Non-infected penile prosthesis cultures during revision surgery; comparison between antibiotic coated and non - coated devices

Directory of Open Access Journals (Sweden)

Seyfettin Ciftci

Full Text Available ABSTRACT Introduction: Aim of this study is to investigate bacterial growth on non-infected devices and compare antibiotic-coated and non-coated implants. Materials and methods: The charts of 71 patients who underwent revision surgeries for penile prosthesis between 1995 and 2013 were reviewed. Of those, 31 devices were antibiotic-coated prostheses, while 40 of the implants were non-coated. Swab cultures were routinely obtained from corporal, pump or reservoir site during the operation. If a bacterial biofilm was determined on the prosthesis, it was also cultured. Results: A total of 5 different organisms were cultured from 18 patients. Of them, 4 devices were antibiotic-coated and the other 14 were non-coated devices. Staphylococcus epidermidis was the most common organism, while Staphylococcus hominis, beta hemolitic streptococcus, Escherichia coli and Proteus mirabilis were also cultured. All patients who had positive cultures were treated with appropriate antibiotics for four weeks postoperatively. Median follow-up time was 41 months, ranging between 8 and 82 months. One prosthesis (non-coated became clinically infected in the follow-up period with a totally different organism. Culture positivity rates of antibiotic-coated and non-coated devices were 13% and 35% respectively and the result was significant (p=0.00254. Conclusions: Positive bacterial cultures are present on non-infected penile prostheses at revision surgeries in some of the patients. Antibiotic coated prostheses have much less positive cultures than non-coated devices.

Characterization of Plasmodium vivax transmission-blocking activity in low to moderate malaria transmission settings of the Colombian Pacific coast.

Science.gov (United States)

Arévalo-Herrera, Myriam; Solarte, Yezid; Rocha, Leonardo; Alvarez, Diego; Beier, John C; Herrera, Sócrates

2011-02-01

Malaria infection induces antibodies capable of suppressing the infectivity of gametocytes and gametes, however, little is known about the duration of the antibody response, the parasite specificity, and the role of complement. We report the analyses of the transmission-blocking (TB) activity of sera collected from 105 Plasmodium vivax-infected and 44 non-infected individuals from a malaria endemic region of Colombia, using a membrane feeding assay in Anopheles albimanus mosquitoes. In infected donors we found that TB activity was antibody dose dependent (35%), lasted for 2-4 months after infection, and in 70% of the cases different P. vivax wild isolates displayed differential susceptibility to blocking antibodies. Additionally, in a number of assays TB was complement-dependent. Twenty-seven percent of non-infected individuals presented TB activity that correlated with antibody titers. Studies here provide preliminary data on factors of great importance for further work on the development of TB vaccines.

Comparison of immediate implant placement in infected and non-infected extraction sockets: a systematic review and meta-analysis.

Science.gov (United States)

Lee, Jungwon; Park, Dueun; Koo, Ki-Tae; Seol, Yang-Jo; Lee, Yong-Moo

2018-04-03

This review aimed to investigate the feasibility of immediate implant placement in infected extraction sockets. We performed electronic and manual searches up to March 2017 to obtain data from randomized controlled trials (RCTs) and nonrandomized controlled clinical trials (CCTs). Using a fixed-effects model to assess the difference in survival rate (primary outcome), we evaluated the risk difference for immediate implant placement in infected and non-infected sites. We estimated the weighted mean differences (WMDs) of the change in marginal bone loss (MBL), probing depth (PD), modified bleeding index (mBI), marginal gingival level (MGL) and width of keratinized gingiva (WKG) at baseline and latest follow-up. In total, five studies (0 RCT, five CCTs) were included in the systematic review and three studies were included in the meta-analysis. The risk difference for immediate implant placement in an infected extraction socket compared with that in a non-infected socket was -0.02. WMDs for MBL, PD, mBI, MGL and WKG between the two groups were 0.32, 0.12, 0.07, -0.06, 0.20 and 0.51, respectively. No statistical differences were observed between the two groups, except for the change in WKG. Implants can be placed in infected extraction sockets after thorough socket debridement. For aesthetics, WKG should be considered when performing immediate implant placement in infected sites.

