Donaldson, Elisabeth A; Cohen, Joanna E; Villanti, Andrea C; Kanarek, Norma F; Barry, Colleen L; Rutkow, Lainie
2015-05-01
This study examined bill- and state-level factors associated with enactment of adult obesity prevention legislation in US states. A review of bills in the Rudd Center for Food Policy and Obesity's legislative database identified 487 adult obesity prevention bills, or proposed legislation, introduced between 2010 and 2013. Multilevel models were constructed to examine bill- and state-level characteristics associated with enactment. From 2010 to 2013, 81 (17%) of obesity prevention bills introduced were enacted across 35 states and the District of Columbia. Bills introduced in 2010 were more likely to be enacted than in 2013 (OR=9.49; 95% CI: 2.61-34.5). Bills focused on access to healthy food, physical activity, general and educational programs, as well as modifying rules and procedures (e.g., preemption) had greater odds of enactment relative to food and beverage taxes (OR=8.18; 95% CI: 2.85-23.4 healthy food; OR=17.3; 95% CI: 4.55-65.7 physical activity; OR=15.2; 95% CI: 4.80-47.9 general; OR=13.7; 95% CI: 3.07-61.5 rules). The year of bill introduction and overall bill enactment rate were related to adult obesity prevention legislation enactment in states. This study highlights the importance of a bill's topic area for enactment and provides insights for advocates and policymakers trying to address enactment barriers. Copyright © 2015 Elsevier Inc. All rights reserved.
Correlates of state enactment of elementary school physical education laws.
Monnat, Shannon M; Lounsbery, Monica A F; Smith, Nicole J
2014-12-01
To describe variation in U.S. state elementary school physical education (PE) policies and to assess associations between state PE policy enactment and education funding, academic achievement, sociodemographic disadvantage, and political characteristics. U.S. state laws regarding school PE time, staffing, curriculum, fitness assessment, and moderate-to-vigorous physical activity (MVPA) in 2012 were classified as strong/specific, weak/nonspecific, or none based on codified law ratings within the Classification of Laws Associated with School Students (C.L.A.S.S.). Laws were merged with state-level data from multiple sources. Logistic regression was used to determine associations between state characteristics and PE laws (N=51). Laws with specific PE and MVPA time requirements and evidence-based curriculum standards were more likely in states with low academic performance and in states with sociodemographically disadvantaged populations. School day length was positively associated with enacting a PE curriculum that referenced evidence-based standards. School funding and political characteristics were not associated with PE laws. Limited time and high-stake testing requirements force schools to prioritize academic programs, posing barriers to state passage of specific PE laws. To facilitate PE policy enactment, it may be necessary to provide evidence on how PE policies can be implemented within existing time and staffing structures. Copyright © 2014 Elsevier Inc. All rights reserved.
From Metaphors of Empire to Enactments of State
DEFF Research Database (Denmark)
Bunkenborg, Mikkel
2014-01-01
township in Hebei Province. Like many other places in the People's Republic of China, the township has seen a revival of popular religion in recent decades. This revival has often been described as a rebounding and selective adaptation of traditions that had been suppressed by the socialist state...... religion from Falungong to Christian sectarianism offer healing and social support in a Hebei township, the article suggests that popular religion does not so much stand for the state as a representation, as it stands in for the state as an alternative enactment....
The Antigerminative Activity of Twenty-Seven Monoterpenes
Directory of Open Access Journals (Sweden)
Laura De Martino
2010-09-01
Full Text Available Monoterpenes, the main constituents of essential oils, are known for their many biological activities. The present work studied the potential biological activity of twenty-seven monoterpenes, including monoterpene hydrocarbons and oxygenated ones, against seed germination and subsequent primary radicle growth of Raphanus sativus L. (radish and Lepidium sativum L. (garden cress, under laboratory conditions. The compounds, belonging to different chemical classes, showed different potency in affecting both parameters evaluated. The assayed compounds demonstrated a good inhibitory activity in a dose-dependent way. In general, radish seed is more sensitive than garden cress and its germination appeares more inhibited by alcohols; at the highest concentration tested, the more active substances were geraniol, borneol, (±-β-citronellol and α-terpineol. Geraniol and carvone inhibited, in a significant way, the germination of garden cress, at the highest concentration tested. Radicle elongation of two test species was inhibited mainly by alcohols and ketones. Carvone inhibited the radicle elongation of both seeds, at almost all concentrations assayed, while 1,8-cineole inhibited their radicle elongation at the lowest concentrations (10−5 M, 10−6 M.
Directory of Open Access Journals (Sweden)
Nadège Rochat
Full Text Available Studies on ultra-endurance suggest that during the races, athletes typically experience three vitality states (i.e., preservation, loss, and revival at the phenomenological level. Nevertheless, how these states contribute to the management and outcome of performance remains unclear. The aim of this study was to determine whether and how the vitality states experienced by runners and their evolution during a trail race can be used to distinguish finishers from withdrawers. From an enactive and phenomenological framework, we processed enactive interviews and blog posts of race narratives. We distinguished units of meaning, which were grouped into sequences of experience; each sequence was then categorized as one of the three vitality states: state of vitality preservation (SVP, state of vitality loss (SVL or state of vitality revival (SVR. We analyzed the distribution of these vitality states and their temporal organization at the beginning, in the second and third quarters, and at the end of the races, and we qualitatively characterized runners' adaptations to SVL. Results showed that finishers completed the race in SVP, with overall significantly more sequences in SVP and significantly fewer sequences in SVL than withdrawers. SVR did not discriminate finishers from withdrawers. The temporal organization of the vitality states showed a significant difference in the emergence of SVP from the second quarter of the race, as well as a significant difference in the emergence of SVL from the third quarter of the race. The analysis of adaptations to SVL confirmed that finishers were more capable of exiting SVL by enacting a preservation world when they felt physical or psychological alerts, whereas withdrawers remained in SVL. Our results showed that finishers and withdrawers did not enact the same phenomenological worlds in the race situation, especially in the organization of vitality adaptations and their relationships to difficulties; the cumulative
Seven principle of highly effective Nuclear Energy Programs
International Nuclear Information System (INIS)
Ferguson, Ch.D.; Reed, Ph.D.
2010-01-01
This paper presents seven principles that demand consideration for any country using a nuclear power program or wanting to acquire such a program. These principles are assessing the overall energy system, determining effective use of financial resources for energy development, ensuring high safety standards, implementing best security practices, preventing the spread of nuclear weapons, managing radioactive waste in a safe and secure manner, and enacting a legal framework that encompasses the other principle areas. The paper applies management methods that underscore development of strong independent national capabilities integrated within an interdependent international system. The paper discusses the individual responsibilities of states in all seven principles and offers recommendations for how states can benefit from greater international cooperation in nuclear energy development
Enactments in Psychoanalysis: Therapeutic Benefits.
Stern, Stanley
The therapeutic benefits of enactments are addressed. Relevant literature reveals disparate conceptions about the nature and use of enactments. Clarification of the term is discussed. This analyst's theoretical and technical evolution is addressed; it is inextricably related to using enactments. How can it not be? A taxonomy of enactments is presented. The article considers that enactments may be fundamental in the evolution from orthodox to contemporary analytic technique. Assumptions underlying enactments are explored, as are guidelines for using enactments. Finally, the article posits that enactments have widened the scope of analysis and contributed to its vitality.
The enactment stage of end-of-life decision-making for children.
Sullivan, Jane Elizabeth; Gillam, Lynn Heather; Monagle, Paul Terence
2018-01-11
Typically pediatric end-of-life decision-making studies have examined the decision-making process, factors, and doctors' and parents' roles. Less attention has focussed on what happens after an end-of-life decision is made; that is, decision enactment and its outcome. This study explored the views and experiences of bereaved parents in end-of-life decision-making for their child. Findings reported relate to parents' experiences of acting on their decision. It is argued that this is one significant stage of the decision-making process. A qualitative methodology was used. Semi-structured interviews were conducted with bereaved parents, who had discussed end-of-life decisions for their child who had a life-limiting condition and who had died. Data were thematically analysed. Twenty-five bereaved parents participated. Findings indicate that, despite differences in context, including the child's condition and age, end-of-life decision-making did not end when an end-of-life decision was made. Enacting the decision was the next stage in a process. Time intervals between stages and enactment pathways varied, but the enactment was always distinguishable as a separate stage. Decision enactment involved making further decisions - parents needed to discern the appropriate time to implement their decision to withdraw or withhold life-sustaining medical treatment. Unexpected events, including other people's actions, impacted on parents enacting their decision in the way they had planned. Several parents had to re-implement decisions when their child recovered from serious health issues without medical intervention. Significance of results A novel, critical finding was that parents experienced end-of-life decision-making as a sequence of interconnected stages, the final stage being enactment. The enactment stage involved further decision-making. End-of-life decision-making is better understood as a process rather than a discrete once-off event. The enactment stage has particular
State of the Union Address, 1997. Remarks by the President in State of the Union Address.
Executive Office of the President, Washington, DC.
This document contains the text of President Clinton's State of the Union Address, delivered on February 4, 1997. The President issues a call to action to work together to prepare America for the twenty-first century. The United States must attend to the unfinished business of balancing the budget, enacting bipartisan campaign-finance reform, and…
DEFF Research Database (Denmark)
Petersen, Morten Krogh; Ren, Carina Bregnholm
see Copenhagen and Denmark getting “much more than a song contest” with this particular choice of venue. We propose to explore the ESC and the choice of Refshale Island as the ESC venue as enacting a specific issue of public concern (Marres 2012), namely the competitiveness of the Danish state. We...... discuss the implications and consequences of organizing the event in this way, arguing that the B&W halls take part in envisioning a new kind of creative and competitive project state rooted in the cultural economy....
Davis, Sean D; Butler, Mark H
2004-07-01
Enactments are a potential common clinical process factor contributing to positive outcomes in many relational therapies. Enactments provide therapists a medium for mediating relationships through simultaneous experiential intervention and change at multiple levels of relationships--including specific relationship disagreements and problems, interaction process surrounding these issues, and underlying emotions and attachment issues confounded with those problems. We propose a model of enactments in marriage and family therapy, consisting of three components--initiation operations, intervention operations, and evaluation operations. We offer a conceptual framework to help clinicians know when and to what purpose to use this model of enactments. We provide an operational description of each component of an enactment, exemplifying them using a hypothetical clinical vignette. Directions for future research are suggested.
Enacting and Re-Enacting the Constitution of Development
DEFF Research Database (Denmark)
Brønnum, Louise; Clausen, Christian
2015-01-01
Many companies find it difficult to enable radical innovation within the organization and its structure. The problem is described by many and tried solved by proposing of new development tools and processes or applying a different organizational structure and culture. This paper presents a case...... study that will show how there in a development company exits a constitution of development. This constitution of development is perceived as a set of development rules and guidelines that are implicitly enacted by the employees and for certain development opportunities. Through the case study we...... will present different strategies for re-enactment of the constitution of development that frame for alternative development spaces with perceived different rules, and therefor make space for the development of a more radical nature....
Enacting Governance through Strategy
DEFF Research Database (Denmark)
Brandtner, Christof; Höllerer, Markus A.; Meyer, Renate E.
2017-01-01
of strategy documents in city administration addresses these challenges. Our central claim is that strategy documents can be understood as a distinct discursive device through which local governments enact aspired governance configurations. We illustrate our argument empirically using two prominent examples...... that, while showing similar features and characteristics, are anchored in different administrative traditions and institutional frameworks: the city administrations of Sydney, Australia, and Vienna, Austria. The contribution of the paper is to show how strategy documents enact governance configurations...... along four core dimensions: the setting in space and time, the definition of the public, the framing of the res publica and legitimacy issues. Moreover, our comparative analysis of Sydney and Vienna gives evidence of differences in governance configurations enacted through strategy documents....
Directory of Open Access Journals (Sweden)
Alberto Fajardo
2013-08-01
Full Text Available This article explores the relationship between pedagogical beliefs and classroom practice. Two Colombian pre-service primary school language teachers in the final stage of their five-year training programme were the research participants. Interview and classroom observation were the methods used, and content analysis was the analytical approach. It is argued in this study that by comparing the stated beliefs (as articulated in interviews and enacted beliefs (as manifested in classroom interaction, it is possible to gain a fine-grained understanding of the relationship between beliefs and teaching practice. The findings suggested that while there were significant cases of coherence between beliefs and classroom action, there was also evidence of some incongruent relationships.
Technological Literacy Reconsidered: A Model for Enactment
Ingerman, Ake; Collier-Reed, Brandon
2011-01-01
This paper presents a model to describe technological literacy as enacted by individuals in the course of shaping their lives and the world around them. The model has two interrelated facets--the "potential" for and "enactment" of technological literacy--where enactment and potential mutually constitute each other. This "potential" is made up of…
Relationships between non-pathological dream-enactment and mirror behaviors.
Nielsen, Tore; Kuiken, Don
2013-09-01
Dream-enacting behaviors (DEBs) are behavioral expressions of forceful dream images often occurring during sleep-to-wakefulness transitions. We propose that DEBs reflect brain activity underlying social cognition, in particular, motor-affective resonance generated by the mirror neuron system. We developed a Mirror Behavior Questionnaire (MBQ) to assess some dimensions of mirror behaviors and investigated relationships between MBQ scores and DEBs in a large of university undergraduate cohort. MBQ scores were normally distributed and described by a four-factor structure (Empathy/Emotional Contagion, Behavioral Imitation, Sleepiness/Anger Contagion, Motor Skill Imitation). DEB scores correlated positively with MBQ total and factor scores even with social desirability, somnambulism and somniloquy controlled. Emotion-specific DEB items correlated with corresponding emotion-specific MBQ items, especially crying and smiling. Results provide preliminary evidence for cross-state relationships between propensities for dream-enacting and mirror behaviors--especially behaviors involving motor-affective resonance--and our suggestion that motor-affective resonance mediates dream-enactment imagery during sleep and emotional empathy during waking. Copyright © 2013 Elsevier Inc. All rights reserved.
Learning from text benefits from enactment.
Cutica, Ilaria; Ianì, Francesco; Bucciarelli, Monica
2014-10-01
Classical studies on enactment have highlighted the beneficial effects of gestures performed in the encoding phase on memory for words and sentences, for both adults and children. In the present investigation, we focused on the role of enactment for learning from scientific texts among primary-school children. We assumed that enactment would favor the construction of a mental model of the text, and we verified the derived predictions that gestures at the time of encoding would result in greater numbers of correct recollections and discourse-based inferences at recall, as compared to no gestures (Exp. 1), and in a bias to confound paraphrases of the original text with the verbatim text in a recognition test (Exp. 2). The predictions were confirmed; hence, we argue in favor of a theoretical framework that accounts for the beneficial effects of enactment on memory for texts.
The Discursive Enactment of Hegemony: Sexual Harassment and Academic Organizing.
Townsley, Nikki C.; Geist, Patricia
2000-01-01
Contributes to scholarship advancing the understanding of human communication, illustrating the discursive enactment of hegemony through organizational responses to sexual harassment. Analyzes stories from both victims of sexual harassment and administrators who manage sexual harassment complaints at a major United States university. Argues that…
Game Movement as Enactive Focalization
Directory of Open Access Journals (Sweden)
Yotam Shibolet
2018-01-01
Full Text Available This paper integrates thought on game narrative and embodied cognition, in order to consider the significance of movement to the embodied narrative experience of games. If games are a mode of ‘environmental storytelling’, determining the player’s mobile situatedness within the gamespace is of crucial importance. The metaphor of game design as narrative architecture should be expanded to include te the design of movement dynamics, alongside geographical gamespace. I suggest a theoretical infrastructure that aims to enable further analysis of movement design’s role in this scope. The theory of enactive perception asserts that all perception is inherently negotiated through embodied understanding of moving within environment. According to this model, by giving meaning to perception, movement is also directly related to the structure of consciousness and thought. Cognitive definitions of ‘narrative’ that integrate embodiment are applied to argue it can relevantly account for part of thought’s role in enactive perception. Mieke Bal’s concept of focalization (1997 broaches narrative perspective by underscoring the constant “movement of the look”. For enactive perception, such mobility should be understood as inseparable from the movement of the body even when perspective could appear detached from embodiment. Therefore, I offer the supplementary concept of “enactive focalization” – narrative perception as interpreted through the interconnected dynamics or perspectival and physical movement. To exemplify my ideas and the potential of future research in this scope, I discuss the uniquely effective and affective movement dynamic design of Journey. This paper concludes by reflecting on enactive focalization in light of the increased utilization of embodiment in the contemporary digital media landscape.
DEFF Research Database (Denmark)
Michea, Adela
This is an ethnographic study of business model innovation in an established manufacturing company. The motivation of the thesis is to propose a sensemaking (Weick, 1995), with focus on enactment (Weick, 1979), analysis of a business model innovation process, stepping outside the usual perspectives...... employed in analysing such a phenomenon, namely activity system, dynamic capability and transaction costs, discovery driven or cognitive perspective. The research question guiding the thesis is: How do established companies enact new business models? The innovation of business models in established...... companies is an intricate process, and a mountain to climb in the eyes of top management. Often, in the choice between innovation and control the latter wins. Studies have shown that technologies and processes, which have the potential to challenge the exiting model, are being filtered out. In here...
Family Communication about End-of-Life Decisions and the Enactment of the Decision-Maker Role
Directory of Open Access Journals (Sweden)
April R. Trees
2017-06-01
Full Text Available End-of-life (EOL decisions in families are complex and emotional sites of family interaction necessitating family members coordinate roles in the EOL decision-making process. How family members in the United States enact the decision-maker role in EOL decision situations was examined through in-depth interviews with 22 individuals who participated in EOL decision-making for a family member. A number of themes emerged from the data with regard to the enactment of the decision-maker role. Families varied in how decision makers enacted the role in relation to collective family input, with consulting, informing and collaborating as different patterns of behavior. Formal family roles along with gender- and age-based roles shaped who took on the decision-maker role. Additionally, both family members and medical professionals facilitated or undermined the decision-maker’s role enactment. Understanding the structure and enactment of the decision-maker role in family interaction provides insight into how individuals and/or family members perform the decision-making role within a cultural context that values autonomy and self-determination in combination with collective family action in EOL decision-making.
DEFF Research Database (Denmark)
Korsgaard, Steffen T.; Neergaard, Helle
2008-01-01
is formulated where opportunities are seen as dynamic in the sense that they are enacted in different social practices at different sites. The method is illustrated through an analysis of the birth of The Republic of Tea, a very successful tea company, as presented in the book "The Republic of Tea"....
Curriculum enactment patterns and associated factors from teachers' perspectives
Son, Ji-Won; Kim, Ok-Kyeong
2016-12-01
As part of a larger effort to improve teacher capacity for high-quality mathematics instruction, we investigated the factors that are associated with different enactment patterns at three levels: contextual (e.g., type and quality of textbook), individual (e.g., teacher knowledge), and teachers' opportunity-to-learn (e.g., professional development experiences). Analysis of 183 teachers' self-reports on their practices revealed three notable findings. First, the factors at the three levels were all found to be significantly related to the different patterns of enacted curriculum. However, the use of quality textbooks and the alignment of teachers' views and instructional goals with curriculum goals were found to be the two factors that are most strongly associated with the enactment pattern of high-level problems and high-level teacher questions in instruction. Furthermore, teachers with the enactment pattern of increasing lower cognitive demand of problems into higher ones tended to rate their curriculum knowledge higher than teachers with the enactment pattern of using low-level problems and teacher questions in their teaching. In particular, deviation from and dissatisfaction with their assigned low-quality textbooks were found to be critical factors that are associated with the enactment pattern of increasing lower cognitive demands of problems in instruction.
MacDonald, Anthony Leo
My study examines the development of forms of knowing that arise when students engage in open-ended explorations involving self-directed design and building involving simple materials. It is grounded in an enactivist theoretical perspective on cognition which holds that the creation of action-thought processes for engaging the world is interwoven with the meanings that are constructed for these experiences. A dynamic conception of persons-acting-in-a-setting is fundamental to an enactivist view of cognition. How is understanding enacted in building activity? How does the shape of a problem emerge? How do students enact meaning and understanding when they experience a high degree of physical engagement in building things? What are some characteristics of an enactive learning/teaching environment? My research settings comprise a range of individual, group and classroom engagements of varying lengths over a three and one-half year period. The first research episode involved two grade eight students in an investigation of Paper Towels. The second four month engagement was in a grade nine science class that culminated in the building of a Solar House. The third grade ten episode involved a one month project to build a Mousetrap Powered Car. A fourth Invent a Machine project was conducted in two grade eight science classes taught by the teacher who participated in the Solar House project. Two students were present in three of the four projects. I interviewed one of these students upon completion of his high school physics courses. I found that building is a form of thinking which develops competency in managing complex practical tasks. A triadic relationship of exploration, planning and acting is present. Practical and procedural understandings emerge as students enter and re-enter self-directed problem settings. Thinking patterns depend on the kinds of materials chosen, the ways they are used, and on how students contextualize the problem. Classroom assessment
Enacting representations of markets in exchange practies in the Danish potato industry
DEFF Research Database (Denmark)
Esbjerg, Lars
: The paper uses the extended case study method to integrate existing concepts and theories using empirical data from the Danish potato industry. Twenty semistructured, narrative interviews were conducted with different actors in the industry. Research findings: Analysis suggests that the representations...... various actors have constructed of the Danish market for potatoes and the different market actors share many common features, but also that there are important differences in representations between members along the marketing channel that explain why actors in the Danish potato industry have difficulties......Purpose of the paper and literature addressed: The paper explores the potential of John Shotter’s (2008) relationally-responsive version of social constructionism for studying and analysing representations of markets and how these are enacted in actual exchanges practices. Research method...
Saewyc, Elizabeth; Clark, Terryann; Barney, Lucy; Brunanski, Dana; Homma, Yuko
2014-01-01
Enacted stigma has been linked to increased HIV risk behaviours among sexual minority youth, but despite higher rates of HIV and other STIs, there is very little research with Indigenous youth. In this study, secondary analyses of three population-based, school surveys were conducted to explore the associations between HIV risk and enacted stigma among sexual minority Indigenous youth in Canada, the US, and New Zealand. Data were analyzed and interpreted with guidance from Indigenous and sexu...
Role of management devices in enacting strategy
DEFF Research Database (Denmark)
Harritz, Daniel
2016-01-01
the SSC’s creation. Originality/value - This study is the first to use a performative method to highlight the temporary and local nature of enacting strategic decisions to construct an SSC in the public sector. Keywords: Management control, SSC, strategic change, actor-network theory, organizational......Purpose - This study illustrates the role of management devices in enacting strategy and strategic decisions, resulting in the development of a Shared Service Centre (SSC) in a Danish municipality. It shows how devices interact in defending, rejecting and reframing strategy, leading to the closure...... the active role of non-human entities, such as management devices, in enacting and reformulating strategy. Findings - Different devices have become key actants in shaping and formulating the new strategy in the municipality and the strategic decision to construct a SSC. However, different devices mobilise...
An enactive and dynamical systems theory account of dyadic relationships
Directory of Open Access Journals (Sweden)
Miriam eKyselo
2014-05-01
Full Text Available Many social relationships are a locus of struggle and suffering, either at the individual or interactional level. In this paper we explore why this is the case and suggest a modeling approach for dyadic interactions and the well-being of the participants. To this end we bring together an enactive approach to self with dynamical systems theory. Our basic assumption is that the quality of any social interaction or relationship fundamentally depends on the nature and constitution of the individuals engaged in these interactions. From an enactive perspective the self is conceived as an embodied and socially enacted autonomous system striving to maintain an identity. This striving is involves a basic two-fold goal: the ability to exist as an individual in its own right, while also being open to and affected by others. In terms of dynamical systems theory one can thus consider the individual self as a self-other organized system represented by a phase space spanned by the dimensions of distinction and participation, and in which attractors can be defined. Based on two everyday examples of dyadic relationship we propose a simple model of relationship dynamics in which struggle or well-being in the dyad is analyzed in terms of movements of dyadic states that are in tension or in harmony with individually developed attractors. Our model predicts that relationships can be sustained when the dyad develops a new joint attractor towards which dyadic states tend to move, and well-being when this attractor is in balance with the individuals’ attractors. We outline how this can inspire research on psychotherapy. The psychotherapy process itself provides a setting in which participants can become aware how they fare with regards to the two-fold norm of distinction and participation and develop, through active engagement between client (or couple and therapist, strategies to co-negotiate their self-organization.
An enactive and dynamical systems theory account of dyadic relationships.
Kyselo, Miriam; Tschacher, Wolfgang
2014-01-01
Many social relationships are a locus of struggle and suffering, either at the individual or interactional level. In this paper we explore why this is the case and suggest a modeling approach for dyadic interactions and the well-being of the participants. To this end we bring together an enactive approach to self with dynamical systems theory. Our basic assumption is that the quality of any social interaction or relationship fundamentally depends on the nature and constitution of the individuals engaged in these interactions. From an enactive perspective the self is conceived as an embodied and socially enacted autonomous system striving to maintain an identity. This striving involves a basic two-fold goal: the ability to exist as an individual in one's own right, while also being open to and affected by others. In terms of dynamical systems theory one can thus consider the individual self as a self-other organized system represented by a phase space spanned by the dimensions of distinction and participation, where attractors can be defined. Based on two everyday examples of dyadic relationship we propose a simple model of relationship dynamics, in which struggle or well-being in the dyad is analyzed in terms of movements of dyadic states that are in tension or in harmony with individually developed attractors. Our model predicts that relationships can be sustained when the dyad develops a new joint attractor toward which dyadic states tend to move, and well-being when this attractor is in balance with the individuals' attractors. We outline how this can inspire research on psychotherapy. The psychotherapy process itself provides a setting that supports clients to become aware how they fare with regards to the two-fold norm of distinction and participation and develop, through active engagement between client (or couple) and therapist, strategies to co-negotiate their self-organization.
Opportunities, threats and barriers to enacting mandatory child car restraint laws in Iran.
Soori, Hamid; Ainy, Elaheh; Bazargan-Hejazi, Shahrzad
2015-01-01
Approximately one-third of Iranian children's deaths are caused by injuries. Of these, 36% result from road traffic injuries (RTIs). Both RTIs and fatalities could be reduced by using child car restraints (CCRs). Despite their demonstrated effectiveness, CCRs are not mandatory in Iran. This study was conducted to assess opportunities and barriers in enacting mandatory CCR laws in that country. Using mixed method research, a phenomenological approach was used to explore the experiences and perspectives of road safety stakeholders in regard to opportunities and threats in enacting mandatory CCR laws in Iran. The themes derived from group discussions were used to first develop a structured questionnaire, which was later distributed to and completed by study participants. The study analysis was conducted using scores and rankings from the responses to these questions. Twenty-eight stakeholders participated in the study. Most were male, aged 36.7 ± 5.6 (range 25-59). In terms of identifying the organization that should establish mandatory CCR laws, the Traffic Police Department achieved the highest score of 90 (range 0-100). The participants also thought that the Traffic Police department is responsible to monitor compliance and conduct follow-up investigations (score = 100). In regard to existing barriers in enacting CCR laws, the lack of positive Publicity by mass media and the lack of related laws received scores of 85 and 70, respectively. Enabling factors and opportunities included 'positive regards or attitude of families towards their child's health,' 'officials' commitment to support such laws' and 'having adequate resources to raise community awareness of the importance of CCR use. These received scores of 83, 69 and 68, respectively. The results suggest that cooperation and collaboration among stakeholders including the Traffic Police, families and local communities are needed to maximize the likelihood of mandating CCR laws.
From action planning and plan enactment to fruit consumption: moderated mediation effects.
Kasten, Stefanie; van Osch, Liesbeth; Eggers, Sander Matthijs; de Vries, Hein
2017-10-23
Sufficient fruit consumption is beneficial for a healthy live. While many Dutch adults intent to eat the recommended amount of fruit, only 5-10% of the population actually adheres to the recommendation. One mechanism that can help to narrow this gap between intention and actual fruit consumption is action planning. However, action planning is only assumed to be effective if plans are enacted. This study assessed which action plans are made and enacted, and further aimed to investigate two main hypotheses: 1. the effect of action planning (at T1) on fruit consumption (at T2) is mediated by plan enactment (at T3); 2. positive intentions (2a), high self-efficacy (2b) and a strong habit to eat fruit (2c) enhance the mediation of plan enactment, whereas a strong habit to eat snacks (2d) hinders the mediation of plan enactment. This study was a self-reported longitudinal online survey study. A total of 428 participants filled in a survey, measuring demographic factors (e.g. gender, age, education level), several socio-cognitive constructs (i.e. attitudes, self-efficacy, habit, action planning, plan enactment), and fruit consumption, at three points in time (baseline, after 1 month, and after 3 months). Mediation and moderated mediation analyses were used to investigate the planning-plan enactment- fruit consumption relationship. Up to 70% of the participants reported to have enacted their T1 action plans at T2. Action planning on fruit consumption was fully mediated by plan enactment (Hypothesis 1). All four proposed moderators (i.e. intention, self-efficacy, habit to consume fruit, and habit to consume snacks) significantly influenced the mediation (Hypotheses 2a-2d). Mediation of plan enactment was only present with high levels of intention, high levels of self-efficacy, strong habits to eat fruit, and weak habits to eat snacks. The study suggests the importance of plan enactment for fruit consumption. Furthermore, it emphasizes the necessity of facilitating factors
Creating One's Reality: The Interaction of Politics Perceptions and Enactment Behavior.
Frieder, Rachel E; Ma, Shuang Sara; Hochwarter, Wayne A
2016-01-01
The current study investigated the previously unexamined relationship between politics perceptions and employee enactment behavior. Consistent with previous job stress and sense-making research, we hypothesized that individuals reporting low levels of enactment behaviors would be more adversely affected by politics perceptions than those who engaged in high levels of enactment behavior. Results across two samples provided strong support for the hypothesized relationships. Specifically, employees who reported low levels of enactment behavior experienced less satisfaction, less person-environment fit, and reported lower levels of effort when faced with highly political environments. Conversely, levels of satisfaction and person-environment fit perceptions of individuals reporting high levels of enactment behaviors were largely unaffected by highly political contexts. Implications of these findings, strengths and limitations, and avenues for future research are provided.
Enact legislation supporting residential property assessed clean energy financing (PACE)
Energy Technology Data Exchange (ETDEWEB)
Saha, Devashree
2012-11-15
Congress should enact legislation that supports residential property assessed clean energy (PACE) programs in the nation’s states and metropolitan areas. Such legislation should require the Federal Housing Finance Agency (FHFA) to allow Fannie Mae and Freddie Mac to purchase residential mortgages with PACE assessments while at the same time providing responsible underwriting standards and a set of benchmarks for residential PACE assessments in order to minimize financial risks to mortgage holders. Congressional support of residential PACE financing will improve energy efficiency, encourage job creation, and foster economic growth in the nation’s state and metropolitan areas.
Enactment or performance? A non-dualist reading of Goffman
Hafermalz, Ella; Riemer, Kai; Boell, Sebastian
2016-01-01
This paper contributes to the sociomateriality research orientation with a critical examination of two concepts – enactment and performance – that have been associated with the notion of performativity. While a preference for the term enactment has been expressed in influential IS literature, we
What contributes to action plan enactment? Examining characteristics of physical activity plans.
Fleig, Lena; Gardner, Benjamin; Keller, Jan; Lippke, Sonia; Pomp, Sarah; Wiedemann, Amelie U
2017-11-01
Individuals with chronic conditions can benefit from formulating action plans to engage in regular physical activity. However, the content and the successful translation of plans into action, so-called plan enactment, are rarely adequately evaluated. The aim of this study was to describe the content of user-specified plans and to examine whether participants were more likely to enact their plans if these plans were highly specific, viable, and instrumental. The study presents secondary analyses from a larger behavioural intervention in cardiac and orthopaedic rehabilitation. The content of 619 action plans from 229 participants was evaluated by two independent raters (i.e., qualitative analyses and ratings of specificity) and by participants themselves (i.e., instrumentality and viability). Plan enactment was also measured via self-reports. Multilevel analyses examined the relationship between these plan characteristics and subsequent plan enactment, and between plan enactment and aggregated physical activity. Participants preferred to plan leisure-time physical activities anchored around time-based cues. Specificity of occasion cues (i.e., when to act) and highly instrumental plans were positively associated with plan enactment. Interestingly, individuals who planned less specific behavioural responses (i.e., what to do) were more likely to enact their plans. Plan enactment was positively associated with aggregated behaviour. Interventions should not only emphasize the importance of planning, but also the benefits of formulating specific contextual cues. Planning of the behavioural response seems to require less precision. Allowing for some flexibility in executing the anticipated target behaviour seems to aid successful plan enactment. Statement of Contribution What is already known on this subject? Action planning interventions are efficacious in promoting health behaviour. Characteristics of plan content (i.e., specificity) matter for unconditional behaviour
Reinders, A A T S; Reinders, A A T Simone; Willemsen, Antoon T M; Vos, Herry P J; den Boer, Johan A; Nijenhuis, Ellert R S
2012-01-01
Dissociative identity disorder (DID) is a disputed psychiatric disorder. Research findings and clinical observations suggest that DID involves an authentic mental disorder related to factors such as traumatization and disrupted attachment. A competing view indicates that DID is due to fantasy proneness, suggestibility, suggestion, and role-playing. Here we examine whether dissociative identity state-dependent psychobiological features in DID can be induced in high or low fantasy prone individuals by instructed and motivated role-playing, and suggestion. DID patients, high fantasy prone and low fantasy prone controls were studied in two different types of identity states (neutral and trauma-related) in an autobiographical memory script-driven (neutral or trauma-related) imagery paradigm. The controls were instructed to enact the two DID identity states. Twenty-nine subjects participated in the study: 11 patients with DID, 10 high fantasy prone DID simulating controls, and 8 low fantasy prone DID simulating controls. Autonomic and subjective reactions were obtained. Differences in psychophysiological and neural activation patterns were found between the DID patients and both high and low fantasy prone controls. That is, the identity states in DID were not convincingly enacted by DID simulating controls. Thus, important differences regarding regional cerebral bloodflow and psychophysiological responses for different types of identity states in patients with DID were upheld after controlling for DID simulation. The findings are at odds with the idea that differences among different types of dissociative identity states in DID can be explained by high fantasy proneness, motivated role-enactment, and suggestion. They indicate that DID does not have a sociocultural (e.g., iatrogenic) origin.
Energy Technology Data Exchange (ETDEWEB)
Lunis, B.C.; Toth, W.J. (comps.)
1982-05-01
The activities and findings of the seven state commercialization teams participating in the Rocky Mountain Basin and Range commercialization program are described. For each state (Colorado, Montana, New Mexico, North and South Dakota, Utah, and Wyoming), prospect identification, area development plans, site specific development analyses, time-phased project plans, the aggregated prospective geothermal energy use, and institutional analyses are discussed. Public outreach activities are also covered, and findings and recommendations are given for each state. Some background information about the program is provided. (LEW)
African Journals Online (AJOL)
User
to arrest customers comprised unfair and discriminatory practices”. ... Even in French feminist theatre of 1870 -1914, Doestoevsky's fiction and Malaysian and ..... called “sex workers”) are compelled to pay tax to the government on their income. .... When a politician sells out his principles, or simply throws them to the wind to.
Teachers' selection and enactment of mathematical problems from textbooks
Son, Ji-Won; Kim, Ok-Kyeong
2015-12-01
In order to investigate how teachers' use of textbooks creates different kinds of opportunities for student learning, this study focused on teachers' selection and enactment of problems and tasks from the textbooks and their influence on the cognitive demand placed on students. By drawing on data from three elementary teachers in the USA, two of which used a reform-oriented textbook— Math Trailblazers and one a commercially developed textbook—this study examined kinds of problems the teachers chose and ways in which they enacted those problems in relation to the cognitive demand of the problems. In particular, we attended to the kinds of questions the teachers asked in enacting the problems and ways in which those questions influenced the cognitive demand of the textbook problems. This study also identified critical issues involved in teacher decision-making on task selection and enactment, such as the match between teachers' goals and those of the textbooks, and teachers' perception of textbook problems. Based on the results of the study, we discuss implications for teacher education and professional development.
Reconciling the Historical and the Contemporary in Liturgical Enactment
DEFF Research Database (Denmark)
Petersen, Nils Holger
2016-01-01
A discussion of the problems and potential insights from reconstructing and modern re-enactments of medieval liturgical ceremonies. The author was a member of an International Research Group invited as discussants within a UK Research Council funded project "Experience of Worship in Late Medieval...... Cathedral and Parish Church" and in this article reflects theoretically on the practical re-enactment of medieval worship, historiographically as well as through modern theory of performativity.......A discussion of the problems and potential insights from reconstructing and modern re-enactments of medieval liturgical ceremonies. The author was a member of an International Research Group invited as discussants within a UK Research Council funded project "Experience of Worship in Late Medieval...
Liu, Cheng-Ji; Li, Zhi-Hui; Bai, Chen-Ming; Si, Meng-Meng
2018-02-01
The concept of judgment space was proposed by Wang et al. (Phys. Rev. A 95, 022320, 2017), which was used to study some important properties of quantum entangled states based on local distinguishability. In this study, we construct 15 kinds of seven-qudit quantum entangled states in the sense of permutation, calculate their judgment space and propose a distinguishability rule to make the judgment space more clearly. Based on this rule, we study the local distinguishability of the 15 kinds of seven-qudit quantum entangled states and then propose a ( k, n) threshold quantum secret sharing scheme. Finally, we analyze the security of the scheme.
Directory of Open Access Journals (Sweden)
A A T S Reinders
Full Text Available BACKGROUND: Dissociative identity disorder (DID is a disputed psychiatric disorder. Research findings and clinical observations suggest that DID involves an authentic mental disorder related to factors such as traumatization and disrupted attachment. A competing view indicates that DID is due to fantasy proneness, suggestibility, suggestion, and role-playing. Here we examine whether dissociative identity state-dependent psychobiological features in DID can be induced in high or low fantasy prone individuals by instructed and motivated role-playing, and suggestion. METHODOLOGY/PRINCIPAL FINDINGS: DID patients, high fantasy prone and low fantasy prone controls were studied in two different types of identity states (neutral and trauma-related in an autobiographical memory script-driven (neutral or trauma-related imagery paradigm. The controls were instructed to enact the two DID identity states. Twenty-nine subjects participated in the study: 11 patients with DID, 10 high fantasy prone DID simulating controls, and 8 low fantasy prone DID simulating controls. Autonomic and subjective reactions were obtained. Differences in psychophysiological and neural activation patterns were found between the DID patients and both high and low fantasy prone controls. That is, the identity states in DID were not convincingly enacted by DID simulating controls. Thus, important differences regarding regional cerebral bloodflow and psychophysiological responses for different types of identity states in patients with DID were upheld after controlling for DID simulation. CONCLUSIONS/SIGNIFICANCE: The findings are at odds with the idea that differences among different types of dissociative identity states in DID can be explained by high fantasy proneness, motivated role-enactment, and suggestion. They indicate that DID does not have a sociocultural (e.g., iatrogenic origin.
Fact or Factitious? A Psychobiological Study of Authentic and Simulated Dissociative Identity States
Simone Reinders, A. A. T.; Willemsen, Antoon T. M.; Vos, Herry P. J.; den Boer, Johan A.; Nijenhuis, Ellert R. S.
2012-01-01
Background Dissociative identity disorder (DID) is a disputed psychiatric disorder. Research findings and clinical observations suggest that DID involves an authentic mental disorder related to factors such as traumatization and disrupted attachment. A competing view indicates that DID is due to fantasy proneness, suggestibility, suggestion, and role-playing. Here we examine whether dissociative identity state-dependent psychobiological features in DID can be induced in high or low fantasy prone individuals by instructed and motivated role-playing, and suggestion. Methodology/Principal Findings DID patients, high fantasy prone and low fantasy prone controls were studied in two different types of identity states (neutral and trauma-related) in an autobiographical memory script-driven (neutral or trauma-related) imagery paradigm. The controls were instructed to enact the two DID identity states. Twenty-nine subjects participated in the study: 11 patients with DID, 10 high fantasy prone DID simulating controls, and 8 low fantasy prone DID simulating controls. Autonomic and subjective reactions were obtained. Differences in psychophysiological and neural activation patterns were found between the DID patients and both high and low fantasy prone controls. That is, the identity states in DID were not convincingly enacted by DID simulating controls. Thus, important differences regarding regional cerebral bloodflow and psychophysiological responses for different types of identity states in patients with DID were upheld after controlling for DID simulation. Conclusions/Significance The findings are at odds with the idea that differences among different types of dissociative identity states in DID can be explained by high fantasy proneness, motivated role-enactment, and suggestion. They indicate that DID does not have a sociocultural (e.g., iatrogenic) origin. PMID:22768068
International Nuclear Information System (INIS)
1994-01-01
This report is a summary of an analysis of recently enacted national energy legislation and the Clean Air Act Amendments of 1990 as related to Decontamination and Decommissioning (D ampersand D) at Federal, State and private facilities. It is submitted pursuant to Appendix A of subcontract 9-X62-0785E-1, dated July 27, 1992, between the Regents of the University of California and Van Ness, Feldman ampersand Curtis
Carnivalesque Enactment at the Children's Medical Centre of Rabin Hospital.
Lev-Aladgem, Shulamith
2000-01-01
Describes the basic characteristics of the "carnivalesque enactment" and its therapeutic potential. Explains a case study of the drama project at the Rabin Children's Medical Centre, how the carnivalesque enactment was developed step by step, and the kind of effect it stimulated among the children. Suggests new theatrical experiments with…
Enacting Informal Science Learning: Exploring the Battle for Informal Learning
Clapham, Andrew
2016-01-01
Informal Science Learning (ISL) is a policy narrative of interest in the United Kingdom and abroad. This paper explores how a group of English secondary school science teachers, enacted ISL science clubs through employing the Periodic Table of Videos. It examines how these teachers "battled" to enact ISL policy in performative conditions…
Stories from the Heart: Narratives of Change in Therapeutic Enactment
Black, Timothy G.
2009-01-01
Research was conducted on the experience of change for participants in a group-based psychotherapy approach called Therapeutic Enactment (TE), which involves the enactment of embodied narratives of participants' past experiences. This study asked the question, "What is your story of change in TE?" The author conducted in-depth interviews with five…
Toward an expansion of an enactive ethics with the help of care ethics
Urban, Petr
2014-01-01
The paper argues that recent developments in the enactive approach to social phenomena call for further expansion of an enactive ethics beyond its initial focus on face-to- face dyadic interactions. The main aim is to draw attention to the so far under- appreciated kinship between an enactive ethics and the ethics of care.
Sexual and gender prejudice among adolescents and enacted stigma at school
Collier, K.L.
2014-01-01
Sexual and gender prejudice refer, respectively, to negative attitudes based on sexual orientation or gender identity or expression; enacted stigma is the behavioral expression of such attitudes. This thesis explored the possible antecedents and outcomes of enacted sexual and gender stigma in
Local enactments of national health promotion policies
DEFF Research Database (Denmark)
Wimmelmann, Camilla Lawaetz
2017-01-01
organisational levels. Visiting, observing and interviewing 15 policy workers from 10 municipalities during a two-year period, this study investigated what happened to a Danish national health promotion policy as it was put into practice and managed in the Danish municipalities. The analysis reveals...... the concrete enactments and their locally experienced effects, our understanding of national public health policies risks becoming detached from praxis and unproductive. Public health policy-makers must pay methodological and analytical attention to the policies' multimodality and their concrete locally......Governments of welfare states are firmly committed to public health, resulting in a substantial number of public health policies. Given the multi-level structure of most welfare systems, the influence of a public health policy is related to its ability to spread geographically and move across...
Field station as stage: Re-enacting scientific work and life in Amani, Tanzania.
Geissler, P Wenzel; Kelly, Ann H
2016-12-01
Located high in Tanzania's Usambara Mountains, Amani Hill Station has been a site of progressive scientific endeavours for over a century, pushing the boundaries of botanical, zoological and medical knowledge, and providing expertise for imperial expansion, colonial welfare, national progress and international development efforts. The station's heyday was from the 1950s to the 1970s, a period of global disease eradication campaigns and the 'Africanization' of science. Today, Amani lies in a state of suspended motion. Officially part of a national network of medical research stations, its buildings and vegetation are only minimally maintained, and although some staff report for duty, scientific work has ceased. Neither ruin nor time capsule, Amani has become a quiet site of remains and material traces. This article examines the methodological potentials of re-enactment - on-site performances of past research practices - to engage ethnographically with the distinct temporalities and affective registers of life at the station. The heuristic power of re-enactment resides in its anachronicity, the tensions it introduces between immediacy and theatricality, authenticity and artifice, fidelity and futility. We suggest that re-enacting early post-colonial science as events unfolding in the present disrupts straightforward narratives about the promises and shortfalls of scientific progress, raising provocative questions about the sentiments and stakes of research in 'the tropics'.
Enacting Green Consumers: The Case of the Scandinavian Preppies
Directory of Open Access Journals (Sweden)
Christian Fuentes
2014-10-01
Full Text Available The aim of this paper is to develop and illustrate an analytic approach that brings the active making and makings of green consumer images to the fore. Efforts to "know" the green consumers have generated multiple representations. Enactments of the green consumer are not innocent but also play a role in shaping how we understand and approach sustainable consumption. Because of this it is important to examine and critically discuss how green consumers are enacted today. This paper develops an approach that allows us to examine how green consumers are enacted and discuss the consequences these constructions might have for sustainability. Theoretically, a performativity approach drawing on theories from Science and Technology Studies (STS and economic sociology is used to discuss the enactment of green consumers. Empirically, focus is on Boomerang � a Swedish fashion retailer, brand, and producer � and its marketing practices. The analysis shows how the marketing work of the Boomerang Company leads to the enactment of the Green Scandinavian Preppy. This specific version of the green consumer is a combination of the knowledgeable green connoisseur - a consumer that knows quality when he/she sees it - and the green hedonist in search of the good life. The Green Scandinavian Preppy wants to enjoy nature, go sailing, and do so wearing fashionable quality clothes. This is a consumer that knows quality, appreciates design, and has the means to pay for both. While this is a version of the green consumer that might be appealing and thus have the potential to pro-mote a version of green consumption, it is also a green consumer image that has lost much of its political power as green consumption is framed as simply another source of pleasure and identity-making.
Teaching (Un)Connected Mathematics: Two Teachers' Enactment of the Pizza Problem
Hill, Heather C.; Charalambous, Charalambos Y.
2012-01-01
This paper documents the ways mathematical knowledge for teaching (MKT) and curriculum materials appear to contribute to the enactment of a 7th grade "Connected Mathematics Project" lesson on comparing ratios. Two teachers with widely differing MKT scores are compared teaching this lesson. The comparison of the teachers' lesson enactments suggests…
DEFF Research Database (Denmark)
Lippert, Ingmar
2013-01-01
Enacting Environments is an ethnography of the midst of the encounter between corporations, sustainable development and climate change. At this intersection 'environmental management' and 'carbon accounting' are put into practice. Purportedly, these practices green capitalism. Drawing on fieldwork...... of day-to-day practices of corporate environmental accountants and managers, Ingmar Lippert reconstructs their work as achieving to produce a reality of environment that is simultaneously stable and flexible enough for a particular corporate project: to stage the company, and in consequence capitalism......, as in control over its relations to an antecedent environment. Not confined to mere texts or meetings between shiny stakeholders co-governing the corporation – among them some of the world's biggest auditing firms, an environmental non-governmental organisation (NGO) and standards – control is found...
The effects of enactment and intention accessibility on prospective memory performance.
Schult, Janette C; Steffens, Melanie C
2017-05-01
The intention-superiority effect denotes faster response latencies to stimuli linked with a prospective memory task compared to stimuli linked with no prospective task or with a cancelled task. It is generally assumed that the increased accessibility of intention-related materials contributes to successful execution of prospective memory tasks at an appropriate opportunity. In two experiments we investigated the relationship between the intention-superiority effect and actual prospective memory performance under relatively realistic conditions. We also manipulated enactment versus observation encoding to further investigate the similarity in representations of enacted and to-be-enacted tasks. Additionally, Experiment 1 included a control condition to investigate the development of the intention-superiority effect over time. Participants were asked to perform prospective tasks at the end of the experiment to prepare the room for the next participant. They studied these preparatory tasks at the beginning of the experiment either by enacting them themselves or by observing the experimenter perform them. In Experiment 2, participants in a control condition did not intend to perform prospective tasks. We observed a smaller intention-superiority effect after enactment encoding than after observation encoding, but only if response latencies were assessed immediately before the prospective memory task. In addition, Experiment 2 suggested that the size of the intention-superiority effect is related to successful prospective memory performance, thus providing evidence for a functional relationship between accessibility and memory.
The impact of the US Clean Air Act - seven years after enactment
Energy Technology Data Exchange (ETDEWEB)
Aloe, A.; Ailor, D.
2000-07-01
The United States Clean Air Act Amendments of 1990 (CAAA) have added operating expenses, renewed interest in coke battery repair techniques, played a role in new battery technology choices and spurred investigation into non-traditional coke making technologies. United States coke producers have demonstrated compliance with the new standards. The ultimate impact of the CAAA requirements will be known as aging coke batteries in the United States are shut down. At that point the demand for coke coupled with the CAAA requirements will determine if new batteries are built, and if so, what technology will be used. 7 refs., 4 figs., 2 tabs.
Dream-Enacting Behaviors in a Normal Population
Nielsen, Tore; Svob, Connie; Kuiken, Don
2009-01-01
Study Objectives: Determine the prevalence and gender distributions of behaviors enacted during dreaming (“dream-enacting [DE] behaviors”) in a normal population; the independence of such behaviors from other parasomnias; and the influence of different question wordings, socially desirable responding and personality on prevalence. Design: 3-group questionnaire study Setting: University classrooms Participants: Three undergraduate samples (Ns = 443, 201, 496; mean ages = 19.9 ± 3.2 y; 20.1 ± 3.4 y; 19.1 ± 1.6 y) Interventions: N/A Measurements and Results: Subjects completed questionnaires about DE behaviors and Social Desirability. Study 1 employed a nonspecific question about the behaviors, Study 2 employed the same question with examples, and Study 3 employed 7 questions describing specific behavior subtypes (speaking, crying, smiling/laughing, fear, anger, movement, sexual arousal). Somnambulism, somniloquy, nightmares, dream recall, alexithymia, and absorption were also assessed. Factor analyses were conducted to determine relationships among DE behaviors and their independence from other parasomnias. Prevalence increased with increasing question specificity (35.9%, 76.7%, and 98.2% for the 3 samples). No gender difference obtained for the nonspecific question, but robust differences occurred for more specific questions. Females reported more speaking, crying, fear and smiling/laughing than did males; males reported more sexual arousal. When controlling other parasomnias and dream recall frequency, these differences persisted. Factor solutions revealed that DE behaviors were independent of other parasomnias and of dream recall frequency, except for an association between dream-talking and somniloquy. Sexual arousal was related only to age. Behaviors were independent of alexithymia but moderately related to absorption. Conclusions: Dream-enacting behaviors are prevalent in healthy subjects and sensitive to question wording but not social desirability
Groenewold, Rimke; Armstrong, Elizabeth
2018-05-14
Previous research has shown that speakers with aphasia rely on enactment more often than non-brain-damaged language users. Several studies have been conducted to explain this observed increase, demonstrating that spoken language containing enactment is easier to produce and is more engaging to the conversation partner. This paper describes the effects of the occurrence of enactment in casual conversation involving individuals with aphasia on its level of conversational assertiveness. To evaluate whether and to what extent the occurrence of enactment in speech of individuals with aphasia contributes to its conversational assertiveness. Conversations between a speaker with aphasia and his wife (drawn from AphasiaBank) were analysed in several steps. First, the transcripts were divided into moves, and all moves were coded according to the systemic functional linguistics (SFL) framework. Next, all moves were labelled in terms of their level of conversational assertiveness, as defined in the previous literature. Finally, all enactments were identified and their level of conversational assertiveness was compared with that of non-enactments. Throughout their conversations, the non-brain-damaged speaker was more assertive than the speaker with aphasia. However, the speaker with aphasia produced more enactments than the non-brain-damaged speaker. The moves of the speaker with aphasia containing enactment were more assertive than those without enactment. The use of enactment in the conversations under study positively affected the level of conversational assertiveness of the speaker with aphasia, a competence that is important for speakers with aphasia because it contributes to their floor time, chances to be heard seriously and degree of control over the conversation topic. © 2018 The Authors International Journal of Language & Communication Disorders published by John Wiley & Sons Ltd on behalf of Royal College of Speech and Language Therapists.
Directory of Open Access Journals (Sweden)
Ilze Bogdanovica
Full Text Available BACKGROUND: Smoking prevention should be a primary public health priority for all governments, and effective preventive policies have been identified for decades. The heterogeneity of smoking prevalence between European Union (EU Member States therefore reflects, at least in part, a failure by governments to prioritise public health over tobacco industry or possibly other financial interests, and hence potentially government corruption. The aims of this study were to test the hypothesis that smoking prevalence is higher in countries with high levels of public sector corruption, and explore the ecological association between smoking prevalence and a range of other national characteristics in current EU Member States. METHODS: Ecological data from 27 EU Member States were used to estimate univariate and multivariate correlations between smoking prevalence and the Transparency International Corruption Perceptions Index, and a range of other national characteristics including economic development, social inclusion, quality of life and importance of religion. We also explored the association between the Corruption Perceptions Index and measures of the extent to which smoke-free policies have been enacted and are enforced. RESULTS: In univariate analysis, smoking prevalence was significantly higher in countries with higher scores for corruption, material deprivation, and gender inequality; and lower in countries with higher per capita Gross Domestic Product, social spending, life satisfaction and human development scores. In multivariate analysis, only the corruption perception index was independently related to smoking prevalence. Exposure to tobacco smoke in the workplace was also correlated with corruption, independently from smoking prevalence, but not with the measures of national smoke-free policy implementation. CONCLUSIONS: Corruption appears to be an important risk factor for failure of national tobacco control activity in EU countries, and
Bogdanovica, Ilze; McNeill, Ann; Murray, Rachael; Britton, John
2011-01-01
Background Smoking prevention should be a primary public health priority for all governments, and effective preventive policies have been identified for decades. The heterogeneity of smoking prevalence between European Union (EU) Member States therefore reflects, at least in part, a failure by governments to prioritise public health over tobacco industry or possibly other financial interests, and hence potentially government corruption. The aims of this study were to test the hypothesis that smoking prevalence is higher in countries with high levels of public sector corruption, and explore the ecological association between smoking prevalence and a range of other national characteristics in current EU Member States. Methods Ecological data from 27 EU Member States were used to estimate univariate and multivariate correlations between smoking prevalence and the Transparency International Corruption Perceptions Index, and a range of other national characteristics including economic development, social inclusion, quality of life and importance of religion. We also explored the association between the Corruption Perceptions Index and measures of the extent to which smoke-free policies have been enacted and are enforced. Results In univariate analysis, smoking prevalence was significantly higher in countries with higher scores for corruption, material deprivation, and gender inequality; and lower in countries with higher per capita Gross Domestic Product, social spending, life satisfaction and human development scores. In multivariate analysis, only the corruption perception index was independently related to smoking prevalence. Exposure to tobacco smoke in the workplace was also correlated with corruption, independently from smoking prevalence, but not with the measures of national smoke-free policy implementation. Conclusions Corruption appears to be an important risk factor for failure of national tobacco control activity in EU countries, and the extent to which key
Nightmare-Enacting Behavior Responding to Zonisamide in Early Parkinson’s Disease
Directory of Open Access Journals (Sweden)
Hiroshi Kataoka
2012-01-01
Full Text Available Recently, zonisamide (ZNS has been approved as a new adjunctive therapy for motor complications of Parkinson’s disease (PD. More recently, ZNS was reported to be effective for the management of impulse control behavior in PD, suggesting potential effects on non-motor PD symptoms. Dream enactment associated with aggressive, violent behavior can carry a serious risk of injury to patients, as well as to spouses or caretakers. This report describes a patient with PD who had vivid nightmares and dream-enacting behavior that resolved after treatment with ZNS. The present case raises the question whether ZNS might potentially be effective for the management of vivid nightmares or dream-enacting behavior.
