse genetic strains of rats is limited. Therefore, the purpose of the present study was to develop a dynamometer-based SSC training protocol to induce increased muscle mass and performance in plantarflexor muscles of mice. Young (3 months old) C57BL/6 mice were subjected to 1 month of plantarflexion SSC training. Hindlimb muscles were analyzed for muscle mass, quantitative morphology, myogenesis/myopathy relevant gene expression, and fiber type distribution. The main aim of the research was achieved when training induced a 2-fold increase in plantarflexion peak torque output and a 19% increase in muscle mass for the agonist plantaris (PLT) muscle. In establishing this model, several outcomes emerged which raised the value of the model past that of being a mere recapitulation of the rat model. An increase in the number of muscle fibers per transverse muscle section accounted for the PLT muscle mass gain while the antagonist tibialis anterior (TA) muscle atrophied by 30% with preferential atrophy of type IIb and IIx fibers. These alterations were accompanied by distinct gene expression profiles. The findings confirm the development of a stretch-shortening contraction training model for the PLT muscle of mice and demonstrate that increased cross-sectional fiber number can occur following high-intensity SSC training. Furthermore, the TA muscle atrophy provides direct evidence for the concept of muscle imbalance in phasic non-weight bearing muscles, a concept largely