Enacting and Transforming Local Language Policies
Tardy, Christine M.
2011-01-01
Exploring language practices, beliefs, and management in a first-year writing program, this article considers the obstacles to and opportunities for transforming language policy and enacting a new multilingual norm in U.S. postsecondary writing instruction. It argues that the articulation of statements regarding language diversity, co-developed by…
Enacted identities in the university spin-off process - bridging an imaginative gap
DEFF Research Database (Denmark)
Hannibal, Martin
2017-01-01
This paper employs a case study to explore the interdependencies between enacted role identities and behavioural logics of eight inventor-founders embedded in university spin-off venturing. The major tendencies in the findings suggest that the inventor-founders enact their academic role identity ...
Enacting the Role of Special Needs Educator--Six Swedish Case Studies
Klang, Nina; Gustafson, Katarina; Möllås, Gunvie; Nilholm, Claes; Göransson, Kerstin
2017-01-01
With the increasing focus on inclusion, special needs educators (SNEs) are now expected to share responsibility for pupils with teacher colleagues and to lead school development, but it is a challenge to enact this role in schools. The aim of the study was to explore how professional roles of Swedish SNEs are enacted in local school contexts. From…
Social change and traditional gender roles in Lagos State, Nigeria ...
African Journals Online (AJOL)
Social change and traditional gender roles in Lagos State, Nigeria. ... twenty seven respondents consisted of 135 Females (59.5%) and 92 Males (40.5%) participated in the survey. The study adopted descriptive method of research design.
Sex Educators and Self-Efficacy: Toward a Taxonomy of Enactive Mastery Experiences
Jensen, Robin E.
2012-01-01
Enactive mastery experiences have been identified as the most influential source of self-efficacy beliefs. Yet little is known about enactive mastery experiences, including how such experiences manifest in naturally occurring situations (as opposed to simulated situations). This study draws from semistructured interviews (N = 50) with sex…
Shaping accountabilities for erroneously enacted environmental evidence
DEFF Research Database (Denmark)
Lippert, Ingmar
of accountability: first, the company was performing itself as a socially and environmentally accountable and responsible "corporate citizen"; second, the company was inhabiting a discourse of evidence-based decision-making, requiring the evidence to be produced accountably. I analyse a limited set of ethnographic......Drawing on fieldwork in and around a transnational Fortune 50 company's "corporate social responsibility" unit, this paper opens up a range of situations that took part in enacting the company's evidence of its impact on global warming. This evidence was implicated in at least two significant modes...... vignettes of situated work practice that (con)figured the company's accounting for their carbon emissions. Common to all these situations was that the environmental realities enacted have been categorised by some members as erroneous or as not good enough. In this paper I am interested, thence...
Karaoğlu, Pakize; Polat, Ayşe İpek; Yiş, Uluç; Hız, Semra
2015-01-01
Brain injuries occurring at a particular time may cause damages in well-defined regions of brain. Perinatal hypoxic ischemic encephalopathy and hypoglycemia are some of the most common types of brain injuries. Neonatal hypoglycemia can cause abnormal myelination in parietal and occipital lobes resulting in parieto-occipital encephalomalacia. There is a small number of studies about clinical and electroencephalographic (EEG) features of children with parieto-occipital encephalomalacia. They might have important neurologic sequelae such as cortical visual loss, seizures, and psychomotor retardation. We aimed to evaluate the causes of parieto-occipital encephalomalacia and evaluate the clinical and electrophysiological features of children with parieto-occipital encephalomalacia. We evaluated clinical features and EEGs of 27 children with parieto-occipital encephalomalacia. Descriptive statistics were used. Hospitalization during the neonatal period was the most common cause (88.9%) of parieto-occipital brain injury. Eleven patients (40.7%) had a history of neonatal hypoglycemia. Twenty-three patients (85.2%) had epilepsy and nine of the epileptic patients (39%) had refractory seizures. Most of the patients had bilateral (50%) epileptic discharges originating from temporal, parietal, and occipital lobes (56.2%). However, some patients had frontal sharp waves and some had continuous spike and wave discharges during sleep. Visual abnormalities were evident in 15 (55.6%) patients. Twenty-two (81.5%) had psychomotor retardation. Fine motor skills, social contact and language development were impaired more than gross motor skills. In our study, most of the patients with parieto-occipital encephalomalacia had an eventful perinatal history. Epilepsy, psychomotor retardation, and visual problems were common neurologic complications.
Energy Technology Data Exchange (ETDEWEB)
Lunis, B. C.; Toth, W. J. [comps.
1981-10-01
The activities and findings of the seven state commercialization teams participating in the Rocky Mountain Basin and Range commercialization program are described. Background information is provided; program objectives and the technical approach that is used are discussed; and the benefits of the program are described. The summary of findings is presented. Prospect identification, area development plans, site specific development analyses, time-phased project plans, the aggregated prospective geothermal energy use, and institutional analyses are discussed. Public outreach activities are covered and findings and recommendations are summarized. The commercialization activities carried out by the respective state teams are described for the following: Colorado, Montana, New Mexico, North Dakota, South Dakota, Utah, and Wyoming.
Role enactment of facilitation in primary care
DEFF Research Database (Denmark)
Due, Tina Drud; Thorsen, Thorkil; Waldorff, Frans Boch
2017-01-01
facilitation visits in 13 practice settings and had interviews and focus groups with facilitators. We applied an explorative approach in data collection and analysis, and conducted an inductive thematic analysis. RESULTS: The facilitators mainly enacted four facilitator roles: teacher, super user, peer...
Role enactment of facilitation in primary care
DEFF Research Database (Denmark)
Due, Tina Drud; Thorsen, Thorkil; Waldorff, Frans Boch
2017-01-01
facilitation visits in 13 practice settings and had interviews and focus groups with facilitators. We applied an explorative approach in data collection and analysis, and conducted an inductive thematic analysis. Results: The facilitators mainly enacted four facilitator roles: teacher, super user, peer...
International Nuclear Information System (INIS)
Levine, S.H.; Totenbier, R.E.
1984-07-01
The twenty-ninth annual progress report of the operation of the Pennsylvania State University Breazeale Reactor is submitted in accordance with the requirements of Contract DE-AC02-76ER03409 with the United States Department of Energy. This report also provides the University administration with a summary of the operation of the facility for the past year
Enacting Environments: An Ethnography of the Digitalisation and Naturalisation of Emissions
Lippert, Ingmar
2013-01-01
Capitalism manages to enact environments in the midst of its centres by means of keeping other environments out. The fundamental practice which allows for this contradictory and generative move is that capitalist agents enact environments. Capitalism does not require a clear, neat, distinct, singular environment. Multiple, fluid, dynamic environments allow far better the tactical and strategical project of staging capitalism as having its destructive environmental impacts in control. That con...
Factors associated with the enactment of safety belt and motorcycle helmet laws.
Law, Teik Hua; Noland, Robert B; Evans, Andrew W
2013-07-01
It has been shown that road safety laws, such as motorcycle helmet and safety belt laws, have a significant effect in reducing road fatalities. Although an expanding body of literature has documented the effects of these laws on road safety, it remains unclear which factors influence the likelihood that these laws are enacted. This study attempts to identify the factors that influence the decision to enact safety belt and motorcycle helmet laws. Using panel data from 31 countries between 1963 and 2002, our results reveal that increased democracy, education level, per capita income, political stability, and more equitable income distribution within a country are associated with the enactment of road safety laws. © 2012 Society for Risk Analysis.
Valuing Errors for Learning: Espouse or Enact?
Grohnert, Therese; Meuwissen, Roger H. G.; Gijselaers, Wim H.
2017-01-01
Purpose: This study aims to investigate how organisations can discourage covering up and instead encourage learning from errors through a supportive learning from error climate. In explaining professionals' learning from error behaviour, this study distinguishes between espoused (verbally expressed) and enacted (behaviourally expressed) values…
Energy Technology Data Exchange (ETDEWEB)
Lunis, B.C. (ed.)
1982-08-01
The activities and findings of the seven state commercialization teams participating in the Rocky Mountain Basin and Range commercialization program are described. The period covered is July through December 1981. Background information is provided, program objectives and the technical approach used are discussed, and the benefits of the program are described. Prospect identification, area development plans, site specific development analyses, time-phased project plans, the aggregated prospective geothermal energy use, and institutional analyses are discussed. Public outreach activities are covered and findings and recommendations are summarized.
Is prospective memory enhanced by cue-action semantic relatedness and enactment at encoding?
Pereira, Antonina; Ellis, Judi; Freeman, Jayne
2012-09-01
Benefits and costs on prospective memory performance, of enactment at encoding and a semantic association between a cue-action word pair, were investigated in two experiments. Findings revealed superior performance for both younger and older adults following enactment, in contrast to verbal encoding, and when cue-action semantic relatedness was high. Although younger adults outperformed older adults, age did not moderate benefits of cue-action relatedness or enactment. Findings from a second experiment revealed that the inclusion of an instruction to perform a prospective memory task led to increments in response latency to items from the ongoing activity in which that task was embedded, relative to latencies when the ongoing task only was performed. However, this task interference 'cost' did not differ as a function of either cue-action relatedness or enactment. We argue that the high number of cue-action pairs employed here influenced meta-cognitive consciousness, hence determining attention allocation, in all experimental conditions. Copyright © 2012 Elsevier Inc. All rights reserved.
Freaky: Collaborative Enactments of Emotion
DEFF Research Database (Denmark)
Leahu, Lucian; Sengers, Phoebe
2015-01-01
The field of CSCW is increasingly drawing on theories and approaches from feminist philosophy of science. To date such efforts have focused on understanding users and their practices. We present a research prototype showing that feminist theories can lead to novel design solutions. Freaky is a mo...... is a mobile, interactive system that collaborates with its users in the enactment of emotion. Informed by the feminist literature, the system introduces a novel approach to emotion: designing for human-machine co-production of emotion....
A Comparison Between Reported and Enacted Pedagogical Content Knowledge (PCK) About Graphs of Motion
Mazibe, Ernest N.; Coetzee, Corene; Gaigher, Estelle
2018-04-01
This paper reports a case study of four grade 10 physical sciences teachers' PCK about graphs of motion. We used three data collection strategies, namely teachers' written accounts, captured by the content representation (CoRe) tool, interviews and classroom observations. We conceptualised the PCK displayed in the CoRe tool and the interviews as reported PCK and the PCK demonstrated during teaching as enacted PCK. These two manifestations of PCK were compared to establish the extent of agreement between reported and enacted PCK. We adopted the topic-specific PCK (TSPCK) model as the framework that guided this study. This model describes TSPCK in terms of five components of teacher knowledge. Guided by the model, we designed two rubrics to assess these manifestations of TSPCK on a four-point scale. The results of this study indicated that the reported PCK was not necessarily a reflection of the PCK enacted during teaching. The levels of PCK in the components were seldom higher in the enacted PCK, but tended to be similar or lower than in the reported PCK. The study implies that the enactment of PCK should be emphasised in teacher education.
eSPEM - A SPEM Extension for Enactable Behavior Modeling
Ellner, Ralf; Al-Hilank, Samir; Drexler, Johannes; Jung, Martin; Kips, Detlef; Philippsen, Michael
OMG's SPEM - by means of its (semi-)formal notation - allows for a detailed description of development processes and methodologies, but can only be used for a rather coarse description of their behavior. Concepts for a more fine-grained behavior model are considered out of scope of the SPEM standard and have to be provided by other standards like BPDM/BPMN or UML. However, a coarse granularity of the behavior model often impedes a computer-aided enactment of a process model. Therefore, in this paper we present eSPEM, an extension of SPEM, that is based on the UML meta-model and focused on fine-grained behavior and life-cycle modeling and thereby supports automated enactment of development processes.
Critical Ontology for an Enactive Music Pedagogy
van der Schyff, Dylan; Schiavio, Andrea; Elliott, David J.
2016-01-01
An enactive approach to music education is explored through the lens of critical ontology. Assumptions central to Western academic music culture are critically discussed; and the concept of "ontological education" is introduced as an alternative framework. We argue that this orientation embraces more primordial ways of knowing and being,…
Twenty lectures on thermodynamics
Buchdahl, H A
2013-01-01
Twenty Lectures on Thermodynamics is a course of lectures, parts of which the author has given various times over the last few years. The book gives the readers a bird's eye view of phenomenological and statistical thermodynamics. The book covers many areas in thermodynamics such as states and transition; adiabatic isolation; irreversibility; the first, second, third and Zeroth laws of thermodynamics; entropy and entropy law; the idea of the application of thermodynamics; pseudo-states; the quantum-static al canonical and grand canonical ensembles; and semi-classical gaseous systems. The text
Amylase production under solid state fermentation by a bacterial ...
African Journals Online (AJOL)
This study was concerned with the screening of a suitable isolate and optimization of cultural conditions for the biosynthesis of thermostable amylase under solid state fermentation (SSF). Twenty seven isolates were screened for amylase production out of which one isolate designated as W74 showed maximal amylase ...
Jelić, Andrea; Tieri, Gaetano; De Matteis, Federico; Babiloni, Fabio; Vecchiato, Giovanni
2016-01-01
Over the last few years, the efforts to reveal through neuroscientific lens the relations between the mind, body, and built environment have set a promising direction of using neuroscience for architecture. However, little has been achieved thus far in developing a systematic account that could be employed for interpreting current results and providing a consistent framework for subsequent scientific experimentation. In this context, the enactive perspective is proposed as a guide to studying architectural experience for two key reasons. Firstly, the enactive approach is specifically selected for its capacity to account for the profound connectedness of the organism and the world in an active and dynamic relationship, which is primarily shaped by the features of the body. Thus, particular emphasis is placed on the issues of embodiment and motivational factors as underlying constituents of the body-architecture interactions. Moreover, enactive understanding of the relational coupling between body schema and affordances of architectural spaces singles out the two-way bodily communication between architecture and its inhabitants, which can be also explored in immersive virtual reality settings. Secondly, enactivism has a strong foothold in phenomenological thinking that corresponds to the existing phenomenological discourse in architectural theory and qualitative design approaches. In this way, the enactive approach acknowledges the available common ground between neuroscience and architecture and thus allows a more accurate definition of investigative goals. Accordingly, the outlined model of architectural subject in enactive terms-that is, a model of a human being as embodied, enactive, and situated agent, is proposed as a basis of neuroscientific and phenomenological interpretation of architectural experience.
Enacted Types of Algebraic Activity in Different Classes Taught by the Same Teacher
Eisenmann, Tammy; Even, Ruhama
2011-01-01
The aim of this study was to examine how teachers enact the same written algebra curriculum materials in different classes. The study addresses this issue by comparing the types of algebraic activity (Kieran, 2004) enacted in two 7th grade classes taught by the same teacher, using the same textbook. Data sources include lesson observations and an…
A New Quantum Proxy Multi-signature Scheme Using Maximally Entangled Seven-Qubit States
Cao, Hai-Jing; Zhang, Jia-Fu; Liu, Jian; Li, Zeng-You
2016-02-01
In this paper, we propose a new secure quantum proxy multi-signature scheme using seven-qubit entangled quantum state as quantum channels, which may have applications in e-payment system, e-government, e-business, etc. This scheme is based on controlled quantum teleportation. The scheme uses the physical characteristics of quantum mechanics to guarantee its anonymity, verifiability, traceability, unforgetability and undeniability.
Casteel, Carri; Peek-Asa, Corinne; Nocera, Maryalice; Smith, Jamie B; Blando, James; Goldmacher, Suzi; O'Hagan, Emily; Valiante, David; Harrison, Robert
2009-02-01
This study examines changes in violent event rates to hospital employees before and after enactment of the California Hospital Safety and Security Act in 1995. We compared pre- and post-initiative employee assault rates in California (n = 116) emergency departments and psychiatric units with those in New Jersey (n = 50), where statewide workplace violence initiatives do not exist. Poisson regression with generalized estimating equations was used to compare assault rates between a 3-year pre-enactment period (1993-1995) and a 6-year post-enactment period (1996-2001) using New Jersey hospitals as a temporal control. Assault rates among emergency department employees decreased 48% in California post-enactment, compared with emergency department employee assault rates in New Jersey (rate ratio [RR] = 0.52, 95% confidence interval [CI]: 0.31, 0.90). Emergency department employee assault rates decreased in smaller facilities (RR = 0.46, 95% CI: 0.21, 0.96) and for-profit-controlled hospitals (RR = 0.39, 95% CI: 0.19, 0.79) post-enactment. Among psychiatric units, for-profit-controlled hospitals (RR = 0.41, 95% CI: 0.19, 0.85) and hospitals located in smaller communities (RR = 0.44, 95% CI: 0.21, 0.92) experienced decreased assault rates post-enactment. Policy may be an effective method to increase safety to health care workers.
Bullying: A socially enacted phenomenon with individual effects
DEFF Research Database (Denmark)
Hansen, Helle Rabøl; Søndergaard, Dorte Marie
2018-01-01
Some practitioners and researchers criticise the concept of bullying and suggest it replaced with e.g. conflict or harassment. We discuss the challenges enacted by the problematisation and propose a joint effort to improve both the conceptualisation and our cooperation in reworking it, while...
Directory of Open Access Journals (Sweden)
Andrea eJelic
2016-03-01
Full Text Available Over the last few years, the efforts to reveal through neuroscientific lens the relations between the mind, body, and built environment have set a promising direction of using neuroscience for architecture. However, little has been achieved thus far in developing a systematic account that could be employed for interpreting current results and providing a consistent framework for subsequent scientific experimentation. In this context, the enactive perspective is proposed as a guide to studying architectural experience for two key reasons. Firstly, the enactive approach is specifically selected for its capacity to account for the profound connectedness of the organism and the world in an active and dynamic relationship, which is primarily shaped by the features of the body. Thus, particular emphasis is placed on the issues of embodiment and motivational factors as underlying constituents of the body-architecture interactions. Moreover, enactive understanding of the relational coupling between body schema and affordances of architectural spaces singles out the two-way bodily communication between architecture and its inhabitants, which can be also explored in immersive virtual reality settings. Secondly, enactivism has a strong foothold in phenomenological thinking that corresponds to the existing phenomenological discourse in architectural theory and qualitative design approaches. In this way, the enactive approach acknowledges the available common ground between neuroscience and architecture and thus allows a more accurate definition of investigative goals. Accordingly, the outlined model of architectural subject in enactive terms – that is, a model of a human being as embodied, enactive, and situated agent, is proposed as a basis of neuroscientific and phenomenological interpretation of architectural experience.
Individual and combined effects of enactment and testing on memory for action phrases.
Kubik, Veit; Söderlund, Hedvig; Nilsson, Lars-Göran; Jönsson, Fredrik U
2014-01-01
We investigated the individual and combined effects of enactment and testing on memory for action phrases to address whether both study techniques commonly promote item-specific processing. Participants (N = 112) were divided into four groups (n = 28). They either exclusively studied 36 action phrases (e.g., "lift the glass") or both studied and cued-recalled them in four trials. During study trials participants encoded the action phrases either by motorically performing them, or by reading them aloud, and they took final verb-cued recall tests over 18-min and 1-week retention intervals. A testing effect was demonstrated for action phrases, however, only when they were verbally encoded, and not when they were enacted. Similarly, enactive (relative to verbal) encoding reduced the rate of forgetting, but only when the action phrases were exclusively studied, and not when they were also tested. These less-than-additive effects of enactment and testing on the rate of forgetting, as well as on long-term retention, support the notion that both study techniques effectively promote item-specific processing that can only be marginally increased further by combining them.
Enacting the 'mobile' in tourism studies - Unraveling research practices
DEFF Research Database (Denmark)
Jensen, Martin Trandberg
This chapter showcases how mobile methods are more than calibrated techniques awaiting application by tourism researchers, but productive in the enactment of the mobile (Law and Urry, 2004). Drawing upon recent findings deriving from a PhD course on mobility and mobile methods it reveals the conc......This chapter showcases how mobile methods are more than calibrated techniques awaiting application by tourism researchers, but productive in the enactment of the mobile (Law and Urry, 2004). Drawing upon recent findings deriving from a PhD course on mobility and mobile methods it reveals......, the engagements with methods are acknowledged to be always political and contextual, reminding us to avoid essentialist discussions regarding research methods. Finally, the chapter draws on recent fieldwork to extend developments in mobilities-oriented tourism research, by employing auto-ethnography to call...
Dealing with difficult days: Functional coping dynamics in self-harm ideation and enactment.
Nielsen, Emma; Sayal, Kapil; Townsend, Ellen
2017-01-15
Self-harm affords people a means of coping. However, little is known about how functional coping dynamics differ between stressful situations in which people self-harm (enactment), think about harming (ideation), or experience no self-harmful thoughts or behaviours. Participants (N = 1,157) aged 16-49 years (M = 18.21, SD = 3.24) with a recent history of self-harm (past 3 months) reported how they coped in response to their most significant recent stressor (3 months). Almost 40% of participants, all of whom had self-harmed in the last 3 months, had no self-harm experience (thoughts or behaviours) in response to their most significant stressor in that time frame. In multivariate analysis, adjusting for symptoms of depression and anxiety, reappraisal coping was predictive of self-harm thoughts. Approach, emotion regulation and reappraisal coping were predictive of self-harm behaviour. Emotion regulation coping differentiated self-harm ideation and enactment groups. The cross-sectional design of the study precludes the ability to make inferences regarding causality. Further, there is no agreed definition of 'recent' self-harm. Taken together, the findings suggest that functional coping dynamics may be differentially associated with self-harm ideation and enactment. This is important, given that understanding the transitions between ideation and enactment has been identified as a critical frontier in suicide prevention. Further, results indicate that seemingly innocuous events may have a profound impact as tipping points for enaction; this has implications for clinical practice, including the co-production of safety plans. Copyright © 2016. Published by Elsevier B.V.
Optimizing enactment of nursing roles: redesigning care processes and structures
Directory of Open Access Journals (Sweden)
Jackson K
2014-02-01
Full Text Available Karen Jackson,1 Deborah E White,2 Jeanne Besner,1 Jill M Norris21Health Systems and Workforce Research Unit, Alberta Health Services, Calgary, Alberta, Canada; 2Faculty of Nursing, University of Calgary, Calgary, Alberta, CanadaBackground: Effective and efficient use of nursing human resources is critical. The Nursing Role Effectiveness Model conceptualizes nursing practice in terms of key clinical role accountabilities and has the potential to inform redesign efforts. The aims of this study were to develop, implement, and evaluate a job redesign intended to optimize the enactment of registered nurse (RN clinical role accountabilities.Methods: A job redesign was developed and implemented in a single medical patient care unit, the redesign unit. A mixed-methods design was used to evaluate the job redesign; a second medical patient care unit served as a control unit. Data from administrative databases, observations, interviews, and demographic surveys were collected pre-redesign (November 2005 and post-redesign (October 2007.Results: Several existing unit structures and processes (eg, model of care delivery influenced RNs' ability to optimally enact their role accountabilities. Redesign efforts were hampered by contextual issues, including organizational alignment, leadership, and timing. Overall, optimized enactment of RN role accountabilities and improvements to patient outcomes did not occur, yet this was predictable, given that the redesign was not successful. Although the results were disappointing, much was learned about job redesign.Conclusion: Potential exists to improve the utilization of nursing providers by situating nurses' work in a clinical role accountability framework and attending to a clear organizational vision and well-articulated strategic plan that is championed by leaders at all levels of the organization. Health care leaders require a clear understanding of nurses' role accountabilities, support in managing change, and
Public Heath in Colonial and Post-Colonial Ghana: Lesson-Drawing for The Twenty-First Century
Directory of Open Access Journals (Sweden)
Adu-Gyamfi, Samuel
2017-06-01
Full Text Available Public health in twenty-first century Ghana is mired with several issues ranging from the inadequacy of public health facilities, improper settlement planning, insanitary conditions, and the inadequacy of laws and their implementation. This situation compared to the colonial era is a direct contradiction. Development in the pre-colonial era to the colonial era sought to make the prevention of diseases a priority in the colonial administration. This was begun with the establishment of the health branch in 1909 as a response to the bubonic plague that was fast spreading in the colony. From here public health policies and strategies were enacted to help the diseases prevention cause. Various public health boards, the medical research institute or the laboratory branch, the waste management department, the use of preventive medicine and maintenance of good settlement planning and sanitation were public health measures in the colonial era. This research seeks to analyse the public health system in the colonial era so as to draw basic lessons for twenty-first century Ghana. Archival data and other secondary sources are reviewed and analysed to help draw these lessons. Richard Rose’s lesson-drawing approach was used to draw the lessons.
Addressing the problems of the twenty-first century will require new initiatives that complement traditional regulatory activities. Existing regulations, such as the Clean Air Act and Clean Water Act are important safety nets in the United States for protecting human health and t...
Drewes, A.; Henderson, J.; Mouza, C.
2017-12-01
Climate change is one of the most pressing challenges facing society, and climate change educational models are emerging in response. This study investigates the implementation and enactment of a climate change professional development model for science educators and its impact on student learning. Using an intrinsic case study methodology, we focused analytic attention on how one teacher made specific curricular, pedagogical, and content decisions, and the implications of those decisions for student's conceptual learning.The research presented here reports on the instructional design, pedagogical enactment, and subsequent effects on student learning of a climate change professional development (PD) model in the United States. Using anthropological theories of conceptual travel, we traced salient ideas from the PD through instructional delivery and into the evidence of student reasoning. We sought to address the following research questions: 1) How did a middle school teacher integrate climate change concepts into her science curriculum following PD participation? and 2) How did climate change instruction influence student understanding of key climate change constructs?From observation of the classroom instruction, we determined that the teacher effectively integrated new climate change information into her pre-existing schema. Additionally, through retrospective analysis of the PD, we found the design of the PD foregrounded the causes, mechanisms and likely effects of anthropogenic climate change at the expense of mitigation and adaptation strategies, and this differentially shaped how climate change was taught in the teacher's classroom. Analysis of student reasoning evidence showed that students gained an increased understanding of the enhanced greenhouse effect and the implications of human activity on this enhanced effect at statistically significant levels and with moderate effect sizes. However, students demonstrated a limited, though non-significant gain on
The same teacher, the same curriculum materials, different schools: What is the enacted curriculum?
Eisenmann, Tammy
This research examines how the same teacher implements the same curriculum material in two different schools. The aim of the study is to examine how the enacted algebra curriculum may change when the same teacher enacts the same written curriculum materials in different classes. This research comprises two case studies. Each case examines one teacher who taught the beginning of the mathematical topic "equivalent algebraic expressions", to two 7th grade classes from different schools. The same textbook was used in all four classes. The data collected includes: 1. Observations: 25930 lessons throughout the school year in each of the participating classes; Other mathematics classes in each of the schools; Other non9mathematics classes in the participating classes. A total of 130 lessons were observed. The observations included continuous observations of the teaching of "equivalent algebraic expressions" (15919 lessons) in each class. These observations are the main data source of this research; 2. Interviews with the teachers; 3. Informal conversations; and 4. Field notes. The data was analyzed both through quantitative and qualitative analysis. The research focuses on the following two aspects of the enacted curriculum: implementation of the recommendation that appeared in the curriculum materials and the types of algebraic activity that the students were exposed to during the teaching of the mathematical topic. Kieran's framework (Kieran, 1996, 2004), which distinguishes between three types of algebraic activities 9 generational, transformational and global/meta9level 9 was employed for the examination of the algebraic activities. Comparisons were made for two aspects of the research: between the enacted curriculum in each of the classes and the curriculum materials; and between each of the classes taught by same teacher. It was found that in case study 1, that examined teacher Sara and schools Carmel and Tavor -- most of the recommendations for instruction that
2009-01-01
For the past two weeks, Bram Conjaerts, a Belgian filmmaker, has been touring the CERN sites and surrounding countryside conducting research for his new documentary. The film will follow the entire 27 Km length of the LHC ring, but unlike most documentaries about the LHC, it will take place mostly above ground! Bram Conjaerts during his visit to CERN.While working towards his film degree in 2008, Bram Conjaerts won an award at the International Documentary Festival for his documentary "Henri and the Islands", an anthropological documentary about the smallest village in Belgium. In an unlikely change of subject matter he decided to use the prize money to make a film about the LHC. "With the money granted by the Flemish government, I wanted to create a documentary about something adventurous and something that I did not know about, " explains Conjaerts. "I started doing research about the LHC and CERN and I came across the fantasy of...
Directory of Open Access Journals (Sweden)
Janette Schult
Full Text Available What are the memory-related consequences of learning actions (such as "apply the patch" by enactment during study, as compared to action observation? Theories converge in postulating that enactment encoding increases item-specific processing, but not the processing of relational information. Typically, in the laboratory enactment encoding is studied for lists of unrelated single actions in which one action execution has no overarching purpose or relation with other actions. In contrast, real-life actions are usually carried out with the intention to achieve such a purpose. When actions are embedded in action sequences, relational information provides efficient retrieval cues. We contrasted memory for single actions with memory for action sequences in three experiments. We found more reliance on relational processing for action-sequences than single actions. To what degree can this relational information be used after enactment versus after the observation of an actor? We found indicators of superior relational processing after observation than enactment in ordered pair recall (Experiment 1A and in emerging subjective organization of repeated recall protocols (recall runs 2-3, Experiment 2. An indicator of superior item-specific processing after enactment compared to observation was recognition (Experiment 1B, Experiment 2. Similar net recall suggests that observation can be as good a learning strategy as enactment. We discuss possible reasons why these findings only partly converge with previous research and theorizing.
Capobianco, Brenda M.; DeLisi, Jacqueline; Radloff, Jeffrey
2018-01-01
In an effort to document teachers' enactments of new reform in science teaching, valid and scalable measures of science teaching using engineering design are needed. This study describes the development and testing of an approach for documenting and characterizing elementary science teachers' multiday enactments of engineering design-based science…
Incremental Method Enactment for Computer Aided Software Engineering Tools
Vlaanderen, K.; Tuijl, G.J. van; Brinkkemper, S.; Jansen, Slinger
2013-01-01
In most cases, enactment is the most resource consuming aspect of process improvement, as large process changes are put into practice. Problems that typically are encountered include ine ective process changes, resistance from employees, and unclarity about the advantages of the new process.
Learning new skills in Multimodal Enactive Environments
Directory of Open Access Journals (Sweden)
Bardy Benoît G.
2011-12-01
Full Text Available A European consortium of researchers in movement and cognitive sciences, robotics, and interaction design developed multimodal technologies to accelerate and transfer the (relearning of complex skills from virtual to real environments. The decomposition of skill into functional elements — the subskills — and the enactment of informational variables used as accelerators are here described. One illustration of accelerator using virtual reality in team rowing is described.
Role Enactment as a Socially Relevant Explanation of Self-Persuasion.
Bodaken, Edward M.; And Others
1979-01-01
Reports on four tests of Charles R. Berger's role enactment model of persuasion, which is addressed to generalizing counterattitudinal communication to social situations when persons find themselves encoding belief-discrepant messages. (JMF)
Enactment of mandatory pharmacy technician certification in Kansas.
Lucas, Amber; Massey, Lindsay; Gill, Taylor; Burger, Gregory; Little, Jeff D
2016-02-01
The successful enactment of mandatory pharmacy technician certification in Kansas is described. In 2004, Kansas began requiring registration of all pharmacy technicians with the state board of pharmacy. Registration identified individuals working as pharmacy technicians but did not require any specific education or certification. In September 2012, the Kansas Board of Pharmacy created a task force of key stakeholders including pharmacists from multiple areas of practice, the University of Kansas School of Pharmacy, organizational leaders from the Kansas Council of Health-System Pharmacists (KCHP) and Kansas Pharmacists Association, and professional lobbyists. The goals of this task force were to research practices of technician certification in other states and to make recommendations to the state board of pharmacy on how Kansas could accomplish mandatory technician certification. The task force outlined the steps needed to achieve legislation that could be supported by the members. These topics included the creation of a technician trainee category, grandfathering certain technicians who had been practicing for a designated period of time, state board-approved exemptions, training requirements, age and education requirements, continuing-education requirements, and pharmacist:technician ratio. The recommendations were finalized at the August 2013 Kansas Pharmacy Summit, and the proposed legislation was introduced and passed during the 2014 legislative session. KCHP members learned many valuable lessons about advocacy and the legislative process with this initiative, including building relationships, working with legislators, and working with other professional organizations. The formation of a task force led to the successful passage of a bill granting the Kansas Board of Pharmacy the authority to issue regulations regarding mandatory pharmacy technician certification. Copyright © 2016 by the American Society of Health-System Pharmacists, Inc. All rights reserved.
Keller, Jan; Fleig, Lena; Hohl, Diana Hilda; Wiedemann, Amelie U; Burkert, Silke; Luszczynska, Aleksandra; Knoll, Nina
2017-09-01
Past research supports individual planning as an effective intervention strategy to increase physical activity in individuals. A similar strategy, dyadic planning, adds a planning partner who supports an individual's planning processes. Whether the two planning formats differ in terms of participants' entered plan content and whether and how different content characteristics are linked to plan enactment remains unknown. By investigating the content of generated plans, this study aimed at distinguishing plan characteristics of the two planning formats and examining their role as predictors of later plan enactment. Secondary analyses of a three-arm RCT with German couples (data collection between 2013 and 2015). Couples were assigned to an individual (IPC, n = 114) or dyadic planning condition (DPC, n = 111) and formulated up to 5 physical activity plans for a target person. Couples assigned to a control condition were not included as they did not generate plans. The following characteristics were distinguished and coded for each plan: number of planned opportunities, presence of a planned routine, planned cue- or activity-related specificity, activity-related intensity, and chronological plan rank. One week before (T0) and two weeks following (T2) the intervention (T1), increase vs. no increase of the planned activity was coded as a dichotomous plan enactment variable. Multilevel logistic regressions were fit. Plan enactment was higher in dyadic than in individual planners. Findings indicated that routines (e.g., after work) were positively related to plan enactment, whereas a high specificity of when-cues (e.g., Friday at 6.30 p.m.) showed a negative relationship. None of the examined plan characteristics could explain differences in enactment between IPC and DPC. Linking health behaviours to other behavioural routines seems beneficial for subsequent plan enactment. Dyadic planning was linked with higher enactment rates than individual planning. However, as
Enacting Risk in Independent Technological Innovation
DEFF Research Database (Denmark)
Berglund, Henrik; Hellström, Tomas
2002-01-01
The present study aims at investigating the role of risk in the activity of independent technological venturing. Altogether, 12 deep-interviews were conducted with technological entrepreneurs, who had taken part in the inventive, developmental and the commercialisation phases of a technology......-based innovation process. The interviews revealed a number of enactment approaches through which these innovators encountered and affected (dealt with or transformed) risk within the innovation process. Factors thus developed from the empirical material included human capital, pace and priority, the world moves...... for the benefit of innovation management....
Klein, S. B.
1980-01-01
Twenty states, the District of Columbia, and the Virgin Islands enacted erosion and sediment control legislation during the past decade to provide for the implementation or the strengthening of statewide erosion and sediment control plans for rural and/or urban lands. That legislation and the state programs developed to implement these laws are quoted and reviewed. The natural resource data requirements of each program are also extracted. The legislation includes amendments to conservation district laws, water quality laws, and erosion and sediment control laws. Laws which provides for legislative review of administrative regulations and LANDSAT applications and/or information systems that were involved in implementing or gathering data for a specific soil erosion and sediment control program are summarized as well as principal concerns affecting erosion and sediment control laws.
Bottoms, SueAnn I.; Ciechanowski, Kathryn M.; Hartman, Brian
2015-01-01
Iterative cycles of enactment embedded in culturally and linguistically diverse contexts provide rich opportunities for preservice teachers (PSTs) to enact core practices of science. This study is situated in the larger Families Involved in Sociocultural Teaching and Science, Technology, Engineering and Mathematics (FIESTAS) project, which weaves…
Pagano, Christopher J
2012-01-01
Psychoanalytic psychotherapists, drawing upon intersubjective and attachment theories, recognize that mutual influence impacts the treatment process. Mutual influence generates enactments--emotionally intense joint creations stemming from the unconscious of both therapist and patient--which often leave both patient and therapist feeling confused and stuck. The author presents a case in which the therapist's use of improvisational role play was a critical therapeutic response to an enactment. The therapist's self-expression through the displacement of the role play 1) modeled a safe, affectively genuine engagement in relationship, 2) provided the patient with an unexpected and powerful window into the therapist's emotional world, 3) shifted the patient's fundamental belief that fathers and men are cold and unfeeling, and 4) led the patient to uncover "new" early memories and to become aware of his role as an agent of vitality and intimacy. The author concludes that using improvisation as a flexible response to rigid patterns of enactment may provide a catalyst for therapeutic change.
An analysis of state legislation on community trails.
Eyler, Amy; Lankford, Tina; Chriqui, Jamie; Evenson, Kelly R; Kruger, Judy; Tompkins, Nancy; Voorhees, Carolyn; Zieff, Susan; Aytur, Semra; Brownson, Ross
2010-03-01
Trails provide opportunities for recreation, transportation and activity. The purpose of this article is to describe state legislation related to community trails, to analyze legislation content, and to evaluate legislation on inclusion of evidence-informed elements. State trail legislation from 2001 to 2008 was identified using online legislative databases. An analysis of evidence-informed elements included in the legislation was conducted. These elements included: funding, liability, accessibility, connectivity, and maintenance. Of the total 991 trail bills, 516 (52.0%) were appropriations bills, of which 167 (32.2%) were enacted. We analyzed 475 (48%) nonappropriation trail bills of which 139 (29.3%) were enacted. The percentage of enactment of appropriations bills decreased over time while enactment of nonappropriations trail bills increased. Over half of the nonappropriations trail bills included at least 1 evidence-informed element, most commonly funding. Few bills contained liability, connectivity, accessibility, or maintenance. There is opportunity for providing evidence-informed information to policy-makers to potentially influence bill content. The number of bills with a funding element demonstrates that fiscal support for trails is an important policy lever that state legislatures may use to support trails. Lastly, trails should be considered in over-all state-level physical activity legislation to provide opportunities for communities to be active.
Twenty Years of French "Didactique" Viewed from the United States
Kilpatrick, Jeremy
2003-01-01
One cannot begin considering the topic of this colloquium without asking, why twenty years? Why not two hundred? Two hundred years ago, Silvestre Franois Lacroix was about to be named chief officer of the Commission Executive de L'Instruction Publique. Out of that experience, together with his long career in instruction, especially as professor of…
Afshin Pourmokhtarian; Charles T. Driscoll; John L. Campbell; Katharine Hayhoe; Anne M. K. Stoner; Mary Beth Adams; Douglas Burns; Ivan Fernandez; Myron J. Mitchell; James B. Shanley
2016-01-01
A cross-site analysis was conducted on seven diverse, forested watersheds in the northeastern United States to evaluate hydrological responses (evapotranspiration, soil moisture, seasonal and annual streamflow, and water stress) to projections of future climate. We used output from four atmosphereâocean general circulation models (AOGCMs; CCSM4, HadGEM2-CC, MIROC5, and...
Directory of Open Access Journals (Sweden)
Salvatore Francesco Carbone
2014-01-01
Full Text Available Objectives. To assess the diagnostic performance of diffusion-weighted MR imaging (DWI in patients affected by prostatic fossa (PF relapse after radical prostatectomy (RP for prostatic carcinoma (PC. Methods. Twenty-seven patients showing a nodular lesion in the PF at T2-weighted MR imaging after RP, with diagnosis of PC relapse established by biopsy or PSA determinations, were investigated by DWI. Two readers evaluated the DWI results in consensus and the apparent diffusion coefficient (ADC of the nodules, separately; a mean value was obtained (ADCm. Results. Relapses did not significantly differ in size in respect of postsurgical benign nodules. The DWI qualitative evaluation showed sensitivity, specificity, accuracy, ppv, and npv values, respectively, of 83.3%, 88.9%, 85.2%, 93.7%, and 72.7% (100%, 87.5%, 95.6%, 93.7%, and 100%, for nodules >6 mm. The intraclass correlation coefficient (ICC for ADC evaluation between the two readers was 0.852 (95% CI 0.661–0.935; P=0.0001. The ADCm values for relapses and benign nodules were, respectively, 0.98±0.21×10−3 mm2/sec and 1.24±0.32×10−3 mm2/sec (P=0.006. Sensitivity, specificity, accuracy, ppv and npv of ADCm were, respectively, 77.8%, 88.9%, 81.8%, 93.3%, and 66.7% (93.3%, 87.5%, 85.4%, 93.3%, and 87.5% for nodules >6 mm. Conclusions. Diffusion-weighted MR imaging is a promising tool in the management of a hyperintense nodule detected by T2-weighted sequences. This might have a relevant importance in contouring radiotherapy treatment volumes.
Breslyn, Wayne; McGinnis, J. Randy
2012-01-01
Teachers' use of inquiry has been studied largely without regard for the disciplines in which teachers practice. As a result, there is no theoretical understanding of the possible role of discipline in shaping teachers' conceptions and enactment of inquiry. In this mixed-methods study, conceptions and enactment of inquiry for 60 National Board…
New science teachers' descriptions of inquiry enactment
Dreon, Oliver, Jr.
This phenomenological study demonstrates the influence that affective factors have on beginning teachers' ability to enact instructional practices. Through narratives shared in interviews and web log postings, two beginning science teachers' emotional engagement with their instructional practices, especially that of implementing inquiry-based instruction, and the resulting impact these emotions had on professional decision-making were evidenced. Anxiety emerged as the most significant impacting emotion on instructional decision-making with the participants. Through their stories, the two participants describe how their emotions and views of self influence whether they continue using inquiry pedagogy or alter their lesson to adopt more didactic means of instruction. These emotions arise from their feelings of being comfortable teaching the content (self-efficacy), from the unpredictability of inquiry lessons (control beliefs), from how they perceive their students as viewing them (teacher identity) and from various school constraints (agency). This research also demonstrates how intertwined these aspects are, informing each other in a complex, dialectical fashion. The participants' self-efficacy and professional identity emerge from their interactions with the community (their students and colleagues) and the perceived agency afforded by their schools' curricula and administration. By providing descriptions of teachers' experiences enacting inquiry pedagogy, this study expands our understanding of factors that influence teachers' instructional practices and provides a basis for reforming science teacher preparation.
Kuhlman, Shane T W; Walch, Susan E; Bauer, Kristina N; Glenn, April D
2017-08-01
Gatekeeper training for suicide prevention was evaluated on a college campus to examine the impact of training on gatekeeper enactment of behaviors in support of suicide prevention and identify predictors of enactment of gatekeeper behaviors. Trained gatekeepers (N = 216) displayed greater perceived knowledge and self-efficacy for suicide prevention and reported higher rates of self-reported actual gatekeeper behaviors, including inquiring about suicidal ideation and referring for mental health treatment when they encountered someone in distress, compared to their untrained counterparts (N = 169). Consistent with the Theory of Planned Behavior, SEM results indicated that attitudes, self-efficacy, and perceived knowledge explained intentions to engage in gatekeeper behaviors, accounting for 59% of the variance in intentions to inquire about suicidal ideation and supporting the role of attitudes and perceived behavioral control in intentions to act. These intentions explained self-reported actual gatekeeper behaviors among participants who encountered someone in distress, with each one-point increase in intention associated with nearly twice the likelihood of both inquiring about suicidal ideation and referring someone for mental health care. On the other hand, self-reported situational barriers were associated with a decreased likelihood of referral behavior, indicating the role of actual behavioral control over volitional actions. Findings support the value of gatekeeper training for promoting factors that influence the likelihood of action on behalf of suicide prevention.
Matsui, Kenichi
2011-01-01
As of December 2010, the US Congress had enacted more than twenty major community-specific Native water-rights settlements, and the state of Arizona had more of these settlements (eight) than any other US state. This unique situation has invited voluminous studies on Arizona's Native water-rights settlements. Although these studies have clarified…
Public Attitudes towards Monetary Integration in Seven New Member States of the EU
Directory of Open Access Journals (Sweden)
Szőcs Csongor-Ernő
2015-04-01
Full Text Available Existing work on euro support has provided insights into the dynamics of preferences, but most of these studies focus on older member states that already form an integral part of the Eurozone. This article inquires into public attitudes towards monetary integration in new member states of the EU: Poland, the Czech Republic, Romania, Hungary, Croatia, Bulgaria and Lithuania. Focusing on the cross-sectional variation of preferences, it applies multilevel logit regression to test three perspectives – economic, conceptual and political – using individual-level survey data and NUTS-2 regional statistical data from seven countries for 2013. One of its novel findings is that beliefs such as the one that European Monetary Union (EMU adherence will cause a spiral in economic inflation are powerful disincentives to euro support in these countries.
Proceedings: Twenty years of energy policy: Looking toward the twenty-first century
International Nuclear Information System (INIS)
1992-01-01
In 1973, immediately following the Arab Oil Embargo, the Energy Resources Center, University of Illinois at Chicago initiated an innovative annual public service program called the Illinois Energy Conference. The objective was to provide a public forum each year to address an energy or environmental issue critical to the state, region and nation. Twenty years have passed since that inaugural program, and during that period we have covered a broad spectrum of issues including energy conservation nuclear power, Illinois coal, energy policy options, natural gas, alternative fuels, new energy technologies, utility deregulation and the National Energy Strategy
Proceedings: Twenty years of energy policy: Looking toward the twenty-first century
Energy Technology Data Exchange (ETDEWEB)
1992-12-31
In 1973, immediately following the Arab Oil Embargo, the Energy Resources Center, University of Illinois at Chicago initiated an innovative annual public service program called the Illinois Energy Conference. The objective was to provide a public forum each year to address an energy or environmental issue critical to the state, region and nation. Twenty years have passed since that inaugural program, and during that period we have covered a broad spectrum of issues including energy conservation nuclear power, Illinois coal, energy policy options, natural gas, alternative fuels, new energy technologies, utility deregulation and the National Energy Strategy.
Directory of Open Access Journals (Sweden)
Patricia Kinast De Camillis
Full Text Available Abstract In the area of Administration, especially in the Organizational Studies (OS, the Actor-Network Theory (ANT has been regarded as part of a movement that aims to leave the functional emphasis of organization and pursue the study of process and practices of organizing - the processual approach to organizations. However, criticism to the ANT has led some authors to seek to overcome them through analytical twists concerning certain concepts. One of these "twists" involved the concept of translation and the inclusion of the concept of enactment . This article discusses both notions with the aid of two studies developed having these concepts as a basis, in order to indicate that the choice of enactment brings along a processual view different from that observed in translation. The concept of translation addresses the predominant and it emphasizes understanding how networks of relationships and objects become "stable"; in turn, enact works with multiplicity and fluidity, where the process takes precedence over things. Although the proposed term enactment does not seek to directly face all criticism, it contributes so that ANT does not take a neutral or mechanical view in its analyses and descriptions. Enactment has the view of organization as a result and product of continuous process and it allows understanding that this is not just working or not (success or failure, but it concerns the "production" of multiple realities when we conduct research in Administration having the processual approach to organizations as a basis.
Chi, Peilian; Li, Xiaoming; Zhao, Junfeng; Zhao, Guoxiang
2013-01-01
Previous research has found a deleterious impact of stigma on the mental health of children affected by HIV/AIDS. Little is known about the longitudinal relationship of stigma and children’s mental health. This study explores the longitudinal reciprocal effects of depressive symptoms and stigma, specifically enacted stigma and perceived stigma, among children affected by HIV/AIDS aged 6 to 12. Longitudinal data were collected from 272 children orphaned by AIDS and 249 children of HIV-positive parents in rural China. Cross-lagged panel analysis was conducted in the study. Results showed that the autoregressive effects were stable for depressive symptoms, perceived stigma and enacted stigma suggesting the substantially stable individual differences over time. The cross-lagged effects indicated a vicious circle among the three variables in an order of enacted stigma→depressive symptom→perceived stigma→enacted stigma. The possibility of employing equal constraints on cross-lagged paths suggested that the cross-lagged effects were repeatable over time. The dynamic interplay of enacted stigma, perceived stigma and depressive symptoms suggests the need of a multilevel intervention in stigma reduction programming to promote mental health of children affected by HIV/AIDS. PMID:24158487
Twenty hanging Dolls and a Lynching:
DEFF Research Database (Denmark)
Risør, Helene
2010-01-01
The article sets lynching of presumed criminals in the city of El Alto, Bolivia, in relation to both everyday experiences of insecurity about crime and violence and the enactment of neighborliness as a grounded notion of citizenship. Focusing on the experience and management of insecurity and its...
Twenty-first century learning in states: the case of the Massachusetts educational system.
Driscoll, David P
2006-01-01
A current crisis in education is leaving students less prepared to succeed in the working world than any generation before them. Increasingly complex external, nonacademic pressures have an impact on many of today's students, often causing them to drop out of school. Only 76 percent of Massachusetts high school students graduate, and only 29 percent earn a college degree. National figures are worse. Most educational institutions share a common goal to support students in becoming skilled, productive, successful members of society, but the author argues that this goal is not being met. Despite the constant changes in the world, educational practices have remained static. Most public schools are not adapting to meet the shifting needs of students. Universities are not able to prepare the right mix of prospective employees for the demands of the job market; for example, schools are graduating only 10 percent of the needed engineers. Institutions of higher learning cannot keep up with employers' needs in an evolving global market: strong math, science, and writing abilities; critical thinking skills; and the ability to work in teams. The author draws on exemplary efforts at work in his home state of Massachusetts--whose improvements in student achievement outcomes have been some of the best in the nation--to suggest there is promise in twenty-first century learning. Middle school students involved in a NASA-funded project write proposals, work in teams, and engage in peer review. Older students participate in enhanced, hands-on cooperative school-to-work and after-school programs. Schools are starting to offer expanded day learning, increasing the number of hours they are engaged in formal learning. Yet such programs have not reached significant levels of scale. The author calls for a major shift in education to help today's students be successful in the twenty-first century.
Steffens, Melanie C; Buchner, Axel; Wender, Karl F; Decker, Claudia
2007-12-01
Verb-object phrases (open the umbrella, knock on the table) are usually remembered better if they have been enacted during study (also called subject-performed tasks) than if they have merely been learned verbally (verbal tasks). This enactment effect is particularly pronounced for phrases for which the objects (table) are present as cues in the study and test contexts. In previous studies with retrieval cues for some phrases, the enactment effect in free recall for the other phrases has been surprisingly small or even nonexistent. The present study tested whether the often replicated enactment effect in free recall can be found if none of the phrases contains context cues. In Experiment 1, we tested, and corroborated, the suppression hypothesis: The enactment effect for a given type of phrase (marker phrases) is modified by the presence or absence of cues for the other phrases in the list (experimental phrases). Experiments 2 and 3 replicated the enactment effect for phrases without cues. Experiment 2 also showed that the presence of cues either at study or at test is sufficient for obtaining a suppression effect, and Experiment 3 showed that the enactment effect may disappear altogether if retrieval cues are very salient.
Gaytan, Candice Renee
Modeling is an important scientific practice through which scientists generate, evaluate, and revise scientific knowledge, and it can be translated into science classrooms as a means for engaging students in authentic scientific practice. Much of the research investigating modeling in classrooms focuses on student learning, leaving a gap in understanding how teachers enact this important practice. This dissertation draws on data collected through a model-based curricular project to uncover instructional moves teachers made to enact modeling, to describe factors influencing enactment, and to discuss a framework for designing and enacting modeling lessons. I framed my analysis and interpretation of data within the varying perceptions of modeling found in the science studies and science education literature. Largely, modeling is described to varying degrees as a means to engage students in sense-making or as a means to deliver content to students. This frame revealed how the instructional moves teachers used to enact modeling may have influenced its portrayal as a reasoning practice. I found that teachers' responses to their students' ideas or questions may have important consequences for students' engagement in modeling, and thus, sense-making. To investigate factors influencing the portrayal of modeling, I analyzed teacher interviews and writings for what they perceived affected instruction. My findings illustrate alignments and misalignments between what teachers perceive modeling to be and what they do through instruction. In particular, teachers valued providing their students with time to collaborate and to share their ideas, but when time was perceived as a constraint, instruction shifted towards delivering content. Additionally, teachers' perceptions of students' capacity to engage in modeling is also related to if and how they provided opportunities for students to make sense of phenomena. The dissertation closes with a discussion of a framework for designing
Oliver, Carolyn; Charles, Grant
2016-06-01
Strengths-based solution-focused approaches are gaining ground in statutory child protection work, but few studies have asked front line practitioners how they navigate the complex worker-client relationships such approaches require. This paper describes one component of a mixed-methods study in a large Canadian statutory child protection agency in which 225 workers described how they applied the ideas of strengths-based practice in their daily work. Interviews with twenty-four practitioners were analysed using an interpretive description approach. Only four interviewees appeared to successfully enact a version of strengths-based practice that closely mirrored those described by key strengths-based child protection theorists and was fully congruent with their mandated role. They described navigating a shifting balance of collaboration and authority in worker-client relationships based on transparency, impartial judgement, attentiveness to the worker-client interaction and the value that clients were fellow human beings. Their accounts extend current conceptualisations of the worker-client relationship in strengths-based child protection work and are congruent with current understandings of effective mandated relationships. They provide what may be a useful model to help workers understand and navigate relationships in which they must reconcile their own authority and expertise with genuine support for the authority and expertise of their clients.
International Nuclear Information System (INIS)
Irving, P.M.; Smith, E.
1991-09-01
The twenty-seven State-of-Science and State-of-Technology (SOS/T) Reports, published in 1990 as the definitive scientific and technical synthesis of information obtained during the first decade of the U.S. national Acid Precipitation Assessment Program (NAPAP), are summarized in the document. In most cases, these summaries were the final chapter of the complete SOS/T Report
Swartjes F; ECO
2003-01-01
Twenty scenarios, differing with respect to land use, soil type and contaminant, formed the basis for calculating human exposure from soil contaminants with the use of models contributed by seven European countries (one model per country). Here, the human exposures to children and children
Haagsma, J A; Geenen, P L; Ethelberg, S; Fetsch, A; Hansdotter, F; Jansen, A; Korsgaard, H; O'Brien, S J; Scavia, G; Spitznagel, H; Stefanoff, P; Tam, C C; Havelaar, A H
2013-08-01
By building reconstruction models for a case of gastroenteritis in the general population moving through different steps of the surveillance pyramid we estimated that millions of illnesses occur annually in the European population, leading to thousands of hospitalizations. We used data on the healthcare system in seven European Union member states in relation to pathogen characteristics that influence healthcare seeking. Data on healthcare usage were obtained by harmonized cross-sectional surveys. The degree of under-diagnosis and underreporting varied by pathogen and country. Overall, underreporting and under-diagnosis were estimated to be lowest for Germany and Sweden, followed by Denmark, The Netherlands, UK, Italy and Poland. Across all countries, the incidence rate was highest for Campylobacter spp. and Salmonella spp. Incidence estimates resulting from the pyramid reconstruction approach are adjusted for biases due to different surveillance systems and are therefore a better basis for international comparisons than reported data.
The Safety Culture Enactment Questionnaire (SCEQ): Theoretical model and empirical validation.
de Castro, Borja López; Gracia, Francisco J; Tomás, Inés; Peiró, José M
2017-06-01
This paper presents the Safety Culture Enactment Questionnaire (SCEQ), designed to assess the degree to which safety is an enacted value in the day-to-day running of nuclear power plants (NPPs). The SCEQ is based on a theoretical safety culture model that is manifested in three fundamental components of the functioning and operation of any organization: strategic decisions, human resources practices, and daily activities and behaviors. The extent to which the importance of safety is enacted in each of these three components provides information about the pervasiveness of the safety culture in the NPP. To validate the SCEQ and the model on which it is based, two separate studies were carried out with data collection in 2008 and 2014, respectively. In Study 1, the SCEQ was administered to the employees of two Spanish NPPs (N=533) belonging to the same company. Participants in Study 2 included 598 employees from the same NPPs, who completed the SCEQ and other questionnaires measuring different safety outcomes (safety climate, safety satisfaction, job satisfaction and risky behaviors). Study 1 comprised item formulation and examination of the factorial structure and reliability of the SCEQ. Study 2 tested internal consistency and provided evidence of factorial validity, validity based on relationships with other variables, and discriminant validity between the SCEQ and safety climate. Exploratory Factor Analysis (EFA) carried out in Study 1 revealed a three-factor solution corresponding to the three components of the theoretical model. Reliability analyses showed strong internal consistency for the three scales of the SCEQ, and each of the 21 items on the questionnaire contributed to the homogeneity of its theoretically developed scale. Confirmatory Factor Analysis (CFA) carried out in Study 2 supported the internal structure of the SCEQ; internal consistency of the scales was also supported. Furthermore, the three scales of the SCEQ showed the expected correlation
Being part of an enacted togetherness: narratives of elderly people with depression.
Nyman, Anneli; Josephsson, Staffan; Isaksson, Gunilla
2012-12-01
In this article, we explored how five elderly persons with depression engaged in everyday activities with others, over time, and how this was related to their experience of meaning. Repeated interviews and participant observations generated data that was analysed using a narrative approach. Analysis identified togetherness as an acted relation, "enacted togetherness", emphasising how the act of doing everyday activities with someone created togetherness and belonging, and being part of an enacted togetherness seemed to be a way for the participants to negotiate and construct meaning. Opportunities for doing things together with someone were closely associated to the place where the participants lived. Furthermore, engagement in activities together with others created hope and expectations of future acting. Findings from this research can extend our understanding of how participating in everyday activities is experienced as a social process including change over time, presenting the perspective of elderly people themselves. In light of these findings, we highlight the need to consider how opportunities to become part of an enacted togetherness can be created. Also, we aspire to contribute to the debate on how to understand the complexity related to social aspects of ageing and add to the emerging understanding of everyday activities as transactional, incorporating people and the environment in a dynamic process that goes beyond the individual. Copyright © 2012 Elsevier Inc. All rights reserved.
Therapeutic Enactment: Integrating Individual and Group Counseling Models for Change
Westwood, Marvin J.; Keats, Patrice A.; Wilensky, Patricia
2003-01-01
The purpose of this article is to introduce the reader to a group-based therapy model known as therapeutic enactment. A description of this multimodal change model is provided by outlining the relevant background information, key concepts related to specific change processes, and the differences in this model compared to earlier psychodrama…
Re-enactment of power economy legislation failed
International Nuclear Information System (INIS)
Heller, W.
2002-01-01
Comment on the failed vote in the German Federal Parliament about the re-enactment of power economy legislation. The amendments were mainly intended to translate into national law the EU Single Market Directive of June 22, 1998 about common regulations of the gas market. The legislative process had included a mediation procedure between the two chambers of parliament, i.e. the Bundestag and the Bundesrat, had been rejected once more by the Bundesrat, and was to have been adopted by an absolute majority vote of the Bundestag, the so-called Chancellor's majority, still in this parliamentary term. (orig.)
What's so critical about Critical Neuroscience? Rethinking experiment, enacting critique.
Fitzgerald, Des; Matusall, Svenja; Skewes, Joshua; Roepstorff, Andreas
2014-01-01
In the midst of on-going hype about the power and potency of the new brain sciences, scholars within "Critical Neuroscience" have called for a more nuanced and sceptical neuroscientific knowledge-practice. Drawing especially on the Frankfurt School, they urge neuroscientists towards a more critical approach-one that re-inscribes the objects and practices of neuroscientific knowledge within webs of social, cultural, historical and political-economic contingency. This paper is an attempt to open up the black-box of "critique" within Critical Neuroscience itself. Specifically, we argue that limiting enactments of critique to the invocation of context misses the force of what a highly-stylized and tightly-bound neuroscientific experiment can actually do. We show that, within the neuroscientific experiment itself, the world-excluding and context-denying "rules of the game" may also enact critique, in novel and surprising forms, while remaining formally independent of the workings of society, and culture, and history. To demonstrate this possibility, we analyze the Optimally Interacting Minds (OIM) paradigm, a neuroscientific experiment that used classical psychophysical methods to show that, in some situations, people worked better as a collective, and not as individuals-a claim that works precisely against reactionary tendencies that prioritize individual over collective agency, but that was generated and legitimized entirely within the formal, context-denying conventions of neuroscientific experimentation. At the heart of this paper is a claim that it was precisely the rigors and rules of the experimental game that allowed these scientists to enact some surprisingly critical, and even radical, gestures. We conclude by suggesting that, in the midst of large-scale neuroscientific initiatives, it may be "experiment", and not "context", that forms the meeting-ground between neuro-biological and socio-political research practices.
Young Children's Enactments of Human Rights in Early Childhood Education
Quennerstedt, Ann
2016-01-01
This paper explores ways in which human rights become part of and affect young children's everyday practices in early childhood education and, more particularly, how very young children enact human rights in the preschool setting. The study is conducted in a Swedish preschool through observations of the everyday practices of a group of children…
International Nuclear Information System (INIS)
Siwicki, R.
1993-01-01
The paper contains information of the WHO about the state of public health in Russia, Ukraine and Belarus seven years after the Chernobyl accident. The results of medical investigations obtained after two years run of IPHECA project have been also presented
The Voices for Healthy Kids and State Legislation to Prevent Childhood Obesity: An Update.
Bleich, Sara N; Jones-Smith, Jesse C; Walters, Hannah J; Rutkow, Lainie
2018-04-09
The purpose of this study is to examine general time trends in childhood obesity legislative activity in all 50 states (overall and by health equity focus) and whether the Voices for Healthy Kids Campaign (Voices) was associated with increased legislative activity. LexisNexis State Capital was used to identify bills related to childhood obesity from 2012 to 2016. Linear and linear probability models were used to assess general time trends and regression-based difference-in-difference models to assess whether time trends differed for states that received a Voices grant. The data were analyzed in 2017. A total of 989 bills were introduced (Year 1=304, Year 2=364; Year 3=321), and a total of 93 bills were enacted (Year 1=34, Year 2=24, Year 3=35) after baseline. The mean number of bills introduced (baseline=4.3, Year 1=6.6, Year 2=7.3, Year 3=7.0, p=0.007), and the average state enactment rate (baseline=11%, Year 1=16%, Year 2=8%, Year 3=27%, p-trend=0.02) increased significantly. States with Voices grantees introduced 2.1 more bills than non-grantee states (p=0.04). The estimated difference over time in bill enactment and health equity focus did not differ by Voices grantee status. Childhood obesity bill introduction and enactment increased between 2013 and 2016. The evidence-based advocacy supported by Voices appears to be significantly associated with greater increases in state-level bill introduction, but not enactment of legislation to address childhood obesity. Copyright © 2018 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.
The Fiscal Impact of Tax-Credit Scholarships in Montana. School Choice Issues in the State
Gottlob, Brian
2009-01-01
Many states have enacted or are considering proposals to give tax credits for contributions that provide tuition scholarships for students in K-12 schools to attend the private or public schools of their choice. This study seeks to inform the public and policymakers about the implications for Montana if the state were to enact such a program. The…
Practice what you preach: how consultants frame management concepts as enacted practice
Heusinkveld, S.; Visscher, Klaasjan
2012-01-01
To contribute to the understanding of management knowledge commodification, this research explores how management consultants frame management concepts as enacted practice. Despite the recognition of consultants as important knowledge entrepreneurs, little academic research considers how they
Entanglements of storytelling and power in the enactment of organizational subjectivity
DEFF Research Database (Denmark)
Jørgensen, Kenneth Mølbjerg
2017-01-01
. It captures the ways spaces of appearance—the spaces where human subjects appear to each other and are mutually recognized—are prescribed and regulated. How people enact their subjectivity is theorized through Arendt’s concept of storytelling as action, which through the work of Butler is reworked...
Curriculum Differential Enactment: The Interplay of Teacher, Class, and Curriculum Materials
Eisenmann, Tammy
2011-01-01
Curriculum materials' developers typically assume the existence of certain general social-educational classroom practices and norms. Conversely, the current study addresses the effects of context on curriculum enactment, focusing on the interrelations between teacher, class and curriculum materials. Each of the two case studies presented herein…
Directory of Open Access Journals (Sweden)
Melanie C Steffens
2015-12-01
Full Text Available According to common sense, things one has done are remembered better than things done by others that one has observed. On first sight, findings concerning memory for actions appear in line with that preconception: Performed actions (subject-performed tasks appear to be remembered particularly well, and better than observed actions (experimenter-performed tasks. A closer look, however, reveals important exceptions regarding this enactment effect. The aim of the present paper is critically evaluating the literature that compares memory for performed and observed tasks. In recognition memory, an enactment effect has regularly been observed. In free recall, however, findings depended on the experimental design: When performed and observed actions were intermixed, an enactment effect was typically found. In contrast, in designs where actions were either all performed or all observed, this was rarely the case. We discuss underlying memory processes, potential moderator variables, open questions, and implications.
Enacting the social relations of science
DEFF Research Database (Denmark)
Nielsen, Kristian Hvidtfelt
2008-01-01
This article investigates the writings of Danish science journalist Børge Michelsen from 1939 to 1956. As part of the international social relations of science movement in the period, Michelsen transformed science journalism from mere reporting on issues pertaining to science into performing...... the social function of science journalism: advancing and enacting the social relations of science. Based on analyses of Michelsen's articles and other initiatives, this study suggests that the social function of science journalism practiced by Michelsen showed many new and conflicting aspects. From...... new links to reinforce mutual relations between scientists and policy-makers, between scientists and journalists, and between science and the public. Finally, in the concluding remarks, the contemporary significance of Michelsen's social function of science journalism is discussed....
New Korean Record of Twenty Eight Species of the Family Ichneumonidae (Hymenoptera
Directory of Open Access Journals (Sweden)
Choi, Jin-Kyung
2014-04-01
Full Text Available We report twenty eight ichneumonid species new to Korea. These species belong to seven subfamilies. Among them five subfamilies, Diacritinae Townes, 1965, Microleptinae Townes, 1958, Orthocentrinae F$\\ddot{o} $ 수식 이미지rster, 1869, Orthopelmatinae Schmiedeknecht, 1910, Phrudinae Townes and Townes, 1949, are newly introduced to Korean fauna. All specimens are based on the insect collection of animal systematic laboratory at the Yeungnam University Gyeongsan Campus. Photographs of habitus of newly recorded subfamilies, diagnosis of 28 species and host information are provided.
Nike Twins Seven Seven: Nigerian Batik Artist.
LaDuke, Betty
1987-01-01
Chronicles the personal and professional life of Nike Twins Seven Seven (born 1951), a Nigerian batik artist, and her husband, Twins Seven Seven, a musician-artist, both of whom have received international acclaim. (BJV)
DRABBLE, LAURIE; THOMAS, SUE; O’CONNOR, LISA; ROBERTS, SARAH CM
2014-01-01
This article describes U.S. state policies related to alcohol use during pregnancy, using data from the National Institute on Alcohol Abuse and Alcoholism (NIAAA) Alcohol Policy Information System (APIS). Specifically, this study examines trends in policies enacted by states over time and types of policies enacted across states in the U.S., with a focus on whether laws were supportive or punitive toward women. Findings revealed substantial variability in characteristics of policies (19 primar...
The Evolution of Policy Enactment on Gender-Based Violence in Schools
Parkes, Jenny
2016-01-01
This article examines how policies and strategies to address school-related gender-based violence have evolved since 2000, when gender-based violence within education was largely invisible. Through an exploration of policy enactment in three countries--Liberia, South Africa, and Brazil--it traces remarkable progress in policy, programmes, and…
Scientific explanation in school: An enactive view
Ibrahim-Didi, Khadeeja
This study explores explanation-in-action, a corollary to an enactive orientation to cognition. Explanation, understood this way is identified as a semiotic, perceptually driven activity, where the interactions that arise between students that enable the engagement to continue indicate a certain tentative coherence of meaning that is brought forth in interaction in a constraining environment. Challenging summary state views of explanation as statement, this study explores the evolution of scientific explanation in two Grade Eight Maldivian classrooms. Enactivism, understood across different embodied cognitive systems, reconfigures the discourse on explanation by re-orienting the form in which explanation is understood. The notion of explanation-in-action as a topological function implicates the boundary of the cognitive system in the action. Further, it also recognizes that embedding boundaries and the dynamics that create the boundaries can constrain the explanation that occurs in different domains. In effect, the study calls for reconfiguring validation as in-action---as the constraining dynamic feature that emerges in the ongoing explanation-in-action. In the study I pay attention to the different boundaries of some systemic configurations in the classroom. I consider how the boundary conditions create the possibility for signification, and therefore, explanation. This research suggests that in explaining-in-action students are able to draw on the enabling possibilities of personal boundaries and the constraining social boundaries to further structure their explaining in ways that are local to the task at hand.
The role of enacted stigma in parental HIV disclosure among HIV-infected parents in China.
Qiao, Shan; Li, Xiaoming; Zhou, Yuejiao; Shen, Zhiyong; Tang, Zhenzhu; Stanton, Bonita
2015-01-01
Existing studies have delineated that HIV-infected parents face numerous challenges in disclosing their HIV infection to the children ("parental HIV disclosure"), and practices of parental HIV disclosure vary with individual characteristics, family contexts, and social environment. Using cross-sectional data from 1254 HIV-infected parents who had children aged 5-16 years in southwest China, the current study examined the association of parental HIV disclosure with mental health and medication adherence among parents and explored the possible effect of enacted stigma on such association. Multivariate analysis of variance revealed that parents who had experienced disclosure to children reported higher level enacted stigma, worse mental health conditions, and poorer medication adherence. Enacted stigma partially mediated the associations between disclosure and both mental health and medication adherence after controlling basic background characteristics. Our findings highlight the importance of providing appropriate disclosure-related training and counseling service among HIV-infected parents. In a social setting where HIV-related stigma is still persistent, disclosure intervention should address and reduce stigma and discrimination in the practice of parental HIV disclosure.
Presence and Enactment as a Vehicle of Psychotherapeutic Change
Viederman, Milton
1999-01-01
This article addresses an aspect of psychoanalytic and psychotherapeutic process that leads to change. Focusing on an aspect of the patient-therapist interaction that the author calls “presence” of the therapist, it demonstrates how the experience of this may lead the patient to unconscious enactment of early wishful fantasies concerning the good parent. The gratification of these wishes implicit in the interaction influences the therapist-patient relationship and plays a significant role in ...
Presence and enactment as a vehicle of psychotherapeutic change.
Viederman, M
1999-01-01
This article addresses an aspect of psychoanalytic and psychotherapeutic process that leads to change. Focusing on an aspect of the patient-therapist interaction that the author calls "presence" of the therapist, it demonstrates how the experience of this may lead the patient to unconscious enactment of early wishful fantasies concerning the good parent. The gratification of these wishes implicit in the interaction influences the therapist-patient relationship and plays a significant role in change.
Safety regulation - twenty years after Chernobyl accident
International Nuclear Information System (INIS)
Aleksashin, P.P.; Bukrinskij, A.M.; Gordon, B.G.
2006-01-01
Main stages of development, successes, achievements and shortcomings of activity of supervision body after the Chernobyl NPP accident are analysed. The estimation of the realized variations of the functions of the state supervision department is carried out. Results of the twenty year period of improvement of the supervision body are summed up. The measures for increasing the efficiency of the supervision body operation are outlined [ru
Chapman, Ashton; Ganong, Lawrence; Coleman, Marilyn; Kang, Youngjin; Sanner, Caroline; Russell, Luke T
2017-11-10
Stepgrandparents are becoming more common, and they can, and often do, provide affective and instrumental support to families. Little is known, however, about how they negotiate and enact their roles within families, especially with stepgrandchildren. Stepgrandmothers warrant special attention because researchers have found that women experience more challenges than men in stepfamilies. Guided by symbolic interactionism, the purposes of our study were: (a) to explore stepgrandmothers' role enactment and (b) to explore the intrapersonal, interpersonal, and contextual factors that contribute to role enactment in intergenerational steprelationships. Eighteen stepgrandmothers participated in semi-structured interviews, discussing their relationships with 94 stepgrandchildren. Consistent with grounded theory methods, data collection and analysis occurred simultaneously. Interviews with stepgrandmothers revealed that they spend considerable time and energy defining their roles with stepgrandchildren. Stepgrandmothers' role enactment is a complex, reflexive process. A few perceived that their roles were shaped by their own dispositions, desires, and expectations (evidence for role-making), but most stepgrandmothers described their roles as reflecting the dispositions, desires, and expectations of others (evidence for role-taking). Stepgrandmothers reflected on their roles as a delicate balance of intra- and inter-personal negotiations, operating within cultural expectations. Findings draw attention to the complex nature of role-taking, role-making, and gendered, relational processes in multigenerational stepfamilies. We discuss implications for research and theory related to stepgrandmotherhood as an incomplete institution. © The Author 2016. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Information report on state legislation
International Nuclear Information System (INIS)
1982-01-01
Summaries of laws enacted by states, during 1982, dealing with the management of low-level radioactive wastes are presented in this report. Also included are adopted resolutions, introduced legislation and introduced resolutions
RT-PCR for detection of all seven genotypes of Lyssavirus genus.
Vázquez-Morón, S; Avellón, A; Echevarría, J E
2006-08-01
The Lyssavirus genus includes seven species or genotypes named 1-7. Rabies genotypes correlate with geographical distribution and specific hosts. Co-circulation of different lyssaviruses, imported cases, and the presence of unknown viruses, such as Aravan, Khujand, Irkut and West Caucasian Bat Virus, make it necessary to use generic methods able to detect all lyssaviruses. Primer sequences were chosen from conserved regions in all genotypes in order to optimise a generic RT-PCR. Serial dilutions of 12 RNA extracts from all seven Lyssavirus genotypes were examined to compare the sensitivity of the RT-PCR standardised in this study with a published RT-PCR optimised for EBLV1 detection and capable of amplifying RNA from all seven lyssaviruses. All seven genotypes were detected by both RT-PCRs, however, the sensitivity was higher with the new version of the test. Twenty samples submitted for rabies diagnosis were tested by the new RT-PCR. Eight out of 20 samples from six dogs, one horse and one bat were found positive, in agreement with immunofluorescence results. Seven samples from terrestrial mammals were genotype 1 and one from a bat was genotype 5. In conclusion, this method can be used to complement immunofluorescence for the diagnosis of rabies, enabling the detection of unexpected lyssaviruses during rabies surveillance.
Directory of Open Access Journals (Sweden)
Dylan van der Schyff
2017-09-01
Full Text Available Despite evolutionary musicology's interdisciplinary nature, and the diverse methods it employs, the field has nevertheless tended to divide into two main positions. Some argue that music should be understood as a naturally selected adaptation, while others claim that music is a product of culture with little or no relevance for the survival of the species. We review these arguments, suggesting that while interesting and well-reasoned positions have been offered on both sides of the debate, the nature-or-culture (or adaptation vs. non-adaptation assumptions that have traditionally driven the discussion have resulted in a problematic either/or dichotomy. We then consider an alternative “biocultural” proposal that appears to offer a way forward. As we discuss, this approach draws on a range of research in theoretical biology, archeology, neuroscience, embodied and ecological cognition, and dynamical systems theory (DST, positing a more integrated model that sees biological and cultural dimensions as aspects of the same evolving system. Following this, we outline the enactive approach to cognition, discussing the ways it aligns with the biocultural perspective. Put simply, the enactive approach posits a deep continuity between mind and life, where cognitive processes are explored in terms of how self-organizing living systems enact relationships with the environment that are relevant to their survival and well-being. It highlights the embodied and ecologically situated nature of living agents, as well as the active role they play in their own developmental processes. Importantly, the enactive approach sees cognitive and evolutionary processes as driven by a range of interacting factors, including the socio-cultural forms of activity that characterize the lives of more complex creatures such as ourselves. We offer some suggestions for how this approach might enhance and extend the biocultural model. To conclude we briefly consider the
van der Schyff, Dylan; Schiavio, Andrea
2017-01-01
Despite evolutionary musicology's interdisciplinary nature, and the diverse methods it employs, the field has nevertheless tended to divide into two main positions. Some argue that music should be understood as a naturally selected adaptation, while others claim that music is a product of culture with little or no relevance for the survival of the species. We review these arguments, suggesting that while interesting and well-reasoned positions have been offered on both sides of the debate, the nature-or-culture (or adaptation vs. non-adaptation) assumptions that have traditionally driven the discussion have resulted in a problematic either/or dichotomy. We then consider an alternative "biocultural" proposal that appears to offer a way forward. As we discuss, this approach draws on a range of research in theoretical biology, archeology, neuroscience, embodied and ecological cognition, and dynamical systems theory (DST), positing a more integrated model that sees biological and cultural dimensions as aspects of the same evolving system. Following this, we outline the enactive approach to cognition, discussing the ways it aligns with the biocultural perspective. Put simply, the enactive approach posits a deep continuity between mind and life, where cognitive processes are explored in terms of how self-organizing living systems enact relationships with the environment that are relevant to their survival and well-being. It highlights the embodied and ecologically situated nature of living agents, as well as the active role they play in their own developmental processes. Importantly, the enactive approach sees cognitive and evolutionary processes as driven by a range of interacting factors, including the socio-cultural forms of activity that characterize the lives of more complex creatures such as ourselves. We offer some suggestions for how this approach might enhance and extend the biocultural model. To conclude we briefly consider the implications of this approach for
van der Schyff, Dylan; Schiavio, Andrea
2017-01-01
Despite evolutionary musicology's interdisciplinary nature, and the diverse methods it employs, the field has nevertheless tended to divide into two main positions. Some argue that music should be understood as a naturally selected adaptation, while others claim that music is a product of culture with little or no relevance for the survival of the species. We review these arguments, suggesting that while interesting and well-reasoned positions have been offered on both sides of the debate, the nature-or-culture (or adaptation vs. non-adaptation) assumptions that have traditionally driven the discussion have resulted in a problematic either/or dichotomy. We then consider an alternative “biocultural” proposal that appears to offer a way forward. As we discuss, this approach draws on a range of research in theoretical biology, archeology, neuroscience, embodied and ecological cognition, and dynamical systems theory (DST), positing a more integrated model that sees biological and cultural dimensions as aspects of the same evolving system. Following this, we outline the enactive approach to cognition, discussing the ways it aligns with the biocultural perspective. Put simply, the enactive approach posits a deep continuity between mind and life, where cognitive processes are explored in terms of how self-organizing living systems enact relationships with the environment that are relevant to their survival and well-being. It highlights the embodied and ecologically situated nature of living agents, as well as the active role they play in their own developmental processes. Importantly, the enactive approach sees cognitive and evolutionary processes as driven by a range of interacting factors, including the socio-cultural forms of activity that characterize the lives of more complex creatures such as ourselves. We offer some suggestions for how this approach might enhance and extend the biocultural model. To conclude we briefly consider the implications of this approach
International Nuclear Information System (INIS)
Carbiener, W.A.
1983-01-01
The identification of potential sites for a nuclear waste repository through screening procedures in the salt states is a well-established, deliberate process. This screening process has made it possible to carry out detailed studies of many of the most promising potential sites, and general studies of all the sites, in anticipation of the siting guidelines specified in the Nuclear Waste Policy Act. The screening work completed prior to the passage of the Act allowed the Secretary of Energy to identify seven salt sites as potentially acceptable under the provisions of Section 116(a) of the Act. These sites were formally identified by letters from Secretary Hodel to the states of Texas, Utah, Mississippi, and Louisiana on February 2, 1983. The potentially acceptable salt sites were in Deaf Smith and Swisher Counties in Texas; Davis and Lavender Canyons in the Gibson Dome location in Utah; Richton and Cypress Creek Domes in Mississippi; and Vacherie Dome in Louisiana. Further screening will include comparison of each potentially acceptable site against disqualification factors and selection of a preferred site in each of the three geohydrologic settings from those remaining, in accordance with the siting guidelines. These steps will be documented in statutory Environmental Assessments prepared for each site to be nominated for detailed characterization. 9 references
An Empirical Comparison of Seven Iterative and Evolutionary Function Optimization Heuristics
Baluja, Shumeet
1995-01-01
This report is a repository of the results obtained from a large scale empirical comparison of seven iterative and evolution-based optimization heuristics. Twenty-seven static optimization problems, spanning six sets of problem classes which are commonly explored in genetic algorithm literature, are examined. The problem sets include job-shop scheduling, traveling salesman, knapsack, binpacking, neural network weight optimization, and standard numerical optimization. The search spaces in these problems range from 2368 to 22040. The results indicate that using genetic algorithms for the optimization of static functions does not yield a benefit, in terms of the final answer obtained, over simpler optimization heuristics. Descriptions of the algorithms tested and the encodings of the problems are described in detail for reproducibility.
Barriers and Enablers to Enacting Child and Youth Related Injury Prevention Legislation in Canada
Directory of Open Access Journals (Sweden)
Linda Rothman
2016-07-01
Full Text Available Injury prevention policy is crucial for the safety of Canada’s children; however legislation is not adopted uniformly across the country. This study aimed to identify key barriers and enablers to enacting injury prevention legislation. Purposive snowball sampling identified individuals involved in injury prevention throughout Canada. An online survey asked respondents to identify policies that were relevant to them, and whether legislation existed in their province. Respondents rated the importance of barriers or enablers using a 5-point Likert type scale and included open-ended comments. Fifty-seven respondents identified the most common injury topics: bicycle helmets (44, 77%, cell phone-distracted driving (36, 63%, booster seats (28, 49%, ski helmets (24, 42%, and graduated driver’s licensing (21, 37%. The top enablers were research/surveillance, managerial/political support and professional group consultation, with much variability between injury topics. Open-ended comments emphasized the importance of a united opinion as an enabler and barriers included costs of protective equipment and inadequate enforcement of legislation. The results highlighted the importance of strategies that include research, management and community collaboration and that injury prevention topics should be addressed individually as information may be lost if topics are considered together. Findings can inform the process of turning injury prevention evidence into action.
Nursing students' understanding and enactment of resilience: a grounded theory study.
Reyes, Andrew Thomas; Andrusyszyn, Mary-Anne; Iwasiw, Carroll; Forchuk, Cheryl; Babenko-Mould, Yolanda
2015-11-01
The aim of this study was to explore nursing students' understanding and enactment of resilience. Stress is considered to be a major factor affecting the health, well-being and academic performance of nursing students. Resilience has been extensively researched as a process that allows individuals to successfully adapt to adversity and develop positive outcomes as a result. However, relatively little is known about the resilience of nursing students. A constructivist, grounded theory qualitative design was used for this study. In-depth individual interviews were conducted with 38 nursing students enrolled in a four-year, integrated baccalaureate nursing degree programme at a university in Ontario, Canada. Face-to-face interviews were conducted from January to April 2012 using a semi-structured interview guide. The basic social process of 'pushing through' emerged as nursing students' understanding and enactment of resilience. Participants employed this process to withstand challenges in their academic lives. This process was comprised of three main phases: 'stepping into', 'staying the course' and 'acknowledging'. 'Pushing through' also included a transient 'disengaging' process where students were temporarily unable to push through their adversities. The process of 'pushing through' was based on a progressive trajectory, which implied that nursing students enacted the process to make progress in their academic lives and to attain goals. Study findings provide important evidence for understanding the phenomenon of resilience as a dynamic, contextual process that can be learnt and developed, rather than a static trait or personality characteristic. © 2015 John Wiley & Sons Ltd.
King, T.C.
2016-01-01
This dissertation is motivated by the need, in today’s globalist world, for a precise way to enable governments, organisations and other regulatory bodies to evaluate the constraints they place on themselves and others. An organisation’s modus operandi is enacting and fulfilling contracts between
What’s so Critical about Critical Neuroscience? -Rethinking Experiment, Enacting Critique
Directory of Open Access Journals (Sweden)
Des eFitzgerald
2014-05-01
Full Text Available In the midst of on-going hype about the power and potency of the new brain sciences, scholars within ‘Critical Neuroscience’ have called for a more nuanced and sceptical neuroscientific knowledge-practice. Drawing especially on the Frankfurt School, they urge neuroscientists towards a more critical approach – one that re-inscribes the objects and practices of neuroscientific knowledge within webs of social, cultural, historical and political-economic contingency. This paper is an attempt to open up the black-box of ‘critique’ within Critical Neuroscience itself. Specifically, we argue that limiting enactments of critique to the invocation of context misses the force of what a highly-stylized and tightly-bound neuroscientific experiment can actually do. We show that, within the neuroscientific experiment itself, the world-excluding and context-denying ‘rules of the game’ may also enact critique, in novel and surprising forms, while remaining formally independent of the workings of society, and culture, and history. To demonstrate this possibility, we analyze the Optimally Interacting Minds paradigm, a neuroscientific experiment that used classical psychophysical methods to show that, in some situations, people worked better as a collective, and not as individuals – a claim that works precisely against reactionary tendencies that prioritise individual over collective agency, but that was generated and legitimized entirely within the formal, context-denying conventions of neuroscientific experimentation. At the heart of this paper is a claim that it was precisely the rigours and rules of the experimental game that allowed these scientists to enact some surprisingly critical, and even radical, gestures. We conclude by suggesting that, in the midst of large-scale neuroscientific initiatives, it may be 'experiment,' and not 'context,' that forms the meeting-ground between neuro-biological and socio-political research practices.
Encouraging Reading through an Enactive Method: Strategies for Hearing Impaired Children.
Winzer, M. A.
The paper describes the enactive method, an alternative approach to introducing and teaching reading to young hearing impaired children. The method actively involves the child as a processor of the material rather than as a passive consumer. The approach is established for a short period of time each day until the student outgrows its original…
D'Andreta, Daniela; Scarbrough, Harry; Evans, Sarah
2013-10-01
We contribute to existing knowledge translation (KT) literature by developing the notion of 'enactment' and illustrate this through an interpretative, comparative case-study analysis of three Collaborations for Leadership in Applied Health Research and Care (CLAHRC) initiatives. We argue for a focus on the way in which the CLAHRC model has been 'enacted' as central to the different KT challenges and capabilities encountered. A comparative, mixed method study created a typology of enactments (Classical, Home-grown and Imported) using qualitative analysis and social network analysis. We identify systematic differences in the enactment of the CLAHRC model. The sources of these different enactments are subsequently related to variation in formative interpretations and leadership styles, the implementation of different governance structures, and the relative epistemic differences between the professional groups involved. Enactment concerns the creative agency of individuals and groups in constituting a particular context for their work through their local interpretation of a particular KT model. Our theory of enactment goes beyond highlighting variation between CLAHRCs, to explore the mechanisms that influence the way a particular model is interpreted and acted upon. We thus encourage less focus on conceptual models and more on the formative role played by leaders of KT initiatives.
Bodzin, Alec M.; Fu, Qiong; Kulo, Violet; Peffer, Tamara
2014-08-01
A potential method for teaching geospatial thinking and reasoning (GTR) is through geospatially enabled learning technologies. We developed an energy resources geospatial curriculum that included learning activities with geographic information systems and virtual globes. This study investigated how 13 urban middle school teachers implemented and varied the enactment of the curriculum with their students and investigated which teacher- and student-level factors accounted for students' GTR posttest achievement. Data included biweekly implementation surveys from teachers and energy resources content and GTR pre- and posttest achievement measures from 1,049 students. Students significantly increased both their energy resources content knowledge and their GTR skills related to energy resources at the end of the curriculum enactment. Both multiple regression and hierarchical linear modeling found that students' initial GTR abilities and gain in energy content knowledge were significantly explanatory variables for their geospatial achievement at the end of curriculum enactment, p critical components of the curriculum or the number of years the teachers had taught the curriculum, did not have significant effects on students' geospatial posttest achievement. The findings from this study provide support that learning with geospatially enabled learning technologies can support GTR with urban middle-level learners.
Frumkin, Peter; Manno, Bruno V.; Edgington, Nell
2011-01-01
"The Strategic Management of Charter Schools" addresses the challenges facing such schools by mapping out, in straightforward and highly pragmatic terms, a management framework for them. The first charter school law in the United States was enacted in Minnesota in 1991. In the twenty years since that modest beginning, the movement has burgeoned…
"Hiding in Plain Sight": An Interview with Cara Hoffman
Hosey, Sara
2014-01-01
Cara Hoffman's work enacts George Orwell's imperative to "pay attention to the obvious" (an idea that several sympathetic characters repeat in her 2011 novel "So Much Pretty"), probing aspects of twenty-first century life in the United States that have become so accepted as to be unremarkable, such as epidemic levels of…
Enacting archetypes in movies : grounding the unconscious mind in emotion-driven media
Chang, H.; Ivonin, L.; Diaz, M.; Català, A.; Chen, W.; Rauterberg, G.W.M.
2015-01-01
The concept of emotion-driven media integrates affective computing into developing new types of digital media by including the human spectator as an essential part of the whole system. Enactive media, as a landmark in this direction, provides a theoretical basis that is rooted in the enactivist
Reading postcards: Multiple enactments of tourism destinations. The case of Pai, Thailand
Pongajarn, C.; Duim, van der V.R.; Peters, K.B.M.
2014-01-01
Actor-network theory was used to examine the role of postcards in the enactment of tourism destinations by analysing the representational and non-representational readings of 325 postcards offered for sale in shops in Pai, northern Thailand. This paper illustrates how postcards take part in the
2010-10-01
... the enactment of the Rural Water Supply Act of 2006 have to comply with the requirements in this rule... RECLAMATION, DEPARTMENT OF THE INTERIOR RECLAMATION RURAL WATER SUPPLY PROGRAM Miscellaneous § 404.58 Do rural water projects authorized before the enactment of the Rural Water Supply Act of 2006 have to comply with...
Complex dream-enacting behavior in sleepwalking.
Pillmann, Frank
2009-02-01
Currently, dream-enacting behaviors are viewed as occurring typically in association with a REM-sleep behavior disorder. In some cases, dream-like mentation is found also in non-REM parasomnia. We report a case of complex and dramatic sleepwalking behavior in a 26-year-old adult male who tied his 4-month-old daughter to the clothesline in the attic of his house. The explanation of this seemingly senseless behavior, which was related to psychosocial stressors, was found in a detailed dream-like mentation that was reported by the patient. At the same time, an organic factor, namely, a worsening of the patient's asthma, was identified as the cause of an increased fragmentation of sleep. In some cases of non-REM parasomnia, detailed dream-like mentation may act as a bridge between psychosocial stressors and the specific parasomnic behavior.
Shu, Bo; Garten, Rebecca; Emery, Shannon; Balish, Amanda; Cooper, Lynn; Sessions, Wendy; Deyde, Varough; Smith, Catherine; Berman, LaShondra; Klimov, Alexander; Lindstrom, Stephen; Xu, Xiyan
2012-01-05
Swine influenza viruses (SIV) have been recognized as important pathogens for pigs and occasional human infections with swine origin influenza viruses (SOIV) have been reported. Between 1990 and 2010, a total of twenty seven human cases of SOIV infections have been identified in the United States. Six viruses isolated from 1990 to 1995 were recognized as classical SOIV (cSOIV) A(H1N1). After 1998, twenty-one SOIV recovered from human cases were characterized as triple reassortant (tr_SOIV) inheriting genes from classical swine, avian and human influenza viruses. Of those twenty-one tr_SOIV, thirteen were of A(H1N1), one of A(H1N2), and seven of A(H3N2) subtype. SOIV characterized were antigenically and genetically closely related to the subtypes of influenza viruses circulating in pigs but distinct from contemporary influenza viruses circulating in humans. The diversity of subtypes and genetic lineages in SOIV cases highlights the importance of continued surveillance at the animal-human interface. Copyright © 2011. Published by Elsevier Inc.
Kilpatrick, Kelley; Lavoie-Tremblay, Mélanie; Lamothe, Lise; Ritchie, Judith A; Doran, Diane
2013-01-01
This article describes a new conceptual framework for acute care nurse practitioner role enactment, boundary work and perceptions of team effectiveness. Acute care nurse practitioners contribute positively to patient care by enacting an expanded scope of practise. Researchers have found both positive and negative reactions to the introduction of acute care nurse practitioners in healthcare teams. The process of role enactment, shifting role boundaries, and perceptions of team effectiveness has been studied disparately. A framework linking team structures and processes to desirable outcomes is needed. Literature was obtained by searching CINAHL, PsycInfo, MedLine, PubMed, British Nursing Index, Cochrane Library, JSTOR Archive, Web of Science, and Google Scholar from 1985-2010. A descriptive multiple-case study was completed from March 2009-May 2009. A new conceptual framework describing how role enactment and boundary work affect perceptions of team effectiveness was developed by combining theoretical and empirical sources. The framework proposes proximal indicators used by team members to assess their team's performance. The framework identifies the inter-related dimensions and concepts that different stakeholders need to consider when introducing nurse practitioners in healthcare teams. Further study is needed to identify team-level outcomes that reflect the contributions of all providers to quality patient care, and explore the patients' and families' perceptions of team effectiveness following the introduction of acute care nurse practitioners. The new framework can guide decision-making and research related to the structures, processes, and outcomes of nurse practitioner roles in healthcare teams. © 2012 Blackwell Publishing Ltd.
An Analysis of How Carl Rogers Enacted Client-Centered Conversation with Gloria.
Wickman, Scott A.; Campbell, Cynthia
2003-01-01
This study analyzed Carl Rogers's session with Gloria in "Three Approaches to Psychotherapy" to determine how Rogers's conversational style functioned to enact his core conditions of empathy, genuineness, and unconditional positive regard. Rogers's conversational style was found to be congruent with his espoused theory as well as a…
Enacted Stigma, Mental Health, and Protective Factors Among Transgender Youth in Canada
Veale, Jaimie F.; Peter, Tracey; Travers, Robb; Saewyc, Elizabeth M.
2017-01-01
Abstract Purpose: We aimed to assess the Minority Stress Model which proposes that the stress of experiencing stigma leads to adverse mental health outcomes, but social supports (e.g., school and family connectedness) will reduce this negative effect. Methods: We measured stigma-related experiences, social supports, and mental health (self-injury, suicide, depression, and anxiety) among a sample of 923 Canadian transgender 14- to 25-year-old adolescents and young adults using a bilingual online survey. Logistic regression models were conducted to analyze the relationship between these risk and protective factors and dichotomous mental health outcomes among two separate age groups, 14- to 18-year-old and 19- to 25-year-old participants. Results: Experiences of discrimination, harassment, and violence (enacted stigma) were positively related to mental health problems and social support was negatively associated with mental health problems in all models among both age groups. Among 14–18 year olds, we examined school connectedness, family connectedness, and perception of friends caring separately, and family connectedness was always the strongest protective predictor in multivariate models. In all the mental health outcomes we examined, transgender youth reporting low levels of enacted stigma experiences and high levels of protective factors tended to report favorable mental health outcomes. Conversely, the majority of participants reporting high levels of enacted stigma and low levels of protective factors reported adverse mental health outcomes. Conclusion: While these findings are limited by nonprobability sampling procedures and potential additional unmeasured risk and protective factors, the results provide positive evidence for the Minority Stress Model in this population and affirm the need for policies and programs to support schools and families to support transgender youth. PMID:29279875
Student veterans' construction and enactment of resilience: A constructivist grounded theory study.
Reyes, A T; Kearney, C A; Isla, K; Bryant, R
2018-02-01
WHAT IS KNOWN ON THE SUBJECT?: Resilience is an ability and a process that allows an individual to develop positive adaptation despite challenges and adversities. Many military veterans returning to college after their military service have difficulty transitioning to civilian life. Although some research exists that explores factors related to the resilience of college student veterans, limited theoretical descriptions exist that explain how student veterans construct resilience, and how resilience is enacted and enhanced in their academic and personal (non-academic) lives. WHAT THIS PAPER ADDS TO EXISTING KNOWLEDGE?: The resilience of student veterans involves a complex process of transitioning from military to civilian life and an iterative journey between positive adaptation and transient perturbations. Student veterans' resilience is a result of integrating and resolving various aspects of their academic and personal challenges. WHAT ARE THE IMPLICATIONS FOR PRACTICE?: Nurses can apply this grounded theory as a practical framework for equipping student veterans with effective strategies to develop and enhance resilience. Nurses can employ a holistic approach of care in their interactions with military veterans and student veterans that includes fostering psychological resilience, helping to manage their multiple non-academic responsibilities and supporting their academic success. Introduction Adjusting to college life is one of the most difficult experiences in a military veteran's transition to civilian life. Many military veterans returning to college not only encounter academic challenges, but also deal with physical and psychiatric disabilities, loss of military camaraderie and social disconnect. These often negatively affect their personal and academic lives. Hence, it is important to explore resilience to best support student veterans as they transition from military to civilian life. Aim The aim of this study was to explore how student veterans
Dimichino, Daniela C.
This mixed-methods case study, influenced by aspects of grounded theory, aims to explore the relationships among a teacher's attitude toward inquiry-based middle school reform, their enactment of such a curriculum, and student interest and achievement in science. A solid theoretical basis was constructed from the literature on the benefits of inquiry-based science over traditional science education, the benefits of using constructivist learning techniques in the classroom, the importance of motivating teachers to change their teaching practices to be more constructive, and the importance of motivating and exciting students in order to boost achievement in science. Data was collected using qualitative documents such as teacher and student interviews, classroom observations, and curriculum development meetings, in addition to quantitative documents such as student science interest surveys and science skills tests. The qualitative analysis focused on examining teacher attitudes toward curricular reform efforts, and the enactments of three science teachers during the initial year of an inquiry-based middle school curriculum adoption using a fidelity of implementation tool constructed from themes that emerged from the data documents utilized in this study. In addition, both qualitative and quantitative tools were used to measure an increase or decrease in student interest and student achievement over the study year, and their resulting relationships to their teachers' attitudes and enactments of the curriculum. Results from data analysis revealed a positive relationship between the teachers' attitude toward curricular change and their fidelity of implementation to the developers' intentions, or curricular enactment. In addition, strong positive relationships were also discovered among teacher attitude, student interest, and student achievement. Variations in teacher enactment also related to variations in student interest and achievement, with considerable positive
International Nuclear Information System (INIS)
Hrehor, M.
1979-01-01
The paper deals with an application of the finite element method to the heat transfer study in seven-pin models of LMFBR fuel subassembly. The developed code NCEL solves two-dimensional steady state heat conduction equation in the whole subassembly model cross-section and enebles to perform the analysis of thermal behaviour in both normal and accidental operational conditions as eccentricity of the central rod or full or partial (porous) blockage of some part of the cross-flow area. The heat removal is simulated by heat sinks in coolant under conditions of subchannels slug flow approximation
A Failed Experiment: Georgia's Tax Credit Scholarships for Private Schools
Southern Education Foundation, 2011
2011-01-01
Georgia is one of seven states that currently allow tax credits for scholarships to private schools. Georgia's law was enacted in May 2008 in order to assist low income students to transfer out of low performing public schools. Operations under the new act began in late 2008. The law permits taxpayers in Georgia to reduce their annual state taxes…
Grbic, Jelica; Goddard, Perilou; Ryder, David
2017-04-01
Clinical trials have shown cannabis to be effective in the treatment of some medical conditions and there is mounting public and political pressure to enact laws enabling the use of cannabis for medicinal purposes. To date, 28 United States (U.S.) states and the District of Columbia have enacted medical cannabis laws. This study sought to identify the main issues pertaining to the development of medical cannabis laws in the U.S, including the role of scientific evidence. Data were collected from three groups of participants: government officials, lobbyists and medical professionals involved in the medical cannabis debate in five selected states in the U.S.; researchers from the same five states conducting funded research in the alcohol and other drugs field; and members of the International Society for the Study of Drug Policy. The data were analysed using thematic analysis. Six major themes emerged in relation to the factors influencing policy: scientific evidence plays a limited role in the development of policy; the available research is limited and mixed; there is a need for clearer communication and active dissemination of evidence to policy makers; researchers need to consider what research is likely to impact on policy; scientific evidence is not a major factor in policy development; and there is a need to consider evidence within a political context. Researchers need to be aware of the political context in which medical cannabis laws are or are not enacted and consider ways in which research findings can achieve a higher profile within this context. Copyright © 2016. Published by Elsevier B.V.
Ironside, Pamela M
2003-11-01
The need to prepare students for a rapidly changing health care system sustains teachers' interest in developing students' thinking abilities at all levels of nursing education. Although significant effort has been directed toward developing efficient and effective strategies to teach thinking, this study explores the underlying assumptions embedded in any approach to teaching and learning and how these assumptions influence students' thinking. This study, using Heideggerian hermeneutics, explored how teachers and students experience enacting a new pedagogy, Narrative Pedagogy, and this article explains how enacting this pedagogy offers new possibilities for teaching and learning thinking. Two themes emerged from this analysis and are discussed: Thinking as Questioning: Preserving Perspectival Openness and Practicing Thinking: Preserving Fallibility and Uncertainty.
State, Foreign Operations, and Related Programs: FY2008 Appropriations
National Research Council Canada - National Science Library
Veillette, Connie; Epstein, Susan B
2007-01-01
... an unprecedented level compared with the past 40 years. Emergency supplementals enacted since the September 11, 2001, terrorist attacks to assist the front-line states in the war on terrorism, fund Afghanistan and Iraq reconstruction, and upgrade State...
Complex negotiations: the lived experience of enacting agency after a stroke.
Bergström, Aileen L; Eriksson, Gunilla; Asaba, Eric; Erikson, Anette; Tham, Kerstin
2015-01-01
This qualitative, longitudinal, descriptive study aimed to understand the lived experience of enacting agency, and to describe the phenomenon of agency and the meaning structure of the phenomenon during the year after a stroke. Agency is defined as making things happen in everyday life through one's actions. This study followed six persons (three men and three women, ages 63 to 89), interviewed on four separate occasions. Interview data were analysed using the Empirical Phenomenological Psychological method. The main findings showed that the participants experienced enacting agency in their everyday lives after stroke as negotiating different characteristics over a span of time, a range of difficulty, and in a number of activities, making these negotiations complex. The four characteristics described how the participants made things happen in their everyday lives through managing their disrupted bodies, taking into account their past and envisioning their futures, dealing with the world outside themselves, and negotiating through internal dialogues. This empirical evidence regarding negotiations challenges traditional definitions of agency and a new definition of agency is proposed. Understanding clients' complex negotiations and offering innovative solutions to train in real-life situations may help in the process of enabling occupations after a stroke.
Why the American public supports twenty-first century learning.
Sacconaghi, Michele
2006-01-01
Aware that constituent support is essential to any educational endeavor, the AOL Time Warner Foundation (now the Time Warner Foundation), in conjunction with two respected national research firms, measured Americans' attitudes toward the implementation of twenty-first century skills. The foundation's national research survey was intended to explore public perceptions of the need for changes in the educational system, in school and after school, with respect to the teaching of twenty-first century skills. The author summarizes the findings of the survey, which were released by the foundation in June 2003. One thousand adults were surveyed by telephone, including African Americans, Latinos, teachers, and business executives. In general, the survey found that Americans believe today's students need a "basics-plus" education, meaning communication, technology, and critical thinking skills in addition to the traditional basics of reading, writing, and math. In fact, 92 percent of respondents stated that students today need different skills from those of ten to twenty years ago. Also, after-school programs were found to be an appropriate vehicle to teach these skills. Furthermore, the survey explored how well the public perceives schools to be preparing youth for the workforce and postsecondary education, which twenty-first century skills are seen as being taught effectively, and the level of need for after-school and summer programs. The survey results provide conclusive evidence of national support for basics-plus education. Thus, a clear opportunity exists to build momentum for a new model of education for the twenty-first century.
Drewry, Jonathan; Sen, Bisakha; Wingate, Martha; Bronstein, Janet; Foster, E Michael; Kotelchuck, Milton
2015-07-01
The 2002 "unborn child ruling" resulted in State Children's Health Insurance Program (SCHIP) expansion for states to cover prenatal care for low-income women without health insurance. Foreign-born Latinas who do not qualify for Medicaid coverage theoretically should have benefited most from the policy ruling given their documented low rates of prenatal care utilization. This study compares prenatal care utilization and subsequent birth outcomes among foreign-born Latinas in six states that used the unborn child ruling to expand coverage to those in ten states that did not implement the expansion. This policy analysis examines cross-sectional pooled US natality data from the pre-enactment years (2000-2003) versus post-enactment years (2004-2007) to estimate the effect of the UCR on prenatal care utilization and birth outcome measures for foreign-born Latinas. Then using a difference-in-difference estimator, we assessed these differences across time for states that did or did not enact the unborn child ruling. Analyses were then replicated on a high-risk subset of the population (single foreign-born Latinas with lower levels of education). The SCHIP unborn child ruling policy expansion increased PNCU over time in the six enacting states. Foreign-born Latinas in expansion enacting states experienced increases in prenatal care utilization though only the high-risk subset were statistically significant. Birth outcomes did not change. The SCHIP unborn child ruling policy was associated with enhanced PNC for a subset of high-risk foreign-born Latinas.
Gestational diabetes: women's concerns, mood state, quality of life and treatment satisfaction.
Trutnovsky, Gerda; Panzitt, Thomas; Magnet, Eva; Stern, Christina; Lang, Uwe; Dorfer, Martha
2012-11-01
The aim of this observational cohort study was to explore concerns, mood state, quality of life (QoL) and treatment satisfaction of women treated for gestational diabetes (GDM). Twenty-seven diet-treated and 18 insulin-treated women participated in a semi-structured interview and completed a series of three different questionnaires. Qualitative analysis identified "the baby's health" as dominant concern, but also as main motivational treatment factor. Treatment satisfaction was generally high and further increased, whereas QoL and mood state significantly dropped over time. Acknowledgment of women's concerns and precise information may improve treatment compliance and outcome.
Getting Closer to the Action: Using the Virtual Enactment Method to Understand Burglary
Meenaghan, Amy; Nee, Claire; Van Gelder, Jean Louis; Otte, Marco; Vernham, Zarah
In this article we describe a new method, the Virtual Enactment Method (VEM), to enhance offender recall and motivation to disclose information by having burglars reflect on their experience while committing a crime in a simulated virtual environment. Participants, a sample of 61 incarcerated
Directory of Open Access Journals (Sweden)
Beat Meier
2018-06-01
Full Text Available Boosting memory with transcranial direct current stimulation (tDCS seems to be an elegant way to optimize learning. Here we tested whether tDCS to the left dorsolateral prefrontal cortex or to the left posterior parietal cortex would boost recognition memory in general and/or particularly for action phrases enacted at study. During study, 48 young adults either read or enacted simple action phrases. Memory for the action phrases was assessed after a retention interval of 45 min and again after 7-days to investigate the long-term consequences of brain stimulation. The results showed a robust enactment effect in both test sessions. Moreover, the decrease in performance was more pronounced for reading than for enacting the phrases at study. However, tDCS did not reveal any effect on subsequent recognition memory performance. We conclude that memory benefits of tDCS are not easily replicated. In contrast, enactment at study reliably boosts subsequent memory.
Directory of Open Access Journals (Sweden)
Irlena Maria Malheiros da Costa
2016-06-01
Full Text Available The article analyzes the enactment of the victim of “children and adolescents sexual abuse” in the criminal justice system of Fortaleza. For a person to be recognized as a victim of “children and adolescents sexual abuse”, it is necessary more than a sexual situation imposed by adults. It is necessary to enact a dossier able to convince the judge that there was an event with the characteristics typified by the Brazilian Penal Code. It is in enactment a crime that a victim is being enacted. However, the elements expected by are not always found criminal justice system, which it can form disbelief in justice and repentance of the complaint.
Hay, Lauren E.; Markstrom, Steven; Ward-Garrison, Christian D.
2011-01-01
The hydrologic response of different climate-change emission scenarios for the twenty-first century were evaluated in 14 basins from different hydroclimatic regions across the United States using the Precipitation-Runoff Modeling System (PRMS), a process-based, distributed-parameter watershed model. This study involves four major steps: 1) setup and calibration of the PRMS model in 14 basins across the United States by local U.S. Geological Survey personnel; 2) statistical downscaling of the World Climate Research Programme’s Coupled Model Intercomparison Project phase 3 climate-change emission scenarios to create PRMS input files that reflect these emission scenarios; 3) run PRMS for the climate-change emission scenarios for the 14 basins; and 4) evaluation of the PRMS output.This paper presents an overview of this project, details of the methodology, results from the 14 basin simulations, and interpretation of these results. A key finding is that the hydrological response of the different geographical regions of the United States to potential climate change may be very different, depending on the dominant physical processes of that particular region. Also considered is the tremendous amount of uncertainty present in the climate emission scenarios and how this uncertainty propagates through the hydrologic simulations. This paper concludes with a discussion of the lessons learned and potential for future work.
The New York State Bird Conservation Area (BCA) Program: A Model for the United States
M. F. Burger; D. J. Adams; T. Post; L. Sommers; B. Swift
2005-01-01
The New York State Bird Conservation Area (BCA) Program, modeled after the National Audubon Society?s Important Bird Areas Program, is based on legislation signed by Governor Pataki in 1997. New York is the first state in the nation to enact such a program. The BCA Program seeks to provide a comprehensive, ecosystem approach to conserving birds and their habitats on...
Narrativity and enaction: the social nature of literary narrative understanding.
Popova, Yanna B
2014-01-01
This paper proposes an understanding of literary narrative as a form of social cognition and situates the study of such narratives in relation to the new comprehensive approach to human cognition, enaction. The particular form of enactive cognition that narrative understanding is proposed to depend on is that of participatory sense-making, as developed in the work of Di Paolo and De Jaegher. Currently there is no consensus as to what makes a good literary narrative, how it is understood, and why it plays such an irreplaceable role in human experience. The proposal thus identifies a gap in the existing research on narrative by describing narrative as a form of intersubjective process of sense-making between two agents, a teller and a reader. It argues that making sense of narrative literature is an interactional process of co-constructing a story-world with a narrator. Such an understanding of narrative makes a decisive break with both text-centered approaches that have dominated both structuralist and early cognitivist study of narrative, as well as pragmatic communicative ones that view narrative as a form of linguistic implicature. The interactive experience that narrative affords and necessitates at the same time, I argue, serves to highlight the active yet cooperative and communal nature of human sociality, expressed in the many forms than human beings interact in, including literary ones.
Narrativity and Enaction: The Social Nature of Literary Narrative Understanding
Directory of Open Access Journals (Sweden)
Yanna B. Popova
2014-08-01
Full Text Available This paper proposes an understanding of literary narrative as a form of social cognition and situates the study of such narratives in relation to the new comprehensive approach to human cognition, enaction. The particular form of enactive cognition that narrative understanding is proposed to depend on is that of participatory sense-making, as developed in the work of Di Paolo and De Jaegher. Currently there is no consensus as to what makes a good literary narrative, how it is understood, and why it plays such an irreplaceable role in human experience. The proposal thus identifies a gap in the existing research on narrative by describing narrative as a form of intersubjective process of sense-making between two agents, a teller and a reader. It argues that making sense of narrative literature is an interactional process of co-constructing a story-world with a narrator. Such an understanding of narrative makes a decisive break with both text-centered approaches that have dominated both structuralist and early cognitivist study of narrative, as well as pragmatic communicative ones that view narrative as a form of linguistic implicature. The interactive experience that narrative affords and necessitates at the same time, I argue, serves to highlight the active yet cooperative and communal nature of human sociality, expressed in the many forms than human beings interact in, including literary ones.
Identification and characterization of twenty-seven short ...
Indian Academy of Sciences (India)
They have been successfully applied to resolve phylo- genetic relationships among various groups at different tax- onomic ranks (Nikaido et al. 2003; Chen et al. .... nizable flanking direct repeats (DRs) that are diagnostic of amplification via RNA intermediates during retrotransposi- tion (Weiner et al. 1986; Deininger 1989) ...
Chriqui, Jamie F.; Ribisl, Kurt M.; Wallace, Raedell M.; Williams, Rebecca S.; O’Connor, Jean C.; el Arculli, Regina
2014-01-01
All U.S. states regulate face-to-face tobacco sales at retail outlets. However, the recent growth of delivery sales of tobacco products by Internet and mail order vendors has prompted new state regulations focused on preventing youth access and tax evasion. To date, there are no comprehensive and systematic analyses of these laws. The objectives of this study were to: (1) document the historical enactment of the laws; (2) assess the nature and extent of the laws; and (3) conduct preliminary analyses to examine the relationship between states with laws and other factors that might predict enactment of or be impacted by these laws. Between 1995 and 2006, thirty-four states (67%) enacted a relevant law, with 23 states’ laws (45%) enacted between 2003 and 2006. Four states banned direct-to-consumer shipment of cigarettes. The remaining 30 states’ laws included a combination of requirements addressing minimum age/ID, payment issues, shipping, vendor licensure and related issues, tax collection/remittance, and penalties/enforcement. States with delivery sales laws also have stronger state excise tax rates, youth access to tobacco policies, and state tobacco control environments as well as higher cigarette excise tax revenue, past month cigarette use rates, and perceptions of risk of use by adolescents. This paper provides the policy context for understanding Internet and other cigarette delivery sales laws in the U.S. It also provides a systematic framework for ongoing policy surveillance and will contribute to future analyses of the impact of these laws on successfully reducing youth access to cigarettes and preventing tax evasion. PMID:18236290
Proceedings of Twenty-Seventh Annual Institute on Mining Health, Safety and Research
Energy Technology Data Exchange (ETDEWEB)
Bockosh, G.R. [ed.] [Pittsburgh Research Center, US Dept. of Energy (United States); Langton, J. [ed.] [Mine Safety and Health Administration, US Dept. of Labor (United States); Karmis, M. [ed.] [Virginia Polytechnic Institute and State University. Dept. of Mining and Minerals Engineering, Blacksburg (United States)
1996-12-31
This Proceedings contains the presentations made during the program of the Twenty-Seventh Annual Institute on Mining Health, Safety and Research held at Virginia Polytechnic Institute and State University, Blacksburg, Virginia, on August 26-28, 1996. The Twenty-Seventh Annual Institute on Mining, Health, Safety and Research was the latest in a series of conferences held at Virginia Polytechnic Institute and State University, cosponsored by the Mine Safety and Health Administration, United States Department of Labor, and the Pittsburgh Research Center, United States Department of Energy (formerly part of the Bureau of Mines, U. S. Department of Interior). The Institute provides an information forum for mine operators, managers, superintendents, safety directors, engineers, inspectors, researchers, teachers, state agency officials, and others with a responsible interest in the important field of mining health, safety and research. In particular, the Institute is designed to help mine operating personnel gain a broader knowledge and understanding of the various aspects of mining health and safety, and to present them with methods of control and solutions developed through research. Selected papers have been processed separately for inclusion in the Energy Science and Technology database.
Community Energy Systems and the Law of Public Utilities. Volume Twenty-seven. Missouri
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is given of the laws and programs of the State of Missouri governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
A Content Analysis of Protective Factors within States' Antibullying Laws
Weaver, Lori M.; Brown, James R.; Weddle, Daniel B.; Aalsma, Matthew C.
2013-01-01
State lawmakers have responded to school bullying by crafting antibullying legislation. By July 2011, 47 states enacted such laws, though varied widely in content and scope. This study systematically evaluated each state's antibullying legislation by focusing on the inclusion of individual, parental, and systemic protective factors through…
Directory of Open Access Journals (Sweden)
Noor Akma Mohd Salleh
2007-10-01
Full Text Available The adoption of innovative information systems (IS by small-and medium-sized enterprises (SMEs across heterogeneous culture, locales, and markets are a critical and an ongoing challenge. Such challenge requires more than just good ideas and extensive resources. It requires organisational capabilities that can be labelled as “enacted capabilities”. This study defines enacted capabilities as the firm’s ability to mobilise and deploy IS-based resources in combination or co-present with other capabilities within SMEs. Consequently, the aim of this study is to make a contribution by empirically examining the enacted capabilities of SMEs in developing countries that may influence the success of innovative IS adoption. In line with this objective, an innovative IS adoption behaviour investigation is conducted particularly as to why some SMEs are able to be enabled for use and utilise innovative IS, while others fail to do so. A survey of 206 of the CEOs/owners from Malaysian SMEs was con-ducted. The innovative IS examined was the government’s electronic procure-ment systems. The findings are consistent with the notion that all SMEs have enacted capabilities. Some SMEs integrate and coordinate them in a different way, depending on the context of each organisation. The findings also indicate that strong enacted capabilities and perceived net benefits affect the SMEs’ ability to perform or assimilate IS related strategic change.
International Nuclear Information System (INIS)
Nishizawa, Kunihide; Shibata, Michihiro; Saze, Takuya
2004-01-01
Laws concerning radiation safety management were analyzed from the point of view of defining precisely what is meant by radiation and what is meant by the subject. There are no laws to protect students from radiation hazards when using X-rays and electron beams under 1 MeV for research and/or education. The Law concerning Technical Standards for Preventing Radiation Hazards gives the authorities the power to enact new rules and regulations that will protect the students. The Radiation Council must take charge for enactment of all laws regarding radiation safety management. (author)
Bauer, Anja; Pregernig, Michael; Reinecke, Sabine
2016-01-01
This article asks how scientific advisory institutions (SAIs) in climate policy strive towards effectiveness. Our analysis is grounded on the assumption that effectiveness is not passively experienced but is deliberately enacted by SAIs. We draw on a widely used set of criteria, namely saliency, credibility and legitimacy (SCL). Based on an…
Drewes, Andrea; Henderson, Joseph; Mouza, Chrystalla
2018-01-01
Climate change is one of the most pressing challenges facing society, and climate change educational models are emerging in response. This study investigates the implementation and enactment of a climate change professional development (PD) model for science educators and its impact on student learning. Using an intrinsic case study methodology,…
Building On Builder: The Persistent Icarus Syndrome at Twenty Years
2013-06-01
mission of the United States Air Force is to "fly, fight, and win…in air, space and cyberspace"--as an intergral member of the Joint team that...Scenarios: A Military Futurist Explores War in the Twenty-First Century (New York: Bantam Books Trade Paperbacksl, 2009), 17. 33 Carl H. Builder
Directory of Open Access Journals (Sweden)
Roosevelt M. Smeke Cassorla
2003-12-01
Full Text Available INTRODUÇÃO: Discutem-se procedimentos utilizados no processo analítico e em psicoterapias analíticas, em especial aqueles que indicariam falhas na capacidade do analista e a necessidade de sua validação. Para esse propósito, apresentam-se diferenças entre Psicanálise e Psicoterapia Psicanalítica em relação a seus procedimentos e objetivos. É apresentado o modelo da "colocação em cena da dupla"("enactment" e discute-se a possibilidade de ele ser útil para o processo de validação, em conjunto com a definição dos objetivos do tratamento. OBJETIVOS: Descrever e discutir formas de validação clínica de procedimentos em psicanálise e relacioná-los com os objetivos da Psicanálise e da Psicoterapia Psicanalítica. MÉTODO: Clínico-psicanalítico, ilustrado com paciente com TOC RESULTADOS-MATERIAL CLÍNICO: APREsenta-se a dinâmica subjacente a trechos de duas sessões, mostrando-se que uma "falha" do analista revelou-se produtiva, ao avaliar-se seu efeito (validação clínica, resultando em ampliação da capacidade de pensar, modelo teórico utilizado. DISCUSSÃO: São discutidos: 1. Validação, "enactment" e contratransferência: mostrando-se a necessidade de o analista "entrar na cena" e usar os derivados de sua contratransferência para a compreensão dos "enactments"; 2. Psicanálise e Psicoterapia Psicanalítica: mostrando-se como a clareza em seus objetivos é condição para que a validação seja possível. CONCLUSÔES: por lidar com variáveis complexas, de impossível isolamento e controle, a Psicanálise e a Psicoterapia Psicanalítica necessitam da validação intra-clínica contínua, e a clareza dos objetivos é condição essencial para tal. Demonstra-se a utilidade dos modelos do "enactment" associados à teoria do pensar de Bion, como bases para essa validação.INTRODUCCIÓN: Se discuten procedimientos utilizados en el proceso analítico y en psicoterapias analíticas, en especial aquellas que indicar
Relational adaptivity - enacting human-centric systems design
DEFF Research Database (Denmark)
Petersen, Kjell Yngve
2016-01-01
Human centered design approaches places the experiencing human at the center of concern, situated in relation to the dynamics of the environmental condition and the variables of the system of control and sensing. Taking the approach of enacted design methods to enforce the experience...... of the inhabitant as core in human-centered design solutions, the intelligence of the connected sensors is suggested to be developed as an actual learning and self-adjusting adaptive environment, where the adaptive system is part of a negotiation with users on the qualities of the environment. We will present...... a fully functional sketching environment for adaptive sensor-control systems, which enable integration of the complex situation of everyday activities and human well-being. The proposed sketching environment allows for the development of sensor systems related to lighting conditions and human occupancy...
An Enactive Perspective of Understanding Leadership: A Comparative Case Study Approach
Koya, Kushwanth; Sice, Petia; Rauch, Laurie
2016-01-01
Leadership is a significant element in the present life of organizations. Recent reviews suggest building novel frameworks through which leadership, as a phenomenon, could be understood comprehensively, considering all the aspects of human experience. The autopoietic perspective on cognition suggests that the quality of human experience is determined by the interplay between the biological and social dynamics of an active situated human agent, we enact our ‘reality’, rather than recognize one...
Enacting the family: the performance of kinship in adoptive parents’ weblogs
García González, Macarena
2013-01-01
Adoptive parents have turned out to be passionate bloggers. Couples adopting internationally are using the Internet intensely to share experiences and pieces of advice in the form of autobiographical accounts of their (troubled) adoption processes. These blogs not only connect a community facing multiple difficulties but, moreover, enact the family where the blood ties are missing. This study examines how the blogs of parents adopting girls in China perform parenthood by paralleling the adopt...
Buxton, Cory A.; Allexsaht-Snider, Martha; Kayumova, Shakhnoza; Aghasaleh, Rouhollah; Choi, Youn-Jeng; Cohen, Allan
2015-01-01
In this paper we use practice theory, with its focus on the interplay of structure and agency, to theorize about teacher engagement in professional learning and teacher enactment of pedagogical practices as an alternative to framing implementation research in terms of program adherence and fidelity of implementation. Practice theory allowed us to…
Firearm legislation and firearm mortality in the USA: a cross-sectional, state-level study.
Kalesan, Bindu; Mobily, Matthew E; Keiser, Olivia; Fagan, Jeffrey A; Galea, Sandro
2016-04-30
In an effort to reduce firearm mortality rates in the USA, US states have enacted a range of firearm laws to either strengthen or deregulate the existing main federal gun control law, the Brady Law. We set out to determine the independent association of different firearm laws with overall firearm mortality, homicide firearm mortality, and suicide firearm mortality across all US states. We also projected the potential reduction of firearm mortality if the three most strongly associated firearm laws were enacted at the federal level. We constructed a cross-sectional, state-level dataset from Nov 1, 2014, to May 15, 2015, using counts of firearm-related deaths in each US state for the years 2008-10 (stratified by intent [homicide and suicide]) from the US Centers for Disease Control and Prevention's Web-based Injury Statistics Query and Reporting System, data about 25 firearm state laws implemented in 2009, and state-specific characteristics such as firearm ownership for 2013, firearm export rates, and non-firearm homicide rates for 2009, and unemployment rates for 2010. Our primary outcome measure was overall firearm-related mortality per 100,000 people in the USA in 2010. We used Poisson regression with robust variances to derive incidence rate ratios (IRRs) and 95% CIs. 31,672 firearm-related deaths occurred in 2010 in the USA (10·1 per 100,000 people; mean state-specific count 631·5 [SD 629·1]). Of 25 firearm laws, nine were associated with reduced firearm mortality, nine were associated with increased firearm mortality, and seven had an inconclusive association. After adjustment for relevant covariates, the three state laws most strongly associated with reduced overall firearm mortality were universal background checks for firearm purchase (multivariable IRR 0·39 [95% CI 0·23-0·67]; p=0·001), ammunition background checks (0·18 [0·09-0·36]; plaws are associated with reduced firearm mortality, and this evidence underscores the importance of focusing on
Enacted and implied stigma for dementia in a community in south-west Nigeria.
Adebiyi, Akindele O; Fagbola, Motunrayo A; Olakehinde, Olaide; Ogunniyi, Adesola
2016-07-01
Dementia is a chronic progressive disease that mostly affects the elderly. There is often a stigma surrounding dementia patients because of poor awareness about the disease. In Nigeria, this stigma and related attitudes have not been fully explored. In this study, we assessed the attitude of people towards demented individuals in a transitional community in Nigeria. The study used a mixed methods approach. Focused group discussions exploring the concept of dementia were conducted among six community groups, and quantitative data was obtained from an interviewer-administered questionnaire. A total of 313 respondents were selected with a cluster sampling technique. Only 212 respondents (67.7%) were aware of dementia. 'Memory loss disease', 'ageing disease', 'disease of insanity', 'brain disorder', 'disease of forgetfulness', and 'dull brain' are the common names used to describe dementia in the community. Enacted stigma was evident as 36% of respondents felt dementia was associated with shame and embarrassment in the community. Implied stigma was evident in another third that opined that demented individuals would prefer not to know or let others know that they have the disease. Also, 28% were of the opinion that people do not take those with dementia seriously. Of the 22 (10.4%) that reported having received structured information about dementia, 16 (72.7%) got the information from health facilities. Qualitative data revealed the presence of enacted stigma in the community as some referred to affected individuals by derogatory names such as 'madman'. Some statements from the focus group discussion participants also gave useful insights into the scorn with which demented individuals are sometimes treated. The presence of enacted and implied stigma related to dementia within the community calls for concern. More research efforts are needed to unravel the burden of stigma within communities and best practice for stigma-reducing interventions. © 2015 The Authors
Children's Friendships in Diverse Primary Schools: Teachers and the Processes of Policy Enactment
Vincent, Carol; Neal, Sarah; Iqbal, Humera
2016-01-01
Drawing on data from a project exploring children's and adults' friendships across social class and ethnic difference, this paper focuses on the enactment of national and institutional policy around children's friendships as realized in three primary schools in diverse urban areas in London. Through a focus on the way in which social and emotional…
Global Feminism from Page to Stage: Teaching "Half the Sky" and "Seven"
Capo, Beth Widmaier
2012-01-01
The documentary play "Seven" is the collaboration of seven female playwrights with seven women activists connected in 2006 by the Vital Voices Global Partnership, a nonprofit nongovernmental organization supporting the development of female leaders (Vital). The stated mission of Vital Voices is to "identify, invest in and bring…
The art and science of teamwork: enacting a transdisciplinary approach in work rehabilitation.
Shaw, L; Walker, R; Hogue, A
2008-01-01
Teamwork, collaboration and interprofessional care are becoming the new standard in health care, and service delivery in work practice is no exception. Most rehabilitation professionals believe that they intuitively know how to work collaboratively with others such as workers, employers, insurers and other professionals. However, little information is available that can assist rehabilitation professionals in enacting authentic transdisciplinary approaches in work practice contexts. A qualitative study was designed using a grounded theory approach, comprised of observations and interviews, to understand the social processes among team members in enacting a transdisciplinary approach in a work rehabilitation clinic. Findings suggest that team members consciously attended to a team approach through nurturing consensus, nurturing professional synergy, and nurturing a learning culture. These processes enabled this team to work in concert with clients who had chronic disabilities in achieving solution focused goals for returning to work and improving functioning. Implications for achieving greater collaborative synergies among stakeholders in return to work settings and in the training of new rehabilitation professionals are explored.
Drewes, Andrea; Henderson, Joseph; Mouza, Chrystalla
2018-01-01
Climate change is one of the most pressing challenges facing society, and climate change educational models are emerging in response. This study investigates the implementation and enactment of a climate change professional development (PD) model for science educators and its impact on student learning. Using an intrinsic case study methodology, we focused analytic attention on how one teacher made particular pedagogical and content decisions, and the implications for student's conceptual learning. Using anthropological theories of conceptual travel, we traced salient ideas through instructional delivery and into student reasoning. Analysis showed that students gained an increased understanding of the enhanced greenhouse effect and the implications of human activity on this enhanced effect at statistically significant levels and with moderate effect sizes. However, students demonstrated a limited, though non-significant gain on the likely effects of climate change. Student reasoning on the tangible actions to deal with these problems also remained underdeveloped, reflecting omissions in both PD and teacher enactment. We discuss implications for the emerging field of climate change education.
Barman, Linda; Silén, Charlotte; Bolander Laksov, Klara
2014-12-01
This paper reports on how teachers within health sciences education translate outcome-based education (OBE) into practice when they design courses. The study is an empirical contribution to the debate about outcome- and competency-based approaches in health sciences education. A qualitative method was used to study how teachers from 14 different study programmes designed courses before and after OBE was implemented. Using an interpretative approach, analysis of documents and interviews was carried out. The findings show that teachers enacted OBE either to design for more competency-oriented teaching-learning, or to further detail knowledge and thus move towards reductionism. Teachers mainly understood the outcome-based framework as useful to support students' learning, although the demand for accountability created tension and became a bureaucratic hindrance to design for development of professional competence. The paper shows variations of how teachers enacted the same outcome-based framework for instructional design. These differences can add a richer understanding of how outcome- or competency-based approaches relate to teaching-learning at a course level.
Peng, Wei
2008-12-01
Abstract Based on Social Cognitive Theory, this study proposes a new concept-mediated enactive experience to understand game playing effects on self-efficacy in the context of a health promotion role-playing game. An experiment demonstrated that a mediated enactive experience afforded by game playing was more effective than a mediated observational experience provided by game watching in influencing self-efficacy. It was found that identification with the game character partially mediated the relationship between experience mode and self-efficacy.
Directory of Open Access Journals (Sweden)
Desta Ayode
2016-09-01
Full Text Available Background: Disease-related stigma is a public health concern steadily gaining global attention. Evidence consistently shows that an individual’s attribution of disease cause can prompt or justify interpersonal stigma. However, few studies have explored causal beliefs about inherited disease and their influence on stigmatising behaviours in low and middle income countries. Design and methods: The study was conducted in 2013, in six communities in Wolaita zone, Southern Ethiopia. A total of 1800 respondents took part in the study, 600 were affected by an inherited disease and 1200 were unaffected neighbours. Two versions of the interviewer- administered survey were created, with measures assessed in parallel on experienced stigma for the affected and enacted stigma for unaffected respondents. Results: Mean levels of enacted stigma reported by unaffected respondents were slightly lower (2.0, SD=0.7 than experienced stigma reported by affected respondents [2.2 (standard deviation=1.1]. Beliefs that podoconiosis was hereditary were significantly and positively associated with levels of enacted stigma reported by unaffected respondents and experienced stigma reported by affected respondents (PConclusions: If stigma reduction interventions are to be successful, culturally tailored, gender inclusive and innovative health education programs are required, directed at the general community as well as individuals affected by inherited diseases.
Directory of Open Access Journals (Sweden)
Arezoo Eshghipour
2016-01-01
Full Text Available This study investigated the effect of enactive pre-reading tasks on Iranian pre-intermediate EFL learners’ reading comprehension and self-efficacy. Moreover, it explored whether Iranian per-intermediate EFL learners’ reading comprehension and self-efficacy are influenced by vicarious pre-reading tasks. The required data was gathered through a reading comprehension passage entailing 20 comprehension questions and a 30-item self-efficacy questionnaire with 5-point Likert-scale response options. A total of 66 participants (including 34 individuals in the enactive group and 32 leaners in the vicarious one took part in this study. The Pearson formula, an independent T-Test, paired T-test, and the Mann-Whitney U test were used to analyze the data. Based on the findings of the study, enactive pre-reading tasks played a key role in the Iranian pre-intermediate EFL learners’ reading comprehension ability. Moreover, it was found that vicarious pre-reading tasks served an important role in the Iranian pre-intermediate EFL learners’ self-efficacy.
STEAM Enacted: A Case Study of a Middle School Teacher Implementing STEAM Instructional Practices
Herro, Danielle; Quigley, Cassie
2016-01-01
This paper examines the implementation practices of a 6th grade middle school teacher enacting STEAM (science, technology, engineering, art and math) teaching in his classroom after participating in a 45-hour STEAM professional development. Case study is used to detail the process, successes, and challenges. Project-based learning, technology…
Seymour, Susan R.
2012-01-01
The purpose of this study was to consider the development of social consciousness in female nonprofit leaders. The problem undergirding the study is that we do not know enough about social consciousness to know how it is learned, if it can be taught, if it is stable over a lifetime, and what factors and life events shape its unique expression. A further concern is understanding how people come to enact caring about social justice causes and why they enacted caring about certain causes but not...
75 FR 76731 - Request for Comment for Report on In-State Broadcast Programming
2010-12-09
... Report on In-State Broadcast Programming AGENCY: Federal Communications Commission. ACTION: Notice... to submit a report on in- state broadcast programming to the appropriate Congressional committees no.... REPORT ON IN-STATE BROADCAST PROGRAMMING. Not later than 18 months after the date of the enactment of...
Trust in Leadership for Sustaining Innovations: How Leaders Enact on Showing Trustworthiness
Directory of Open Access Journals (Sweden)
Savolainen Taina
2014-11-01
Full Text Available In the environment of continuous change today, trust is needed more in most organizations but is enacted less. This paper discusses trust in leadership. Trust is the essence of leadership forming a foundation for functioning relationships and co-operation. Trust is intangible asset, a managerial skill, and an influencing power for leaders. Leadership by trust emphasizes trustful behavior towards employees. It can be defined as an interactive way of leading organizations for effectiveness and profitability. In this paper, we suggest that, it is trustworthiness in leader behavior that matters. Showing trustworthiness by competence, integrity, benevolence, and credibility makes a difference in daily leadership work and sustaining innovations. This paper focuses on how leaders enact on trust by showing trustworthiness to subordinates. Real life case examples are presented and their implications are discussed. In conclusion, leadership by trust matters in building innovative work environment. As to untrustworthy leader behavior, it is worth noting that building and sustaining trust is reciprocal in nature. A practical implication for leaders is that the development of an awareness of trustworthiness and skills for demonstrating it should be a top priority in the current business environment, which demands strong interaction, cooperation, and communication abilities.
Directory of Open Access Journals (Sweden)
Urban Wråkberg
2014-07-01
Full Text Available Critical geopolitics is used in analysing discourses on a micro-social level in the performances and enactments taking place during fact-finding tours and leisure journeys in northernmost Europe. The cases of journeys focussed are those of Scandinavians travelling along, and sometimes departing from, the highway between the Norwegian village of Kirkenes and the Russian city of Murmansk. In travels undertaken for professional or leisure purposes alike a hyperreal meta-script is enacted mediated on the cosmopolitan cultural experiences held collectively by the travellers; simulacra provide the context for the enactments of fact-finding and drama taking place during border-passage. It is argued that the characteristic montage-like sequence of events of border-crossings are interwoven with a geopolitical discourse, and that it should be understood as encompassing both language and practice in order to appreciate the geopolitics at work. Three ways in which geopolitics enters travels in the northern borderland between Scandinavia and Russia are identified: scenarios of future regional scenarios of future regional developments, popularisations of research obsessed with the problems of borders, and what has been termed here the geopolitical anecdote. In considering the aesthetics of the simulations taking place in cross-border travels this study suggests focussing the meta-script of the American and the European road movie film genres. The essay argues that the cosmopolitan mind of any traveller, and its collective mediated content of cultural and political discourses, has been underestimated so far in the socio-political research regarding the borderlands of the European north.
77 FR 35199 - Swap Data Recordkeeping and Reporting Requirements: Pre-Enactment and Transition Swaps
2012-06-12
.... Summary of the Proposed Part 46 Rule 1. Fundamental Goals 2. Historical Swap Recordkeeping 3. Historical... Consumer Protection Act, Public Law 111-203, 124 Stat. 1376 (2010). The text of the Dodd- Frank Act may be...-enactment swaps and transition swaps as ``historical swaps.'' \\16\\ Subsection (A) of CEA Section 2(h)(5...
Outlook: The Next Twenty Years
Energy Technology Data Exchange (ETDEWEB)
Murayama, Hitoshi
2003-12-07
I present an outlook for the next twenty years in particle physics. I start with the big questions in our field, broken down into four categories: horizontal, vertical, heaven, and hell. Then I discuss how we attack the bigquestions in each category during the next twenty years. I argue for a synergy between many different approaches taken in our field.
Childhood Obesity Task Forces Established by State Legislatures, 2001-2010
Kim, Sonia A.; Sherry, Bettylou; Blanck, Heidi M.
2013-01-01
Introduction States and communities are considering policy and environmental strategies, including enacting legislation, to reduce and prevent childhood obesity. One legislative approach has been to create task forces to understand key issues and develop a course of action. The goal of this study was to describe state-level, childhood obesity task forces in the United States created by legislation from 2001 through 2010. Methods We used the Center for Disease Control and Prevention’s Division of Nutrition, Physical Activity, and Obesity database to identify state-level childhood obesity task forces created through legislation from 2001 through 2010. Results We identified 21 states that had enacted legislation creating childhood obesity task forces of which 6 had created more than one task force. Most task forces were charged with both gathering and reviewing information and making recommendations for obesity-prevention actions in the state. Most legislation required that task forces include representation from the state legislature, state agencies, community organizations, and community members. Conclusion Evaluation of the effectiveness of obesity-prevention task forces and the primary components that contribute to their success may help to determine the advantages of the use of such strategies in obesity prevention. PMID:23987250
State-level gonorrhea rates and expedited partner therapy laws: insights from time series analyses.
Owusu-Edusei, K; Cramer, R; Chesson, H W; Gift, T L; Leichliter, J S
2017-06-01
In this study, we examined state-level monthly gonorrhea morbidity and assessed the potential impact of existing expedited partner therapy (EPT) laws in relation to the time that the laws were enacted. Longitudinal study. We obtained state-level monthly gonorrhea morbidity (number of cases/100,000 for males, females and total) from the national surveillance data. We used visual examination (of morbidity trends) and an autoregressive time series model in a panel format with intervention (interrupted time series) analysis to assess the impact of state EPT laws based on the months in which the laws were enacted. For over 84% of the states with EPT laws, the monthly morbidity trends did not show any noticeable decreases on or after the laws were enacted. Although we found statistically significant decreases in gonorrhea morbidity within four of the states with EPT laws (Alaska, Illinois, Minnesota, and Vermont), there were no significant decreases when the decreases in the four states were compared contemporaneously with the decreases in states that do not have the laws. We found no impact (decrease in gonorrhea morbidity) attributable exclusively to the EPT law(s). However, these results do not imply that the EPT laws themselves were not effective (or failed to reduce gonorrhea morbidity), because the effectiveness of the EPT law is dependent on necessary intermediate events/outcomes, including sexually transmitted infection service providers' awareness and practice, as well as acceptance by patients and their partners. Published by Elsevier Ltd.
Chriqui, Jamie F; Ribisl, Kurt M; Wallace, Raedell M; Williams, Rebecca S; O'Connor, Jean C; el Arculli, Regina
2008-02-01
All U.S. states regulate face-to-face tobacco sales at retail outlets. However, the recent growth of delivery sales of tobacco products by Internet and mail-order vendors has prompted new state regulations focused on preventing youth access and tax evasion. To date, there are no comprehensive and systematic analyses of these laws. The objectives of this study were to: (a) document the historical enactment of the laws; (b) assess the nature and extent of the laws; and (c) examine the relationship between the presence of laws and state tobacco control policy and other contextual variables. Between 1992 and 2006, 34 states (67%) enacted a relevant law, with 27 states' laws (45%) effective between 2003 and 2006. Five states banned direct-to-consumer shipment of cigarettes. The remaining 29 states' laws included a combination of requirements addressing minimum age/ID, payment issues, shipping, vendor licensure and related issues, tax collection/remittance, and penalties/enforcement. States with delivery sales laws have stronger youth tobacco access policies and state tobacco control environments, as well as higher state cigarette excise tax rates and revenue, past-month cigarette use rates, and perceptions of risk of use by adolescents. This paper provides the policy context for understanding Internet and other cigarette delivery sales laws in the U.S. It also provides a systematic framework for ongoing policy surveillance and will contribute to future analyses of the impact of these laws on successfully reducing youth access to cigarettes and preventing tax evasion.
Mason, Henry D.
2017-01-01
This article reports a qualitative study that explored South African conceptions and enactment of life purpose. Data collected using semi-structured interviews with 25 first-year university students (female = 56%, age range = 18-25) offer a unique insight into African young adults' conceptions of life purpose. From a phenomenological analysis…
Patahuddin, Sitti Maesuri; Puteri, Indira; Lowrie, Tom; Logan, Tracy; Rika, Baiq
2018-04-01
This study examined student mathematical engagement through the intended and enacted lessons taught by two teachers in two different middle schools in Indonesia. The intended lesson was developed using the ELPSA learning design to promote mathematical engagement. Based on the premise that students will react to the mathematical tasks in the forms of words and actions, the analysis focused on identifying the types of mathematical engagement promoted through the intended lesson and performed by students during the lesson. Using modified Watson's analytical tool (2007), students' engagement was captured from what the participants' did or said mathematically. We found that teachers' enacted practices had an influence on student mathematical engagement. The teacher who demonstrated content in explicit ways tended to limit the richness of the engagement; whereas the teacher who presented activities in an open-ended manner fostered engagement.
The E.N.A.C.T. Model: Enhancing Teacher Candidates' Ability to Manage Student Behavior
Yost, Deborah S.; Mosca, Frank J.
2003-01-01
This program description presents a model of critical reflection that has helped teacher candidates appropriately apply behavior management theory to resolve behavioral problems. The authors developed the ENACT (Examine, Name, Analyze, Critically evaluate, and Treat) model to help teacher candidates analyze the cause of inappropriate behaviors to…
Pepin, B.
2014-01-01
This article provides a commentary to the eight papers of this issue of ZDM entitled "Researching the enacted mathematics curriculum." It is structured around three main questions concerning (1) the layers of the curriculum addressed in the eight papers; (2) an identification of the main theoretical
Toward an Expansion of an Enactive Ethics with the Help of Care Ethics
Czech Academy of Sciences Publication Activity Database
Urban, Petr
2014-01-01
Roč. 5, č. 1354 (2014), s. 1-3 ISSN 1664-1078 R&D Projects: GA ČR(CZ) GPP401/12/P544 Institutional support: RVO:67985955 Keywords : enactivism * enactive ethics * feminist relational theory * the ethics of care * socially extended mind Subject RIV: AA - Philosophy ; Religion Impact factor: 2.560, year: 2014 http://journal.frontiersin.org/Journal/10.3389/fpsyg.2014.01354/full
Wei, Wei; Li, Xiaoming; Tu, Xiaoming; Zhao, Junfeng; Zhao, Guoxiang
2016-01-01
Some previous studies have revealed a negative impact of enacted stigma on post-traumatic growth (PTG) of children affected by HIV/AIDS, but little is known about protective psychological factors that can mitigate the effect of enacted stigma on children's PTG. This study aims to examine the mediating effects of perceived social support, hopefulness, and emotional regulation on the relationship between enacted stigma and PTG among HIV-affected children. Cross-sectional data were collected from 790 children affected by parental HIV (382 girls, 408 boys) aged 6-17 years in 2012 in rural central China. Multiple regression was conducted to test the mediation model. The study found that the experience of enacted stigma had a negative effect on PTG among children affected by HIV/AIDS. Emotional regulation together with hopefulness and perceived social support mediated the impact of enacted stigma on PTG. Perceived social support, hopefulness, and emotional regulation offer multiple levels of protection that can mitigate the impact of enacted stigma on PTG. Results suggest that future psychological intervention programs should seek strategies to reduce the stigmatizing experience of these children and promote children's level of PTG, and health professionals should also emphasize the development of these protective psychological factors.
Twenty Practices of an Entrepreneurial University
DEFF Research Database (Denmark)
Gjerding, Allan Næs; Wilderom, Celeste P.M.; Cameron, Shona P.B.
2006-01-01
studies twenty organisational practices against which a University's entrepreneurship can be measured. These twenty practices or factors in effect formed the basis for an entrepreneurship audit. During a series of interviews, the extent to which the universities are seen as entrepreneurial...
Milk production and distribution in nine western states in the 1950s
International Nuclear Information System (INIS)
Ward, G.M.; Whicker, F.W.
1987-03-01
This report provides information on milk distribution and dairy cattle feeding practices in Nevada, Utah and portions of seven other adjacent states during the 1950s. The information was gathered to support the US Department of Energy's ''Offsite Radiation Exposure Review Project (ORERP).'' This project is charged with providing radiation dose estimates for residents of Nevada, Utah, and surrounding states from nuclear weapons testing conducted at the Nevada Test Site from 1951 through 1962. The information on milk production and distribution is essential for assessment of the internal organ doses received by people as a result of ingesting radioactive fallout-contaminated foods. The information is used as input data for Colorado State University's PATHWAY computer code which estimates the ingestion of twenty radionuclides by people relative to a given level of fallout deposition
Energy Technology Data Exchange (ETDEWEB)
2014-09-01
This document summarizes proposed and enacted legislation and activities related to energy storage for nine states, which are presented alphabetically. These states were selected to provide a high-level view of various energy storage efforts taking place across the United States.
Twenty-first workshop on geothermal reservoir engineering: Proceedings
Energy Technology Data Exchange (ETDEWEB)
None
1996-01-26
PREFACE The Twenty-First Workshop on Geothermal Reservoir Engineering was held at the Holiday Inn, Palo Alto on January 22-24, 1996. There were one-hundred fifty-five registered participants. Participants came from twenty foreign countries: Argentina, Austria, Canada, Costa Rica, El Salvador, France, Iceland, Indonesia, Italy, Japan, Mexico, The Netherlands, New Zealand, Nicaragua, the Philippines, Romania, Russia, Switzerland, Turkey and the UK. The performance of many geothermal reservoirs outside the United States was described in several of the papers. Professor Roland N. Horne opened the meeting and welcomed visitors. The key note speaker was Marshall Reed, who gave a brief overview of the Department of Energy's current plan. Sixty-six papers were presented in the technical sessions of the workshop. Technical papers were organized into twenty sessions concerning: reservoir assessment, modeling, geology/geochemistry, fracture modeling hot dry rock, geoscience, low enthalpy, injection, well testing, drilling, adsorption and stimulation. Session chairmen were major contributors to the workshop, and we thank: Ben Barker, Bobbie Bishop-Gollan, Tom Box, Jim Combs, John Counsil, Sabodh Garg, Malcolm Grant, Marcel0 Lippmann, Jim Lovekin, John Pritchett, Marshall Reed, Joel Renner, Subir Sanyal, Mike Shook, Alfred Truesdell and Ken Williamson. Jim Lovekin gave the post-dinner speech at the banquet and highlighted the exciting developments in the geothermal field which are taking place worldwide. The Workshop was organized by the Stanford Geothermal Program faculty, staff, and graduate students. We wish to thank our students who operated the audiovisual equipment. Shaun D. Fitzgerald Program Manager.
Low-level radioactive-waste compacts. Status report as of July 1982
International Nuclear Information System (INIS)
1982-07-01
The Low-Level Radioactive Waste Policy Act (P.L. 96-573), enacted in December 1980, established as federal policy that states take responsibility for providing disposal capacity for low-level radioactive waste (LLW) generated within their borders, except for defense waste and Federal R and D. At the request of Senator James A. McClure, Chairman of the Senate Committee on Energy and Natural Resources, DOE has documented the progress of states individually and collectively in fulfilling their responsibilities under the Public Law. Regionalization through formation of low-level waste compacts has been the primary vehicle by which many states are assuming this responsibility. To date seven low-level waste compacts have been drafted and six have been enacted by state legislatures or ratified by a governor. As indicated by national progress to date, DOE considers the task of compacting achievable by the January 1, 1986, exclusionary date set in law, although several states and NRC questioned this
Low-level radioactive-waste compacts. Status report as of July 1982
Energy Technology Data Exchange (ETDEWEB)
1982-07-01
The Low-Level Radioactive Waste Policy Act (P.L. 96-573), enacted in December 1980, established as federal policy that states take responsibility for providing disposal capacity for low-level radioactive waste (LLW) generated within their borders, except for defense waste and Federal R and D. At the request of Senator James A. McClure, Chairman of the Senate Committee on Energy and Natural Resources, DOE has documented the progress of states individually and collectively in fulfilling their responsibilities under the Public Law. Regionalization through formation of low-level waste compacts has been the primary vehicle by which many states are assuming this responsibility. To date seven low-level waste compacts have been drafted and six have been enacted by state legislatures or ratified by a governor. As indicated by national progress to date, DOE considers the task of compacting achievable by the January 1, 1986, exclusionary date set in law, although several states and NRC questioned this.
Energy Technology Data Exchange (ETDEWEB)
Wimer, R.L.; Adams, M.A.; Jurich, D.M.
1981-02-01
This report characterizes seven United State coal regions in the Northern Great Plains, Rocky Mountain, Interior, and Gulf Coast coal provinces. Descriptions include those of the Fort Union, Powder River, Green River, Four Corners, Lower Missouri, Illinois Basin, and Texas Gulf coal resource regions. The resource characterizations describe geologic, geographic, hydrologic, environmental and climatological conditions of each region, coal ranks and qualities, extent of reserves, reclamation requirements, and current mining activities. The report was compiled as a basis for the development of hypothetical coal mining situations for comparison of conventional and terrace pit surface mining methods, under contract to the Department of Energy, Contract No. DE-AC01-79ET10023, entitled The Development of Optimal Terrace Pit Coal Mining Systems.
Information report on state legislation
International Nuclear Information System (INIS)
Landau, M.
1983-06-01
Legislation that would consent to the Central Interstate Low-Level Radioactive Waste Compact has been introduced into Congress as H.R. 3002. Similar legislation is expected to be introduced into the Senate soon. This is the second compact consent legislation to be introduced into Congress this year - the first was the Northwest Compact, introduced in January. States in the Central Compact are AR, KS, LA, NE and OK. Enacted and introduced radioactive waste management legislation in various states is summarized
Percutaneous gastrostomy -a report of twenty-seven cases-
International Nuclear Information System (INIS)
Kim, Tae Ho; Lee, Ho Suk; Kim, Yong Joo; Kim, Tae Hun; Suh, Kyung Jin; Kang, Duk Sik
1991-01-01
Nutritional support by gastrostomy feeding is an important treatment adjunct when major swallowing difficulty or debilitating diseases is present. This technique for percutaneous placement of a gastric feeding tube now provides many patients with a simple, safe, and well-tolerated alternative to surgical feeding gastrostomy. We experienced 27 cases of percutaneous gastrostomy from January 1989 to February 1991 at Kyungpook National University Hospital. The underlying diseases of the patients were esophageal cancer (11), pyriform sinus cancer (4), laryngeal cancer (3), tongue cancer (2), lye stricture (1), lung cancer (1), chordoma (1), lethal midline granuloma (1), malignant lymphoma (1), maxillary cancer (1), and tonsil cancer (1). Selding method was used in all cases. In five patients it was difficult to insert the nasogastric tube for air insufflation, and one patient had subtotal gastrectomy with gastrojejunostomy, but gastrostomy was performed in all cases. The general condition improved in all patients. We experienced one case of mild peritonitis, but no other significant complications were observed. Gastrostomy tubes were patient in all patients during their survival period, except two patients who experienced obstruction 2 and 6 months after the procedure. Percutaneous gastrostomy can be used safely and effectively in such patients who have pharyngoesophageal or CNS lesions precluding oral intake
Ramirez, Pablo C.; Ross, Lydia; Jimenez-Silva, Margarita
2016-01-01
In this one-year qualitative study, the authors examined how border pedagogy is enacted by two Latino/a high school teachers in a border community in Southern California. Through classroom observations, the authors documented powerful student discussions that named complex borders (Giroux, 1992) that existed in their daily lives. We drew from…
National Research Council Canada - National Science Library
Cohen, Henry
2007-01-01
.... To date, 33 states and the District of Columbia have recognized a journalists' privilege through the enactment of press "shield laws," which protect the relationship between reporters, their source...
The politics of federal-state relations
International Nuclear Information System (INIS)
Dravo, A.N.
1986-01-01
States' ability to reject siting of high-level waste repositories has rested on politics, technical judgement and the potential that procedural error could disqualify a project. Prior to enactment of the Nuclear Waste Policy Act, sites were rejected through parochial political action in Congress. The NWPA limited the ability of states to receive parochial assistance, but did not eliminate the potential for Congressional politics to dominate programmatic decisions. Technical and procedural opportunity for affecting siting have, however, increased
Norta, A.; Grefen, P.; Angelov, S.; Kutvonen, L.
2010-01-01
The question what a business-to-business (B2B) collaboration setup and enactment application-system should look like remains open. An important element of such collaboration constitutes the inter-organizational disclosure of business-process details so that the opposing parties may protect their business secrets. For that purpose, eSourcing [37] has been developed as a general businessprocess collaboration concept in the framework of the EU research project Cross- Work. The eSourcing characte...
International Nuclear Information System (INIS)
Clark, Sue B.; Nash, Ken; Benny, Paul; Clark, Aurora; Wall, Nathalie; Wall, Don; Yoo, Choong-Shik
2009-01-01
Since 2002, Washington State University has been building radiochemistry as a component of its overall chemistry program. Using an aggressive hiring strategy and leveraged funds from the state of Washington and federal agencies, six radiochemistry faculty members have been added to give a total of seven radiochemists out of a department of twenty-five faculty members. These faculty members contribute to a diverse curriculum in radiochemistry, and the Chemistry Department now enjoys a significant increase in the number of trainees, the quantity of research expenditures, and the volume and quality of peer-reviewed scientific literature generated by the radiochemistry faculty and the trainees. These three factors are essential for sustaining the radiochemistry education and research program at any academic institution.
Is Moving More Memorable than Proving? Effects of Embodiment and Imagined Enactment on Verb Memory.
Sidhu, David M; Pexman, Penny M
2016-01-01
Theories of embodied cognition propose that sensorimotor information is simulated during language processing (e.g., Barsalou, 1999). Previous studies have demonstrated that differences in simulation can have implications for word processing; for instance, lexical processing is facilitated for verbs that have relatively more embodied meanings (e.g., Sidhu et al., 2014). Here we examined the effects of these differences on memory for verbs. We observed higher rates of recognition (Experiments 1a-2a) and recall accuracy (Experiments 2b-3b) for verbs with a greater amount of associated bodily information (i.e., an embodiment effect). We also examined how this interacted with the imagined enactment effect: a memory benefit for actions that one imagines performing (e.g., Ditman et al., 2010). We found that these two effects did not interact (Experiment 3b), suggesting that the memory benefits of automatic simulation (i.e., the embodiment effect) and deliberate simulation (i.e., the imagined enactment effect) are distinct. These results provide evidence for the role of simulation in language processing, and its effects on memory.
Capital in the Twenty-First Century
DEFF Research Database (Denmark)
Hansen, Per H.
2014-01-01
Review essay on: Capital in the Twenty-First Century. By Thomas Piketty . Translated by Arthur Goldhammer . Cambridge, Mass.: The Belknap Press of Harvard University Press, 2014. viii + 685 pp......Review essay on: Capital in the Twenty-First Century. By Thomas Piketty . Translated by Arthur Goldhammer . Cambridge, Mass.: The Belknap Press of Harvard University Press, 2014. viii + 685 pp...
75 FR 33761 - Notice of Proposed Change to Section IV of the Virginia State Technical Guide
2010-06-15
... revisions made after enactment of the law to NRCS State technical guides used to carry out highly erodible... Section IV of the Virginia State Technical Guide AGENCY: Natural Resources Conservation Service (NRCS), U... NRCS State Technical Guide for review and comment. SUMMARY: It has been determined by the NRCS State...
75 FR 34974 - Notice of Proposed Change to Section IV of the Virginia State Technical Guide
2010-06-21
... revisions made after enactment of the law to NRCS State technical guides used to carry out highly erodible... Section IV of the Virginia State Technical Guide AGENCY: Natural Resources Conservation Service (NRCS), U... NRCS State Technical Guide for review and comment. SUMMARY: It has been determined by the NRCS State...
75 FR 62759 - Notice of Proposed Change to Section IV of the Virginia State Technical Guide
2010-10-13
... revisions made after enactment of the law to NRCS State technical guides used to carry out highly erodible... Section IV of the Virginia State Technical Guide AGENCY: Natural Resources Conservation Service (NRCS), U... NRCS State Technical Guide for review and comment. SUMMARY: It has been determined by the NRCS State...
Directory of Open Access Journals (Sweden)
Ken Edge
2015-12-01
Full Text Available This research study interrogates the self-reported perceptions of seven experienced Human Society and Its Environment (HSIE teachers about the professional learning influencing their classroom teaching after being involved in a number of initiatives to improve their teaching in New South Wales (Australia. The results indicated that the teachers’ professional learning experiences, ways of thinking about professional learning and responses to implementation of new approaches to professional learning were dominated by traditional training models even while operating under a new state-wide professional learning model (Quality Teaching approach. While the teachers acknowledged the value of reflective practice, collaborative networking and teaming, they found that difficulties in implementing these strategies within faculties and across schools lessened their impact. It was apparent that local institutional history, context and politics had an enormous impact on the success of the professional learning programme. The findings of this study are significant because leadership aimed at acknowledging and addressing the teaching context at the school level is a critical factor if we are to develop twenty-first-century teachers.
Why American business demands twenty-first century skills: an industry perspective.
Bruett, Karen
2006-01-01
Public education is the key to individual and business prosperity. With a vested stake in education, educators, employers, parents, policymakers, and the public should question how this nation's public education system is faring. Knowing that recent international assessments have shown little or no gains in American students' achievement, the author asserts the clear need for change. As both a large American corporate employer and a provider of technology for schools, Dell is concerned with ensuring that youth will thrive in their adult lives. Changing workplace expectations lead to a new list of skills students will need to acquire before completing their schooling. Through technology, Dell supports schools in meeting educational goals, striving to supply students with the necessary skills, referred to as twenty-first century skills. The Partnership for 21st Century Skills, of which Dell is a member, has led an initiative to define what twenty-first century learning should entail. Through extensive research, the partnership has built a framework outlining twenty-first century skills: analytical thinking, communication, collaboration, global awareness, and technological and economic literacy. Dell and the partnership are working state by state to promote the integration of these skills into curricula, professional development for teachers, and classroom environments. The authors describe two current initiatives, one in Virginia, the other in Texas, which both use technology to help student learning. All stakeholders can take part in preparing young people to compete in the global economy. Educators and administrators, legislators, parents, and employers must play their role in helping students be ready for what the workforce and the world has in store for them.
An Investigation of Southwestern Area Principals and the Enactment of Crisis Plans in High Schools
Parker, Kerry L.
2012-01-01
The purpose of this study was to identify what southwestern area high school principals reported as the enactment of school crisis plans as described in the Center for Mental Health in Schools at UCLA (CMHS, 2008), "Resource Aid: Responding to a Crisis at School." The conceptual framework guiding the study was an adaptation of the Crisis…
Milk production and distribution in nine western states in the 1950s
Energy Technology Data Exchange (ETDEWEB)
Ward, G.M.; Whicker, F.W.
1987-03-01
This report provides information on milk distribution and dairy cattle feeding practices in Nevada, Utah and portions of seven other adjacent states during the 1950s. The information was gathered to support the US Department of Energy's ''Offsite Radiation Exposure Review Project (ORERP).'' This project is charged with providing radiation dose estimates for residents of Nevada, Utah, and surrounding states from nuclear weapons testing conducted at the Nevada Test Site from 1951 through 1962. The information on milk production and distribution is essential for assessment of the internal organ doses received by people as a result of ingesting radioactive fallout-contaminated foods. The information is used as input data for Colorado State University's PATHWAY computer code which estimates the ingestion of twenty radionuclides by people relative to a given level of fallout deposition.
Park, Hyunchul; Kim, Eunjin; Kim, Jeongeun; Ro, Youngsuck; Ko, Jooyeon
2015-01-01
Background High-intensity focused ultrasound (HIFU) treatment has recently emerged in response to the increasing demand for noninvasive procedures for skin lifting and tightening. Objective This study was aimed at evaluating the clinical efficacy of and patient satisfaction with HIFU treatment for wrinkles and laxity in seven different areas of the face in Asian skin. Methods Twenty Korean patients with facial wrinkle and laxity were analyzed after a single session of HIFU treatment. Two inde...
State laws and the provision of family planning and abortion services in 1985.
Sollom, T; Donovan, P
1985-01-01
65 laws relating to fertility were enacted by the 49 state legislatures that held sessions in 1985. This was the largest enacted since 1973, and the 2nd largest total since. Some of the 1985 abortion laws are designed to protect abortion rights. Several states in the US took action to severely punish the perpetrators of violence against abortion clinics. Lesislation dealing with the delivery of family planning services was subjected to public funding restrictions in 1985. Attempts have been made recently on the federal level to prevent Title X recipients from being provided with information on abortion in their pregnancy counseling sessions. These actions are similar to some of the state laws attempting to reach the same end. Many states included funds for family planning in general appropriations bills. Differences among legislators regarding the right of minors to consent to reproductive health care have led to 2 patterns of response: 1) affirmation of the right of minors to receive family planning services on their own consent; or 2) laws mandating parental involvement in a minor's abortion decision. The most troubling aspect of the fertility related legislation endated in 1985 is the effort by a number of legislatures to attach restrictions on abortion counseling and referral to family planning appropriations bills. In 1985, state laws were enacted to regulate the disposal of fetal remains, to prohibit the use of fetal remains for commercial purposes and to impose criminal sanctions for causing the miscarriage of a fetus during a felony.
Dreon, Oliver; McDonald, Scott
2012-01-01
This phenomenological study demonstrates the influence that affective factors have on beginning teachers' ability to enact inquiry science pedagogy. Through narratives shared in interviews and weblog postings, two beginning science teachers' emotional engagement with their teaching practices, especially that of implementing inquiry-based…
Appraisal of seven critical reading strategies employed by teachers ...
African Journals Online (AJOL)
Appraisal of seven critical reading strategies employed by teachers in Ogun State senior secondary schools to teach reading comprehension. ... as a result of the teachers' ability to engage the students in skilful and well- framed questions.
Cook-Sather, Alison; Schlosser, Joel Alden; Sweeney, Abigail; Peterson, Laurel M.; Cassidy, Kimberly Wright; Colón García, Ana
2018-01-01
Academic development that supports the enactment of positive psychology practices through student-faculty pedagogical partnership can increase faculty confidence and capacity in their first year in a new institution. When student partners practice affirmation and encouragement of strengths-based growth, processes of faculty acclimation and…
Wang, Xiaodong; Zhang, Xiaoyu; Cai, Hongming; Xu, Boyi
Enacting a supply-chain process involves variant partners and different IT systems. REST receives increasing attention for distributed systems with loosely coupled resources. Nevertheless, resource model incompatibilities and conflicts prevent effective process modeling and deployment in resource-centric Web service environment. In this paper, a Petri-net based framework for supply-chain process integration is proposed. A resource meta-model is constructed to represent the basic information of resources. Then based on resource meta-model, XML schemas and documents are derived, which represent resources and their states in Petri-net. Thereafter, XML-net, a high level Petri-net, is employed for modeling control and data flow of process. From process model in XML-net, RESTful services and choreography descriptions are deduced. Therefore, unified resource representation and RESTful services description are proposed for cross-system integration in a more effective way. A case study is given to illustrate the approach and the desirable features of the approach are discussed.
International Nuclear Information System (INIS)
1994-04-01
The Transportation Legislative Data Base (TLDB) is a computer-based information service containing summaries of federal, state and certain local government statutes and regulations relating to the transportation of radioactive materials in the United States. The TLDB has been operated by the National Conference of State Legislatures (NCSL) under cooperative agreement with the US Department of Energy's (DOE) Office of Civilian Radioactive Waste Management since 1992. The data base system serves the legislative and regulatory information needs of federal, state, tribal and local governments, the affected private sector and interested members of the general public. Users must be approved by DOE and NCSL. This report is a state statute compilation that updates the 1989 compilation produced by Battelle Memorial Institute, the previous manager of the data base. This compilation includes statutes not included in the prior compilation, as well as newly enacted laws. Statutes not included in the prior compilation show an enactment date prior to 1989. Statutes that deal with low-level radioactive waste transportation are included in the data base as are statutes from the states of Alaska and Hawaii. Over 155 new entries to the data base are summarized in this compilation
A Summary and Analysis of Warrantless Arrest Statutes for Domestic Violence in the United States
Zeoli, April M.; Norris, Alexis; Brenner, Hannah
2011-01-01
In the United States, all 50 states and the District of Columbia have enacted statutes that allow police officers to make warrantless arrests for domestic violence given probable cause; however, state laws differ from one another in multiple, important ways. Research on domestic violence warrantless arrest laws rarely describe them as anything…
Cost-efficient enactment of stream processing topologies
Directory of Open Access Journals (Sweden)
Christoph Hochreiner
2017-12-01
Full Text Available The continuous increase of unbound streaming data poses several challenges to established data stream processing engines. One of the most important challenges is the cost-efficient enactment of stream processing topologies under changing data volume. These data volume pose different loads to stream processing systems whose resource provisioning needs to be continuously updated at runtime. First approaches already allow for resource provisioning on the level of virtual machines (VMs, but this only allows for coarse resource provisioning strategies. Based on current advances and benefits for containerized software systems, we have designed a cost-efficient resource provisioning approach and integrated it into the runtime of the Vienna ecosystem for elastic stream processing. Our resource provisioning approach aims to maximize the resource usage for VMs obtained from cloud providers. This strategy only releases processing capabilities at the end of the VMs minimal leasing duration instead of releasing them eagerly as soon as possible as it is the case for threshold-based approaches. This strategy allows us to improve the service level agreement compliance by up to 25% and a reduction for the operational cost of up to 36%.
Homanen, Riikka
2018-04-01
The multimillion-euro fertility industry increasingly tailors its treatments to infertile people who are willing to travel across national borders for treatments inaccessible at home, especially reproductive tissue donor treatments. Finland is the Nordic destination for access to donor eggs, particularly for Swedes and Norwegians hoping for a donor match that will achieve a child of phenotypically plausible biological descent. Finns are seen as Nordic kin, and the inheritability of "Nordicness" is reinforced at clinics. Drawing on ethnographic material from three fertility clinics in Finland during 2015-2017, this article discusses how Nordic relatedness and whiteness are enacted in the practices of matching of donors with recipient parents. The analysis shows a selective and exclusionary rationale to matching built around whiteness: matches between donors with dark skin tone and recipients with fair skin tone are rejected, but a match of a donor with fair skin and recipients with dark skin may be made. Within the context of transnational egg donation, the whiteness or Nordicness of Finns is not questioned as it has been in other historical circumstances. Even the establishment of a state donor register offers a guarantee of kin-ness, especially non-Russian kin-ness. It is concluded that the logics of matching protect the "purity" of whiteness but not browness or blackness, enacting Nordic(kin)ness in ways that are part of broader intra-European histories of racism and post-socialist Othering. Copyright © 2018 Elsevier Ltd. All rights reserved.
Big Business as a Policy Innovator in State School Reform: A Minnesota Case Study.
Mazzoni, Tim L.; Clugston, Richard M., Jr.
1987-01-01
The Minnesota Business Partnership (MBP) was studied as a policy innovator in state school reform (for kindergarten through grade 12) in relation to agenda setting, alternative formulation, and authoritative enactment. Focus is on the MBP's policy-making involvement during the 1985 state legislative session. Overall, the MBP's influence was…
Chaturvedi, Arvind K; Craft, Kristi J; Cardona, Patrick S; Rogers, Paul B; Canfield, Dennis V
2009-05-01
During toxicological evaluations of samples from fatally injured pilots involved in civil aviation accidents, a high degree of quality control/quality assurance (QC/QA) is maintained. Under this philosophy, the Federal Aviation Administration (FAA) started a forensic toxicology proficiency-testing (PT) program in July 1991. In continuation of the first seven years of the PT findings reported earlier, PT findings of the next seven years are summarized herein. Twenty-eight survey samples (12 urine, 9 blood, and 7 tissue homogenate) with/without alcohols/volatiles, drugs, and/or putrefactive amine(s) were submitted to an average of 31 laboratories, of which an average of 25 participants returned their results. Analytes in survey samples were correctly identified and quantitated by a large number of participants, but some false positives of concern were reported. It is anticipated that the FAA's PT program will continue to serve the forensic toxicology community through this important part of the QC/QA for laboratory accreditations.
Politics of risk-taking: Welfare state reform in advanced democracies
Vis, B.
2010-01-01
How much and in which direction have the welfare states among the Western democracies changed over the past decades? Moreover, under which conditions have governments enacted these changes? Based on insights from prospect theory, a psychological theory of choice under risk, Vis demonstrates ably
Fischer, Ilan; Frid, Alex; Goerg, Sebastian J; Levin, Simon A; Rubenstein, Daniel I; Selten, Reinhard
2013-06-18
Although cooperation and trust are essential features for the development of prosperous populations, they also put cooperating individuals at risk for exploitation and abuse. Empirical and theoretical evidence suggests that the solution to the problem resides in the practice of mimicry and imitation, the expectation of opponent's mimicry and the reliance on similarity indices. Here we fuse the principles of enacted and expected mimicry and condition their application on two similarity indices to produce a model of mimicry and relative similarity. Testing the model in computer simulations of behavioral niches, populated with agents that enact various strategies and learning algorithms, shows how mimicry and relative similarity outperforms all the opponent strategies it was tested against, pushes noncooperative opponents toward extinction, and promotes the development of cooperative populations. The proposed model sheds light on the evolution of cooperation and provides a blueprint for intentional induction of cooperation within and among populations. It is suggested that reducing conflict intensities among human populations necessitates (i) instigation of social initiatives that increase the perception of similarity among opponents and (ii) efficient lowering of the similarity threshold of the interaction, the minimal level of similarity that makes cooperation advisable.
Haug, T.; Bontempo, K.; Leeson, L.; Napier, J.; Nicodemus, B.; Van den Bogaerde, B.; Vermeerbergen, M.
In this paper, we report interview data from 14 Deaf leaders across seven countries (Australia, Belgium, Ireland, the Netherlands, Switzerland, the United Kingdom, and the United States) regarding their perspectives on signed language interpreters. Using a semistructured survey questionnaire, seven
Twenty five years of fundamental theory
International Nuclear Information System (INIS)
Bell, J.S.
1980-01-01
In reviewing the last twenty five years in fundamental physics theory it is stated that there has been no revolution in this field. In the absence of gravitation, Lorentz invariance remains a requirement on fundamental laws. Einstein's theory of gravitation inspires increasing conviction on the astronomical scale. Quantum theory remains the framework for all serious effort in microphysics, and quantum electrodynamics remains the model of a fully articulated microphysical theory, completely successful in its domain. However,a number of ideas have appeared, of great theoretical interest and some phenomenological success, which may well contribute to the next decisive step. Recent work on the following topics is mentioned; gravitational radiation, singularites, black body radiation from black holes, gauge and hidden symmetry in quantum electrodynamics, the renormalization of electromagnetic and weak interaction theory, non-Abelian gauge theories, magnetic monopoles as the most striking example of solitons, and supersymmetry. (UK)
The United States Experience with Economic Incentives to Control Environmental Pollution (1992)
Over the past 20 years, federal, state, and local authorities as well as many foreign nations have enacted a diverse array of environmental incentive mechanisms. This report presents one of the most comprehensive surveys available of these mechanisms.
Space power technology for the twenty-first century (SPT21)
International Nuclear Information System (INIS)
Borger, W.U.; Massie, L.D.
1988-01-01
During the spring and summer months of 1987, the Aero Propulsion Laboratory of the Air Force Wright Aeronautical Laboratories, Wright-Patterson AFB, Ohio in cooperation with the Air Force Space Technology Center at Kirtland AFB, New Mexico, undertook an initiative to develop a Strategic Plan for Space Power Technology Development. The initiative was called SPT21, Space Power Technology for the Twenty-First Century. The planning process involved the participation of other Government organizations (U.S. Army, Navy, DOE and NASA) along with major aerospace companies and universities. Following an SPT21 kickoff meeting on 28 May 1987, detailed strategic planning was accomplished through seven (7) Space Power Technology Discipline Workshops commencing in June 1987 and concluding in August 1987. Technology Discipline Workshops were conducted in the following areas: (1) Solar Thermal Dynamic Power Systems (2) Solar Photovoltaic Cells and Arrays (3) Thermal Management Technology (4) Energy Storage Technology (5) Nuclear Power Systems Technology (6) Power Conditioning, Distribution and Control and (7) Systems Technology/Advanced Concepts. This technical paper summarizes the planning process and describes the salient findings and conclusions of the workshops
McDonald, Scott Powell
New understandings about how people learn and constructivist pedagogy pose challenges for teachers. Science teachers face an additional challenge of developing inquiry-based pedagogy to foster complex reasoning skills. Theory provides only fuzzy guidance as to how constructivist or inquiry pedagogy can be accomplished in a wide variety of contexts and local constraints. This study contributes to the understanding of the development of constructivist, inquiry-based pedagogy by addressing the question: How do teachers interpret and enact a technology-rich, inquiry fostering science curricula for fifth grade students' biodiversity learning? This research is a case study of two teachers chosen as critical contrasting cases and represent differences across multiple criteria including: urban I suburban, teaching philosophy, and content preparation. The two fifth grade teachers each enacted BioKIDS: Kids' Inquiry in Diverse Species, an eight week curriculum focused on biodiversity. BioKIDS incorporates multiple learning technologies to support student learning including handheld computer software designed to help students collect field data, and a web-based resource for data on local animal species. The results of this study indicate there are tensions teachers must struggle with when setting goals during enactment of inquiry science curricula. They must find a balance between an emphasis on authentic learning and authentic science, and between natural history and natural science. Authentic learning focuses on students' interests and lives; Authentic science focuses on students working with the tools and processes of science. Natural history focuses on the foundational skills in science of observation and classification. Natural science focuses on analytical science drawing on data to develop claims about the world. These two key tensions in teachers' goal setting were critical in defining and understanding differences in how teachers interpreted a curriculum to meet
2013-02-22
...] Proposed Information Collection; Land and Water Conservation Fund State Assistance Program AGENCY: National.... Abstract The Land and Water Conservation Fund Act of 1965 (LWCF Act) (16 U.S.C. 460l-4 et seq.) was enacted... discussed in detail in the Land and Water Conservation Fund State Assistance Program Federal Financial...
Petrila, John
2014-07-01
Twenty-five years after enactment of the Americans with Disabilities Act (ADA), the U.S. Justice Department has begun to aggressively use the law to compel states to reform community care of individuals with mental disabilities. In this month's Law & Psychiatry column, the author highlights settlement agreements between Justice and the states of New York and Rhode Island that will produce sweeping changes in housing and employment for thousands of individuals with mental disabilities. Is the ADA's original promise finally being realized? The Americans with Disabilities Act (ADA) was enacted with the hope that it would result in the end of segregation based on disability. That promise has been only partially met. However, two recent settlement agreements between the U.S. Department of Justice and the states of New York and Rhode Island promise sweeping change in housing and employment for thousands of individuals with mental disabilities. This column describes the agreements, which adopt best practices as the foundation for community change and which suggest that the ADA may be reaching its full promise.
States Stepping up Mandates for School Safety Drills
Shah, Nirvi
2013-01-01
Hundreds of U.S. schools will supplement fire drills and tornado training next fall with simulations of school shootings. In response to the December shootings by an intruder at Sandy Hook Elementary School in Newtown, Connecticut, several states have enacted or are considering laws that require more and new types of school safety drills, more…
Reis, R.
2013-01-01
This article examines children’s enactment of spirit possession idioms and witchcraft in Africa including the meanings such idioms provide and the local healing resources they mobilize. Idioms of haunting spirits in Northern Uganda and witch-children elsewhere in Africa can be interpreted as
The Prediction of States' PK-12 Funding Effort and Distribution Based on Their Ideological Makeups
Malin, Joel R.
2016-01-01
States differ markedly in their funding for public schools, both in terms of the fiscal effort their citizens demonstrate and the progressivity with which funds are distributed. Yet, less is known about why different states have enacted such different policies and financing systems. In this study, the relationships between a measure of states'…
Over the past 20 years, federal, state, and local authorities as well as many foreign nations have enacted a diverse array of environmental incentive mechanisms. This report presents one of the most comprehensive surveys available of these mechanisms.
Seven Possible Cave Skylights on Mars
2007-01-01
[figure removed for brevity, see original site] Figure 1 Seven very dark holes on the north slope of a Martian volcano have been proposed as possible cave skylights, based on day-night temperature patterns suggesting they are openings to subsurface spaces. These six excerpts of images taken in visible-wavelength light by the Thermal Emission Imaging System camera on NASA's Mars Odyssey orbiter show the seven openings. Solar illumination comes from the left in each frame. The volcano is Arsia Mons, at 9 degrees south latitude, 239 degrees east longitude. The features have been given informal names to aid comparative discussion (see figure 1). They range in diameter from about 100 meters (328 feet) to about 225 meters (738 feet). The candidate cave skylights are (A) 'Dena,' (B) 'Chloe,' (C) 'Wendy,' (D) 'Annie,' (E) 'Abby' (left) and 'Nikki,' and (F) 'Jeanne.' Arrows signify north and the direction of illumination. Mars Odyssey is managed by NASA's Jet Propulsion Laboratory, a division of the California Institute of Technology, Pasadena, for NASA's Science Mission Directorate, Washington. Lockheed Martin Space Systems, Denver, is the prime contractor for the project and built the spacecraft. The orbiter's Thermal Emission Imaging System was developed by Arizona State University, Tempe, in collaboration with Raytheon Santa Barbara Remote Sensing, Santa Barbara, Calif., and is operated by Arizona State University.
77 FR 2721 - Privacy Act System of Records
2012-01-19
...-3, ``National Deaf-Blind Equipment Distribution Program (NDBEDP).'' Following enactment of the Twenty-First Century Communications and Video Accessibility Act of 2010 (CVAA) on October 8, 2010, the..., Implementation of the Twenty- First Century Communications and Video Accessibility Act of 2010, Section 105...
Grainger, Catherine; Williams, David M.; Lind, Sophie E.
2017-01-01
It is well established that neurotypical individuals generally show better memory for actions they have performed than actions they have observed others perform or merely read about, a so-called "enactment effect." Strikingly, research has also shown that neurotypical individuals demonstrate superior memory for actions they…
Directory of Open Access Journals (Sweden)
Cynthia Hatsue Kitayama Cabral
2011-01-01
Full Text Available βS haplotypes were studied in 47 non-related patients with sickle-cell anemia from the state of Rio Grande do Norte, Brazil. Molecular analysis was conducted by PCR/RFLP using restriction endonucleases XmnI, HindIII, HincII and HinfI to analyze six polymorphic sites from the beta cluster. Twenty-seven patients (57.5% were identified with genotype CAR/CAR, 9 (19.1% CAR/BEN, 6 (12.8% CAR/CAM, 1 (2.1% BEN/BEN, 2 (4.3% CAR/Atp, 1 (2.1% BEN/Atp and 1 (2.1% with genotype Atp/Atp. The greater frequency of Cameroon haplotypes compared to other Brazilian states suggests the existence of a peculiarity of African origin in the state of Rio Grande do Norte.
Sheikh, Irfan; Bagley, Carl
2018-01-01
The article uncovers the complex process of educational policy enactment and the impact this process has on teachers as policy actors as they undertake the task of introducing a new mathematics curriculum in a Canadian secondary school. The three year study based on in-depth qualitative interviews adopts a classic grounded theory approach of…
State Technologies Advancement Collaborative
Energy Technology Data Exchange (ETDEWEB)
David S. Terry
2012-01-30
The U. S. Department of Energy (DOE), National Association of State Energy Officials (NASEO), and Association of State Energy Research and Technology Transfer Institutions (ASERTTI) signed an intergovernmental agreement on November 14, 2002, that allowed states and territories and the Federal Government to better collaborate on energy research, development, demonstration and deployment (RDD&D) projects. The agreement established the State Technologies Advancement Collaborative (STAC) which allowed the states and DOE to move RDD&D forward using an innovative competitive project selection and funding process. A cooperative agreement between DOE and NASEO served as the contracting instrument for this innovative federal-state partnership obligating funds from DOE's Office of Energy Efficiency and Renewable Energy and Office of Fossil Energy to plan, fund, and implement RDD&D projects that were consistent with the common priorities of the states and DOE. DOE's Golden Field Office provided Federal oversight and guidance for the STAC cooperative agreement. The STAC program was built on the foundation of prior Federal-State efforts to collaborate on and engage in joint planning for RDD&D. Although STAC builds on existing, successful programs, it is important to note that it was not intended to replace other successful joint DOE/State initiatives such as the State Energy Program or EERE Special Projects. Overall the STAC process was used to fund, through three competitive solicitations, 35 successful multi-state research, development, deployment, and demonstration projects with an overall average non-federal cost share of 43%. Twenty-two states were awarded at least one prime contract, and organizations in all 50 states and some territories were involved as subcontractors in at least one STAC project. Projects were funded in seven program areas: (1) Building Technologies, (2) Industrial Technologies, (3) Transportation Technologies, (4) Distributed Energy
Klieger, Sarah B; Gutman, Abraham; Allen, Leslie; Pacula, Rosalie Liccardo; Ibrahim, Jennifer K; Burris, Scott
2017-12-01
(1) To describe open source legal data sets, created for research use, that capture the key provisions of US state medical marijuana laws. The data document how state lawmakers have regulated a medicine that remains, under federal law, a Schedule I illegal drug with no legitimate medical use. (2) To demonstrate the variability that exists across states in rules governing patient access, product safety and dispensary practice. Two legal researchers collected and coded state laws governing marijuana patients, product safety and dispensaries in effect on 1 February 2017, creating three empirical legal data sets. We used summary tables to identify the variation in specific statutory provisions specified in each state's medical marijuana law as it existed on 1 February 2017. We compared aspects of these laws to the traditional Federal approach to regulating medicine. Full data sets, codebooks and protocols are available through the Prescription Drug Abuse Policy System (http://www.pdaps.org/; Archived at http://www.webcitation.org/6qv5CZNaZ on 2 June 2017). Twenty-eight states (including the District of Columbia) have authorized medical marijuana. Twenty-seven specify qualifying diseases, which differ across states. All states protect patient privacy; only 14 protect patients against discrimination. Eighteen states have mandatory product safety testing before any sale. While the majority have package/label regulations, states have a wide range of specific requirements. Most regulate dispensaries (25 states), with considerable variation in specific provisions such as permitted product supply sources number of dispensaries per state and restricting proximity to various types of location. The federal ban in the United States on marijuana has resulted in a patchwork of regulatory strategies that are not uniformly consistent with the approach usually taken by the Federal government and whose effectiveness remains unknown. © 2017 Society for the Study of Addiction.
Kademian, Sylvie M.
Current reform efforts prioritize science instruction that provides opportunities for students to engage in productive talk about scientific phenomena. Given the challenges teachers face enacting instruction that integrates science practices and science content, beginning teachers need support to develop the knowledge and teaching practices required to teach reform-oriented science lessons. Practice-based teacher education shows potential for supporting beginning teachers while they are learning to teach in this way. However, little is known about how beginning elementary teachers draw upon the types of support and tools associated with practice-based teacher education to learn to successfully enact this type of instruction. This dissertation addresses this gap by investigating how a practice-based science methods course using a suite of teacher educator-provided tools can support beginning teachers' planning and enactment of investigation-based science lessons. Using qualitative case study methodologies, this study drew on video-records, lesson plans, class assignments, and surveys from one cohort of 22 pre-service teachers (called interns in this study) enrolled in a year-long elementary education master of the arts and teaching certification program. Six focal interns were also interviewed at multiple time-points during the methods course. Similarities existed across the types of tools and teaching practices interns used most frequently to plan and enact investigation-based discussions. For the focal interns, use of four synergistic teaching practices throughout the lesson enactments (including consideration of students' initial ideas; use of open-ended questions to elicit, extend, and challenge ideas; connecting across students' ideas and the disciplinary core ideas; and use of a representation to organize and highlight students' ideas) appeared to lead to increased opportunities for students to share their ideas and engage in data analysis, argumentation and
Ruigendijk, H.A.H.; Koole, S.L.
2014-01-01
People vary in action versus state orientation, or the ease versus difficulty by which they can form and enact goals under demanding conditions (Kuhl and Beckmann in Volition and personality: action versus state orientation, Hogrefe, Göttingen, 1994). According to the over-maintenance hypothesis,
State contraceptive coverage laws: creative responses to questions of "conscience".
Dailard, C
1999-08-01
The Federal Employees Health Benefits Program (FEHBP) guaranteed contraceptive coverage for employees of the federal government. However, opponents of the FEHBP contraceptive coverage questioned the viability of the conscience clause. Supporters of the contraceptive coverage pressed for the narrowest exemption, one that only permit religious plans that clearly states religious objection to contraception. There are six of the nine states that have enacted contraceptive coverage laws aimed at the private sector. The statutes included a provision of conscience clause. The private sector disagrees to the plan since almost all of the employees¿ work for employers who only offer one plan. The scope of exemption for employers was an issue in five states that have enacted the contraceptive coverage. In Hawaii and California, it was exemplified that if employers are exempted from the contraceptive coverage based on religious grounds, an employee will be entitled to purchase coverage directly from the plan. There are still questions on how an insurer, who objects based on religious grounds to a plan with contraceptive coverage, can function in a marketplace where such coverage is provided by most private sector employers.
Energy: the states' response in 1978
Energy Technology Data Exchange (ETDEWEB)
Mackey, Earl S.
1978-01-01
A compilation of all state legislative energy enactments for legislature, in 1978 is presented. It provides source material to legislators and their staff. Each bill is separated into one or more of the 37 major subject categories. Broad categories cover public utilities; tax exemption; tax application; franchise protection; conservation; resource development; solar easements; mineral extraction regulation; management; emergency powers; anti-trust; anit-environment; and miscellaneous legislation.
A meta-analytic investigation of the relation between interpersonal attraction and enacted behavior.
Montoya, R Matthew; Kershaw, Christine; Prosser, Julie L
2018-05-07
We present a meta-analysis that investigated the relation between self-reported interpersonal attraction and enacted behavior. Our synthesis focused on (a) identifying the behaviors related to attraction; (b) evaluating the efficacy of models of the relation between attraction and behavior; (c) testing the impact of several moderators, including evaluative threat salience, cognitive appraisal salience, and the sex composition of the social interaction; and (d) investigating the degree of agreement between the meta-analytic findings and an ethnographic analysis. Using a multilevel modeling approach, an analysis of 309 effect sizes (N = 5,422) revealed a significant association (z = .20) between self-reported attraction and enacted behavior. Key findings include: (a) that the specific behaviors associated with attraction (e.g., eye contact, smiling, laughter, mimicry) are those behaviors research has linked to the development of trust/rapport; (b) direct behaviors (e.g., physical proximity, talking to), compared with indirect behaviors (e.g., eye contact, smiling, mimicry), were more strongly related to self-reported attraction; and (c) evaluative threat salience (e.g., fear of rejection) reduced the magnitude of the relation between direct behavior and affective attraction. Moreover, an ethnographic analysis revealed consistency between the behaviors identified by the meta-analysis and those behaviors identified by ethnographers as predictive of attraction. We discuss the implications of our findings for models of the relation between attraction and behavior, for the behavioral expressions of emotions, and for how attraction is measured and conceptualized. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
The Demise of Higher Education Performance Funding Systems in Three States. CCRC Brief. Number 41
Dougherty, Kevin J.; Natow, Rebecca S.
2009-01-01
Performance funding in higher education ties state funding directly to institutional performance on specific indicators, such as rates of retention, graduation, and job placement. One of the great puzzles about performance funding is that it has been both popular and unstable. Between 1979 and 2007, 26 states enacted it, but 14 of those states…
Directory of Open Access Journals (Sweden)
Chandrakant S Pandav
2015-12-01
Full Text Available Iodine Deficiency Disorders (IDD constitute the single largest cause of preventable brain damage worldwide. In India the entire population is prone to IDD due to deficiency of iodine in the soil of the subcontinent and consequently the food derived from it. Of these, an estimated 350 million people are at higher risk of IDDs as they consume salt with inadequate iodine. Every year nine million pregnant women and eight million newborns are at risk of IDD in India.On September 13, 2000, the Government of India lifted the ban at the national level on the sale of non-iodized salt (India Gazette 2000. Scientists, civil society, international agencies and other stakeholders joined ranks to fight against this retrograde step by the government of India. The four pronged approach to fight the removal of ban on non- iodized salt comprised of writing advocacy documents, meeting with stakeholders, media campaign and tracking of Universal Salt Iodization (USI in states by state iodine status surveys.But effective advocacy and media campaign were hampered by lack of scientific data substantiating the magnitude of Iodine Deficiency disorders (IDD in India. To address this lacuna, state level Iodine status surveys were planned in seven states of India and were executed over next five years in collaboration with various national and international stakeholders.State level IDD surveys were carried out in seven states (Kerala, Tamil Nadu, Orissa, Rajasthan, Bihar, Goa and Jharkhand from 2000 to 2006 by International Council for Control of Iodine Deficiency Disorders (ICCIDD in collaboration with state medical colleges, Micronutrient Initiative (MI and UNICEF. The surveys were carried as per the recommended guidelines of WHO/UNICEF/ICCIDD and used 30 cluster into 40 children sampling methodology. Children in the age group of 6-12 years, women in the household, retail shop keepers and other community stakeholders constituted the study population. All three indicators
Breslyn, Wayne Gene
The present study investigated differences in the continuing development of National Board Certified Science Teachers' (NBCSTs) conceptions of inquiry across the disciplines of biology, chemistry, earth science, and physics. The central research question of the study was, "How does a NBCST's science discipline (biology, chemistry, earth science, or physics) influence their conceptions, enactment, and goals for inquiry-based teaching and learning?" A mixed methods approach was used that included an analysis of the National Board portfolio entry, Active Scientific Inquiry, for participants (n=48) achieving certification in the 2007 cohort. The portfolio entry provided detailed documentation of teachers' goals and enactment of an inquiry lesson taught in their classroom. Based on the results from portfolio analysis, participant interviews were conducted with science teachers (n=12) from the 2008 NBCST cohort who represented the science disciplines of biology, chemistry, earth science, and physics. The interviews provided a broader range of contexts to explore teachers' conceptions, enactment, and goals of inquiry. Other factors studied were disciplinary differences in NBCSTs' views of the nature of science, the relation between their science content knowledge and use of inquiry, and changes in their conceptions of inquiry as result of the NB certification process. Findings, based on a situated cognitive framework, suggested that differences exist between biology, chemistry, and earth science teachers' conceptions, enactment, and goals for inquiry. Further, individuals teaching in more than one discipline often held different conceptions of inquiry depending on the discipline in which they were teaching. Implications for the research community include being aware of disciplinary differences in studies on inquiry and exercising caution in generalizing findings across disciplines. In addition, teachers who teach in more than one discipline can highlight the contextual
Over Twenty Years Of Experience In ITU TRIGA MARK-II Reactor
International Nuclear Information System (INIS)
Yavuz, Hasbi
2008-01-01
I.T.U. TRIGA MARK-II Training and Research Reactor, rated at 250 kW steady-state and 1200 MW pulsing power is the only research and training reactor owned and operated by a university in Turkey. Reactor has been operating since March 11, 1979; therefore the reactor has been operating successfully for more than twenty years. Over the twenty years of operation: - The tangential beam tube was equipped with a neutron radiography facility, which consists of a divergent collimator and exposure room; - A computerized data acquisition system was designed and installed such that all parameters of the reactor, which are observed from the console, could be monitored both in normal and pulse operations; - An electrical power calibration system was built for the thermal power calibration of the reactor; - Publications related with I.T.U. TRIGA MARK-II Training and Research Reactor are listed in Appendix; - Two majors undesired shutdown occurred; - The I.T.U. TRIGA MARK-II Training and Research Reactor is still in operation at the moment. (authors)
The clinical characteristics of twenty-eight idiopathic pulmonary fibrosis cases
International Nuclear Information System (INIS)
Yu Yong; Shi Minhua; Hu Huacheng
2007-01-01
Objective: To summarize the clinical characteristics of idiopathic pulmonary fibrosis (IPF). Methods: The clinical characteristics of twenty-eight cases diagnosed as IPF between 1991 and 2006 were studied retrospectively. Results: Most IPF patients had an insidious onset of progressive dyspnea and non-productive cough. Inspiratory crackles and finger clubbing were also noted in most patients. The most impressive appearance of their radiography was peripheral reticular and nodular opacities, distributed largely at the lung bases. Pulmonary function test showed restrictive impairment and impaired oxygen diffusion. The arterial blood gas analysis revealed type I respiratory failure. One IPF case was complicated with lung cancer. The symptoms of fifteen cases(71.4%) were relieved under the therapy with glucocorticoid. Seven patients died as yet in our group and the middle duration was 24 months. Conclusions: The diagnosis of IPF relies mostly on the clinical characteristics, radiography, pulmonary function test, blood gas analysis and exclusion of other ILD. Atypical cases need lung biopsy to do further the diagnosis. Therapy with glucocorticoid may be effective in some cases. Prognosis in IPF cases complicated with lung cancer is poor. (authors)
Patahuddin, Sitti Maesuri; Puteri, Indira; Lowrie, Tom; Logan, Tracy; Rika, Baiq
2018-01-01
This study examined student mathematical engagement through the intended and enacted lessons taught by two teachers in two different middle schools in Indonesia. The intended lesson was developed using the ELPSA learning design to promote mathematical engagement. Based on the premise that students will react to the mathematical tasks in the forms…
Energy Technology Data Exchange (ETDEWEB)
Strauss, Lewis L.
1957-01-31
This volume contains a name and subject indext for the twenty-first semiannual report of the United States Atomic Energy Commission to Congress. The full semiannual report covers the major unclassified activities of the Commission from July 1956 through December 1956.
Heyder, Anke; Kessels, Ursula
2015-01-01
Girls presently outperform boys in overall academic success. Corresponding gender stereotypes portray male students as lazy and troublesome and female students as diligent and compliant. The present study investigated whether these stereotypes impact teachers' perceptions of students and whether students' visible enactment of their gender at…
Member States must apply most favoured nation treatment under EU law
de Groot, I.M.
2014-01-01
According to case law from the Court of Justice of the European Union (CJEU), a Member State is not obliged to enact most favoured nation treatment if a tax treaty prescribes a certain type of tax treatment (bilateral most favoured nation treatment). In this article, the author discusses whether EU
Rhizobia symbiosis of seven leguminous species growing along Xindian riverbank of Northern Taiwan
Directory of Open Access Journals (Sweden)
Cheng-Tai Huang
2018-01-01
Full Text Available Legume-rhizobia symbioses of seven leguminous species growing along Xindian riverbank of Northern Taiwan were investigated in this study. These legumes form either determinate or indeterminate types of root nodules. The determinate nodules of Alysicarpus vaginalis, Desmodium. triflorum, D. heterophyllum, Sesbania cannabina and the indeterminate nodules of Mimosa pudica harbored bacteroids of morphological uniformity (length of 1-3 μm, while the indeterminate nodules of Crotalaria zanzibarica and Trifolium repens contained bacteroids of highly pleomorphism (size varying from 1 to 5 μm. The enclosed bacteria were isolated from respective nodules, and twenty slow-growing and nine fast-growing rhizobial isolates were recovered. The slow-growing isolates were classified to the genus Bradyrhizobium based on the 16S rRNA sequences, whereas the fast-growing rhizobia comprise four genera, Neorhizobium, Rhizobium, Cupriavidus and Paraburkholderia. Results of stable isotope analyses revealed that the seven leguminous species had similar and consistently negative δ15N values in leaves (mean of -1.2 ‰, whereas the values were positive (varying from 3.7 to 7.3 ‰ in the nodules. These values were significantly higher in the indeterminate nodules than those in the determinate ones. In addition, variations in the values of leaf δ13C (varying from -29 to -34‰ among the seven legumes were measured, indicating their photosynthetic water use efficiencies were different. This is the first field survey to report the rhizobial diversity and the nutrient relationships of sympatric legume in Taiwan.
The interplay between structure and agency in the enactment of STEM policy
Martins, Isabel; Pinhão, Francine; Vilanova, Rita
2017-12-01
In their paper, Hoeg and Bencze argue that current STEM curriculum guidelines prioritise the training of a workforce in detriment of a democratically grounded education for citizenship. We agree that there is an insufficient questioning about which type of citizenship STEM curricula would favour and wish to contribute to this debate by (1) problematising different meanings and aspects of citizenship in different models of democracy and (2) exploring the dialectical nature of structure and agency in the discursive construction of educational (policy) discourse. We also discuss results from recent empirical research about teachers' ideas on citizenship education in order to challenge views that assume a linearity between educational policy and its enactment.
Mellor, Peter Warren
2017-01-01
This thesis addresses the question, would the reintroduction of income taxation at the State level in Australia be feasible at the present time? The States levied income taxes from the late nineteenth century until 1942, when the Commonwealth unilaterally enacted legislation for its ‘uniform tax’ scheme for centralised income taxation which made it effectively impossible for State income taxation to continue. As the States also face a significant constitutional restrictions ...
McGinty, Emma E; Stuart, Elizabeth A; Caleb Alexander, G; Barry, Colleen L; Bicket, Mark C; Rutkow, Lainie
2018-02-26
The U.S. opioid epidemic has been driven by the high volume of opioids prescribed by healthcare providers. U.S. states have recently enacted four types of laws designed to curb high-risk prescribing practices, such as high-dose and long-term opioid prescribing, associated with opioid-related mortality: (1) mandatory Prescription Drug Monitoring Program (PDMP) enrollment laws, which require prescribers to enroll in their state's PDMP, an electronic database of patients' controlled substance prescriptions, (2) mandatory PDMP query laws, which require prescribers to query the PDMP prior to prescribing an opioid, (3) opioid prescribing cap laws, which limit the dose and/or duration of opioid prescriptions, and (4) pill mill laws, which strictly regulate pain clinics to prevent nonmedical opioid prescribing. Some pain experts have expressed concern that these laws could negatively affect pain management among patients with chronic non-cancer pain. This paper describes the protocol for a mixed-methods study analyzing the independent effects of these four types of laws on opioid prescribing patterns and chronic non-cancer pain treatment, accounting for variation in implementation and enforcement of laws across states. Many states have enacted multiple opioid prescribing laws at or around the same time. To overcome this issue, our study focuses on 18 treatment states that each enacted a single law of interest, and no other potentially confounding laws, over a 4-year period (2 years pre-/post-law). Qualitative interviews with key leaders in each of the 18 treatment states will characterize the timing, scope, and strength of each state law's implementation and enforcement. This information will inform the design and interpretation of synthetic control models analyzing the effects of each of the two types of laws on two sets of outcomes: measures of (1) high-risk opioid prescribing and (2) non-opioid treatments for chronic non-cancer pain. Study of mandatory PDMP enrollment
The twenty-first century in space
Evans, Ben
2015-01-01
This final entry in the History of Human Space Exploration mini-series by Ben Evans continues with an in-depth look at the latter part of the 20th century and the start of the new millennium. Picking up where Partnership in Space left off, the story commemorating the evolution of manned space exploration unfolds in further detail. More than fifty years after Yuri Gagarin’s pioneering journey into space, Evans extends his overview of how that momentous voyage continued through the decades which followed. The Twenty-first Century in Space, the sixth book in the series, explores how the fledgling partnership between the United States and Russia in the 1990s gradually bore fruit and laid the groundwork for today’s International Space Station. The narrative follows the convergence of the Shuttle and Mir programs, together with standalone missions, including servicing the Hubble Space Telescope, many of whose technical and human lessons enabled the first efforts to build the ISS in orbit. The book also looks to...
Pourmokhtarian, Afshin; Driscoll, Charles T.; Campbell, John L.; Hayhoe, Katharine; Stoner, Anne M. K.; Adams, Mary Beth; Burns, Douglas; Fernandez, Ivan; Mitchell, Myron J.; Shanley, James B.
2017-01-01
A cross-site analysis was conducted on seven diverse, forested watersheds in the northeastern United States to evaluate hydrological responses (evapotranspiration, soil moisture, seasonal and annual streamflow, and water stress) to projections of future climate. We used output from four atmosphere–ocean general circulation models (AOGCMs; CCSM4, HadGEM2-CC, MIROC5, and MRI-CGCM3) included in Phase 5 of the Coupled Model Intercomparison Project, coupled with two Representative Concentration Pathways (RCP 8.5 and 4.5). The coarse resolution AOGCMs outputs were statistically downscaled using an asynchronous regional regression model to provide finer resolution future climate projections as inputs to the deterministic dynamic ecosystem model PnET-BGC. Simulation results indicated that projected warmer temperatures and longer growing seasons in the northeastern United States are anticipated to increase evapotranspiration across all sites, although invoking CO2 effects on vegetation (growth enhancement and increases in water use efficiency (WUE)) diminish this response. The model showed enhanced evapotranspiration resulted in drier growing season conditions across all sites and all scenarios in the future. Spruce-fir conifer forests have a lower optimum temperature for photosynthesis, making them more susceptible to temperature stress than more tolerant hardwood species, potentially giving hardwoods a competitive advantage in the future. However, some hardwood forests are projected to experience seasonal water stress, despite anticipated increases in precipitation, due to the higher temperatures, earlier loss of snow packs, longer growing seasons, and associated water deficits. Considering future CO2effects on WUE in the model alleviated water stress across all sites. Modeled streamflow responses were highly variable, with some sites showing significant increases in annual water yield, while others showed decreases. This variability in streamflow responses poses a
The Demise of Higher Education Performance Funding Systems in Three States. CCRC Working Paper No.17
Dougherty, Kevin J.; Natow, Rebecca S.
2009-01-01
Performance funding in higher education ties state funding directly to institutional performance on specific indicators, such as rates of retention, graduation, and job placement. One of the great puzzles about performance funding is that it has been both popular and unstable. Between 1979 and 2007, 26 states enacted it, but 14 of those states…
Monte-Sano, Chauncey; Budano, Christopher
2013-01-01
Using artifacts of teachers' practices, classroom observations, and teacher interviews, we explore the development and enactment of 2 novices' pedagogical content knowledge (PCK) for teaching history. We identify and track 4 components of PCK that are relevant to teaching history: representing history, transforming history, attending to students'…
International Nuclear Information System (INIS)
Wu Jilan; Yuan Rongyao
1986-01-01
Now, it is said that we are at the dawn of food irradiation application both nationally and internationally. However, referring to the acceptability of customers the labeling of irradiated foods has been a nightmare to the food processors. On the other hand the recommended international standard has the shortcomings of thinking in absolute terms. In this paper a proposal which puts special emphasis on enacting hygienic safety standard of individual irradiated food is recommended. The hygienic safety standard of the irradiated food may be classified in three classes: 1) its hygienic safety standard is similar to that of common food; 2) the maximum permissible quantities of harmful compounds induced by radiation must be controlled; and 3) the quantity of unique radiolysis products may by dutermined. Radiation chemistry plays an important role in enacting the hygienic safety standard of irradiated foods. For international cooperation in this field some suggestions are made
Tanning Salon Compliance Rates in States With Legislation to Protect Youth Access to UV Tanning.
Williams, Melissa S; Buhalog, Brittany; Blumenthal, Laura; Stratman, Erik J
2018-01-01
The US Food and Drug Administration has classified tanning beds as carcinogenic. Most states have enacted legislation to prevent or create barriers for minors accessing tanning establishments. Determining tanning salon compliance with legislation would provide an indication of the influence of legislation at preventing exposure to the carcinogen in minors. To investigate compliance rates in the 42 states and the District of Columbia with legislation restricting tanning bed use in minors and to identify differences in compliance based on population, regional location, salon ownership, age group being regulated, and time since the law was enacted. This investigation was a cross-sectional telephone survey conducted between February 1, 2015, and April 30, 2016, by callers posing as minors attempting to schedule a tanning appointment. The setting was tanning salons in the 42 states and the District of Columbia that currently have legislation restricting tanning bed use in minors. Included in the study were 427 tanning salons, 10 randomly selected from each state or territory with tanning legislation. Overall compliance of tanning salons with state tanning legislation and differences in compliance based on community population, regional location, independent vs chain tanning salon, age group being regulated, and time since the law was enacted. Of the 427 tanning salons surveyed, overall noncompliance with state legislation was 37.2% (n = 159). There were more noncompliant tanning salons in rural locations (45.5%; 95% CI, 37.5%-53.7%; P = .009), southern regions of the United States (49.4%; 95% CI, 41.4%-57.4%; P = .001), independently owned salons (43.9%; 95% CI, 37.3%-50.6%; P = .003), states with younger age groups being regulated (53.5%; 95% CI, 45.7%-61.2%; P legislation aimed at limiting tanning bed use among US minors is unsatisfactory, indicating that additional efforts to enforce the laws and education of the harmful effects of UV tanning are
Dakota, Minnesota and Eastern Railroad: 1997
Paul R. Reed; Carol J. Cumber
1998-01-01
Approximately twenty-five years ago, a majority of the railroads in the industry were either in or near bankruptcy. As a partial cure, a series of federal and state legislation was enacted which freed the industry from archaic laws passed in the days railroads enjoyed a virtual monopoly in U.S. transportation. One of the outcomes of this new legislation was the freedom granted major railroads to abandon or sell off excess trackage to entrepreneurs. The Dakota Minnesota & Eastern (DM&E) is a r...
An Overview of State Policies Supporting Worksite Health Promotion Programs.
VanderVeur, Jennifer; Gilchrist, Siobhan; Matson-Koffman, Dyann
2017-05-01
Worksite health promotion (WHP) programs can reduce the occurrence of cardiovascular disease risk factors. State law can encourage employers and employer-provided insurance companies to offer comprehensive WHP programs. This research examines state law authorizing WHP programs. Quantitative content analysis. Worksites or workplaces. United States (and the District of Columbia). State law in effect in 2013 authorizing WHP programs. Frequency and distribution of states with WHP laws. To determine the content of the laws for analysis and coding, we identified 18 policy elements, 12 from the Centers for Disease Control and Prevention's Worksite Health ScoreCard (HSC) and 6 additional supportive WHP strategies. We used these strategies as key words to search for laws authorizing WHP programs or select WHP elements. We calculated the number and type of WHP elements for each state with WHP laws and selected two case examples from states with comprehensive WHP laws. Twenty-four states authorized onsite WHP programs, 29 authorized WHP through employer-provided insurance plans, and 18 authorized both. Seven states had a comprehensive WHP strategy, addressing 8 or more of 12 HSC elements. The most common HSC elements were weight management, tobacco cessation, and physical activity. Most states had laws encouraging the adoption of WHP programs. Massachusetts and Maine are implementing comprehensive WHP laws but studies evaluating their health impact are needed.
''How clean is clean'' in the United States federal and Washington State cleanup regulations
International Nuclear Information System (INIS)
Landau, H.G.
1993-01-01
The enactment of legislation and promulgation of implementing regulations generally involves the resolution of conflicting goals. Defining ''How Clean is Clean?'' in federal and state cleanup laws, regulations, and policies is no exception. Answering the ''How Clean is Clean?'' question has resulted in the identification of some important and sometimes conflicting goals. Continuing resolution of the following conflicting goals is the key to effect cleanup of hazardous waste sites: Expediency vs. Fairness; Flexibility vs. Consistency; Risk Reduction vs. Risk Causation; and Permanence vs. Cost Effectiveness
State distributed PV policies: Can low cost (to government) policies have a market impact?
International Nuclear Information System (INIS)
Krasko, Vitaliy A.; Doris, Elizabeth
2013-01-01
This analysis examines the use of state policy as a tool to support the development of distributed generation photovoltaic (PV) markets. The focus is on low-cost market opening policies instead of various forms of government subsidies aimed at reducing installation costs. The ideas tested in this work are: (1) low-cost market opening policies can be effective in facilitating PV market growth without subsidizing projects, and (2) policies can be made more effective if states and localities stage their enactment in a particular order. The policies selected for evaluation emerge from a policy stacking theory outlined in Doris (2012), NREL/CP-7A30-54801, Golden, CO: National Renewable Energy Laboratory. A cross-section econometric analysis that takes into account the quality of interconnection standards, net metering standards, Renewable Portfolio Standards (RPS), RPS set-asides, and a non-policy determinant (population) explains about 70% of the variation in newly installed PV capacity across states and indicates that all of the selected policies are significant. Nonparametric statistical tests confirm the regression results. Qualitative evidence is also presented indicating that effective policy ordering starts with improving interconnection standards, closely followed by improvements in net metering standards, and eventually strengthened by the enactment of an RPS and set-asides. - Highlights: • Impacts of low cost market opening policies on PV capacity are evaluated. • Impact of a strategic policy enactment sequence is evaluated. • Effective interconnection, net metering, RPS, and set-asides increase PV capacity. • Effective ordering is market preparation, then creation, then expansion policies
Mangin, Melinda M.; Dunsmore, KaiLonnie
2015-01-01
Purpose: Instructional coaching is framed as both a means for systemic and individual reform. These competing conceptualizations of coaching as a mechanism for change have not been systematically examined, and therefore, we know little about how the framing of instructional coaching initiatives affects the enactment of coaching. In response to…
Low-level radioactive waste management in New York State: Meeting the milestones
International Nuclear Information System (INIS)
White, I.L.
1987-01-01
The federal Low-Level Radioactive Waste Policy Act of 1980 made the states responsible for disposal of low-level radioactive waste (LLRW) generated within their borders. After extensive hearings and public participation, New York State enacted a Radioactive Waste Management Act (State LLRWMA) in July 1986. This paper describes New York's program and reviews the State's progress in complying with the milestone established by Public Law 99-240. A number of concerns about LLRW disposal and the schedule calling for a facility to be operational by January 1, 1993, are also discussed
Barrilleaux, Charles; Brace, Paul
2007-08-01
We identify two policy strategies that state governments pursue to reduce uninsurance, and we classify policies as being either state based or market based. The two policy strategies are distinguished by whether states rely on the institutional capabilities of the state or market processes to provide insurance. We develop and test models to explain states' adoptions of each type of policy. Using Poisson regression, we evaluate hypotheses suggested by the two strategies with data from U.S. states in the 1990s. The results indicate that institutionally more-capable state governments with strong liberal-party presence in the legislature adopt more state-based policies and fewer market-based policies. By contrast, the model of market-based, business-targeted reforms reveals that government capability plays a smaller role. Instead, these policies are driven by economic affluence, political competition, higher incomes, greater uninsurance, and more previous attempts to address the uninsurance problem. These findings reveal distinct institutional, partisan, electoral and demographic influences that shape state-based and market-based strategies. First, policy choices can be driven by the presence or absence of state capability. The domain of feasible policy choices open to states with institutional capability may be decidedly different than that available to states with fewer institutional resources. Second, while market-based policy approaches may be the most feasible politically, they may be the least successful in remedying practical uninsurance issues. These results thus reveal that institutional characteristics of states create an important foundation for policy choice and policy success or failure. These results would suggest that the national government's strategy of pursuing market-based solutions to the problem will not result in its being solved.
Kaur, Berinderjeet; Tay, Eng Guan; Toh, Tin Lam; Leong, Yew Hoong; Lee, Ngan Hoe
2018-03-01
A study of school mathematics curriculum enacted by competent teachers in Singapore secondary schools is a programmatic research project at the National Institute of Education (NIE) funded by the Ministry of Education (MOE) in Singapore through the Office of Education Research (OER) at NIE. The main goal of the project is to collect a set of data that would be used by two studies to research the enacted secondary school mathematics curriculum. The project aims to examine how competent experienced secondary school teachers implement the designated curriculum prescribed by the MOE in the 2013 revision of curriculum. It does this firstly by examining the video recordings of the classroom instruction and interactions between secondary school mathematics teachers and their students, as it is these interactions that fundamentally determine the nature of the actual mathematics learning and teaching that take place in the classroom. It also examines content through the instructional materials used—their preparation, use in classroom and as homework. The project comprises a video segment and a survey segment. Approximately 630 secondary mathematics teachers and 600 students are participating in the project. The data collection for the video segment of the project is guided by the renowned complementary accounts methodology while the survey segment adopts a self-report questionnaire approach. The findings of the project will serve several purposes. They will provide timely feedback to mathematics specialists in the MOE, inform pre-service and professional development programmes for mathematics teachers at the NIE and contribute towards articulation of "Mathematics pedagogy in Singapore secondary schools" that is evidence based.
Higgins, Joanna; Bonne, Linda
2011-01-01
Purpose: This article examines how and why four leadership functions are enacted in an elementary school, with a focus on hierarchical and "heterarchical" configurations of leadership. Research Design: The data were collected using an exploratory 2-year case study approach, and the data set comprises one-on-one interviews and relevant school…
Andrews, James P.
2012-01-01
This qualitative research study focuses on crisis events affecting university international populations. It explores how seven directors of university international offices at seven different geographical locations in Texas respond to those events. The study findings shed light on the current state of crisis preparedness in higher education from…
Isolation of Borrelia burgdorferi from the blood of seven patients with Lyme disease.
Nadelman, R B; Pavia, C S; Magnarelli, L A; Wormser, G P
1990-01-01
Borrelia burgdorferi, the etiologic agent of Lyme disease, has rarely been successfully cultured from blood. We report on seven patients from Westchester County, New York, with B. burgdorferi bacteremia diagnosed between April 1987 and August 1987. One hundred thirty-two attempts to isolate spirochetes were made on blood specimens obtained from 104 patients. Twenty-two of these specimens were obtained from nine patients who had recently been bitten by Ixodes ticks but who were asymptomatic. Heparinized blood or serum specimens (0.2 to 0.4 mL) were inoculated onto 6 mL of modified Barbour-Stoenner-Kelly medium. Lyme serology was performed by enzyme-linked immunosorbent polyvalent, IgM, and IgG assays, fluorescent immunoassay, and microhemagglutination. Four of the seven patients had erythema migrans, two had facial nerve palsy, and one had a flu-like syndrome without rash. These patients represented 21% (four of 19) of all patients with the characteristic skin lesion who had blood cultures for B. burgdorferi, and 40% (two of five) of all those with facial nerve palsy. Serologic testing was frequently nonreactive; two patients had no detectable antibody on multiple sera by five different assays. All patients improved with antibiotic treatment, and had negative subsequent blood cultures, but five of seven had persistent complaints after completion of therapy. Culturing blood for B. burgdorferi may be useful in confirming the diagnosis of Lyme disease in selected patients. Use of spirochete blood cultures may facilitate a better understanding of the pathogenesis and natural history of Lyme disease.
Phulkerd, Sirinya; Vandevijvere, Stefanie; Lawrence, Mark; Tangcharoensathien, Viroj; Sacks, Gary
2017-02-01
To determine and compare the level of implementation of policies for healthy food environments in Thailand with reference to international best practice by state and non-state actors. Data on the current level of implementation of food environment policies were assessed independently using the adapted Healthy Food Environment Policy Index (Food-EPI) by two groups of actors. Concrete actions were proposed for Thai Government. A joint meeting between both groups was subsequently held to reach consensus on priority actions. Thailand. Thirty state actors and twenty-seven non-state actors. Level of policy implementation varied across different domains and actor groups. State actors rated implementation levels higher than non-state actors. Both state and non-state actors rated level of implementation of monitoring of BMI highest. Level of implementation of policies promoting in-store availability of healthy foods and policies increasing tax on unhealthy foods were rated lowest by state and non-state actors, respectively. Both groups reached consensus on eleven priority actions for implementation, focusing on food provision in public-sector settings, food composition, food promotion, leadership, monitoring and intelligence, and food trade. Although the implementation gaps identified and priority actions proposed varied between state and non-state actors, both groups achieved consensus on a comprehensive food policy package to be implemented by the Thai Government to improve the healthiness of food environments. This consensus is a platform for continued policy dialogue towards cross-sectoral policy coherence and effective actions to address the growing burden of non-communicable diseases and obesity in Thailand.
The compulsion to repeat the trauma. Re-enactment, revictimization, and masochism.
van der Kolk, B A
1989-06-01
Trauma can be repeated on behavioral, emotional, physiologic, and neuroendocrinologic levels. Repetition on these different levels causes a large variety of individual and social suffering. Anger directed against the self or others is always a central problem in the lives of people who have been violated and this is itself a repetitive re-enactment of real events from the past. People need a "safe base" for normal social and biologic development. Traumatization occurs when both internal and external resources are inadequate to cope with external threat. Uncontrollable disruptions or distortions of attachment bonds precede the development of post-traumatic stress syndromes. People seek increased attachment in the face of external danger. Adults, as well as children, may develop strong emotional ties with people who intermittently harass, beat, and threaten them. The persistence of these attachment bonds leads to confusion of pain and love. Assaults lead to hyperarousal states for which the memory can be state-dependent or dissociated, and this memory only returns fully during renewed terror. This interferes with good judgment about these relationships and allows longing for attachment to overcome realistic fears. All primates subjected to early abuse and deprivation are vulnerable to engage in violent relationships with peers as adults. Males tend to be hyperaggressive, and females fail to protect themselves and their offspring against danger. Chronic physiologic hyperarousal persists, particularly to stimuli reminiscent of the trauma. Later stresses tend to be experienced as somatic states, rather than as specific events that require specific means of coping. Thus, victims of trauma may respond to contemporary stimuli as a return of the trauma, without conscious awareness that past injury rather than current stress is the basis of their physiologic emergency responses. Hyperarousal interferes with the ability to make rational assessments and prevents resolution and
Applying the Seven Principles of Good Practice: Technology as a Lever--In an Online Research Course
Johnson, Sherryl
2014-01-01
This article provides an overview of the seven principles of good practice with emphasis on the implementation of technology in an online healthcare research class in a southwest Georgia (United States) university. The seven principles are outlined using various elements of the online course. Historical and philosophical reasoning are applied to…
DEFF Research Database (Denmark)
Esbjerg, Lars
of nine German food retailers, the paper analyses the role of identity in relation to the buying activities. In particular, this paper focuses on how retail buyers discursively construct their professional identities as buyers and the identities of the retail chains they work for and how this influences......This paper explores how retail buyers construct their own professional identities and the organisational identity of the retailers they work for and the importance of these constructions for the formulation and enactment of strategies and policies in the field of fresh pork. Through a case study...
Dantas, Galileu P S; Hamada, Neusa; Mendes, Humberto F
2016-05-30
Twenty two species of Stenochironomus Kieffer are known from Brazil, 19 of which occur in the Amazon region. In order to increase knowledge of the taxonomy of this genus in the Amazon region, collections were carried out in streams located in Presidente Figueiredo, Manaus and Itacoatiara municipalities, Amazonas State. Leaves and wood mined by Stenochironomus larvae were collected and transported to the laboratory where they were kept until adult emergence. Seven new species were found, one of which is described in the immature stages and as adults of both sexes (S. amazonicus sp. n.), one as immatures and adult male (S. liviae sp. n.), four as male and pupa (S. bare sp. n., S. figueiredoensis sp. n., S. gracilis sp. nov. and S. manauara sp. n.) and one only as male (S. suzanae sp. n.). Additionally, the female, pupa and larva of S. impendens Borkent, pupa and larva of S. jubatus Borkent, female and pupa of S. zonarius Borkent and female of S. palliaculeatus Borkent were described.
Bettez, Silvia
2017-01-01
Diversity and inclusion are popular, yet often challenging, topics for youth in schools. A common approach to address the issues is to invite outside speakers to discuss ways to "celebrate diversity." After being invited to give such a talk, I created and enacted a presentation at an affluent high school on this topic that is grounded in…
Political processes and variation in renewable energy policies between U.S. states
Vasseur, Michael
Over the past forty years federal efforts at renewable energy policy in the United States have been fragmented and are largely stalled. This is much different from U.S. states, which enact a diverse array of renewable energy policies. What factors explain this subnational variation? Addressing this question requires moving past the standard model of binary policy adoption that dominates studies of renewable energy policy. In its place I provide analyses of multifaceted policy outcomes, and also include predictors from a more inclusive view of politics than the standard economic and political interest factors. These additions to the standard energy policy model shed light not just on when states take policy action, but also on the content of the policies states ultimately adopt. In this dissertation I argue that different combinations of state-level political and economic characteristics influence policy adoption and policy content, a fact that is obscured by analysis of only binary policy action. I demonstrate this through three empirical projects that utilize an original longitudinal dataset and a variety of quantitative methods. The first project examines the diffusion of two varieties of a single regulatory policy instrument within a political context. I demonstrate that, contrary to most diffusion studies, policy adoption should be thought of as a multifaceted process, with separate factors determining the impetus for action and others shaping the content of the policy. My second project examines the role of economic, political, institutional, and cultural factors on a state's portfolio of policies. This work extends findings from prior literature on tax policies and incorporates institutional and cultural accounts of policy adoption into the study of renewable energy policy. I show that state economic and political factors, the predictors in traditional energy policy models, predict policy action but not policy content. Instead it is a state's cultural context
Houle, Meredith
2008-10-01
This multiple case study examined how three urban science teachers used curriculum materials designed educatively. Educative curriculum materials have been suggested as one way to support science teacher learning, particularly around new innovations and new pedagogies and to support teachers in evaluating and modifying materials to meet the needs of their students (Davis & Krajcik, 2005). While not a substitute for professional development, educative curriculum materials may provide an opportunity to support teachers' enactment and learning in the classroom context (Davis & Krajcik, 2005; Remillard, 2005; Schneider & Krajcik, 2002). However, little work has examined how science teachers interact with written curriculum materials to design classroom instruction. Grounded in sociocultural analysis, this study takes the theoretical stance that teachers and curriculum materials are engaged in a dynamic and participatory relationship from which the planned and enacted curriculum emerges (Remillard, 2005). Teaching is therefore a design activity where teachers rely on their personal resources and the curricular resources to construct and shape their students' learning experiences (Brown, 2002). Specifically this study examines how teacher beliefs influence their reading and use of curriculum and how educative features in the written curriculum inform teachers' pedagogical decisions. Data sources included classroom observation and video, teacher interviews, and classroom artifacts. To make sense how teachers' make curricular decisions, video were analyzed using Brown's (2002) Pedagogical Design for Enactment Framework. These coded units were examined in light of the teacher interviews, classroom notes and artifacts to examine how teachers' beliefs influenced these decisions. Data sources were then reexamined for evidence of teachers' use of specific educative features. My analyses revealed that teachers' beliefs about curriculum influenced the degree to which teachers
Fidelity of Implementation of a State Antibullying Policy with a Focus on Protected Social Classes
Hall, William J.; Chapman, Mimi V.
2018-01-01
Bullying threatens the mental and educational well-being of students. All states have enacted antibullying laws. This study surveyed 634 educators about the implementation of the North Carolina School Violence Prevention Act, which enumerated social classes protected from bullying: race, national origin, gender, socioeconomic status, sexual…
Stinson, Thomas F.; Voelker, Stanley W.
Development of Northern Great Plains coal resources will create new demands for state and local government services. Development will also produce increased government revenues. Special taxes on coal production have been enacted in Montana, North Dakota, and Wyoming in order to ensure that state and local governments receive sufficient revenues to…
Seven challenges for neuroscience.
Markram, Henry
2013-01-01
Although twenty-first century neuroscience is a major scientific enterprise, advances in basic research have not yet translated into benefits for society. In this paper, I outline seven fundamental challenges that need to be overcome. First, neuroscience has to become "big science" - we need big teams with the resources and competences to tackle the big problems. Second, we need to create interlinked sets of data providing a complete picture of single areas of the brain at their different levels of organization with "rungs" linking the descriptions for humans and other species. Such "data ladders" will help us to meet the third challenge - the development of efficient predictive tools, enabling us to drastically increase the information we can extract from expensive experiments. The fourth challenge goes one step further: we have to develop novel hardware and software sufficiently powerful to simulate the brain. In the future, supercomputer-based brain simulation will enable us to make in silico manipulations and recordings, which are currently completely impossible in the lab. The fifth and sixth challenges are translational. On the one hand we need to develop new ways of classifying and simulating brain disease, leading to better diagnosis and more effective drug discovery. On the other, we have to exploit our knowledge to build new brain-inspired technologies, with potentially huge benefits for industry and for society. This leads to the seventh challenge. Neuroscience can indeed deliver huge benefits but we have to be aware of widespread social concern about our work. We need to recognize the fears that exist, lay them to rest, and actively build public support for neuroscience research. We have to set goals for ourselves that the public can recognize and share. And then we have to deliver on our promises. Only in this way, will we receive the support and funding we need.
State insurance parity legislation for autism services and family financial burden.
Parish, Susan; Thomas, Kathleen; Rose, Roderick; Kilany, Mona; McConville, Robert
2012-06-01
We examined the association between states' legislative mandates that private insurance cover autism services and the health care-related financial burden reported by families of children with autism. Child and family data were drawn from the National Survey of Children with Special Health Care Needs (N = 2,082 children with autism). State policy characteristics were taken from public sources. The 3 outcomes were whether a family had any out-of-pocket health care expenditures during the past year for their child with autism, the expenditure amount, and expenditures as a proportion of family income. We modeled the association between states' autism service mandates and families' financial burden, adjusting for child-, family-, and state-level characteristics. Overall, 78% of families with a child with autism reported having any health care expenditures for their child for the prior 12 months. Among these families, 54% reported expenditures of more than $500, with 34% spending more than 3% of their income. Families living in states that enacted legislation mandating coverage of autism services were 28% less likely to report spending more than $500 for their children's health care costs, net of child and family characteristics. Families living in states that enacted parity legislation mandating coverage of autism services were 29% less likely to report spending more than $500 for their children's health care costs, net of child and family characteristics. This study offers preliminary evidence in support of advocates' arguments that requiring private insurers to cover autism services will reduce families' financial burdens associated with their children's health care expenses.
Moving Theory to Practice: One State's Role in Professional Learning for School and District Leaders
Augustine-Shaw, Donna
2016-01-01
As a continuum of professional learning for building and district leaders transitioning from leadership preparation programs into practice, the state of Kansas enacted mentoring and induction requirements as part of their role in supporting development of leadership skills important to on-the-job application of essential knowledge. One approved…
State legislative developments in radioactive materials transportation, July 1, 1994--June 30, 1995
International Nuclear Information System (INIS)
Goehring, J.B.; Reed, J.B.
1995-08-01
Each year, the National Conference of State Legislatures (NCSL) prepares an update on state developments in radioactive materials transportation. The 1995 Report on State Legislative Developments in Radioactive Materials Transportation describes activities between July 1, 1994 and June 30, 1995. Forty-six bills were introduced and are arranged in this report by state according to their status--enacted, pending or failed. The bills address nuclear materials transportation as well as the broader areas of hazardous materials transportation, waste storage and emergency responsiveness. Also included are state legislative resolutions and Federal Register notices and rule changes related to radioactive waste and hazardous materials transportation that affect states
State legislative developments in radioactive materials transportation, July 1, 1996--June 6, 1997
International Nuclear Information System (INIS)
Kim, M.H.; Reed, J.B.
1997-06-01
The National Conference of State Legislatures (NCSL) prepares an update on state developments in radioactive materials transportation each year. The 1997 Report on State Legislative Developments in Radioactive Materials Transportation describes activities between July 1, 1996 and June 6, 1997. Fifty bills were introduced and are arranged in this report by state according to their status--enacted, pending or failed. The bills address nuclear materials transportation as well as the broader areas of hazardous materials transportation, waste, storage and emergency response. Also summarized are state legislative resolutions and Federal Register notices and rule changes related to radioactive waste and hazardous materials transportation that affect states
Tremblay, Marie-Claude; Pluye, Pierre; Gore, Genevieve; Granikov, Vera; Filion, Kristian B; Eisenberg, Mark J
2015-06-03
Electronic cigarettes (e-cigarettes) have been steadily increasing in popularity since their introduction to US markets in 2007. Debates surrounding the proper regulatory mechanisms needed to mitigate potential harms associated with their use have focused on youth access, their potential for nicotine addiction, and the renormalization of a smoking culture. The objective of this study was to describe the enacted and planned regulations addressing this novel public health concern in the US. We searched LexisNexis Academic under Federal Regulations and Registers, as well as State Administrative Codes and Registers. This same database was also used to find information about planned regulations in secondary sources. The search was restricted to US documents produced between January 1(st), 2004, and July 14(th), 2014. We found two planned regulations at the federal level, and 74 enacted and planned regulations in 44 states. We identified six state-based regulation types, including i) access, ii) usage, iii) marketing and advertisement, iv) packaging, v) taxation, and vi) licensure. These were further classified into 10 restriction subtypes: sales, sale to minors, use in indoor public places, use in limited venues, use by minors, licensure, marketing and advertising, packaging, and taxation. Most enacted restrictions aimed primarily to limit youth access, while few regulations enforced comprehensive restrictions on product use and availability. Current regulations targeting e-cigarettes in the US are varied in nature and scope. There is greater consensus surrounding youth protection (access by minors and/or use by minors, and/or use in limited venues), with little consensus on multi-level regulations, including comprehensive use bans in public spaces.
World Climate Conference - a play re-enacting the COPs
Vamborg, Freja S. E.; Klockmann, Marlene; Koch, Boris P.; Otto, Juliane; Rauser, Florian; Schemann, Vera; Sonntag, Sebastian; Haug, Helgard; Kaegi, Stefan; Wetzel, Daniel; Schipper, Imanuel; Bochow, Jörg
2016-04-01
Last December, Paris was the host city for the 21st Conference of the Parties (COP21) of the United Nations Framework Convention on Climate Change (UNFCCC). Representatives of 195 countries met to dispute a legally binding climate agreement - a highly complex process involving thousands of politicians, scientists and activists, that to date has taken over two decades. The director ensemble "Rimini Protokoll" re-enacted this mammoth-scale drama of diplomacy in the play "Weltklimakonferenz" (World Climate Conference) at the "Deutsches Schauspielhaus" theatre in Hamburg, Germany. Since the opening night (21st Nov. 2014), the play has been performed 16 times, reaching an audience of over 9000. All performers in the play were experts and scientists at different stages of their careers, including PhD students, journalists and professors. Each spectator took on the identity of a delegate of one of the 195 participating countries. We will present the project and the performance, thereby highlighting the role of and the interaction between the spectators and early career scientists. In a nutshell the play went as follows (https://vimeo.com/137817619); after an opening ceremony, the audience was divided up into seven groups, each of which was given advice by experts in several different briefings. These informed on country-specific challenges caused by the social and economic situation, possible future climatic changes and negotiating tactics. In addition, the delegations had bilateral meetings, enabling them to exchange views and experiences with one another. Towards the end of the play each delegation was asked to submit a national commitment to greenhouse gas reduction and a financial contribution to the Green Climate Fund. Based on these national commitments, the final plenum revealed whether or not the delegations had managed to submit reductions compatible with restricting global warming to 2°C compared to pre-industrial times. Due to their direct personal involvement
The co-creation of meaningful action: bridging enaction and interactional sociology.
De Jaegher, Hanne; Peräkylä, Anssi; Stevanovic, Melisa
2016-05-05
What makes possible the co-creation of meaningful action? In this paper, we go in search of an answer to this question by combining insights from interactional sociology and enaction. Both research schools investigate social interactions as such, and conceptualize their organization in terms of autonomy. We ask what it could mean for an interaction to be autonomous, and discuss the structures and processes that contribute to and are maintained in the so-called interaction order. We also discuss the role played by individual vulnerability as well as the vulnerability of social interaction processes in the co-creation of meaningful action. Finally, we outline some implications of this interdisciplinary fraternization for the empirical study of social understanding, in particular in social neuroscience and psychology, pointing out the need for studies based on dynamic systems approaches on origins and references of coordination, and experimental designs to help understand human co-presence. © 2016 The Authors.
The co-creation of meaningful action: bridging enaction and interactional sociology
Peräkylä, Anssi; Stevanovic, Melisa
2016-01-01
What makes possible the co-creation of meaningful action? In this paper, we go in search of an answer to this question by combining insights from interactional sociology and enaction. Both research schools investigate social interactions as such, and conceptualize their organization in terms of autonomy. We ask what it could mean for an interaction to be autonomous, and discuss the structures and processes that contribute to and are maintained in the so-called interaction order. We also discuss the role played by individual vulnerability as well as the vulnerability of social interaction processes in the co-creation of meaningful action. Finally, we outline some implications of this interdisciplinary fraternization for the empirical study of social understanding, in particular in social neuroscience and psychology, pointing out the need for studies based on dynamic systems approaches on origins and references of coordination, and experimental designs to help understand human co-presence. PMID:27069055
Enacting Efficacy in Early Career: Narratives of Agency, Growth, and Identity
Directory of Open Access Journals (Sweden)
Elizabeth K Niehaus
2017-01-01
Full Text Available Aim/Purpose: To explore how early career faculty in the field of higher education administration develop and enact their personal and professional identities. Background:\tParticipants sought to understand themselves, to understand their environments and the “rules” of the academic “game,” and to reconcile conflicts between their own values and identities and the expectations and culture of their environments. Methodology: In-depth case studies of seventeen early career scholars in the field. Contribution: The participants’ experiences underscore important implications for mentoring and socialization that takes into consideration the unique motivation and identity development of aspiring and new faculty members. Findings: Identifies the early career period as one where new faculty are working to develop a strong internal foundation upon which they can manage the many challenges of their personal and professional lives. Recommendations: The findings point to implications for practice, both in graduate education and in departments hiring new faculty members.
DEFF Research Database (Denmark)
Engberg-Pedersen, Elisabeth; Christensen, Rikke Vang
2017-01-01
This study focuses on the relationship between content elements and mental-state language in narratives from twenty-seven children with autism (ASD), twelve children with language impairment (LI), and thirty typically developing children (TD). The groups did not differ on chronological age...... (;–;) and non-verbal cognitive skills, and the groups with ASD and TD did not differ on language measures. The children with ASD and LI had fewer content elements of the storyline than the TD children. Compared with the TD children, the children with ASD used fewer subordinate clauses about the characters......’ thoughts, and preferred talking about mental states as reported speech, especially in the form of direct speech. The children with LI did not differ from the TD children on these measures. The results are discussed in the context of difficulties with socio-cognition in children with ASD and of language...
Jones, Marian Moser; Benrubi, Isidore Daniel
2013-05-01
The history of consumer protection against household poisons presents a key case study of the uniquely American struggle to balance public health and safety with the interests of business. By the late 19th century, package designs, warning labels, and state statutes had formed an uneven patchwork of protective mechanisms against accidental poisonings. As household chemicals proliferated in the early 20th century, physicians concerned with childhood poisonings pressured the federal government to enact legislation mandating warning labels on packaging for these substances. Manufacturers of household chemicals agreed to labeling requirements for caustic poisons but resisted broader regulation. Accidental poisonings of children continued to increase until the enactment of broad labeling and packaging legislation in the 1960s and 1970s. This history suggests that voluntary agreements between government agencies and manufacturers are inadequate to protect consumers against household poisonings and that, in the United States, protective household chemical regulation proceeds in a reactive rather than a precautionary manner.
Bloxham, Sue; Boyd, Pete
2012-01-01
This article, using a student outcomes definition of academic standards, reports on academics' sense of standards as enacted through marking practices. Twelve lecturers from two UK universities were asked to "think aloud" as they graded written assignments followed by a semi-structured interview. The interview data were used to…
Swindells, Tracy; Francis, Leslie J.; Robbins, Mandy
2010-01-01
This study set out to examine the differences in attitude toward Christianity among year seven secondary school pupils who had undertaken their primary education either in a Church of England voluntary aided school or a non-denominational state-maintained school. Data were provided by 492 year-seven pupils attending three Church of England…
Twenty years of „post-communism”: the radiography of a political failure
Directory of Open Access Journals (Sweden)
Aurora Martin
2011-11-01
Full Text Available This empirical view on the current „state” of Romania has as main objective to emphasize that the contemporary economic crisis actually revealed some other escalated crises in the very heart of the Romanian society. The vicious circle determined by three crises – one political, another social-institutional and last, but not least, a cultural one, continuously weakened the state for the last twenty years. Romania will overcome the economic crisis but the key for walking out of the above-mentioned circle would be the real transformation of its core systems – political, institutional and educational.
The twenty-eight lodges (xiu 宿)
Morgan, Daniel Patrick
2018-01-01
The twenty-eight lodges (xiu 宿). Named and numbered in the central circle, the twenty-eight lodges, represent uneven orange-segment-like divisions of the celestial sphere running from pole to pole through the ‘guide stars’ (juxing 距星) at/near the western extremity of the constellations after which they are named. In the inner circle are the modern identifications of those guide stars. In the outer circle are the equatorial lodge widths in contemporary use in du 度 / days, where the number of d...
Living or Dead? Specifics of the Language of the Second Amendment to the U.S. Constitution
Directory of Open Access Journals (Sweden)
Kraśnicka Izabela
2014-09-01
Full Text Available The original text of the Constitution of the United States of America, written over 200 years ago, constitutes the supreme source of law in the American legal system. The seven articles and twenty seven amendments dictate understanding of fundamental principles of the federation’s functioning and its citizens’ rights.
Elyas, Tariq; Badawood, Omar
2016-01-01
There has been limited research focusing on the place of culture and resulting teaching and learning identities in EFL and how these issues impact on EFL policy, curriculum and enacted curriculum, especially textbooks. Even less research has focussed on these issues in the Gulf context. Some international research has explored the role of culture…
The Twenty Statement Test in Teacher Development
Directory of Open Access Journals (Sweden)
Ahmet Aypay
2011-10-01
Full Text Available The purpose of this study is to describe teacher characteristics using Twenty Statements Test (TST. Study group includes a total of thirty-five individuals, including teachers, guidance and counselors and research assistants. The study used a qualitative approach on teacher identity. TST is one of the qualitative methods that were used to determine individual self-conceptualization. Study group were requested to write twenty statements that describe themselves responding to the question “Who I am?” in a free format. The findings indicated that teachers were overwhelmingly in group c (reflective. No differences were found in terms of gender and profession. Only few significant differences have been found based on marital status. The utility of TST in teacher training and development was discussed.
The Twenty Statement Test in Teacher Development
Directory of Open Access Journals (Sweden)
Ahmet Aypay
2011-04-01
Full Text Available The purpose of this study is to describe teacher characteristics using Twenty Statements Test (TST. Study group includes a total of thirty-five individuals, including teachers, guidance and counselors and research assistants. The study used a qualitative approach on teacher identity. TST is one of the qualitative methods that were used to determine individual self-conceptualization. Study group were requested to write twenty statements that describe themselves responding to the question “Who I am?” in a free format. The findings indicated that teachers were overwhelmingly in group c (reflective. No differences were found in terms of gender and profession. Only few significant differences have been found based on marital status. The utility of TST in teacher training and development was discussed
Putting Gino's lesson to work: Actor-network theory, enacted humanity, and rehabilitation.
Abrams, Thomas; Gibson, Barbara E
2016-02-01
This article argues that rehabilitation enacts a particular understanding of "the human" throughout therapeutic assessment and treatment. Following Michel Callon and Vololona Rabeharisoa's "Gino's Lesson on Humanity," we suggest that this is not simply a top-down process, but is cultivated in the application and response to biomedical frameworks of human ability, competence, and responsibility. The emergence of the human is at once a materially contingent, moral, and interpersonal process. We begin the article by outlining the basics of the actor-network theory that underpins "Gino's Lesson on Humanity." Next, we elucidate its central thesis regarding how disabled personhood emerges through actor-network interactions. Section "Learning Gino's lesson" draws on two autobiographical examples, examining the emergence of humanity through rehabilitation, particularly assessment measures and the responses to them. We conclude by thinking about how rehabilitation and actor-network theory might take this lesson on humanity seriously. © The Author(s) 2016.
Islamic Family Law Enactment 1987 (No. 3 of 1987), 20 May 1987.
1988-01-01
This Islamic Family Law Enactment of Pahang, Malaysia, is based on the model of the Islamic Family Law (Federal Territory) Act, 1984 (Annual Review of Population Law, Vol. 11, 1984, Section 250). It differs from that Law in the following major respects: 1) marriages between Muslims and non-Muslims are prohibited; 2) a wali Hakim (special guardian appointed by the Sultan) is authorized to consent to marriage if the wali (guardian) of the bride unreasonably withholds consent; 3) the grounds for divorce are fewer (failure to maintain and cruelty being omitted), although there is a general provision allowing divorce for any ground that is recognized as valid by Islamic law; 4) a son is to be maintained until the age of 15, not 18; and 5) a religious court, rather than a civil court, may order a putative father to maintain his illegitimate child. full text
Strong coupling in F-theory and geometrically non-Higgsable seven-branes
Directory of Open Access Journals (Sweden)
James Halverson
2017-06-01
Full Text Available Geometrically non-Higgsable seven-branes carry gauge sectors that cannot be broken by complex structure deformation, and there is growing evidence that such configurations are typical in F-theory. We study strongly coupled physics associated with these branes. Axiodilaton profiles are computed using Ramanujan's theories of elliptic functions to alternative bases, showing explicitly that the string coupling is O(1 in the vicinity of the brane; that it sources nilpotent SL(2,Z monodromy and therefore the associated brane charges are modular; and that essentially all F-theory compactifications have regions with order one string coupling. It is shown that non-perturbative SU(3 and SU(2 seven-branes are related to weakly coupled counterparts with D7-branes via deformation-induced Hanany–Witten moves on (p,q string junctions that turn them into fundamental open strings; only the former may exist for generic complex structure. D3-brane near these and the Kodaira type II seven-branes probe Argyres–Douglas theories. The BPS states of slightly deformed theories are shown to be dyonic string junctions.
Exposure and Knowledge of Sharps Injuries among Medical Students in Seven States of Mexico
Directory of Open Access Journals (Sweden)
Adrián Camacho-Ortiz
2015-03-01
Full Text Available Background: Medical students are vulnerable to accidental exposure to blood-borne pathogens when performing clinical activities. Knowledge of both the prevalence of exposure and necessary reporting procedures is important to minimize the risk of harm to medical students. Methods: A cross-sectional online survey of medical students from 19 universities from seven states in Mexico was utilized to determine the prevalence of needle stick injuries amongst medical students and the associated reporting procedures. Results: We included 312 respondents; of these, 52.24% were men and 47.76% were women, with a mean age of 23.19 years (SD ± 2.11 years. Nearly all of them (94.23% were medical students doing clerkships in public hospitals. Mean knowledge score of blood-borne pathogens was 3.6 (SD ± 1.16 on a scale of 0-10 designed specifically for this study. Thirty-five per cent of the respondents had sustained a needle stick injury at some point during their medical school training, and 33.97% reported some type of mucocutaneous exposure. Overall, the non-reporting rate of needle stick injury was 48.34%. Approximately 25% of the respondents were not familiar with reporting procedures in the event of a needle stick injury or mucocutaneous exposure; 61.50% had received information from their hospital about the standard protocol to follow after a blood or body fluid exposure. Conclusion: In this Mexican population of medical students, there is a high risk of suffering needle stick injuries during medical training. Furthermore, knowledge regarding prevention, evaluation, and reporting of needle stick injuries is suboptimal.
Completion of the first approach to critical for the seven percent critical experiment
International Nuclear Information System (INIS)
Barber, A. D.; Harms, G. A.
2009-01-01
The first approach-to-critical experiment in the Seven Percent Critical Experiment series was recently completed at Sandia. This experiment is part of the Seven Percent Critical Experiment which will provide new critical and reactor physics benchmarks for fuel enrichments greater than five weight percent. The inverse multiplication method was used to determine the state of the system during the course of the experiment. Using the inverse multiplication method, it was determined that the critical experiment went slightly supercritical with 1148 fuel elements in the fuel array. The experiment is described and the results of the experiment are presented. (authors)
The impact of late budgets on state government borrowing costs
DEFF Research Database (Denmark)
Andersen, Asger Lau; Lassen, David Dreyer; Nielsen, Lasse Holbøll Westh
2014-01-01
We analyze how a key component of fiscal governance, the ability of governments to pass a budget on time, affects government bond yield spreads. Based on a sample of 36 US states from 1988 to 1997, and using an original data set on budget enactment dates, we estimate that a 30. day budget delay h...... a cumulative impact that is equivalent to a one-time increase in the yield spread of around 10 basis points. States with sufficient liquidity incur no costs from late budgets, while unified governments face large penalties from not finishing a budget on time....
Johnson, Donna B; Quinn, Emilee L; Podrabsky, Mary; Beckwith-Stanley, Nadia; Chan, Nadine; Ellings, Amy; Kovacs, Tricia; Lane, Claire
2013-12-01
The present study measured the perceived impact and political and implementation feasibility of state-level policy strategies related to increasing access to healthy foods and limiting unhealthy foods. Potential state-level policy strategies to improve access to healthy foods were identified through a review of evidence-based literature and policy recommendations. Respondents rated the perceived impact and political and implementation feasibility of each policy on a five-point scale using online surveys. Washington State policy process. Forty-nine content experts (national researchers and subject experts), forty policy experts (state elected officials or their staff, gubernatorial or legislative policy analysts) and forty-five other stakeholders (state-level advocates, programme administrators, food producers). In aggregate, respondents rated policy impact and implementation feasibility higher than political feasibility. Policy experts rated policy strategies as less politically feasible compared with content experts (P political and implementation feasibility. These included policies related to nutrition standards in schools and child-care facilities, food distribution systems, urban planning projects, water availability, joint use agreements and breast-feeding supports. Although they may be perceived as potentially impactful, some policies will be more difficult to enact than others. Information about the potential feasibility of policies to improve access to healthy foods can be used to focus limited policy process resources on strategies with the highest potential for enactment, implementation and impact.
Establishing the R&D Agenda for Twenty-First Century Learning
Kay, Ken; Honey, Margaret
2006-01-01
Much ink has flowed over the past few years describing the need to incorporate twenty-first century skills into K-12 education. Preparing students to succeed as citizens, thinkers, and workers--the bedrock of any educational system--in this environment means arming them with more than a list of facts and important dates. Infusing twenty-first…
From naturalistic neuroscience to modeling radical embodiment with narrative enactive systems
Tikka, Pia; Kaipainen, Mauri Ylermi
2014-01-01
Mainstream cognitive neuroscience has begun to accept the idea of embodied mind, which assumes that the human mind is fundamentally constituted by the dynamical interactions of the brain, body, and the environment. In today’s paradigm of naturalistic neurosciences, subjects are exposed to rich contexts, such as video sequences or entire films, under relatively controlled conditions, against which researchers can interpret changes in neural responses within a time window. However, from the point of view of radical embodied cognitive neuroscience, the increasing complexity alone will not suffice as the explanatory apparatus for dynamical embodiment and situatedness of the mind. We suggest that narrative enactive systems with dynamically adaptive content as stimuli, may serve better to account for the embodied mind engaged with the surrounding world. Among the ensuing challenges for neuroimaging studies is how to interpret brain data against broad temporal contexts of previous experiences that condition the unfolding experience of nowness. We propose means to tackle this issue, as well as ways to limit the exponentially growing combinatoria of narrative paths to a controllable number. PMID:25339890
From naturalistic neuroscience to modeling radical embodiment with narrative enactive systems.
Tikka, Pia; Kaipainen, Mauri Ylermi
2014-01-01
Mainstream cognitive neuroscience has begun to accept the idea of embodied mind, which assumes that the human mind is fundamentally constituted by the dynamical interactions of the brain, body, and the environment. In today's paradigm of naturalistic neurosciences, subjects are exposed to rich contexts, such as video sequences or entire films, under relatively controlled conditions, against which researchers can interpret changes in neural responses within a time window. However, from the point of view of radical embodied cognitive neuroscience, the increasing complexity alone will not suffice as the explanatory apparatus for dynamical embodiment and situatedness of the mind. We suggest that narrative enactive systems with dynamically adaptive content as stimuli, may serve better to account for the embodied mind engaged with the surrounding world. Among the ensuing challenges for neuroimaging studies is how to interpret brain data against broad temporal contexts of previous experiences that condition the unfolding experience of nowness. We propose means to tackle this issue, as well as ways to limit the exponentially growing combinatoria of narrative paths to a controllable number.
Break the "wall" and become creative: Enacting embodied metaphors in virtual reality.
Wang, Xinyue; Lu, Kelong; Runco, Mark A; Hao, Ning
2018-07-01
This study investigated whether the experience of "breaking the walls", the embodiment of the metaphor "breaking the rules", could enhance creative performance. The virtual reality technology was used to simulate the scenario where participants could "break the walls" while walking in a corridor. Participants were asked to solve the creativity-demanding problems (ie., alternative uses tasks, AUT) in either the "break" condition in which they had to break the walls to move forward in VR, or the "no-break" condition where no barrier walls would appear. Results showed higher AUT originality and AUT fluency in the "break" condition than in the "no-break" condition. Moreover, the effects of "breaking the walls" on AUT originality were fully mediated by cognitive flexibility and persistence. These findings may indicate that enacting metaphors such as "breaking the rules" contribute to creative performance. The enhanced cognitive flexibility and persistence may account for the benefits. Copyright © 2018 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Qi, Rongfeng; Zhang, Long Jiang; Zhong, Jianhui; Zhang, Zhiqiang; Ni, Ling; Zheng, Gang; Lu, Guang Ming
2013-01-01
Background and purpose: Little is known about the role of thalamus in the pathophysiology of minimal hepatic encephalopathy (MHE). The purpose of this study was to investigate whether the thalamic functional connectivity was disrupted in cirrhotic patients with MHE by using resting-state functional magnetic resonance imaging (rs-fMRI). Materials and Methods: Twenty seven MHE patients and twenty seven age- and gender- matched healthy controls participated in the rs-fMRI scans. The functional connectivity of 11 thalamic nuclei were characterized by using a standard seed-based whole-brain correlation method and compared between MHE patients and healthy controls. Pearson correlation analysis was performed between the thalamic functional connectivity and venous blood ammonia levels/neuropsychological tests scores of patients. Results: The ventral anterior nucleus (VAN) and the ventral posterior medial nucleus (VPMN) in each side of thalamus showed abnormal functional connectivities in MHE. Compared with healthy controls, MHE patients demonstrated significant decreased functional connectivity between the right/left VAN and the bilateral putamen/pallidum, inferior frontal gyri, insula, supplementary motor area, right middle frontal gyrus, medial frontal gyrus. In addition, MHE patients showed significantly decreased functional connectivity with the right/left VPMN in the bilateral middle temporal gyri (MTG), temporal lobe, and right superior temporal gyrus. The venous blood ammonia levels of MHE patients negatively correlated with the functional connectivity between the VAN and the insula. Number connecting test scores showed negative correlation with the functional connectivity between the VAN and the insula, and between the VPMN and the MTG. Conclusion: MHE patients had disrupted thalamic functional connectivity, which mainly located in the bilateral ventral anterior nuclei and ventral posterior medial nuclei. The decreased connectivity between thalamus and many
Energy Technology Data Exchange (ETDEWEB)
Qi, Rongfeng [Department of Medical Imaging, Jinling Hospital, Clinical School of Medical College, Nanjing University, Nanjing 210002 (China); Zhang, Long Jiang, E-mail: kevinzhanglongjiang@yahoo.com.cn [Department of Medical Imaging, Jinling Hospital, Clinical School of Medical College, Nanjing University, Nanjing 210002 (China); Zhong, Jianhui [Department of Biomedical Engineering, Zhejiang University, Hangzhou, Zhejiang 310027 (China); Zhang, Zhiqiang; Ni, Ling; Zheng, Gang [Department of Medical Imaging, Jinling Hospital, Clinical School of Medical College, Nanjing University, Nanjing 210002 (China); Lu, Guang Ming, E-mail: cjr.luguangming@vip.163.com [Department of Medical Imaging, Jinling Hospital, Clinical School of Medical College, Nanjing University, Nanjing 210002 (China)
2013-05-15
Background and purpose: Little is known about the role of thalamus in the pathophysiology of minimal hepatic encephalopathy (MHE). The purpose of this study was to investigate whether the thalamic functional connectivity was disrupted in cirrhotic patients with MHE by using resting-state functional magnetic resonance imaging (rs-fMRI). Materials and Methods: Twenty seven MHE patients and twenty seven age- and gender- matched healthy controls participated in the rs-fMRI scans. The functional connectivity of 11 thalamic nuclei were characterized by using a standard seed-based whole-brain correlation method and compared between MHE patients and healthy controls. Pearson correlation analysis was performed between the thalamic functional connectivity and venous blood ammonia levels/neuropsychological tests scores of patients. Results: The ventral anterior nucleus (VAN) and the ventral posterior medial nucleus (VPMN) in each side of thalamus showed abnormal functional connectivities in MHE. Compared with healthy controls, MHE patients demonstrated significant decreased functional connectivity between the right/left VAN and the bilateral putamen/pallidum, inferior frontal gyri, insula, supplementary motor area, right middle frontal gyrus, medial frontal gyrus. In addition, MHE patients showed significantly decreased functional connectivity with the right/left VPMN in the bilateral middle temporal gyri (MTG), temporal lobe, and right superior temporal gyrus. The venous blood ammonia levels of MHE patients negatively correlated with the functional connectivity between the VAN and the insula. Number connecting test scores showed negative correlation with the functional connectivity between the VAN and the insula, and between the VPMN and the MTG. Conclusion: MHE patients had disrupted thalamic functional connectivity, which mainly located in the bilateral ventral anterior nuclei and ventral posterior medial nuclei. The decreased connectivity between thalamus and many
The next twenty years - IAEA's role
International Nuclear Information System (INIS)
Tape, G.F.
1977-01-01
The twentieth anniversary of an institution is an appropriate time to look back and to ask what has been achieved. It is also an appropriate time to look ahead and to ask what should be the mission for the future. How can the strengths of the International Atomic Energy Agency (IAEA) be best utilized, what new opportunities should be seized upon, and what challenges should the IAEA be prepared to meet in the next twenty years? Forward planning is a very necessary activity in today's world. There are so many demands on national or institutional resources that careful analysis of options is necessary to establish priorities and ultimately to provide for implementation. But such planning must be done carefully with full appreciation for the validity and sensitivity of the input assumptions and data. Furthermore, today's plan, while setting goals and directions, cannot be so inflexible that it cannot be responsive to ever-changing political, economic and technical constraints or opportunities. Thus in looking ahead, the plan must contain provisions for flexibility to provide for further modifications in the light of ever-changing knowledge, attitudes, and world conditions. The experience of the past five years in the energy field, and especially in nuclear energy, underscores this need. In looking ahead for the next twenty years, we are attempting to describe the International Atomic Energy Agency and its role through the twentieth century. In doing so, we are automatically laying the base for the Agency's work going into the twenty-first century. In short, we are trying to visualize a programme that can serve the coming generation and, in doing so, creating a base from which the needs of the succeeding generation can be met. This is a large order and the crystal ball is less than clear. (author)
Advancing public health obesity policy through state attorneys general.
Pomeranz, Jennifer L; Brownell, Kelly D
2011-03-01
Obesity in the United States exacts a heavy health and financial toll, requiring new approaches to address this public health crisis. State attorneys general have been underutilized in efforts to formulate and implement food and obesity policy solutions. Their authority lies at the intersection of law and public policy, creating unique opportunities unavailable to other officials and government entities. Attorneys general have a broad range of authority over matters specifically relevant to obesity and nutrition policy, including parens patriae (parent of the country) authority, protecting consumer interests, enacting and supporting rules and regulations, working together across states, engaging in consumer education, and drafting opinions and amicus briefs. Significant room exists for greater attorney general involvement in formulating and championing solutions to public health problems such as obesity.
Directory of Open Access Journals (Sweden)
Corinne Grenier
2011-02-01
Full Text Available Research question: We are looking at the process of structuring an integrated care system as an innovative process that swings back and forth between the diversity of the actors involved, local aspirations and national and regional regulations. We believe that innovation is enriched by the variety of the actors involved, but may also be blocked or disrupted by that diversity. Our research aims to add to other research, which, when questioning these integrated systems, analyses how the actors involved deal with diversity without really questioning it. Case study: The empirical basis of the paper is provided by case study analysis. The studied integrated care system is a French healthcare network that brings together healthcare professionals and various organisations in order to improve the way in which interventions are coordinated and formalised, in order to promote better detection and diagnosis procedures and the implementation of a care protocol. We consider this case as instrumental in developing theoretical proposals for structuring an integrated care system in light of the diversity of the actors involved. Results and discussion: We are proposing a model for structuring an integrated care system in light of the enacted diversity of the actors involved. This model is based on three factors: the diversity enacted by the leaders, three stances for considering the contribution made by diversity in the structuring process and the specific leading role played by those in charge of the structuring process. Through this process, they determined how the actors involved in the project were differentiated, and on what basis those actors were involved. By mobilizing enacted diversity, the leaders are seeking to channel the emergence of a network in light of their own representation of that network. This model adds to published research on the structuring of integrated care systems.
Directory of Open Access Journals (Sweden)
Corinne Grenier
2011-02-01
Full Text Available Research question: We are looking at the process of structuring an integrated care system as an innovative process that swings back and forth between the diversity of the actors involved, local aspirations and national and regional regulations. We believe that innovation is enriched by the variety of the actors involved, but may also be blocked or disrupted by that diversity. Our research aims to add to other research, which, when questioning these integrated systems, analyses how the actors involved deal with diversity without really questioning it.Case study: The empirical basis of the paper is provided by case study analysis. The studied integrated care system is a French healthcare network that brings together healthcare professionals and various organisations in order to improve the way in which interventions are coordinated and formalised, in order to promote better detection and diagnosis procedures and the implementation of a care protocol. We consider this case as instrumental in developing theoretical proposals for structuring an integrated care system in light of the diversity of the actors involved.Results and discussion: We are proposing a model for structuring an integrated care system in light of the enacted diversity of the actors involved. This model is based on three factors: the diversity enacted by the leaders, three stances for considering the contribution made by diversity in the structuring process and the specific leading role played by those in charge of the structuring process. Through this process, they determined how the actors involved in the project were differentiated, and on what basis those actors were involved. By mobilizing enacted diversity, the leaders are seeking to channel the emergence of a network in light of their own representation of that network. This model adds to published research on the structuring of integrated care systems.
Directory of Open Access Journals (Sweden)
Martin J-D Otis
Full Text Available Our daily activities imply displacements on various types of soil. For persons with gait disorder or losing functional autonomy, walking on some types of soil could be challenging because of the risk of falling it represents.In this paper, we present, in a first part, the use of an enactive shoe for an automatic differentiation of several types of soil. In a second part, using a second improved prototype (an enactive insole, twelve participants with Parkinson's disease (PD and nine age-matched controls have performed the Timed Up and Go (TUG test on six types of soil with and without cueing. The frequency of the cueing was set at 10% above the cadence computed at the lower risk of falling (walking over the concrete. Depending on the cadence computed at the lower risk, the enactive insole activates a vibrotactile cueing aiming to improve gait and balance control. Finally, a risk index is computed using gait parameters in relation to given type of soil.The frequency analysis of the heel strike vibration allows the differentiation of various types of soil. The risk computed is associated to an appropriate rhythmic cueing in order to improve balance and gait impairment. The results show that a vibrotactile cueing could help to reduce the risk of falling.Firstly, this paper demonstrates the feasibility of reducing the risk of falling while walking on different types of soil using vibrotactile cueing. We found a significant difference and a significant decrease in the computed risks of falling for most of types of soil especially for deformable soils which can lead to fall. Secondly, heel strike provides an approximation of the impulse response of the soil that can be analyzed with time and frequency-domain modeling. From these analyses, an index is computed enabling differentiation the types of soil.
International Nuclear Information System (INIS)
Koo, Gyeong Hoi; Kim, J. B.; Lee, H. Y.; Park, C. G.
2008-11-01
This report is a draft of an enactment of KEPIC MNH based on 2007 ASME Boiler and Pressure Vessel Code, Section III, Division 1 Subsection NH for Class 1 Components in Elevated Temperature Service and contains of ASME Article NH-3000 design, the mandatory appendix I-14, and non-mandatory appendices T and X
Energy Technology Data Exchange (ETDEWEB)
Koo, Gyeong Hoi; Kim, J. B.; Lee, H. Y.; Park, C. G
2008-11-15
This report is a draft of an enactment of KEPIC MNH based on 2007 ASME Boiler and Pressure Vessel Code, Section III, Division 1 Subsection NH for Class 1 Components in Elevated Temperature Service and contains of ASME Article NH-3000 design, the mandatory appendix I-14, and non-mandatory appendices T and X.
Furtak, Erin Marie; Alonzo, Alicia C.
2010-05-01
The Trends in International Mathematics and Science Study (TIMSS) Video Study explored instructional practices in the United States (US) in comparison with other countries that ranked higher on the 1999 TIMSS assessment, and revealed that 8th grade science teachers in the US emphasize activities over content during lessons (Roth et al. 2006). This study applies the content framework from the TIMSS Video Study to a sample of 28 3rd grade teachers enacting an inquiry-based unit on floating and sinking, and seeks a deeper understanding of teachers’ practices through analysis of interviews with those teachers. Transcripts of observed lessons were coded according to the TIMSS framework for types of content, and transcripts of teacher interviews were coded to capture the ways in which teachers described their role in and purposes for teaching science, particularly with respect to the floating and sinking unit. Results indicate that teachers focused more on canonical, procedural and experimental knowledge during lessons than on real-world connections and the nature of science; however, none of the types of content received major emphasis in a majority of the classrooms in the sample. During interviews, teachers described their practice in ways that prioritized helping students to like science over specific content outcomes. The study suggests that elementary school teachers’ emphasis on doing and feeling during inquiry-based lessons may interfere with teaching of content.
DiGiulio, Anne; Jump, Zach; Yu, Annie; Babb, Stephen; Schecter, Anna; Williams, Kisha-Ann S; Yembra, Debbie; Armour, Brian S
2018-04-06
Cigarette smoking prevalence among Medicaid enrollees (25.3%) is approximately twice that of privately insured Americans (11.8%), placing Medicaid enrollees at increased risk for smoking-related disease and death (1). Medicaid spends approximately $39 billion annually on treating smoking-related diseases (2). Individual, group, and telephone counseling and seven Food and Drug Administration (FDA)-approved medications* are effective in helping tobacco users quit (3). Although state Medicaid coverage of tobacco cessation treatments improved during 2014-2015, coverage was still limited in most states (4). To monitor recent changes in state Medicaid cessation coverage for traditional (i.e., nonexpansion) Medicaid enrollees, the American Lung Association collected data on coverage of a total of nine cessation treatments: individual counseling, group counseling, and seven FDA-approved cessation medications † in state Medicaid programs during July 1, 2015-June 30, 2017. The American Lung Association also collected data on seven barriers to accessing covered treatments, such as copayments and prior authorization. As of June 30, 2017, 10 states covered all nine of these treatments for all enrollees, up from nine states as of June 30, 2015; of these 10 states, Missouri was the only state to have removed all seven barriers to accessing these cessation treatments. State Medicaid programs that cover all evidence-based cessation treatments, remove barriers to accessing these treatments, and promote covered treatments to Medicaid enrollees and health care providers would be expected to reduce smoking, smoking-related disease, and smoking-attributable federal and state health care expenditures (5-7).
International Nuclear Information System (INIS)
Tait, T.D.
1987-03-01
The 1980 Low-Level Radioactive Waste Policy Act (Public Law 96-573) assigned each state the responsibility for providing disposal capacity for the low-level radioactive waste (LLW) generated within its borders, except for certain LLW generated by the activities of the federal government. The law also authorized and encouraged states to enter into interstate compacts to provide for the establishment and operation of regional LLW disposal facilities. The January 1986 enactment of Public Law 99-240, the Low-Level Radioactive Waste Policy Amendments Act of 1985 (LLRWPAA), resolved an impasse that had delayed congressional consent to seven interstate compacts formed for the regional disposal of LLW. The Act ensures that LLW generators will have continued access to the three existing commercial LLW disposal sites through 1992 as long as their states or regions are in compliance with milestones prescribed in the Act for development of new disposal facilities. Furthermore, the LLRWPAA assigned several responsibilities to the Department of Energy. The objective of the Low-Level Radioactive Waste Policy Amendments Act of 1985 is to ensure the development of an effective, safe, and environmentally acceptable nationwide system for the disposal of LLW by 1993. The Department of Energy is assisting the states and regions to achieve that objective and ensure that the system that is developed provides for the safe management and disposal of LLW at reasonable costs. Furthermore, the Department is working with the states and regions to ensure that while the new system is being developed, there are not disruptions in the current LLW management and disposal practices and that the public continues to receive the benefits of the industries that rely on nuclear materials to deliver their services
It is just not fair: the Endangered Species Act in the United States and Ontario
Directory of Open Access Journals (Sweden)
Andrea Olive
2016-09-01
Full Text Available The United States and the Canadian province of Ontario have enacted endangered species laws that regulate private land. The rationale for this is that the vast majority of endangered species in the two countries rely on private lands for survival. However, from a landowner perspective the law is deemed unfair. This paper presents analysis from 141 interviews with landowners in three U.S. states and Ontario. In recognition of distributive justice claims, both the U.S. government and the Ontario government have enacted programs aimed at increasing financial incentives for participation and compliance with the law. However, the law is still perceived as unfair. The central argument of this paper is that future amendments and new policies for endangered species should confront two other forms of environmental justice: procedural justice and justice-as-recognition. Landowners in both countries expressed not only concerns about compensation, but also a deep desire to be included in the protection and recovery process, as well as to be recognized by government and society as good stewards of the land. The paper concludes by stating that future policy amendments need to address justice-as-recognition if endangered species conservation on private lands is to be considered fair by landowners.
State legislative developments in radioactive materials transportation, July 1, 1995--June 30, 1996
International Nuclear Information System (INIS)
Goehring, J.B.; Reed, J.B.
1996-09-01
The National Conference of State Legislatures (NCSL) prepares an update on state developments in radioactive materials transportation each year. The 1996 Report on State Legislative Developments in Radioactive Materials Transportation describes activities between July 1, 1995, and June 30, 1996. Thirteen bills were introduced and are arranged in this report by state according to their status--enacted, pending or failed. The report also includes 10 New York bills introduced in 1995 that remained pending during this review period. The bills address nuclear materials transportation as well as the broader areas of hazardous materials transportation, waste storage and emergency response. Also summarized are a state legislative resolution and Federal Register notices and rule changes related to radioactive waste and hazardous materials transportation that affect states
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-11-01
The Interstate Oil and Gas Compact Commission (IOGCC) has conducted a series of studies to evaluate the known, remaining oil resource in twenty-three (23) states. The primary objective of die IOGCC`s effort is to examine the potential impact of an aggressive and focused program of research, development, and demonstration (RD&D) and technology transfer on future oil recovery in the United States. As part of a larger effort by the IOGCC, this report focuses on the potential economic benefits of improved oil recovery in the state of Kansas. Individual reports for seven other oil producing states and a national report have been separately published by the IOGCC. Several major technical insights for state and Federal policymakers and regulators can be reached from this analysis. Overall, well abandonments and more stringent environmental regulations could limit economic access to the nation`s known, remaining oil resource. The high risk of near-term abandonment and the significant benefits of future application of improved oil recovery technoloy, clearly point to a need for more aggressive transfer of currently available technologies to domestic oil producers. Development and application of advanced oil recovery technologies could leave even greater benefits to the nation. A collaborative, focused RD&D effort, integrating the resources and expertise of industry, state and local governments, and the Federal government, is clearly warranted. With effective RD&D and a program of aggressive technology transfer to widely disseminate its results, Kansas oil production could be maximized. The resulting increase in production rates, employment, operator profits, state and Federal tax revenues, energy security will benefit the state of Kansas and the nation as a whole.
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-11-01
The Interstate Oil and Gas Compact Commission (IOGCC) has conducted a series of studies to evaluate the known, remaining oil resource in twenty-three (23) states. The primary objective of die IOGCC`s effort is to examine the potential impact of an aggressive and focused program of research, development, and demonstration (RD&D) and technology transfer on future oil recovery in the United States. As part of a larger effort by the IOGCC, this report focuses on the potential economic benefits of improved oil recovery in the state of Louisiana. Individual reports for seven other oil producing states and a national report have been separately published by the IOGCC. Several major technical insights for state and Federal policymakers and regulators can be reached from this analysis. Overall, well abandonments and more stringent environmental regulations could limit economic access to the nation`s known, remaining oil resource. The high risk of near-term abandonment and the significant benefits of future application of improved oil recovery technoloy, clearly point to a need for more aggressive transfer of currently available technologies to domestic oil producers. Development and application of advanced oil recovery technologies could leave even greater benefits to the nation. A collaborative, focused RD&D effort, integrating the resources and expertise of industry, state and local governments, and the Federal government, is clearly warranted. With effective RD&D and a program of aggressive technology transfer to widely disseminate its results, Louisiana oil production could be maximized. The resulting increase and improvement in production rates, employment, operator profits, state and Federal tax revenues, energy security will benefit both the state of Louisiana and the nation as a whole.
Waaldijk, C.; Bonini-Baraldi, M.T.
2006-01-01
Since 2003 the Employment Equality Directive (2000/78/EC) requires Member States of the European Union to prohibit sexual orientation discrimination in the field of employment. This book assesses to what degree the Directive’s requirements have been met by the twenty-seven Member States. The authors
Developing A Strategy to Enact Lean
Directory of Open Access Journals (Sweden)
Nicola Morrey
2013-01-01
Full Text Available This paper explains the strategy employed by a case study company to implement lean across the business, and to reflect on the success of this approach so other companies may consider this learning and how it might be useful to them. The strategy to enact lean in the case study company was based on creating a number of standard tools/ways of working. These tools can be considered to be standardised work for key aspects of the construction process that the company undertakes. The aim of the tools was to ensure that critical tasks would be carried out to the correct standard (quality, time, cost, health and safety every time, across the business. Achievement of this is expected to lead to improved performance and elimination of variation (waste. To implement this strategy of using standardised work to eliminate variation and lead to improved performance, a step-by-step process was developed to create the tools/standardised work. The paper describes the process that was undertaken and how it aimed to not only produce a number of tools/standardised work, but also to involve people and managers from across the business such that lean philosophy and thinking might also begin to become embedded. The paper will firstly explain, with reference to the relevant literature, how and why the strategy to implement standardised work was chosen, the process that was defined to develop the standardised work, and what happened when that process was put into practice. The findings of the paper show that whilst the completed tools delivered business benefits, the development of the tools did not follow the planned process. The paper discusses how people within the business responded to this strategy and how the process had to be continuously adapted to cope with the current business environment and path dependencies, further evidencing that lean implementations need to be tailored to suit the needs of the individual firm, rather than there being a one size fits all
International Nuclear Information System (INIS)
Jenerette, G Darrel; Buyantuev, Alexander; Miller, Greg; Pataki, Diane E; Gillespie, Thomas W; Pincetl, Stephanie
2013-01-01
To better understand how urbanization affects the amount and timing of urban vegetation in drylands we investigated remotely sensed vegetation patterns across seven large metropolitan regions in the southwestern United States. We asked (1) how low density urban land cover differed from adjacent wildland grass, herb, and shrub land covers in both the amount of vegetation and the length of the growing season, (2) how neighborhood income affected patterns of vegetation within low density urban cover, and (3) how cities differed from one another in their vegetation patterns. We found that urbanization generally has a strong influence on vegetation compared to adjacent wildlands. In four of the metropolitan regions the cumulative enhanced vegetation index (EVI) and growing season length in low density developments were higher than grass, herb, and shrub land covers. Within all metropolitan regions, there was a significant socioeconomic effect where higher income areas had a higher cumulative EVI than lower income areas. The large differences in urban vegetation among cities were related to precipitation and total domestic water use. These findings help to identify how urbanization influences vegetation, with implications for the availability of ecosystem services and requirements for irrigation in hot dryland cities. (letter)
Mathews, Ben; Lee, Xing Ju; Norman, Rosana E
2016-06-01
Child sexual abuse is widespread and difficult to detect. To enhance case identification, many societies have enacted mandatory reporting laws requiring designated professionals, most often police, teachers, doctors and nurses, to report suspected cases to government child welfare agencies. Little research has explored the effects of introducing a reporting law on the number of reports made, and the outcomes of those reports. This study explored the impact of a new legislative mandatory reporting duty for child sexual abuse in the State of Western Australia over seven years. We analyzed data about numbers and outcomes of reports by mandated reporters, for periods before the law (2006-2008) and after the law (2009-2012). Results indicate that the number of reports by mandated reporters of suspected child sexual abuse increased by a factor of 3.7, from an annual mean of 662 in the three year pre-law period to 2448 in the four year post-law period. The increase in the first two post-law years was contextually and statistically significant. Report numbers stabilized in 2010-2012, at one report per 210 children. The number of investigated reports increased threefold, from an annual mean of 451 in the pre-law period to 1363 in the post-law period. Significant decline in the proportion of mandated reports that were investigated in the first two post-law years suggested the new level of reporting and investigative need exceeded what was anticipated. However, a subsequent significant increase restored the pre-law proportion, suggesting systemic adaptive capacity. The number of substantiated investigations doubled, from an annual mean of 160 in the pre-law period to 327 in the post-law period, indicating twice as many sexually abused children were being identified. Copyright © 2016 Elsevier Ltd. All rights reserved.
Twenty-One at TREC-8: using Language Technology for Information Retrieval
Kraaij, Wessel; Pohlmann, Renée; Hiemstra, Djoerd; Voorhees, E.M; Harman, D.K.
2000-01-01
This paper describes the official runs of the Twenty-One group for TREC-8. The Twenty-One group participated in the Ad-hoc, CLIR, Adaptive Filtering and SDR tracks. The main focus of our experiments is the development and evaluation of retrieval methods that are motivated by natural language
Chemical composition and antioxidant activity of seven cultivars of guava (Psidium guajava) fruits.
Flores, Gema; Wu, Shi-Biao; Negrin, Adam; Kennelly, Edward J
2015-03-01
The antioxidant activity and identification of phenolic compounds of seven edible guava (Psidium guajava) cultivars that varied in colour from white to pink were examined. In the DPPH assay all four pink-pulp guavas (Barbie Pink, Homestead, Sardina 1, Sardina 2) included in the study showed higher activity than the white pulp cultivars (Yen 2 and Sayla) and less than the red pulp guava cultivar (Thai Maroon). In the ABTS(+) assay this trend was the same up to 20 min, but from 20 to 40 min Barbie Pink showed lower activity than the white guavas. Twenty-one compounds were characterised in the cultivars, and ten of them are reported for the first time in this fruit. Principle component analysis was performed to identify differences in chemistry among these cultivars. Our results suggest that the antioxidant activity and phytochemical composition of P. guajava vary significantly according to the cultivar and pulp colour. Copyright © 2014. Published by Elsevier Ltd.
Directory of Open Access Journals (Sweden)
Barrak F Alobeidy
Full Text Available Previous genome-wide association studies (GWAS in multiple populations identified several genetic loci for coronary heart diseases (CHD. Here we utilized a 2-stage candidate gene association strategy in Chinese Han population to shed light on the putative association between several metabolic-related candidate genes and CHD. At the 1(st stage, 190 patients with CHD and 190 controls were genotyped through the MassARRAY platform. At the 2(nd stage, a larger sample including 400 patients and 392 controls was genotyped by the High Resolution Melt (HRM method to confirm or rule out the associations with CHD. MLXIP expression level was quantified by the real time PCR in 65 peripheral blood samples. From the 21 studied single nucleotide polymorphisms (SNPs of seven candidate genes: MLXIPL, MLXIP, MLX, ADIPOR1, VDR, SREBF1 and NR1H3, only one tag SNP rs4758685 (T→C was found to be statistically associated with CHD (P-value = 0.02, Odds ratio (OR of 0.83. After adjustment for the age, sex, lipid levels and diabetes, the association remained significant (P-value = 0.03. After adjustment for the hypertension, P-value became 0.20 although there was a significant difference in the allele distribution between the CHD patients with hypertension and the controls (P-value = 0.04, 406 vs 582. In conclusion, among the 21 tested SNPs, we identified a novel association between rs4758685 of MLXIP gene and CHD. The C allele of common variant rs4758685 interacted with hypertension, and was found to be protective against CHD in both allelic and genotypic models in Chinese Han population.
Strategic Leader Competencies for the Twenty-First Century
National Research Council Canada - National Science Library
Becker, Bradley A
2007-01-01
...: interpersonal skills, conceptual skills, and technical skills. From these three primary strategic leadership skills, there is a list of twenty-one competencies that a strategic leader should posses...
Enactment effects and integration processes in younger and older adults' memory for actions.
Feyereisen, Pierre
2009-05-01
The positive effects of gesturing on memory are robust but their interpretation is still controversial. To clarify the issue, recognition and cued recall of action phrases were compared in 24 younger (M=20 years) and 20 older adults (M=68 years), in three encoding conditions--purely verbal tasks (VTs), subject-performed tasks (SPTs), and experimenter-performed tasks (EPTs)--for well- and poorly integrated phrases. As expected, the effects of these factors were significant, but there was no interaction between age-related differences, enactment effects, and semantic association. In particular, both SPT and EPT displayed similar advantages over VT conditions in both age groups and in the two memory tasks. These results are discussed in relation to the debate between Engelkamp on one side, and Kormi-Nouri and Nilsson on the other side, about the role of motor components in the episodic integration of verbs and nouns in action phrases.
Directory of Open Access Journals (Sweden)
Gilbert Cardoso Bouyer
2007-04-01
Full Text Available Este artigo, baseado no novo paradigma das ciências cognitivas, convida a uma ruptura ontológica com a abordagem objetivista da representação operatória em Ergonomia Cognitiva. O atuacionismo é um ponto de vista incorporado-enativo. Ou seja, processos cognitivos emergem ou enagem pelos agentes (trabalhadores. A abordagem atuacionista pode fornecer significativas contribuições à Ergonomia. Este trabalho é o resultado de pesquisa realizada em sistemas reais de produção, pelos métodos de Análise Ergonômica do Trabalho. Ele identificou e caracterizou uma falha ontológica, presente nas análises da atividade operatória: Observador isolado do objeto observado pelas distinções de atuação entre ambos. Isso resulta em diferenças de ação, percepção e interpretação, as quais, historicamente, têm tornado impraticável um conhecimento aprofundado sobre o funcionamento do processo de trabalho. Atualmente, os processos que aparentam ser rotineiros, parcelados e manuais abrigam uma nova noção de competência, a competência atuacionista ou cognitiva, necessária para conferir continuidade e fluxo à produção.Based on the new paradigm of cognitive sciences, this paper deals with an ontological rupture having an objectivist approach to the Operating-Representation in cognitive ergonomics. Actuationism is an embodied-enactive view. According to this approach, cognitive processes are seen as emerging or enacted by situated agents (workers. The Actuationistic approach is important underpinning various contributions in ergonomics. This work is the result of research done on real production systems using an ergonomic work analysis. It identified and characterized an ontological failure present in the operating-activity analysis: An isolated observer observing the object by the actuation distinguishes between them. This results in perception, interpretation and action differences, which, historically, have made an in-depth knowledge
Directory of Open Access Journals (Sweden)
Dr Aleks Kolkowski
2015-05-01
Full Text Available The Art and Science of Acoustic Recording was a collaborative project between the Royal College of Music and the Science Museum that saw an historic orchestral recording from 1913 re-enacted by musicians, researchers and sound engineers at the Royal College of Music (RCM in 2014. The original recording was an early attempt to capture the sound of a large orchestra without re-scoring or substituting instruments and represents a step towards phonographic realism. Using replicated recording technology, media and techniques of the period, the re-enactment recorded two movements of Beethoven’s Fifth Symphony on to wax discs – the first orchestral acoustic recordings made since 1925. The aims were primarily to investigate the processes and practices of acoustic sound recording, developed largely through tacit knowledge, and to derive insights into the musicians’ experience of recording acoustically. Furthermore, the project sought to discover what the acoustic recordings of the past do – and don't – communicate to listeners today. Archival sources, historic apparatus and early photographic evidence served as groundwork for the re-enactment and guided its methodology, while the construction of replicas, wax manufacture and sound engineering were carried out by an expert in the field of acoustic recording. The wax recordings were digitised and some processed to produce disc copies playable on gramophone, thus replicating the entire course of recording, processing, duplication and reproduction. It is suggested that the project has contributed to a deeper understanding of early recordings and has provided a basis for further reconstructions of historical recording sessions.
Richman, Ilana; Asch, Steven M; Bendavid, Eran; Bhattacharya, Jay; Owens, Douglas K
2017-06-01
Twenty-eight states have passed breast density notification laws, which require physicians to inform women of a finding of dense breasts on mammography. To evaluate changes in breast cancer stage at diagnosis after enactment of breast density notification legislation. Using a difference-in-differences analysis, we examined changes in stage at diagnosis among women with breast cancer in Connecticut, the first state to enact legislation, compared to changes among women in control states. We used data from the Surveillance, Epidemiology, and End Results Program (SEER) registry, 2005-2013. Women ages 40-74 with breast cancer. Breast density notification legislation, enacted in Connecticut in October of 2009. Breast cancer stage at diagnosis. Our study included 466,930 women, 25,592 of whom lived in Connecticut. Legislation was associated with a 1.38-percentage-point (95 % CI 0.12 to 2.63) increase in the proportion of women in Connecticut versus control states who had localized invasive cancer at the time of diagnosis, and a 1.12-percentage-point (95 % CI -2.21 to -0.08) decline in the proportion of women with ductal carcinoma in situ at diagnosis. Breast density notification legislation was not associated with a change in the proportion of women in Connecticut versus control states with regional-stage (-0.09 percentage points, 95 % CI -1.01 to 1.02) or metastatic disease (-0.24, 95 % CI -0.75 to 0.28). County-level analyses and analyses limited to women younger than 50 found no statistically significant associations. Single intervention state, limited follow-up, potential confounding from unobserved trends. Breast density notification legislation in Connecticut was associated with a small increase in the proportion of women diagnosed with localized invasive breast cancer in individual-level but not county-level analyses. Whether this finding reflects potentially beneficial early detection or potentially harmful overdiagnosis is not known. Legislation was not
International Nuclear Information System (INIS)
Trosten, L.M.
1988-01-01
The United States has enacted complex legislation to help assure proper handling of hazardous waste and the availability of funds to cover the expenditures. There are a number of uncertainties concerning the impact of this legislation, and regulations promulgated by the Environmental Protection Agency and the states, upon nuclear installations and radioactive waste management. This report provides an overview of the U.S. hazardous waste legislation and examines the outlook for its application to the nuclear industry (NEA) [fr
Gene : CBRC-PABE-07-0025 [SEVENS
Lifescience Database Archive (English)
Full Text Available e-82 48% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-130 78% MINDSYFSGFILLGFT...QIFIDVALYSVECILLAMMSCDRLNAICKPLHHMTIMNLQLCQGLVVISWVVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAA
Gene : CBRC-PTRO-07-0026 [SEVENS
Lifescience Database Archive (English)
Full Text Available e-79 50% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-120 76% MINDSRFSGFILLGFT...QLFIDVALYSVECILLSMMSYDRLNAICKPLHHMTIMNLQLCQGLVVISWIVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAFGTCSSHLIVVSIFYGTVRYMYTQPGNSPSQDEGKLLHIFYSIFTPTLNPSH ...
Twenty-One at TREC-7: ad-hoc and cross-language track
Hiemstra, Djoerd; Kraaij, Wessel; Voorhees, E.M; Harman, D.K.
1999-01-01
This paper describes the official runs of the Twenty-One group for TREC-7. The Twenty-One group participated in the ad-hoc and the cross-language track and made the following accomplishments: We developed a new weighting algorithm, which outperforms the popular Cornell version of BM25 on the ad-hoc
Relationship between dysphagia and depressive states in patients with Parkinson's disease.
Han, Meng; Ohnishi, Hirofumi; Nonaka, Michio; Yamauchi, Rika; Hozuki, Takayoshi; Hayashi, Takashi; Saitoh, Masaki; Hisahara, Shin; Imai, Tomihiro; Shimohama, Shun; Mori, Mitsuru
2011-07-01
Aspiration pneumonia related to dysphagia is known to be the leading cause of death in patients with Parkinson's disease (PD). We investigated the relationship between depressive states and dysphagia in patients with PD. A hundred and twenty-seven PD patients gave their informed consent and were enrolled in this study. We used the Beck Depression Inventory (BDI) questionnaire to determine the participants' depressive states, and also used a questionnaire to assess participants' state of dysphagia. Participants were divided into four groups according to their BDI score. We compared the PD patients with Swallowing Disturbances Questionnaire (SDQ) scores of more than or equal to 11 with the SDQ scores of less than 11 regarding depressive categories. A logistic regression analysis was conducted to calculate odds ratios (ORs) and their 95% confidence intervals (95%CI) adjusting for age, sex, disease duration, wearing-off phenomenon and severity of movement disorder. OR (95%CI) of depressive categories, in which the trivial class was set as a reference group, were 3.28 (0.93-11.55), 13.44 (3.10-58.16), 30.35 (5.65-162.97) in the mild class, the moderate class and the severe class, respectively. This study suggests that there may be a strong relationship between depressive states and dysphagia in patients with PD. Copyright © 2011 Elsevier Ltd. All rights reserved.
Development of a Nevada Statewide Database for Safety Analyst Software
2017-02-02
Safety Analyst is a software package developed by the Federal Highway Administration (FHWA) and twenty-seven participating state and local agencies including the Nevada Department of Transportation (NDOT). The software package implemented many of the...
Twenty-second DOE/NRC nuclear air cleaning and treatment conference
International Nuclear Information System (INIS)
Bellamy, R.R.; Moeller, D.W.; First, M.W.
1992-01-01
The Twenty-Second Department of Energy/Nuclear Regulatory Commission Nuclear Air Cleaning and Treatment Conference was held Aug. 24-27, 1992, in Denver, Colo. A total of 224 air-cleaning specialists attended the conference. The United States and 12 foreign countries were represented, and the specialists were affiliated with government agencies, educational institutions, and all aspects of the nuclear industry, including utilities, architect engineers, equipment suppliers, and consultants. Several major topics were discussed, similar to areas covered at previous conferences: chemical processing off-gas cleaning; particulate filler developments, including filter testing, performance, and response to physical stress,adsorber testing and performance, including laboratory and in-place testing; waste management; system operation; codes and standards; and advanced nuclear power plants. The conference continued to provide an effective forum for direct interchange of information of both a practical and theoretical nature. International participation and interest continues, as evidenced by over 40% of the papers being sponsored by foreign interests and almost 20% of the attendees being from outside the United States. The potential for new, safer nuclear plants of an advanced design was an optimistic note during the conference. Regulatory authorities are playing a major role in providing guidance in the development of safety goals and other technical criteria for these new installations
Seven essential questions on G-quadruplexes.
König, Sebastian L B; Evans, Amanda C; Huppert, Julian L
2010-08-01
The helical duplex architecture of DNA was discovered by Francis Crick and James Watson in 1951 and is well known and understood. However, nucleic acids can also adopt alternative structural conformations that are less familiar, although no less biologically relevant, such as the G-quadruplex. G-quadruplexes continue to be the subject of a rapidly expanding area of research, owing to their significant potential as therapeutic targets and their unique biophysical properties. This review begins by focusing on G-quadruplex structure, elucidating the intermolecular and intramolecular interactions underlying its formation and highlighting several substructural variants. A variety of methods used to characterize these structures are also outlined. The current state of G-quadruplex research is then addressed by proffering seven pertinent questions for discussion. This review concludes with an overview of possible directions for future research trajectories in this exciting and relevant field.
Energy Technology Data Exchange (ETDEWEB)
Tuttle, J.; Coe, B.A.; Gertsch, W.D.; Meyer, R.T.
1980-12-01
The following are included: a summary of the state projects, a summary of findings, public outreach, and a description of the major conclusions and recommendations. The commercialization activities carried out by the state teams are described for Colorado, Montana, New Mexico, North Dakota, South Dakota, Utah, and Wyoming. (MHR)
Ndumele, Chima D; Cohen, Michael S; Cleary, Paul D
2017-10-01
Medicaid recipients have consistently reported less timely access to specialists than patients with other types of coverage. By 2018, state Medicaid agencies will be required by the Center for Medicare and Medicaid Services (CMS) to enact time and distance standards for managed care organizations to ensure an adequate supply of specialist physicians for enrollees; however, there have been no published studies of whether these policies have significant effects on access to specialty care. To compare ratings of access to specialists for adult Medicaid and commercial enrollees before and after the implementation of specialty access standards. We used Consumer Assessment of Healthcare Providers and Systems survey data to conduct a quasiexperimental difference-in-differences (DID) analysis of 20 163 nonelderly adult Medicaid managed care (MMC) enrollees and 54 465 commercially insured enrollees in 5 states adopting access standards, and 37 290 MMC enrollees in 5 matched states that previously adopted access standards. Reported access to specialty care in the previous 6 months. Seven thousand six hundred ninety-eight (69%) Medicaid enrollees and 28 423 (75%) commercial enrollees reported that it was always or usually easy to get an appointment with a specialist before the policy implementation (or at baseline) compared with 11 889 (67%) of Medicaid enrollees in states that had previously implemented access standards. Overall, there was no significant improvement in timely access to specialty services for MMC enrollees in the period following implementation of standard(s) (adjusted difference-in-differences, -1.2 percentage points; 95% CI, -2.7 to 0.1), nor was there any impact of access standards on insurance-based disparities in access (0.6 percentage points; 95% CI, -4.3 to 5.4). There was heterogeneity across states, with 1 state that implemented both time and distance standards demonstrating significant improvements in access and reductions in disparities
The Family Gap in Pay: Evidence from Seven Industrialized Countries
Harkness, Susan; Waldfogel, Jane
1999-01-01
In this paper we use microdata on employment and earnings from a variety of industrialized countries to investigate the family gap in pay - the differential in hourly wages between women with children and women without children. We present results from seven countries: Australia, Canada, the United Kingdom, the United States, Germany, Finland, and Sweden. We find that there is a good deal of variation across our sample countries in the effects of children on women's employment. We also find l...
The family gap in pay: evidence from seven industrialised countries
Susan Harkness; Jane Waldfogel
1999-01-01
In this paper we use microdata on employment and earnings from a variety of industrialised countries to investigate the family gap in pay - the differential in hourly wages between women with children and women without children. We present results from seven countries: Australia, Canada, the United Kingdom, the United States, Germany, Finland, and Sweden. We find that there is a good deal of variation across our sample countries in the effects of children on women's employment. We also find l...
Wang, He; Xiao, Meng; Kong, Fanrong; Chen, Sharon; Dou, Hong-Tao; Sorrell, Tania; Li, Ruo-Yu; Xu, Ying-Chun
2011-01-01
Eleven reference and 25 clinical isolates of Fusarium were subject to multilocus DNA sequence analysis to determine the species and haplotypes of the fusarial isolates from Beijing and Shandong, China. Seven loci were analyzed: the translation elongation factor 1 alpha gene (EF-1α); the nuclear rRNA internal transcribed spacer (ITS), large subunit (LSU), and intergenic spacer (IGS) regions; the second largest subunit of the RNA polymerase gene (RPB2); the calmodulin gene (CAM); and the mitochondrial small subunit (mtSSU) rRNA gene. We also evaluated an IGS-targeted PCR/reverse line blot (RLB) assay for species/haplotype identification of Fusarium. Twenty Fusarium species and seven species complexes were identified. Of 25 clinical isolates (10 species), the Gibberella (Fusarium) fujikuroi species complex was the commonest (40%) and was followed by the Fusarium solani species complex (FSSC) (36%) and the F. incarnatum-F. equiseti species complex (12%). Six FSSC isolates were identified to the species level as FSSC-3+4, and three as FSSC-5. Twenty-nine IGS, 27 EF-1α, 26 RPB2, 24 CAM, 18 ITS, 19 LSU, and 18 mtSSU haplotypes were identified; 29 were unique, and haplotypes for 24 clinical strains were novel. By parsimony informative character analysis, the IGS locus was the most phylogenetically informative, and the rRNA gene regions were the least. Results by RLB were concordant with multilocus sequence analysis for all isolates. Amphotericin B was the most active drug against all species. Voriconazole MICs were high (>8 μg/ml) for 15 (42%) isolates, including FSSC. Analysis of larger numbers of isolates is required to determine the clinical utility of the seven-locus sequence analysis and RLB assay in species classification of fusaria. PMID:21389150
Men's and women's experiences with HIV and stigma in Swaziland.
Shamos, Sara; Hartwig, Kari A; Zindela, Nomsa
2009-12-01
To explore how gender differentially affects the stigma experiences of people living with HIV (PLHIV) in Swaziland, the extent and dimensions of HIV-related felt and enacted stigma and social support were analyzed. Thirty-seven semistructured, face-to-face interviews were conducted with PLHIV in Swaziland between 2004 and 2006. Through the process of conceptual analysis, themes, including felt stigma, information management, enacted stigma, and social support, were explored, coded, and analyzed in the contexts of partner and familial relationships, and workplace and neighborhood settings. Findings revealed that there were high levels of felt stigma in all contexts, yet fewer than anticipated accounts of enacted stigma in family, work, and neighborhood contexts compared to their expressions of felt stigma. The amount and characteristics of felt and enacted stigma and social support differed based on gender, as women often experienced more felt and enacted stigma than men, and had less definite financial or emotional support.
Nowell, Lisa H.; Moran, Patrick W.; Gilliom, Robert J.; Calhoun, Daniel L.; Ingersoll, Christopher G.; Kemble, Nile E.; Kuivila, Kathryn; Phillips, Patrick J.
2013-01-01
Organic contaminants and trace elements were measured in bed sediments collected from streams in seven metropolitan study areas across the United States to assess concentrations in relation to urbanization. Polycyclic aromatic hydrocarbons, polychlorinated biphenyls, organochlorine pesticides, the pyrethroid insecticide bifenthrin, and several trace elements were significantly related to urbanization across study areas. Most contaminants (except bifenthrin, chromium, nickel) were significantly related to the total organic carbon (TOC) content of the sediments. Regression models explained 45–80 % of the variability in individual contaminant concentrations using degree of urbanization, sediment-TOC, and study-area indicator variables (which represent the combined influence of unknown factors, such as chemical use or release, that are not captured by available explanatory variables). The significance of one or more study-area indicator variables in all models indicates marked differences in contaminant levels among some study areas, even after accounting for the nationally modeled effects of urbanization and sediment-TOC. Mean probable effect concentration quotients (PECQs) were significantly related to urbanization. Trace elements were the major contributors to mean PECQs at undeveloped sites, whereas organic contaminants, especially bifenthrin, were the major contributors at highly urban sites. Pyrethroids, where detected, accounted for the largest share of the mean PECQ. Part 2 of this series (Kemble et al. 2012) evaluates sediment toxicity to amphipods and midge in relation to sediment chemistry.
Saewyc, Elizabeth M.; Poon, Colleen S.; Homma, Yuko; Skay, Carol L.
2008-01-01
Over the past decade, several large-scale school-based studies of adolescents in Canada and the U.S. have documented health disparities for lesbian, gay and bisexual teens compared to their heterosexual peers, such as higher rates of suicide attempts, homelessness, and substance use. Many of these disparities have been linked to “enacted stigma,” or the higher rates of harassment, discrimination, and sexual or physical violence that sexual minority youth experience at home, at school, and in ...
Mårald, Erland; Langston, Nancy; Sténs, Anna; Moen, Jon
2016-02-01
By combining digital humanities text-mining tools and a qualitative approach, we examine changing concepts in forestry journals in Sweden and the United States (US) in the early twentieth and early twenty-first centuries. Our first hypothesis is that foresters at the beginning of the twentieth century were more concerned with production and less concerned with ecology than foresters at the beginning of the twenty-first century. Our second hypothesis is that US foresters in the early twentieth century were less concerned with local site conditions than Swedish foresters. We find that early foresters in both countries had broader-and often ecologically focused-concerns than hypothesized. Ecological concerns in the forestry literature have increased, but in the Nordic countries, production concerns have increased as well. In both regions and both time periods, timber management is closely connected to concerns about governance and state power, but the forms that governance takes have changed.
United States home births increase 20 percent from 2004 to 2008.
MacDorman, Marian F; Declercq, Eugene; Mathews, T J
2011-09-01
After a gradual decline from 1990 to 2004, the percentage of births occurring at home increased from 2004 to 2008 in the United States. The objective of this report was to examine the recent increase in home births and the factors associated with this increase from 2004 to 2008. United States birth certificate data on home births were analyzed by maternal demographic and medical characteristics. In 2008, there were 28,357 home births in the United States. From 2004 to 2008, the percentage of births occurring at home increased by 20 percent from 0.56 percent to 0.67 percent of United States births. This rise was largely driven by a 28 percent increase in the percentage of home births for non-Hispanic white women, for whom more than 1 percent of births occur at home. At the same time, the risk profile for home births has been lowered, with substantial drops in the percentage of home births of infants who are born preterm or at low birthweight, and declines in the percentage of home births that occur to teen and unmarried mothers. Twenty-seven states had statistically significant increases in the percentage of home births from 2004 to 2008; only four states had declines. The 20 percent increase in United States home births from 2004 to 2008 is a notable development that will be of interest to practitioners and policymakers. (BIRTH 38:3 September 2011). © 2011, Copyright the Authors. Journal compilation © 2011, Wiley Periodicals, Inc.
[Surveillance in Spain 3 years since the enactment of the Public Health Law].
Pousa, Anxela; Godoy, Pere; Aragonés, Nuria; Cano, Rosa; Sierra, María José; González, Francisco; Mayoral, José María
2016-01-01
In 2014, the Epidemiological Surveillance Working Group of the Sociedad Española de Epidemiología (Spanish Society of Epidemiology), carried out a descriptive study in order to evaluate the level of development of the Spanish Public Health Law since its enactment in 2011. A survey collecting data on the existence of information systems and other aspects pertaining to each surveillance section included in the law was sent to all 19 autonomous communities and cities. All regional authorities reported the presence of an information system for communicable diseases, and six also reported an information system for social factors. 18 reported that at least one chronic disease was subject to surveillance and 14 confirmed surveillance of some of its determinants. They all systematically analysed the data derived from the communicable diseases. There is room for improvement in Public Health surveillance in Spain, and action should be aimed at the main health problems. Copyright © 2016 SESPAS. Published by Elsevier Espana. All rights reserved.
Does State Legislation Improve Nursing Workforce Diversity?
Travers, Jasmine; Smaldone, Arlene; Cohn, Elizabeth Gross
2015-08-01
A health-care workforce representative of our nation's diversity is a health and research priority. Although racial and ethnic minorities represent 37% of Americans, they comprise only 16% of the nursing workforce. The purpose of this study was to examine the effect of state legislation on minority recruitment to nursing. Using data from the National Conference of State Legislatures, American Association of Colleges of Nursing, and U.S. census, we compared minority enrollment in baccalaureate nursing programs of states (Texas, Virginia, Michigan, California, Florida, Connecticut, and Arkansas) before and 3 years after enacting legislation with geographically adjacent states without legislation. Data were analyzed using descriptive and chi-square statistics. Following legislation, Arkansas (13.8%-24.5%), California (3.3%-5.4%), and Michigan (8.0%-10.0%) significantly increased enrollment of Blacks, and Florida (11.8%-15.4%) and Texas (11.2%-13.9%) significantly increased enrollment of Hispanic baccalaureate nursing students. States that tied legislation to funding, encouragement, and reimbursement had larger enrollment gains and greater minority representation. © The Author(s) 2015.
International Nuclear Information System (INIS)
1994-10-01
The Interstate Oil and Gas Compact Commission (IOGCC) has conducted a series of studies to evaluate the known, remaining oil resource in twenty-three (23) states. The primary objective of the IOGCC's effort is to examine the potential impact of an aggressive and focused program of research, development, and demonstration (RD ampersand D) and technology transfer on future oil recovery in the United States. As a part of this larger effort by the IOGCC, this report focuses on the potential economic benefits of improved oil recovery in the state of California. Individual reports for seven other oil producing states and a national report have been separately published by the IOGCC. The analysis presented in this report is based on the databases and models available in the Tertiary Oil Recovery Information System (TORIS). Overall, well abandonments and more stringent environmental regulations could limit economic access to California's known, remaining oil resource. The high risk of near-term abandonment and the significant benefits of future application of improved oil recovery technology, clearly point to a need for more aggressive transfer of currently available technologies to oil producers. Development and application of advanced oil recovery technologies could have even greater benefits to the state and the nation. A collaborative, focused RD ampersand D effort, integrating the resources and expertise of industry, state and local governments, and the Federal government, is clearly warranted. With effective RD ampersand D and a program of aggressive technology transfer to widely disseminate its results, California oil production could be maximized. The resulting increase in production rates, employment, operator profits, state and Federal tax revenues, and energy security will benefit both the state of California and the nation as a whole
Peri-ictal signal changes in seven patients with status epilepticus: interesting MRI observations
Energy Technology Data Exchange (ETDEWEB)
Goyal, Manoj K; Sinha, Sanjib [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neurology, Bangalore, Karnataka (India); Ravishankar, Shivshankar; Shivshankar, Jai Jai [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neuroimaging and Interventional Radiology, Bangalore (India)
2009-03-15
Transient peri-ictal changes on imaging had been described following status epilepticus (SE), but its cause is not very well understood. We analyzed the magnetic resonance imaging (MRI) findings in SE patients in order to elucidate such changes including peri-ictal signal. This prospective study involved 34 patients (M/F 23:11, mean age 25.8 {+-} 17.2 years) who experienced SE. MRI was performed during or within 96 h of cessation of seizures. Twenty-five patients had generalized convulsive status epilectus (GCSE; ten secondary GCSE and 15 primary GCSE). Seven patients had epilepsia partialis continua and two patients non-convulsive SE. Eight patients had a history of seizures and three patients previous SE. The mean duration of SE prior to MRI was 89.2 {+-} 105.3 h (range 2-360 h). MRI provided diagnosis in 17 patients, and in 13 patients, no structural cause was identified. Peri-ictal focal signal changes with restricted diffusion on apparent diffusion coefficient maps were present in seven (20.6%) patients with SE (generalized convulsive, three; partial, three; non-convulsive, one). The changes were observed when MRI was performed during SE in 3/10 (30%) patients, or within 24 h in 1/7 (14.3%), 48 h in 1/5 (20%), 72 h in 1/6 (16.7%), or 96 h in 1/6 (16.7%) patients after cessation of seizures. Repeat MRI revealed disappearance of signal changes in two patients. Peri-ictal MR changes with restricted diffusion appear to be an effect rather than the cause of SE. (orig.)
Peri-ictal signal changes in seven patients with status epilepticus: interesting MRI observations
International Nuclear Information System (INIS)
Goyal, Manoj K.; Sinha, Sanjib; Ravishankar, Shivshankar; Shivshankar, Jai Jai
2009-01-01
Transient peri-ictal changes on imaging had been described following status epilepticus (SE), but its cause is not very well understood. We analyzed the magnetic resonance imaging (MRI) findings in SE patients in order to elucidate such changes including peri-ictal signal. This prospective study involved 34 patients (M/F 23:11, mean age 25.8 ± 17.2 years) who experienced SE. MRI was performed during or within 96 h of cessation of seizures. Twenty-five patients had generalized convulsive status epilectus (GCSE; ten secondary GCSE and 15 primary GCSE). Seven patients had epilepsia partialis continua and two patients non-convulsive SE. Eight patients had a history of seizures and three patients previous SE. The mean duration of SE prior to MRI was 89.2 ± 105.3 h (range 2-360 h). MRI provided diagnosis in 17 patients, and in 13 patients, no structural cause was identified. Peri-ictal focal signal changes with restricted diffusion on apparent diffusion coefficient maps were present in seven (20.6%) patients with SE (generalized convulsive, three; partial, three; non-convulsive, one). The changes were observed when MRI was performed during SE in 3/10 (30%) patients, or within 24 h in 1/7 (14.3%), 48 h in 1/5 (20%), 72 h in 1/6 (16.7%), or 96 h in 1/6 (16.7%) patients after cessation of seizures. Repeat MRI revealed disappearance of signal changes in two patients. Peri-ictal MR changes with restricted diffusion appear to be an effect rather than the cause of SE. (orig.)
DEFF Research Database (Denmark)
Söderqvist, Thomas
2011-01-01
Today, scientific biography is primarily thought of as a way of writing contextual history of science. But the genre has other functions as well. This article discusses seven kinds of ideal-typical subgenres of scientific biography. In addition to its mainstream function as an ancilla historiae...
Single-Atom Gating of Quantum State Superpositions
Energy Technology Data Exchange (ETDEWEB)
Moon, Christopher
2010-04-28
The ultimate miniaturization of electronic devices will likely require local and coherent control of single electronic wavefunctions. Wavefunctions exist within both physical real space and an abstract state space with a simple geometric interpretation: this state space - or Hilbert space - is spanned by mutually orthogonal state vectors corresponding to the quantized degrees of freedom of the real-space system. Measurement of superpositions is akin to accessing the direction of a vector in Hilbert space, determining an angle of rotation equivalent to quantum phase. Here we show that an individual atom inside a designed quantum corral1 can control this angle, producing arbitrary coherent superpositions of spatial quantum states. Using scanning tunnelling microscopy and nanostructures assembled atom-by-atom we demonstrate how single spins and quantum mirages can be harnessed to image the superposition of two electronic states. We also present a straightforward method to determine the atom path enacting phase rotations between any desired state vectors. A single atom thus becomes a real-space handle for an abstract Hilbert space, providing a simple technique for coherent quantum state manipulation at the spatial limit of condensed matter.
Schwartz, Ariel E; Kramer, Jessica M
2017-06-08
Peer mentoring may be an effective approach for fostering skill development for mentors and mentees with developmental disabilities. However, little is known about how mentors with developmental disabilities perceive and enact their roles. (1) How do young adults with developmental disabilities describe their role as a peer mentor in the context of instrumental peer mentoring? (2) How do they enact their perceived roles? Thematic analysis of semi-structured reflections completed by six mentors with developmental disabilities (ages 17-35) with multiple mentoring experiences. Mentors perceived themselves as professionals with a primary role of teaching, and for some mentoring relationships, a secondary role of developing an interpersonal relationship. To enact these roles, mentors used a supportive interactional approach characterized by actions such as encouragement and sharing examples and dispositions, such as flexibility and patience. Mentors monitored mentee learning and engagement within the mentoring session and, as needed, adjusted their approach to optimize mentee learning and engagement. To successfully manage their interactional approach, mentors used supports such as peer mentoring scripts, tip sheets, and supervisors. While mentors reported several actions for teaching, they may benefit from training to learn approaches to facilitate more consistent development of interpersonal relationships. Implications for Rehabilitation Peer mentoring may be an effective approach for fostering skill development for young adult mentors and mentees with developmental disabilities. In this study, young adult peer mentors with developmental disabilities perceived themselves as professionals with a primary role of teaching and a secondary role of developing an interpersonal relationship. Peer mentors used actions and dispositions that matched their perceived roles and supported mentees with developmental disabilities to engage in instrumental mentoring. With supports and
Confronting quasi-exponential inflation with WMAP seven
International Nuclear Information System (INIS)
Pal, Barun Kumar; Pal, Supratik; Basu, B.
2012-01-01
We confront quasi-exponential models of inflation with WMAP seven years dataset using Hamilton Jacobi formalism. With a phenomenological Hubble parameter, representing quasi exponential inflation, we develop the formalism and subject the analysis to confrontation with WMAP seven using the publicly available code CAMB. The observable parameters are found to fair extremely well with WMAP seven. We also obtain a ratio of tensor to scalar amplitudes which may be detectable in PLANCK
International Nuclear Information System (INIS)
Lautenberger, C.; Pearson, L.
1993-01-01
Passage of the US Oil Pollution Act (OPA) of 1990 expanded the existing federal planning and response framework in several ways. The OPA created a new requirement for facility and tank vessel response plans and creates an area-level planning and coordination structure to help supplement federal, regional, and local planning efforts. The OPA amended the existing Clean Water Act's section 311(j)(4), which establishes area committees and area contingency plans as primary components of this structure. In 1980, the Alaska legislature enacted legislation which defines the state's policies regarding oil spills. Following the 1989 Exxon Valdez spill, additional legislation was passed to expand and strengthen the state's oil spill program. Specifically, in 1989 the Senate Bill 261 required the Alaska Department of Environmental Conservation to develop, annually review, and revise the State Oil and Hazardous Substance Contingency Plans (State Master and Regional Plans). State regional plans serve as annexes to the State Master Plan. The coordinated and cooperative efforts by government agencies and local entities toward creating a unified federal/state, coastal/inland Oil and Hazardous Substance Contingency Plan are presented, along with the development and progress of unified area/regional contingency plans for Alaska. 3 figs
Game Demands of Seven-A-Side Soccer in Young Players.
Barbero-Alvarez, José C; Gómez-López, Maite; Castagna, Carlo; Barbero-Alvarez, Verónica; Romero, David V; Blanchfield, Anthony W; Nakamura, Fábio Y
2017-07-01
Barbero-Alvarez, JC, Gómez-López, M, Castagna, C, Barbero-Alvarez, V, Romero, DV, Blanchfield, AW, and Nakamura, FY. Game demands of seven-a-side soccer in young players. J Strength Cond Res 31(7): 1771-1779, 2017-The aim of this study was to examine the activity patterns and physiological demands of 7-a-side youth soccer matches across 2 chronological age categories (U12 and U14). Twenty-two soccer players of a national youth soccer academy were investigated. Players of each age category performed 2 training matches (2 × 25 minutes) and were monitored by global positioning system and heart rate monitor units. Players of both categories covered similar total distance (5,348 ± 307 m), at similar mean heart rate values (86 ± 4% of maximum). However, the number of high-intensity runs (82.5 ± 17.4 vs. 69.7 ± 15.2) and total distance covered during sprints (264 ± 207 vs. 128 ± 74 m) were significantly (p ≤ 0.05) higher in U14 compared with U12. The results suggest a highly demanding nature of 7-a-side soccer for skilled players, with physical maturity possibly influencing the match-related high-intensity performance at these ages.
Philip, Noah S; Kuras, Yuliya I; Valentine, Thomas R; Sweet, Lawrence H; Tyrka, Audrey R; Price, Lawrence H; Carpenter, Linda L
2013-12-30
Early life stress (ELS) confers risk for psychiatric illness. Previous literature suggests ELS is associated with decreased resting-state functional connectivity (rs-FC) in adulthood, but there are no studies of resting-state neuronal activity in this population. This study investigated whether ELS-exposed individuals demonstrate resting-state activity patterns similar to those found in PTSD. Twenty-seven adults (14 with at least moderate ELS), who were medication-free and without psychiatric or medical illness, underwent MRI scans during two 4-minute rest periods. Resting-state activity was examined using regional homogeneity (ReHo), which estimates regional activation patterns through indices of localized concordance. ReHo values were compared between groups, followed by rs-FC analyses utilizing ReHo-localized areas as seeds to identify other involved regions. Relative to controls, ELS subjects demonstrated diminished ReHo in the inferior parietal lobule (IPL) and superior temporal gyrus (STG). ReHo values were inversely correlated with ELS severity. Secondary analyses revealed decreased rs-FC between the IPL and right precuneus/posterior cingulate, left fusiform gyrus, cerebellum and caudate in ELS subjects. These findings indicate that ELS is associated with altered resting-state activity and connectivity in brain regions involved in trauma-related psychiatric disorders. Future studies are needed to evaluate whether these associations represent potential imaging biomarkers of stress exposure. Published by Elsevier Ireland Ltd.
International Nuclear Information System (INIS)
Fan Ying; Shi Lichi; Ladizhansky, Vladimir; Brown, Leonid S.
2011-01-01
Overexpression of isotope-labeled multi-spanning eukaryotic membrane proteins for structural NMR studies is often challenging. On the one hand, difficulties with achieving proper folding, membrane insertion, and native-like post-translational modifications frequently disqualify bacterial expression systems. On the other hand, eukaryotic cell cultures can be prohibitively expensive. One of the viable alternatives, successfully used for producing proteins for solution NMR studies, is yeast expression systems, particularly Pichia pastoris. We report on successful implementation and optimization of isotope labeling protocols, previously used for soluble secreted proteins, to produce homogeneous samples of a eukaryotic seven-transmembrane helical protein, rhodopsin from Leptosphaeria maculans. Even in shake-flask cultures, yields exceeded 5 mg of purified uniformly 13 C, 15 N-labeled protein per liter of culture. The protein was stable (at least several weeks at 5°C) and functionally active upon reconstitution into lipid membranes at high protein-to-lipid ratio required for solid-state NMR. The samples gave high-resolution 13 C and 15 N solid-state magic angle spinning NMR spectra, amenable to a detailed structural analysis. We believe that similar protocols can be adopted for challenging mammalian targets, which often resist characterization by other structural methods.
Puckett, Mary; Neri, Antonio; Rohan, Elizabeth; Clerkin, Castine; Underwood, J Michael; Ryerson, A Blythe; Stewart, Sherri L
2016-01-01
Cancer is the second-leading cause of death in children, but incidence data are not available until two years after diagnosis, thereby delaying data dissemination and research. An early case capture (ECC) surveillance program was piloted in seven state cancer registries to register pediatric cancer cases within 30 days of diagnosis. We sought to determine the quality of ECC data and understand pilot implementation. We used quantitative and qualitative methods to evaluate ECC. We assessed data quality by comparing demographic and clinical characteristics from the initial ECC submission to a resubmission of ECC pilot data and to the most recent year of routinely collected cancer data for each state individually and in aggregate. We conducted telephone focus groups with registry staff to determine ECC practices and difficulties in August and September 2013. Interviews were recorded, transcribed, and coded to identify themes. Comparing ECC initial submissions with submissions for all states, ECC data were nationally representative for age (9.7 vs. 9.9 years) and sex (673 of 1,324 [50.9%] vs. 42,609 of 80,547 [52.9%] male cases), but not for primary site (472 of 1,324 [35.7%] vs. 27,547 of 80,547 [34.2%] leukemia/lymphoma cases), behavior (1,219 of 1,324 [92.1%] vs. 71,525 of 80,547 [88.8%] malignant cases), race/ethnicity (781 of 1,324 [59.0%] vs. 64,518 of 80,547 [80.1%] white cases), or diagnostic confirmation (1,233 of 1,324 [93.2%] vs. 73,217 of 80,547 [90.9%] microscopically confirmed cases). When comparing initial ECC data with resubmission data, differences were seen in race/ethnicity (808 of 1,324 [61.1%] vs. 1,425 of 1,921 [74.2%] white cases), primary site (475 of 1,324 [35.9%] vs. 670 of 1,921 [34.9%] leukemia/lymphoma cases), and behavior (1,215 of 1,324 [91.8%] vs. 1,717 of 1,921 [89.4%] malignant cases). Common themes from focus group analysis included implementation challenges and facilitators, benefits of ECC, and utility of ECC data. ECC provided data
Twenty-First Century Literacy: A Matter of Scale from Micro to Mega
Brown, Abbie; Slagter van Tryon, Patricia J.
2010-01-01
Twenty-first century technologies require educators to look for new ways to teach literacy skills. Current communication methods are combinations of traditional and newer, network-driven forms. This article describes the changes twenty-first century technologies cause in the perception of time, size, distance, audience, and available data, and…
Energy Technology Data Exchange (ETDEWEB)
Arzel, Olivier [University of New South Wales, Climate and Environmental Dynamics Laboratory, School of Mathematics and Statistics, Sydney, NSW (Australia); Fichefet, Thierry; Goosse, Hugues [Universite Catholique de Louvain, Institut d' Astronomie et de Geophysique G. Lemaitre, Louvain-la-Neuve (Belgium); Dufresne, Jean-Louis [Institut Pierre Simon Laplace UPMC/CNRS, Laboratoire de Meteorologie Dynamique, Paris (France)
2008-01-15
The fourth version of the atmosphere-ocean general circulation (AOGCM) model developed at the Institut Pierre-Simon Laplace (IPSL-CM4) is used to investigate the mechanisms influencing the Arctic freshwater balance in response to anthropogenic greenhouse gas forcing. The freshwater influence on the interannual variability of deep winter oceanic convection in the Nordic Seas is also studied on the basis of correlation and regression analyses of detrended variables. The model shows that the Fram Strait outflow, which is an important source of freshwater for the northern North Atlantic, experiences a rapid and strong transition from a weak state toward a relatively strong state during 1990-2010. The authors propose that this climate shift is triggered by the retreat of sea ice in the Barents Sea during the late twentieth century. This sea ice reduction initiates a positive feedback in the atmosphere-sea ice-ocean system that alters both the atmospheric and oceanic circulations in the Greenland-Iceland-Norwegian (GIN)-Barents Seas sector. Around year 2080, the model predicts a second transition threshold beyond which the Fram Strait outflow is restored toward its original weak value. The long-term freshening of the GIN Seas is invoked to explain this rapid transition. It is further found that the mechanism of interannual changes in deep mixing differ fundamentally between the twentieth and twenty-first centuries. This difference is caused by the dominant influence of freshwater over the twenty-first century. In the GIN Seas, the interannual changes in the liquid freshwater export out of the Arctic Ocean through Fram Strait combined with the interannual changes in the liquid freshwater import from the North Atlantic are shown to have a major influence in driving the interannual variability of the deep convection during the twenty-first century. South of Iceland, the other region of deep water renewal in the model, changes in freshwater import from the North Atlantic
Lean for Government: Eliminating the Seven Wastes
Shepherd, Christena C.
2012-01-01
With shrinking budgets and a slow economy, it is becoming increasingly important for all government agencies to become more efficient. Citizens expect and deserve efficient and effective services from federal, state and local government agencies. One of the best methods to improve efficiency and eliminate waste is to institute the business process improvement methodologies known collectively as Lean; however, with reduced budgets, it may not be possible to train everyone in Lean or to engage the services of a trained consultant. It is possible, however, to raise awareness of the "Seven Wastes" of Lean in each employee, and encourage them to identify areas for improvement. Management commitment is vital to the success of these initiatives, and it is also important to develop the right metrics that will track the success of these changes.
The CAIR vacatur. A Dilemma for States
Energy Technology Data Exchange (ETDEWEB)
Amy Royden-Bloom [National Association of Clean Air Agencies (NACAA) (United States)
2008-12-15
The vacatur of the Clean Air Interstate Rule (CAIR) creates a dilemma for the many states that were relying on CAIR for reductions in emissions of nitrogen oxides (NOx) and sulfur dioxide (SO{sub 2}) from power plants. NOx is an ozone (O{sub 3}) precursor, NOx and SO{sub 2} are precursors to fine particulate matter (PM2.5) and PM2.5 impairs visibility, contributing to regional haze. Thus, reductions in these emissions are important to achieving the 8-hr O{sub 3} and PM2.5 National Ambient Air Quality Standards (NAAQS) and for improving visibility. With the vacatur of CAIR, the reductions States counted on in the near-term (2009-2011) are in jeopardy. Ultimately, Congress will hopefully enact stringent multipollutant legislation targeting EGUs. However, in the meantime, to protect public health from deadly air pollution, states will need to step in to fill the gap and act quickly to restrict air pollutant emissions from EGUs. 1 ref.
Busch, Fredric N
2017-01-01
In psychoanalytic theory, the importance of actual neuroses-considered to be devoid of psychic content-diminished as Freud and subsequent analysts focused on unconscious intrapsychic conflict. This paper explores the relationship between actual neurotic and unrepresented states, which are believed to be best addressed through attention to countertransference, intersubjectivity, and enactments rather than interpretation of intrapsychic conflict. Models suggesting how actual neurotic states and symbolized intrapsychic conflict may interact with each other and environmental stressors are described. Symbolizing actual neurotic states and establishing meaningful linkages between somatic/affective experiences and intrapsychic conflict are viewed as necessary for effective treatment of many disorders. © 2017 The Psychoanalytic Quarterly, Inc.
Afterword: Victorian Sculpture for the Twenty-First Century
Directory of Open Access Journals (Sweden)
David J. Getsy
2016-06-01
Full Text Available Commenting on the directions proposed by this issue of '19', the afterword discusses the broad trends in twenty-first century studies of Victorian sculpture and the opportunity for debate arising from the first attempt at a comprehensive exhibition.
Paper 5944 Changing Climates @ Colorado State: It's Everybody's Business
Campbell, S.; Calderazzo, J.; Denning, S.; Betsill, M.; Klein, J. A.; Fiege, M.
2014-12-01
With the help of faculty from all eight colleges, twenty-seven departments, and numerous other entities on and off the Colorado State University campus, this education and outreach initiative is based on the premises that climate change is everybody's business and that everyone has something to offer in meeting its challenges. Beginning in 2007, CC@CSU has organized some 120 talks to audiences totaling some 6,000, helping inform the student body and community and catalyzing relationships among faculty and researchers across campus. It has offered communication coaching to scientists (and others) who want to translate their expertise for the public. And it has developed a multidisciplinary website (http://changingclimates.colostate.edu) with over 450 annotated entries, all college-level content, primer-level clarity, on topics that include climate science and ecology, economics and emotions, ethics and policy, communication and activism, paleoclimate and human history, and much more. This presentation will address the basic questions of why, who, how, what, for whom, and so what, concluding with some of the key lessons learned about communicating across disciplinary boundaries on this important subject.
1Department of Environmental M
African Journals Online (AJOL)
USER
2014-08-01
Aug 1, 2014 ... impacts of inland sand mining in six selected local government areas of Ogun state, Nigeria. Twenty-seven ... land value, and destruction of infrastructural facilities. The study ... input in the construction industry in many parts of ...
Perkins, Rebecca B.; Lin, Mengyun; Wallington, Sherrie F.; Hanchate, Amresh D.
2016-01-01
Objective: To determine the effectiveness of existing school entry and education mandates on HPV vaccination coverage, we compared coverage among girls residing in states and jurisdictions with and without education and school-entry mandates. Virginia and the District of Columbia enacted school entry mandates, though both laws included liberal opt-out provisions. Ten additional states had mandates requiring distribution of education to parents or provision of education within school curricula...
Focal Dystonia and the Sensory-Motor Integrative Loop for Enacting (SMILE
Directory of Open Access Journals (Sweden)
David ePerruchoud
2014-06-01
Full Text Available Performing accurate movements requires preparation, execution, and monitoring mechanisms. The first two are coded by the motor system, and the latter by the sensory system. To provide an adaptive neural basis to overt behaviors, motor and sensory information has to be properly integrated in a reciprocal feedback loop. Abnormalities in this sensory-motor loop are involved in movement disorders such as focal dystonia, a hyperkinetic alteration affecting only a specific body part and characterized by sensory and motor deficits in the absence of basic motor impairments. Despite the fundamental impact of sensory-motor integration mechanisms on daily life, the general principles of healthy and pathological anatomic-functional organization of sensory-motor integration remain to be clarified. Based on the available data from experimental psychology, neurophysiology, and neuroimaging, we propose a bio-computational model of sensory-motor integration: the Sensory-Motor Integrative Loop for Enacting (SMILE. Aiming at direct therapeutic implementations and with the final target of implementing novel intervention protocols for motor rehabilitation, our main goal is to provide the information necessary for further validating the SMILE model. By translating neuroscientific hypotheses into empirical investigations and clinically relevant questions, the prediction based on the SMILE model can be further extended to other pathological conditions characterized by impaired sensory-motor integration.
Focal dystonia and the Sensory-Motor Integrative Loop for Enacting (SMILE).
Perruchoud, David; Murray, Micah M; Lefebvre, Jeremie; Ionta, Silvio
2014-01-01
Performing accurate movements requires preparation, execution, and monitoring mechanisms. The first two are coded by the motor system, the latter by the sensory system. To provide an adaptive neural basis to overt behaviors, motor and sensory information has to be properly integrated in a reciprocal feedback loop. Abnormalities in this sensory-motor loop are involved in movement disorders such as focal dystonia, a hyperkinetic alteration affecting only a specific body part and characterized by sensory and motor deficits in the absence of basic motor impairments. Despite the fundamental impact of sensory-motor integration mechanisms on daily life, the general principles of healthy and pathological anatomic-functional organization of sensory-motor integration remain to be clarified. Based on the available data from experimental psychology, neurophysiology, and neuroimaging, we propose a bio-computational model of sensory-motor integration: the Sensory-Motor Integrative Loop for Enacting (SMILE). Aiming at direct therapeutic implementations and with the final target of implementing novel intervention protocols for motor rehabilitation, our main goal is to provide the information necessary for further validating the SMILE model. By translating neuroscientific hypotheses into empirical investigations and clinically relevant questions, the prediction based on the SMILE model can be further extended to other pathological conditions characterized by impaired sensory-motor integration.
Pharmacy technician-to-pharmacist ratios: a state-driven safety and quality decision.
Bess, D Todd; Carter, Jason; DeLoach, Lindsey; White, Carol L
2014-01-01
To discuss the policy of pharmacy technician-to-pharmacist ratios by comparing Florida as an example of legislative-led authority versus Tennessee as an example of board of pharmacy-led ruling. Over the past 2 years, the Florida legislature has debated the issue of pharmacy staffing ratios, initially leaving the Florida Board of Pharmacy with little authority to advocate for and enact safe technician staffing ratios. Anticipating this situation, the Tennessee Board of Pharmacy created rules to meet pharmacy staffing needs while protecting the authority of the pharmacist-in-charge and promoting patient safety. Before enacting rules, members of the board toured the state and talked about proposed rule changes with pharmacists. The final rule sets the pharmacy technician-to-pharmacist ratio at 2:1 but permits a 4:1 ratio based on public safety considerations and availability of at least two Certified Pharmacy Technicians. Pharmacists and leaders within the profession should conduct further research on appropriate and safe ratios of pharmacy technicians to pharmacists, with a focus on safety and quality of care.
Open Adoption Placement by Birth Mothers in Their Twenties.
Clutter, Lynn B
The purpose of this study was to summarize birth mothers' descriptions of unplanned pregnancy experienced in their twenties and how open adoption influenced their lives. Naturalistic inquiry was used with purposive sampling from one agency and telephone interviews of women who experienced unplanned pregnancy in their twenties and relinquishment through open adoption. Recorded, transcribed, and deidentified interviews were analyzed for qualitative themes. Fifteen participants judiciously weighed the open adoption decision. Over half parented other children prior to placement. Most knew they could not have parented this child due to life stressors. Placement was a hard decision, but ongoing contact with birth child and adoptive family was valued. Open adoption processes made them stronger by being happy that their child experienced family life with greater opportunities than birth mothers could offer at the time. Summarized themes used the acronym COMMITTED: C-care deeply about what is best for the child, O-ongoing open adoption: good and hard, M-meeting together regularly, M-moving on in personal growth, accomplishments, and milestones, I-independence from previous stressors or crises, T-transitions, T-therapeutic support, E-emotions, D-depression giving way to deepened strength and personal direction. Open adoption is reinforced as a positive resolution of unintended pregnancy for birth mothers in their twenties.
Joelson, Anders; Hedlund, Rune; Frennered, Karin
2014-06-18
The purpose of this mixed prospective and retrospective case series was to evaluate the long-term health-related quality of life and physical disability after in situ arthrodesis for high-grade isthmic spondylolisthesis. Thirty-five of forty consecutive patients who had in situ spinal arthrodesis for high-grade isthmic spondylolisthesis at a mean age of fifteen years (range, nine to twenty-five years) completed validated questionnaires (Short Form-36 [SF-36], EuroQol-5 Dimensions [EQ-5D], Zung depression scale, Oswestry disability index [ODI], Million score, and back and leg pain visual analog scale [VAS]) and underwent physical examination twenty-nine years (range, twenty-three to thirty-five years) after surgery. The mean age at the time of follow-up was forty-three years (range, thirty-seven to fifty-one years). In the absence of a formal control group, the scores on the SF-36 and EQ-5D were compared with Swedish normative data. The proportion of patients at work was compared with an age-matched control group derived from official statistics of Sweden. The Million score at the long-term follow-up was compared with the corresponding results at the mid-term follow-up of the same patients at a mean age of twenty-two years. The scores on the SF-36 and EQ-5D were similar to the scores of the general Swedish population. The mean Zung depression scale score was 30 (range, 20 to 52), the mean ODI score was 10 (range, 0 to 34), the mean back pain VAS score was 13 (range, 0 to 72), and the mean leg pain VAS score was 9 (range, 0 to 60). The Million score averaged 28 (range, 0 to 109) and was slightly worsened compared with the score of 19 (range, 0 to 94) at the mid-term follow-up (p = 0.034). The proportion of patients at work was the same as that for the age-matched general Swedish population. Our study shows good outcomes in health-related quality of life, disability, pain, and ability to work at up to twenty-nine years after in situ lumbar spine arthrodesis for high
Parental Leave Policies and Pediatric Trainees in the United States.
Dixit, Avika; Feldman-Winter, Lori; Szucs, Kinga A
2015-08-01
The American Academy of Pediatrics (AAP) states that each residency program should have a clearly delineated, written policy for parental leave. Parental leave has important implications for trainees' ability to achieve their breastfeeding goals. This study aimed to measure the knowledge and awareness among members of the AAP Section on Medical Students, Residents, and Fellowship Trainees (SOMSRFT) regarding parental leave. An online survey was emailed to SOMSRFT members in June 2013. Quantitative data are presented as percentage of respondents. Awareness of leave policies was analyzed based on having children and the sex of respondents. Nine hundred twenty-seven members responded to the survey. Among those with children, 40% needed to extend the duration of their training in order to have longer maternity leave, 44% of whom did so in order to breastfeed longer. Thirty percent of respondents did not know if their program had a written, accessible policy for parental leave. Trainees without children and men were more unaware of specific aspects of parental leave such as eligibility for the Family Medical Leave Act as compared to women and those with children. Despite the fact that United States national policies support parental leave during pediatrics training, and a majority of programs comply, trainees' awareness regarding these policies needs improvement. © The Author(s) 2015.
Nuclear power in the twenty-first century - An assessment (Part 1)
von Hirschhausen, Christian
2017-01-01
Nuclear power was one of the most important discoveries of the twentieth century, and it continues to play an important role in twenty-first century discussions about the future energy mix, climate change, innovation, proliferation, geopolitics, and many other crucial policy topics. This paper addresses some key issues around the emergence of nuclear power in the twentieth century and perspectives going forward in the twenty-first, including questions of economics and competitiveness, the str...
Basic Life Support Access to Injectable Epinephrine across the United States.
Brasted, Ian D; Dailey, Michael W
2017-01-01
Aggressive epinephrine administration has growing support in the treatment of anaphylaxis, a life-threatening allergic reaction. Emergency Medical Services (EMS) providers are frequently in a position to provide the first care to someone experiencing an anaphylactic reaction. Intramuscular injection of epinephrine is the definitive pharmacologic treatment for many associated symptoms. While easy to use, epinephrine autoinjectors (EAI) are prohibitively expensive, having increased in price ten-fold in ten years. Some states and EMS departments have begun expanding the scope of practice to allow Basic Life Support (BLS) providers, previously restricted to noninvasive therapies, to administer epinephrine by syringe. To compile a current and comprehensive list of how epinephrine is carried and used by EMS across the USA. An online survey focusing on anaphylaxis protocols and epinephrine administration was sent to state EMS medical directors and officials in all 50 states. Follow-up telephone calls were made to ensure compliance. Data were analyzed with descriptive statistics. Forty-nine of the 50 states in the USA provided a survey response. Texas responded but declined to participate in the survey because of practice variability across the state. In the other states, the form of epinephrine allowed or required on BLS ambulances was consistent with the scope of practice of their Basic Emergency Medical Technician (EMT). Thirteen states had training programs to allow BLS providers to inject epinephrine; 7 were considering it; 29 were not. Twenty-seven states specified EAI as the only form of epinephrine required or allowed on their BLS ambulances. No states reported allowing any level of EMS provider below EMT to use alternatives to EAI. This study confirms that many states have expanded the training of BLS providers to include the use of syringe injectable epinephrine. Even so, the majority of states relied on EAI in BLS ambulances.
Vermeulen, Erik; Fenwick, Mark
2016-01-01
Seven “Corporate Venturing” Strategies to Foster Innovation tackles the question: What should companies do to accelerate innovation and remain relevant? Or, stated differently: What should companies do to avoid being disrupted by more agile and innovative startups? One answer is corporate venturing.
The State Geologic Map Compilation (SGMC) geodatabase of the conterminous United States
Horton, John D.; San Juan, Carma A.; Stoeser, Douglas B.
2017-06-30
The State Geologic Map Compilation (SGMC) geodatabase of the conterminous United States (https://doi. org/10.5066/F7WH2N65) represents a seamless, spatial database of 48 State geologic maps that range from 1:50,000 to 1:1,000,000 scale. A national digital geologic map database is essential in interpreting other datasets that support numerous types of national-scale studies and assessments, such as those that provide geochemistry, remote sensing, or geophysical data. The SGMC is a compilation of the individual U.S. Geological Survey releases of the Preliminary Integrated Geologic Map Databases for the United States. The SGMC geodatabase also contains updated data for seven States and seven entirely new State geologic maps that have been added since the preliminary databases were published. Numerous errors have been corrected and enhancements added to the preliminary datasets using thorough quality assurance/quality control procedures. The SGMC is not a truly integrated geologic map database because geologic units have not been reconciled across State boundaries. However, the geologic data contained in each State geologic map have been standardized to allow spatial analyses of lithology, age, and stratigraphy at a national scale.
Summary record of the twenty-seventh meeting
International Nuclear Information System (INIS)
Young, P.
1990-01-01
The topics presented and discussed at the twenty-seventh international meeting of the Nuclear Data Committee of the Nuclear Energy Agency are summarized. Relations with other committees and reports of data centers are analyzed. Problems concerning nuclear model codes are underlined. National evaluation efforts on data library and data file are reported. Reports from several laboratories and subcommittees are summarized
A Farewell to Innocence? African Youth and Violence in the Twenty-First Century
Directory of Open Access Journals (Sweden)
Charles Ugochukwu Ukeje
2012-12-01
Full Text Available This is a broad examination of the issue of youth violence in twenty-first-century Africa, looking at the context within which a youth culture of violence has evolved and attempting to understand the underlining discourses of hegemony and power that drive it. The article focuses specifically on youth violence as apolitical response to the dynamics of (disempowerment, exclusion, and economic crisis and uses (postconflict states like Liberia, Sierra Leone, and Nigeriato explain not just the overall challenge of youth violence but also the nature of responses that it has elicited from established structures of authority. Youth violence is in many ways an expression of youth agency in the context of a social and economic system that provides little opportunity.
Civil Rights Laws as Tools to Advance Health in the Twenty-First Century.
McGowan, Angela K; Lee, Mary M; Meneses, Cristina M; Perkins, Jane; Youdelman, Mara
2016-01-01
To improve health in the twenty-first century, to promote both access to and quality of health care services and delivery, and to address significant health disparities, legal and policy approaches, specifically those focused on civil rights, could be used more intentionally and strategically. This review describes how civil rights laws, and their implementation and enforcement, help to encourage health in the United States, and it provides examples for peers around the world. The review uses a broad lens to define health for both classes of individuals and their communities--places where people live, learn, work, and play. Suggestions are offered for improving health and equity broadly, especially within societal groups and marginalized populations. These recommendations include multisectorial approaches that focus on the social determinants of health.
Values that matter, barriers that interfere: the struggle of Canadian nurses to enact their values.
Beagan, Brenda; Ells, Carolyn
2009-03-01
Qualitative interviews were conducted with 20 nurses in a Canadian city to explore the moral experience of nurses in their working lives. The participants were asked what they valued in their profession and how well their work lives enabled them act on their values. Almost uniformly, they expressed commitment to the values of helping others, caring, making a difference, patient-centredness, advocacy, professional integrity, holistic care, and sharing knowledge for patient empowerment. They identified several challenges and frustrations experienced in attempting to enact these values. System-level challenges included professional hierarchies, organizational structures, issues in the health-care system, and power dynamics. Removing these barriers cannot be left to nurses alone. It requires complex, wide-ranging strategies: system change, power restructuring, and the creation of ethical climates and cultures that support values that are essential to good patient care.
The Summit of «Group of Twenty» – 2016: geopolitical assessments
Directory of Open Access Journals (Sweden)
O. S. Vonsovych
2016-08-01
Full Text Available The article investigated the geopolitical assessments of the results of the Summit of «Group of Twenty», which took place in Hangzhou from 4 till 5 September, 2016. The main idea of this event was the development of innovation, healthy, coherent and inclusive economy. Moreover, important for the geopolitical consolidation of efforts of member countries in the context of further development of the world economy was making such documents as: Contours of the innovative growth of «Group of Twenty», Action plan of «Group of Twenty» in connection with a new industrial revolution, Hangzhou action plan, which set out a strategy for overall and confident growth and also initiative of «Group of twenty» in development and cooperation in the field of digital economy. Important thing is that analysis of the Summit’s results for world regions is important from a geopolitical point of view. We can predict that in the future geopolitical dialogue between the EU and the US in the economy will become more vital for both sides, and will enable to contribute to the implementation of more global challenges of the global economy. We should mention that Summit of «Group of Twenty» largely determined the prospects of global economic processes and build a new world economic order with the introduction of innovative approaches and elements of the digital economy. Activity on the functioning of the global economy should be based on the collective efforts of all participants and take into account all the realities on the international stage. No less important is that the Summit proved the presence of leading geopolitical centers that affect not only the balance of power in the world, but also the further development of key economic processes. Each of these centers sees its future not only the global economy but the global system as a whole as well as its geopolitical influence in certain regions and countries. On the one hand, as for the development of
International Nuclear Information System (INIS)
Aaen, Sara Bjørn; Kerndrup, Søren; Lyhne, Ivar
2016-01-01
This article adds to the growing insight into public acceptance by presenting a novel approach to how citizens make sense of new energy infrastructure. We claim that to understand public acceptance, we need to go beyond the current thinking of citizens framed as passive respondents to proposed projects, and instead view infrastructure projects as enacted by citizens in their local settings. We propose a combination of sensemaking theory and actor–network theory that allows insight into how citizens enact entities from experiences and surroundings in order to create meaning and form a reaction to new infrastructure projects. Empirically, we analyze how four citizens make sense of an electricity cable project through a conversation process with a representative from the infrastructure developer. Interestingly, the formal participation process and the materiality of the cable play minor roles in citizens' sensemaking process. We conclude that insight into the way citizens are making sense of energy infrastructure processes can improve and help to overcome shortcomings in the current thinking about public acceptance and public participation. - Highlights: •Attention to citizens' sensemaking enables greater insight into the decision-making process. •A combination of sensemaking and actor-network theory (ANT) is relevant for studies of public acceptance. •Sensemaking explains why citizens facing similar situations act differently. •Complexity of citizens' sensemaking challenges the predictability of processes.
Energy Technology Data Exchange (ETDEWEB)
McCone, John A.
1960-01-31
The first twenty five semiannual reports of the United States Atomic Energy Commission to Congress cover the major unclassified activities of the Commission from January 1947 through January 1959. In addition to the semiannual summaries, a series of special reports on important atomic energy programs were included in many of the semiannual reports. This cumulative name and subject index provides a guide to the information published in these reports. Beginning in 1960, the Commission will be issuing annual reports, each separately indexed, ceasing the semiannual reporting.
Seven-laser diode end-pumped Nd
International Nuclear Information System (INIS)
Berger, J.; Welch, D.F.; Streifer, W.; Scifres, D.R.; Smith, J.J.; Hoffman, H.J.; Peisley, D.; Radecki, D.
1988-01-01
End pumping of solid-state lasers by single semiconductor laser diode arrays (LDAs) is efficient, but the maximum pump power is limited by the source brightness and matching the TEM/sub 00/ Nd:YAG cavity mode. To increase the output power from a solid-state Nd:YAG laser, one option is to employ a multiplicity of LDA to provide more pump power than is available from a single source. The authors report herein a 660-mW cw TEM/sub 00/ Nd:YAG laser, end-pumped by seven LDA, with bundled optical fibers coupling the light from each diode to the Nd:YAG rod end. The maximum electrical-to-optical conversion efficiency attained was 4.7% at 560-mW Nd:YAG output power. The LDAs (SDL-2430-C, 100 μm wide) were mounted on separate thermoelectric coolers to tune emission wavelength to the Nd:YAG absorption bands. The diodes were operated at their rated output power (50,000 h mean time to failure). The 110/125-μm diam 0.37-N.A. fibers were butt coupled to the lasers and glued together into a hexagonal close pack. The authors have obtained the highest average power demonstrated to date in the TEM/sub 00/ mode from a Nd:YAG laser, reliably end-pumped by multiple laser diodes with good efficiency
Pre-university Chemistry Students in a Mimicked Scholarly Peer Review
van Rens, Lisette; Hermarij, Philip; Pilot, Albert; Beishuizen, Jos; Hofman, Herman; Wal, Marjolein
2014-10-01
Peer review is a significant component in scientific research. Introducing peer review into inquiry processes may be regarded as an aim to develop student understanding regarding quality in inquiries. This study examines student understanding in inquiry peer reviews among pre-university chemistry students, aged 16-17, when they enact a design of a mimicked scholarly peer review. This design is based on a model of a human activity system. Twenty-five different schools in Brazil, Germany, Poland and The Netherlands participated. The students (n = 880) conducted in small groups (n = 428) open inquiries on fermentation. All groups prepared an inquiry report for peer review. These reports were published on a website. Groups were randomly paired in an internet symposium, where they posted review comments to their peers. These responses were qualitatively analyzed on small groups' level of understanding regarding seven categories: inquiry question, hypothesis, management of control variables, accurate measurement, presenting results, reliability of results, discussion and conclusion. The mimicked scholarly review prompted a collective practice. Student understanding was significantly well on presenting results, discussion and conclusion, and significantly less on inquiry question and reliability of results. An enacted design, based on a model of a human activity system, created student understanding of quality in inquiries as well as an insight in a peer-reviewing practice. To what extent this model can be applied in a broader context of design research in science education needs further study.
Directory of Open Access Journals (Sweden)
Michael P Kaschak
Full Text Available We report a design study that assessed the feasibility of Enacted Reading Comprehension (ERC, an intervention designed to teach 3rd and 4th grade students (n = 40 and 25, respectively to use gestures to understand an increasingly abstract set of texts. Students were taught to use gestures to understand the idea of "opposing forces" in a concrete setting-the forces at play as tectonic plates move past each other-and then taught to use the gestures to understand opposing forces in more abstract situations. For example, students were taught to use gestures to understand the opposing sides of an argument, and to understand the internal conflicts that arise as individuals are faced with moral dilemmas. The results of our design study suggest that ERC has promise as a method for introducing students to the idea of using gesture to understand text content, and to employ this strategy in a range of reading contexts.
Digital earth applications in the twenty-first century
de By, R.A.; Georgiadou, P.Y.
2014-01-01
In these early years of the twenty-first century, we must look at how the truly cross-cutting information technology supports other innovations, and how it will fundamentally change the information positions of government, private sector and the scientific domain as well as the citizen. In those
Snakes of Cerrado localities in western Bahia, Brazil
de Freitas, Marco; Colli, Guarino; Entiauspe-Neto, Omar; Trinchão, Luiz; Araújo, Daniel; Lima, Tiago; de França, Daniella; Gaiga, Renato; Dias, Pedro
2016-01-01
We present a list of snake species found in 10 municipalities in the Cerrado of western Bahia state, Brazil. One hundred and twenty individuals of 46 species from seven families were examined. We also present a new state record for the genus Phalotris Cope, 1862 and a candidate new species for the genus Thamnodynastes Wagler, 1830.
Radiation curing - twenty five years on
International Nuclear Information System (INIS)
Garnett, J.L.
1995-01-01
Progress in UV/EB curing during the past twenty five years is briefly reviewed. During this time developments in unique polymer chemistry, novel equipment design and the introduction of relevant educational programmes has enabled radiation curing to become an established technology with specific strengths in certain industries. Possible reasons for the emergence of the technology in these niche markets are discussed. Despite the worldwide recession, radiation curing is shown to be expanding at 5% per annum with the prospect of higher growth with improving economic conditions. (Author)
Medical cannabis laws and opioid analgesic overdose mortality in the United States, 1999-2010.
Bachhuber, Marcus A; Saloner, Brendan; Cunningham, Chinazo O; Barry, Colleen L
2014-10-01
Opioid analgesic overdose mortality continues to rise in the United States, driven by increases in prescribing for chronic pain. Because chronic pain is a major indication for medical cannabis, laws that establish access to medical cannabis may change overdose mortality related to opioid analgesics in states that have enacted them. To determine the association between the presence of state medical cannabis laws and opioid analgesic overdose mortality. A time-series analysis was conducted of medical cannabis laws and state-level death certificate data in the United States from 1999 to 2010; all 50 states were included. Presence of a law establishing a medical cannabis program in the state. Age-adjusted opioid analgesic overdose death rate per 100 000 population in each state. Regression models were developed including state and year fixed effects, the presence of 3 different policies regarding opioid analgesics, and the state-specific unemployment rate. Three states (California, Oregon, and Washington) had medical cannabis laws effective prior to 1999. Ten states (Alaska, Colorado, Hawaii, Maine, Michigan, Montana, Nevada, New Mexico, Rhode Island, and Vermont) enacted medical cannabis laws between 1999 and 2010. States with medical cannabis laws had a 24.8% lower mean annual opioid overdose mortality rate (95% CI, -37.5% to -9.5%; P = .003) compared with states without medical cannabis laws. Examination of the association between medical cannabis laws and opioid analgesic overdose mortality in each year after implementation of the law showed that such laws were associated with a lower rate of overdose mortality that generally strengthened over time: year 1 (-19.9%; 95% CI, -30.6% to -7.7%; P = .002), year 2 (-25.2%; 95% CI, -40.6% to -5.9%; P = .01), year 3 (-23.6%; 95% CI, -41.1% to -1.0%; P = .04), year 4 (-20.2%; 95% CI, -33.6% to -4.0%; P = .02), year 5 (-33.7%; 95% CI, -50.9% to -10.4%; P = .008), and year 6 (-33.3%; 95% CI, -44.7% to
Early twenty-first-century droughts during the warmest climate
Directory of Open Access Journals (Sweden)
Felix Kogan
2016-01-01
Full Text Available The first 13 years of the twenty-first century have begun with a series of widespread, long and intensive droughts around the world. Extreme and severe-to-extreme intensity droughts covered 2%–6% and 7%–16% of the world land, respectively, affecting environment, economies and humans. These droughts reduced agricultural production, leading to food shortages, human health deterioration, poverty, regional disturbances, population migration and death. This feature article is a travelogue of the twenty-first-century global and regional droughts during the warmest years of the past 100 years. These droughts were identified and monitored with the National Oceanic and Atmospheric Administration operational space technology, called vegetation health (VH, which has the longest period of observation and provides good data quality. The VH method was used for assessment of vegetation condition or health, including drought early detection and monitoring. The VH method is based on operational satellites data estimating both land surface greenness (NDVI and thermal conditions. The twenty-first-century droughts in the USA, Russia, Australia and Horn of Africa were intensive, long, covered large areas and caused huge losses in agricultural production, which affected food security and led to food riots in some countries. This research also investigates drought dynamics presenting no definite conclusion about drought intensification or/and expansion during the time of the warmest globe.
Directory of Open Access Journals (Sweden)
Michael eKimmel
2015-01-01
Full Text Available Our micro-ethnographic study demonstrates how bodywork skills in Feldenkrais and Shiatsu are infused with systemic sensitivities. A micro-genetic study both of process vignettes and bodyworkers’ subjective theories reveals their intrinsically systemic self-awareness for process management – which is why we deem dynamic systems concepts a suitable meta-language. From an abstract angle, bodyworkers stimulate self-organization and dynamic homeostatic balance in the client’s somato-personal system. Operating in such a framework requires a progressive reconfiguring of the client’s attractor landscape, his or her systemic dispositions. Specifically, we argue that bodyworkers context-intelligently soft-assemble (frequently non-linear synergies within their apperception of functional architectures of somato-systemic order. The client’s system is stimulated with a mix of perturbing and stabilizing interventions, while oscillating between eigenfunctions of joints, muscles, etc., and their integration in functional ensembles. In concrete embodied interaction this is implemented with continuous tactile coupling in a safe dyadic sphere and in an irreducibly real-time dynamics, even when sketchily planned. By sensorially charting systemic states in the making practitioners continuously stay apace of emergence, respond to minute changes, and customize reactions in a zone of proximal development (dynamic immediacy. Immediate responsiveness, in turn, benefits the client’s somatic learning. Finally, we inventorize the bodyworker’s tool-box at the operative level. Here a host of micro-enactive skills provides the necessary wherewithal for situated intervention, ranging from educated senses which know how to – often subtly – elicit information, via hands-on techniques from the action repertoire (grips, stretches, etc., to habitus (proper posture, muscle activation, gaze patterns, etc..
The Predictiveness of Achievement Goals
Directory of Open Access Journals (Sweden)
Huy P. Phan
2013-11-01
Full Text Available Using the Revised Achievement Goal Questionnaire (AGQ-R (Elliot & Murayama, 2008, we explored first-year university students’ achievement goal orientations on the premise of the 2 × 2 model. Similar to recent studies (Elliot & Murayama, 2008; Elliot & Thrash, 2010, we conceptualized a model that included both antecedent (i.e., enactive learning experience and consequence (i.e., intrinsic motivation and academic achievement of achievement goals. Two hundred seventy-seven university students (151 women, 126 men participated in the study. Structural equation modeling procedures yielded evidence that showed the predictive effects of enactive learning experience and mastery goals on intrinsic motivation. Academic achievement was influenced intrinsic motivation, performance-approach goals, and enactive learning experience. Enactive learning experience also served as an antecedent of the four achievement goal types. On the whole, evidence obtained supports the AGQ-R and contributes, theoretically, to 2 × 2 model.
Association between the training loads imposed to amateur rugby sevens players and burnout syndrome
Directory of Open Access Journals (Sweden)
Alberto Sarly Coutinho Sobral
2014-06-01
Full Text Available Burnout syndrome has been shown to be increasingly prevalent in athletes, since it is related to factors that influence levels of stress during the preparation of sports. Therefore, it has been studied in several sports, but not in Rugby Seven. The aim of this study was to correlate the effects of training loads imposed on amateur Rugby Sevens players with the burnout questionnaire. Nine players (25 ± 5 years-old were evaluated before the preparatory period. Assessment included the measurement of the % fat percentage; nutritional status, stress, and aerobic power. During the preparatory period, once again, it was assessed the state of stress, aerobic power, and intensity of the training program. It was observed that there is no significant correlation between the intensity of the workout and Burnout scores (p> 0.05, nor between Burnout scores and aerobic capacity. However, there was significant a correlation between the intensity of training performed with aerobic power (p< 0.01. Therefore, it is concluded that a training program prescribed properly, prevents the onset of burnout syndrome in Rugby Sevens players.
Sobolewski-McMahon, Lauren M.
2017-01-01
The purpose of this study was to examine the influences of various facets of middle school mathematics teachers' practical rationality on their instructional decision making as they plan to enact the Common Core State Standards for Mathematical Practice, CCSS-MP1 (perseverance in problem solving) and CCSS-MP3 (communicating and critiquing). The…
Simultaneous Determination of Seven Constituents in Herbal ...
African Journals Online (AJOL)
Simultaneous Determination of Seven Constituents in Herbal Prescription Jaeumganghwa-Tang Using HPLC-PDA. CS Seo, JH Kim, HK Shin. Abstract. A simple and accurate high-performance liquid chromatographic method was applied to the quantitative analysis of seven components of the traditional herbal prescription ...
Park, Hyunchul; Kim, Eunjin; Kim, Jeongeun; Ro, Youngsuck; Ko, Jooyeon
2015-12-01
High-intensity focused ultrasound (HIFU) treatment has recently emerged in response to the increasing demand for noninvasive procedures for skin lifting and tightening. This study was aimed at evaluating the clinical efficacy of and patient satisfaction with HIFU treatment for wrinkles and laxity in seven different areas of the face in Asian skin. Twenty Korean patients with facial wrinkle and laxity were analyzed after a single session of HIFU treatment. Two independent, blinded clinicians evaluated the clinical improvement in seven areas of the face by comparison of standardized photographs obtained before, and at 3 and 6 months after treatment. Assessment of subjective satisfaction and adverse effects of treatment were done by using questionnaires. The physicians' evaluation and patients' satisfaction with the clinical effects of HIFU in each area were similar regardless of the number of treatment shots. The jawline, cheek, and perioral areas were the sites where HIFU was most effective, in decreasing order. The adverse effects included erythema and swelling in six cases, and purpura and bruising in two cases. However, the adverse effects were mild and transient. HIFU could be a safe, effective, and noninvasive procedure that can be used to improve facial wrinkles and skin laxity in Asian skin. It is particularly effective for clinical improvement in the jawline, cheek, and perioral areas.
Report of the twenty-first session, London, 18-22 February 1991
International Nuclear Information System (INIS)
1991-01-01
The Joint Group of Experts on the Scientific Aspects of Marine Pollution (GESAMP) held its twenty-first session at the Headquarters of the International Maritime Organization (IMO), London, from 18 to 22 February 1991. Marine pollution is primarily linked to coastal development. The most serious problems are those associated with inadequately controlled coastal development and intensive human settlement of the coastal zone. GESAMP emphasizes the importance of the following problems and issues: State of the marine environment; comprehensive framework for the assessment and regulation of waste disposal in the marine environment; information on preparations for the United Nations Conference on Environment and Development; review of potentially harmful substances: 1. Carcinogenic substances. 2. Mutagenic substances. 3. Teratogenic substances. 4. Organochlorine compounds. 5. Oil, and other hydrocarbons including used lubricating oils, oil spill dispersants and chemicals used in offshore oil exploration and exploitation; environmental impacts of coastal aquaculture; global change and the air/sea exchange of chemicals; future work programme
Golf science research at the beginning of the twenty-first century.
Farrally, M R; Cochran, A J; Crews, D J; Hurdzan, M J; Price, R J; Snow, J T; Thomas, P R
2003-09-01
At the beginning of the twenty-first century, there are 30,000 golf courses and 55 million people who play golf worldwide. In the USA alone, the value of golf club memberships sold in the 1990s was US dollar 3.2 billion. Underpinning this significant human activity is a wide variety of people researching and applying science to sustain and develop the game. The 11 golf science disciplines recognized by the World Scientific Congress of Golf have reported 311 papers at four world congresses since 1990. Additionally, scientific papers have been published in discipline-specific peer-reviewed journals, research has been sponsored by the two governing bodies of golf, the Royal and Ancient Golf Club of St. Andrews and the United States Golf Association, and confidential research is undertaken by commercial companies, especially equipment manufacturers. This paper reviews much of this human endeavour and points the way forward for future research into golf.
Survey of state approaches to solar energy incentives
Energy Technology Data Exchange (ETDEWEB)
Johnson, S. B.
1979-07-01
A comprehensive survey is presented of state statutes designed to encourage the application of solar technology. A large majority of the states have enacted financial incentives designed to stimulate solar energy use. Commonly, these incentives include preferential property tax treatment of solar systems, and income tax benefits to solar users. There are a wide variety of other tax breaks as well, including excise and franchise tax incentives. Some states have recently developed loan or grant programs for solar installations. Other states have addressed aspects of real property and land-use planning law, which have served as barriers to either the installation of solar technology or access to sunlight. In addition to removing such obstacles as restrictive convenants and zoning limitations, the legislation of several states provides affirmative recognition of the potential of real property law to serve as a spur to solar development, through solar easements, planning and zoning, and public nuisance. A small number of states have legislated in the field of utility regulation, addressing important questions of (1) nondiscriminatory rates for utility backup to solar systems and public utility commissions, and (2) utility involvement in solar energy applicatons.
Da Silva, Roberta Dos Santos; Cavichioli, Rodney R; Takiya, Daniela M; Mejdalani, Gabriel
2018-01-18
Seven new species of the economically important sharpshooter genus Acrogonia Stål are described and illustrated: A. falcata sp. nov. (French Guiana and state of Amazonas, Brazil), A. felixi sp. nov. (department of Loreto, Peru), A. quintasi sp. nov. (state of Pará, Brazil), A. distincta sp. nov. (state of Amazonas, Brazil), A. dentata sp. nov. (department of San Martin in Peru, French Guiana, and states of Amazonas, Mato Grosso, Pará, and Rondônia in Brazil), A. luizi sp. nov. (province of Pastaza in Ecuador and state of Amazonas in Brazil), and A. lobulata sp. nov. (province of Orellana, Ecuador). In addition to the external morphology, color pattern, and male genitalia, detailed descriptions and illustrations of the female genitalia are provided for three of the new species (A. dentata, A. luizi, and A. lobulata). Females of the other four new species are unknown. Acrogonia includes now 39 species, being among the most species-rich genera of the Proconiini.
2015-02-13
This document announces a CMS Ruling that states the CMS policies for implementing United States v. Windsor ("Windsor''), in which the Supreme Court held that section 3 of the Defense of Marriage Act (DOMA), enacted in 1996, is unconstitutional. Section 3 of DOMA defined ``marriage'' and "spouse'' as excluding same-sex marriages and same-sex spouses, and effectively precluded the Federal government from recognizing same-sex marriages and spouses.
Seven Deadliest Wireless Technologies Attacks
Haines, Brad
2010-01-01
How can an information security professional keep up with all of the hacks, attacks, and exploits? One way to find out what the worst of the worst are is to read the seven books in our Seven Deadliest Attacks Series. Not only do we let you in on the anatomy of these attacks but we also tell you how to get rid of them and how to defend against them in the future. Countermeasures are detailed so that you can fight against similar attacks as they evolve. Attacks featured in this book include:Bluetooth AttacksCredit Card, Access Card, and Passport AttacksBad Encryption
The Political and Territorial Development of Nations without States
Directory of Open Access Journals (Sweden)
Jernej Zupančič
2010-12-01
Full Text Available This paper analyzes the issue of nations without states in contemporary Europe between the Atlantic and the Urals. The political map of the continent comprises forty-seven countries, most of which are nation-states. However, the cultural mosaic of Europe is far more complex; there are around fifty ethnic groups (in addition to historical, territorial, or indigenous ethnic minorities and an enormous number of immigrant ethnic communities lacking a state-based organization. Together, these people add up to 78 million, or almost 15% of the European population. Twenty-seven groups can be considered nations without states; they are culturally and ethnically based and have various forms of territorial integrity and political organization. However, they did not create a state organization, despite many attempts by some through history. Without a state organization, those communities have poorer opportunities to protect their folk culture and to reproduce various elements of ethnic identity. This is why they seek territorial autonomy or independent statehood through nationalist movements. In many cases, these ambitions are encompassed in regional movements. These movements have been popular in Europe, particularly because the idea of a “Europe of regions” as part of the European Union has had broad political support and acceptance. However, it has not actually succeeded. The EU and Europe as a whole are still a Europe of (nation-states. In general, regional movements have been successful and through this some nations without states have attained part of their political ambitions in the form of territorial autonomy. The regionalization of former centralist states (e.g., Spain and the United Kingdom increased the chances of ethnic survival for the Catalans, Basques, Scots, and Welsh. On the other hand, the regionalization of nations without states represented territorial division, a kind of “divide and rule” strategy serving to reduce their
Glaser, John P
2008-01-01
Partners Healthcare, and its affiliated hospitals, have a long track record of accomplishments in clinical information systems implementations and research. Seven ideas have shaped the information systems strategies and tactics at Partners; centrality of processes, organizational partnerships, progressive incrementalism, agility, architecture, embedded research, and engage the field. This article reviews the ideas and discusses the rationale and steps taken to put the ideas into practice.
SEAPOWER: A GUIDE FOR THE TWENTY- FIRST CENTURY
African Journals Online (AJOL)
Abel
$154,37 (amazon.com hardback). With the publication of Seapower: A Guide for the Twenty-First Century. Geoffrey Till has set the standard for publications on all things maritime. The updated and expanded new edition of the book is an essential guide for students of naval history and maritime strategy and provides ...
Clustering of resting state networks.
Directory of Open Access Journals (Sweden)
Megan H Lee
Full Text Available The goal of the study was to demonstrate a hierarchical structure of resting state activity in the healthy brain using a data-driven clustering algorithm.The fuzzy-c-means clustering algorithm was applied to resting state fMRI data in cortical and subcortical gray matter from two groups acquired separately, one of 17 healthy individuals and the second of 21 healthy individuals. Different numbers of clusters and different starting conditions were used. A cluster dispersion measure determined the optimal numbers of clusters. An inner product metric provided a measure of similarity between different clusters. The two cluster result found the task-negative and task-positive systems. The cluster dispersion measure was minimized with seven and eleven clusters. Each of the clusters in the seven and eleven cluster result was associated with either the task-negative or task-positive system. Applying the algorithm to find seven clusters recovered previously described resting state networks, including the default mode network, frontoparietal control network, ventral and dorsal attention networks, somatomotor, visual, and language networks. The language and ventral attention networks had significant subcortical involvement. This parcellation was consistently found in a large majority of algorithm runs under different conditions and was robust to different methods of initialization.The clustering of resting state activity using different optimal numbers of clusters identified resting state networks comparable to previously obtained results. This work reinforces the observation that resting state networks are hierarchically organized.
Directory of Open Access Journals (Sweden)
John Orchard
2010-05-01
Full Text Available John Orchard1, Trefor James2, Alex Kountouris2, Marc Portus21School of Public Health, University of Sydney, Sydney, Australia; 2Cricket Australia, Melbourne, AustraliaAbstract: This study analyzes injuries occurring prospectively in Australian men’s cricket at the state and national levels over 11 seasons (concluding in season 2008–09. In the last four of these seasons, there was more cricket played, with most of the growth being a new form of the game – Twenty20 cricket. Since the introduction of a regular Twenty20 program, injury incidence rates in each form of cricket have been fairly steady. Because of the short match duration, Twenty20 cricket exhibits a high match injury incidence, expressed as injuries per 10,000 hours of play. Expressed as injuries per days of play, Twenty20 cricket injury rates compare more favorably to other forms of cricket. Domestic level Twenty20 cricket resulted in 145 injuries per 1000 days of play (compared to 219 injuries per 1000 days of domestic one day cricket, and 112 injuries per 1000 days of play in first class domestic cricket. It is therefore recommended that match injury incidence measures be expressed in units of injuries per 1000 days of play. Given the high numbers of injuries which are of gradual onset, seasonal injury incidence rates (which typically range from 15–20 injuries per team per defined ‘season’ are probably a superior incidence measure. Thigh and hamstring strains have become clearly the most common injury in the past two years (greater than four injuries per team per season, perhaps associated with the increased amount of Twenty20 cricket. Injury prevalence rates have risen in conjunction with an increase in the density of the cricket calendar. Annual injury prevalence rates (average proportion of players missing through injury have exceeded 10% in the last three years, with the injury prevalence rates for fast bowlers exceeding 18%. As the amount of scheduled cricket is
Rappuoli, Rino
2011-01-01
In the twentieth century, vaccination has been possibly the greatest revolution in health. Together with hygiene and antibiotics, vaccination led to the elimination of many childhood infectious diseases and contributed to the increase in disability-free life expectancy that in Western societies rose from 50 to 78–85 years (Crimmins, E. M. & Finch, C. E. 2006 Proc. Natl Acad. Sci. USA 103, 498–503; Kirkwood, T. B. 2008 Nat. Med 10, 1177–1185). In the twenty-first century, vaccination will be expected to eliminate the remaining childhood infectious diseases, such as meningococcal meningitis, respiratory syncytial virus, group A streptococcus, and will address the health challenges of this century such as those associated with ageing, antibiotic resistance, emerging infectious diseases and poverty. However, for this to happen, we need to increase the public trust in vaccination so that vaccines can be perceived as the best insurance against most diseases across all ages. PMID:21893537
International Nuclear Information System (INIS)
Quattrocchi, J. L.
2006-01-01
The dawn of the atomic age brought with it both the hope of great benefit and the fear of great disaster. By the mid-1950's, the United States recognized that it was in the national interest to promote commercial development of nuclear energy in medicine and industry, particularly in the generation of electric power. The uncertainties of the technology and the potential for severe accidents were clear obstacles to commercial development. Exposure to potentially serious uninsured liabilities inhibited the private sector. These impediments led Congress to enact the Price-Anderson Act in 1957. Its three-fold purpose was to encourage private development of nuclear power, establish a framework for handling liability claims and provide a ready source of funds to compensate accident victims. The law was originally enacted for ten years but has now been extended four times. The major provisions of the Act and its importance to the public and to insurers are described in this paper.(author)
Vesico-vaginal fistula repair: experience with first twenty-three ...
African Journals Online (AJOL)
Vesico-vaginal fistula repair: experience with first twenty-three patients seen at a tertiary hospital in north-central Nigeria. Stephen D. Ngwan, Bassey E. Edem, Ajen S. Anzaku, Barnabas A. Eke, Mohammed A. Shittu, Solomon A. Obekpa ...
State laws on tobacco control--United States, 1998.
Fishman, J A; Allison, H; Knowles, S B; Fishburn, B A; Woollery, T A; Marx, W T; Shelton, D M; Husten, C G; Eriksen, M P
1999-06-25
State laws addressing tobacco use, the leading preventable cause of death in the United States, are summarized. Laws address smoke-free indoor air, minors' access to tobacco products, advertising of tobacco products, and excise taxes on tobacco products. Legislation effective through December 31, 1998. CDC identified laws addressing tobacco control by using an on-line legal research database. CDC's findings were verified with the National Cancer Institute's State Cancer Legislative Database. Since a previous surveillance summary on state tobacco-control laws published in November 1995 (covering legislation effective through June 30, 1995), several states have enacted new restrictions or strengthened existing legislation that addresses smoke-free indoor air, minors' access to tobacco, tobacco advertising, and tobacco taxes. Five states strengthened their smoke-free indoor air legislation. All states and Washington, D.C., continued to prohibit the sale and distribution of tobacco products to minors; however, 21 states expanded minors' access laws by designating enforcement authorities, adding license suspension or revocation for sale to minors, or requiring signage. Since the 1995 report, eight additional states (a total of 19 states and Washington, D.C.) now ban vending machines from areas accessible to minors. Thirteen states restrict advertising of tobacco products, an increase of four states since the 1995 report. Although the number of states that tax cigarettes and smokeless tobacco did not change, 13 states increased excise taxes on cigarettes, and five states increased excise taxes on smokeless tobacco products. The average state excise tax on cigarettes is 38.9 cents per pack, an increase of 7.4 cents compared with the average tax in the 1995 report. State laws addressing tobacco control vary in relation to restrictiveness, enforcement and penalties, preemptions, and exceptions. The data summarizing state tobacco-control laws are available through CDC
Western states uranium resource survey
International Nuclear Information System (INIS)
Tinney, J.F.
1977-01-01
ERDA's National Uranium Resource Evaluation (NURE) program was established to provide a comprehensive description of uranium resources in the United States. To carry out this task, ERDA has contracted with various facilities, including universities, private companies, and state agencies, to undertake projects such as airborne radiometric surveys, geological and geochemical studies, and the development of advanced geophysical technology. LLL is one of four ERDA laboratories systematically studying uranium distribution in surface water, groundwater, and lake and stream sediments. We are specifically responsible for surveying seven western states. This past year we have designed and installed facilities for delayed-neutron counting and neutron-activation analysis, completed seven orientation surveys, and analyzed several thousand field samples. Full-scale reconnaissance surveys began last fall
Deformation quantization: Twenty years after
International Nuclear Information System (INIS)
Sternheimer, Daniel
1998-01-01
We first review the historical developments, both in physics and in mathematics, that preceded (and in some sense provided the background of) deformation quantization. Then we describe the birth of the latter theory and its evolution in the past twenty years, insisting on the main conceptual developments and keeping here as much as possible on the physical side. For the physical part the accent is put on its relations to, and relevance for, 'conventional' physics. For the mathematical part we concentrate on the questions of existence and equivalence, including most recent developments for general Poisson manifolds; we touch also noncommutative geometry and index theorems, and relations with group theory, including quantum groups. An extensive (though very incomplete) bibliography is appended and includes background mathematical literature
Changing conditions on wilderness campsites: Seven case studies of trends over 13 to 32 years
David N. Cole
2013-01-01
This report brings together seven case studies of trends in the number and condition of wilderness campsites over periods ranging from 13 to 32 years. Case examples come from five mountainous wilderness areas in the western United States: Sequoia-Kings Canyon Wilderness in California, the Eagle Cap Wilderness in Oregon, the Frank Church-River of No Return Wilderness in...
Enacting open disclosure in the UK National Health Service: A qualitative exploration.
Harrison, Reema; Birks, Yvonne; Bosanquet, Kate; Iedema, Rick
2017-08-01
Open and honest discussion between healthcare providers and patients and families affected by error is considered to be a central feature of high quality and safer patient care, evidenced by the implementation of open disclosure policies and guidance internationally. This paper discusses the perceived enablers that UK doctors and nurses report as facilitating the enactment of open disclosure. Semistructured interviews with 13 doctors and 22 nurses from a range of levels and specialities from 5 national health service hospitals and primary care trusts in the UK were conducted and analysed using a framework approach. Five themes were identified which appear to capture the factors that are critical in supporting open disclosure: open disclosure as a moral and professional duty, positive past experiences, perceptions of reduced litigation, role models and guidance, and clarity. Greater openness in relation to adverse events requires health professionals to recognise candour as a professional and moral duty, exemplified in the behaviour of senior clinicians and that seems more likely to occur in a nonpunitive, learning environment. Recognising incident disclosure as part of ongoing respectful and open communication with patients throughout their care is critical. © 2017 The Authors Journal of Evaluation in Clinical Practice Published by John Wiley & Sons Ltd.
International Nuclear Information System (INIS)
Falzetti, L.; Meneghello, S.; Pezzilli, M.
1979-01-01
Two sets of experiments have been performed in sodium with two seven pin electrically heated bundles: the first with a nominal arrangement, the second with one dummy pin enlarged 20% in diameter in peripheral position. In this paper a rapid review of experimental results and theoretical works, related to the temperature distribution in these geometries, is presented together with a short description of the developed test section technology
The value of group purchasing organizations in the United States.
Rooney, Curtis
2011-01-01
This article examines the valuable role of group purchasing organizations (GPOs) in hospital purchasing in the United States. For over 100 years old GPOs have helped hospitals and other health care providers realize savings and create contracting efficiencies by aggregating purchasing volume to negotiate discounts with manufacturers, distributors and other vendors. The US has recently enacted a series of healthcare reforms to correct some of the historical concerns regarding cost, quality and access. GPOs are expected to continue to play a critical role in the business of hospital purchasing and may potential export that other countries may wish to examine.
Irrigation quality of ground water of twenty villages in Lahore district
Directory of Open Access Journals (Sweden)
M.S. Ali
2009-05-01
Full Text Available study was conducted in twenty villages of Lahore district to assess the suitability of ground water for irrigation. Three water samples were collected from each of twenty villages and were analyzed for electrical conductivity (EC, sodium adsorption ratio (SAR, residual sodium carbonate (RSC and chloride concentration. Out of total 60 water samples, 7 (11.7% were fit, 7 (11.7% were marginally fit, and remaining 46 (76.6% were unfit for irrigation. Twenty eight samples (46.6% had electrical conductivity higher than permissible limit (i.e. >1250 µS cm-1, 19 samples (31.6% were found with high SAR (i.e. >10 (m mol L-10. 5, 44 samples (73.3% had high RSC (i.e. >2.5 me L-1 and 10 samples (16.6% were found unfit for irrigation due to high concentration of chloride (i.e. >3.9 me L-1. It can be inferred from data that quality of available ground water in most ofthe villages is not suitable for sustainable crop production and soil health.
Glatard, T; Pennec, X
2006-01-01
Medical image registration is pre-processing needed for many medical image analysis procedures. A very large number of registration algorithms are available today, but their performance is often not known and very difficult to assess due to the lack of gold standard. The Bronze Standard algorithm is a very data and compute intensive statistical approach for quantifying registration algorithms accuracy. In this paper, we describe the Bronze Standard application and we discuss the need for grids to tackle such computations on medical image databases. We demonstrate MOTEUR, a service-based workflow engine optimized for dealing with data intensive applications. MOTEUR eases the enactment of the Bronze Standard and similar applications on the EGEE production grid infrastructure. It is a generic workflow engine, based on current standards and freely available, that can be used to instrument legacy application code at low cost.
2005-01-01
The fourth CERN Golden Hadron awards saw seven of the LHC's best suppliers receive recognition for the high quality of their work, compliance with delivery deadlines, flexibility and adaptability to the demanding working conditions of the project. The representatives of the seven companies which received awards during the Golden Hadron ceremony, standing with Lyn Evans, LHC Project Leader. 'The Golden Hadron awards are a symbol of our appreciation of not only the quality and timely delivery of components but also the collaborative and flexible way the firms have contributed to this very difficult project,' said Lyn Evans, head of the LHC project. The awards went to Kemppi-Kempower (Finland), Metso Powdermet (Finland), Transtechnik (Germany), Babcock Noell Nuclear (Germany), Iniziative Industriali (Italy), ZTS VVU Kosice (Slovakia), and Jehier (France). Babock Noell Nuclear (BNN) successfully produced one-third (416 cold dipole masses) of the LHC's superconducting dipole magnets, one of the most critical an...
Climate change law and politics in the United States
International Nuclear Information System (INIS)
Gerrard, Michael B.
2014-01-01
The United States has an extensive system of environmental law. Congress has passed numerous environmental statutes, but no major ones since 1990. While there was a general consensus on the need for environmental regulation during the 1970s and 1980s, it has broken down and the issue has become the subject of bitter partisan division. One consequence is that the U.S. has no comprehensive statute on climate change, and none appears imminent. A sweeping climate change bill passed the House of Representatives in 2009 but died in the Senate in 2010, and the political situation is such that it now appears that it will be at least several years before Congress enacts any serious climate change legislation. Meanwhile, the federal government is utilizing old statutes, especially the Clean Air Act of 1970, to cobble together a regulatory program. States and regional groupings of states, as well as cities, are also playing important roles in formulating climate change strategies.
Climate change law and politics in the United States
Energy Technology Data Exchange (ETDEWEB)
Gerrard, Michael B. [Columbia Law School New York, NY (United States). Center for Climate Change Law
2014-07-01
The United States has an extensive system of environmental law. Congress has passed numerous environmental statutes, but no major ones since 1990. While there was a general consensus on the need for environmental regulation during the 1970s and 1980s, it has broken down and the issue has become the subject of bitter partisan division. One consequence is that the U.S. has no comprehensive statute on climate change, and none appears imminent. A sweeping climate change bill passed the House of Representatives in 2009 but died in the Senate in 2010, and the political situation is such that it now appears that it will be at least several years before Congress enacts any serious climate change legislation. Meanwhile, the federal government is utilizing old statutes, especially the Clean Air Act of 1970, to cobble together a regulatory program. States and regional groupings of states, as well as cities, are also playing important roles in formulating climate change strategies.
Community-level policy responses to state marijuana legalization in Washington State.
Dilley, Julia A; Hitchcock, Laura; McGroder, Nancy; Greto, Lindsey A; Richardson, Susan M
2017-04-01
Washington State (WA) legalized a recreational marijuana market - including growing, processing and retail sales - through voter initiative 502 in November 2012. Legalized recreational marijuana retail sales began in July 2014. In response to state legalization of recreational marijuana, some cities and counties within the state have passed local ordinances that either further regulated marijuana markets, or banned them completely. The purpose of this study is to describe local-level marijuana regulations on recreational retail sales within the context of a state that had legalized a recreational marijuana market. Marijuana-related ordinances were collected from all 142 cities in the state with more than 3000 residents and from all 39 counties. Policies that were in place as of June 30, 2016 - two years after the state's recreational market opening - to regulate recreational marijuana retail sales within communities were systematically coded. A total of 125 cities and 30 counties had passed local ordinances to address recreational marijuana retail sales. Multiple communities implemented retail market bans, including some temporary bans (moratoria) while studying whether to pursue other policy options. As of June 30, 2016, 30% of the state population lived in places that had temporarily or permanently banned retail sales. Communities most frequently enacted zoning policies explicitly regulating where marijuana businesses could be established. Other policies included in ordinances placed limits on business hours and distance requirements (buffers) between marijuana businesses and youth-related land use types or other sensitive areas. State legalization does not necessarily result in uniform community environments that regulate recreational marijuana markets. Local ordinances vary among communities within Washington following statewide legalization. Further study is needed to describe how such local policies affect variation in public health and social outcomes
Latvian Security and Defense Policy within the Twenty-First Century Security Environment
Directory of Open Access Journals (Sweden)
Rublovskis Raimonds
2014-12-01
Full Text Available The aim of this paper is to analyze fundamental factors which form and profoundly shape security and defense policy of the Republic of Latvia. One can argue that historical background, geographical location, common institutional history within the former Soviet Union, the Russia factor, the relative smallness of the territory of state and the population, the ethnic composition of the population, the low density of the population and rather limited financial and manpower resources available for the defense of the Republic of Latvia are the key factors of influence on the state security and defense policy. The core principles of the security and defense policy of Latvia are the membership in powerful global military alliance of NATO and bilateral strategic partnership with the United States. However, security and defense cooperation among the three Baltic States as well as enhanced cooperation within the Baltic-Nordic framework is seen as an important supplementary factor for the increased security of the Republic of Latvia. Latvia has developed a sustainable legal and institutional framework in order to contribute to state security and defense; however, security challenges and significant changes within the global security environment of the twenty-first century will further challenge the ability of the Republic of Latvia to sustain its current legal framework, and more importantly, current institutional structure of Latvian security and defense architecture. Significant internal and external challenges will impact the fundamental pillars of Latvian security and defense policy, such as American strategic shift to the Pacific, and lack of political will to increase defense budgets in European part of NATO. It has to be clear that very independence, security and defense of the Republic of Latvia depend on the ability of NATO to remain an effective organization with timely and efficient decision-making, and the ability of the United States to remain
Enacting Pedagogy in Curricula: On the Vital Role of Governance in Medical Education.
Casiro, Oscar; Regehr, Glenn
2018-02-01
Managing curricula and curricular change involves both a complex set of decisions and effective enactment of those decisions. The means by which decisions are made, implemented, and monitored constitute the governance of a program. Thus, effective academic governance is critical to effective curriculum delivery. Medical educators and medical education researchers have been invested heavily in issues of educational content, pedagogy, and design. However, relatively little consideration has been paid to the governance processes that ensure fidelity of implementation and ongoing refinements that will bring curricular practices increasingly in line with the pedagogical intent. In this article, the authors reflect on the importance of governance in medical schools and argue that, in an age of rapid advances in knowledge and medical practices, educational renewal will be inhibited if discussions of content and pedagogy are not complemented by consideration of a governance framework capable of enabling change. They explore the unique properties of medical curricula that complicate academic governance, review the definition and properties of good governance, offer mechanisms to evaluate the extent to which governance is operating effectively within a medical program, and put forward a potential research agenda for increasing the collective understanding of effective governance in medical education.
Whitehead, Jim; De Bra, Paul; Grønbæk, Kaj; Larsen, Deena; Legget, John; schraefel, monica m.c.
2002-01-01
It has been 15 years since the original presentation by Frank Halasz at Hypertext'87 on seven issues for the next generation of hypertext systems. These issues are: Search and Query Composites Virtual Structures Computation in/over hypertext network Versioning Collaborative Work Extensibility and Tailorability Since that time, these issues have formed the nucleus of multiple research agendas within the Hypertext community. Befitting this direction-setting role, the issues have been revisited ...
Twenty years of diffraction at the Tevatron
International Nuclear Information System (INIS)
Goulianos, K.; Rockefeller U.
2005-01-01
Results on diffractive particle interactions from the Fermilab Tevatron (bar p)p collider are placed in perspective through a QCD inspired phenomenological approach, which exploits scaling and factorization properties observed in data. The results discussed are those obtained by the CDF Collaboration from a comprehensive set of single, double, and multigap soft and hard diffraction processes studied during the twenty year period since 1985, when the CDF diffractive program was proposed and the first Blois Workshop was held
Directory of Open Access Journals (Sweden)
Adam Burtle
2016-06-01
Full Text Available Over the last two decades, numerous studies have suggested that dedicated time for parents to be with their children in the earliest months of life offers significant benefits to child health. The United States (US is the only wealthy nation without a formalized policy guaranteeing workers paid time off when they become new parents. As individual US states consider enacting parental leave policies, there is a significant opportunity to decrease health inequities and build a healthier American population. This document is intended as a critical review of the present evidence for the association between paid parental leave and population health.