Heifers infected with coagulase-negative staphylococci in early lactation have fewer cases of clinical mastitis and higher milk production in their first lactation than noninfected heifers.

Science.gov (United States)

Piepers, S; Opsomer, G; Barkema, H W; de Kruif, A; De Vliegher, S

2010-05-01

Intramammary infections (IMI) in recently calved dairy heifers are more common than was formerly believed but their relevance for future performance has been studied only rarely. In the present study, the association between the IMI status of fresh heifers and their subsequent udder health, milk production, and culling in first lactation was explored. Quarter milk samples were collected between 1 and 4 d in milk (DIM) and between 5 and 8 DIM from 191 dairy heifers in 20 dairy herds for bacteriological culturing and somatic cell count (SCC) analysis. Monthly milk recording data including composite milk SCC and test-day milk yield (MY) were obtained for the first 285 DIM or until culling. Farmer-recorded clinical mastitis cases were available. Data were analyzed using mixed models and survival analysis. Approximately 80% of the fresh heifers (79.8%) had at least one culture-positive quarter. Coagulase-negative staphylococci (CNS) were the most frequently isolated pathogens (72%), followed by esculin-positive streptococci (4.6%) and Staphylococcus aureus (3.5%). Overall geometric mean SCC at quarter level decreased between the first and second samplings from 348,000 to 116,000 cells/mL. Heifers infected with CNS had an intermediate average test-day SCC (84,000 cells/mL) during the first 285 DIM compared with noninfected heifers (53,000 cells/mL) and heifers infected with major pathogens (195,000 cells/mL). Heifers infected with major pathogens had a much lower average daily MY (18.3kg) during first lactation compared with noninfected animals (21.3kg). That CNS-infected heifers out-produced their noninfected counterparts could be at least partially explained by their significantly lower incidence of clinical mastitis (incidence risk 3.6 vs. 21.0%) during first lactation compared with noninfected heifers. We conclude that although CNS cause the majority of IMI in heifers around calving, they should not be a reason for serious concern. Copyright 2010 American Dairy

Parieto-occipital encephalomalacia in children; clinical and electrophysiological features of twenty-seven cases.

Science.gov (United States)

Karaoğlu, Pakize; Polat, Ayşe İpek; Yiş, Uluç; Hız, Semra

2015-01-01

Brain injuries occurring at a particular time may cause damages in well-defined regions of brain. Perinatal hypoxic ischemic encephalopathy and hypoglycemia are some of the most common types of brain injuries. Neonatal hypoglycemia can cause abnormal myelination in parietal and occipital lobes resulting in parieto-occipital encephalomalacia. There is a small number of studies about clinical and electroencephalographic (EEG) features of children with parieto-occipital encephalomalacia. They might have important neurologic sequelae such as cortical visual loss, seizures, and psychomotor retardation. We aimed to evaluate the causes of parieto-occipital encephalomalacia and evaluate the clinical and electrophysiological features of children with parieto-occipital encephalomalacia. We evaluated clinical features and EEGs of 27 children with parieto-occipital encephalomalacia. Descriptive statistics were used. Hospitalization during the neonatal period was the most common cause (88.9%) of parieto-occipital brain injury. Eleven patients (40.7%) had a history of neonatal hypoglycemia. Twenty-three patients (85.2%) had epilepsy and nine of the epileptic patients (39%) had refractory seizures. Most of the patients had bilateral (50%) epileptic discharges originating from temporal, parietal, and occipital lobes (56.2%). However, some patients had frontal sharp waves and some had continuous spike and wave discharges during sleep. Visual abnormalities were evident in 15 (55.6%) patients. Twenty-two (81.5%) had psychomotor retardation. Fine motor skills, social contact and language development were impaired more than gross motor skills. In our study, most of the patients with parieto-occipital encephalomalacia had an eventful perinatal history. Epilepsy, psychomotor retardation, and visual problems were common neurologic complications.

Microarray-based analysis of differential gene expression between infective and noninfective larvae of Strongyloides stercoralis.

Directory of Open Access Journals (Sweden)

Roshan Ramanathan

2011-05-01

Full Text Available Differences between noninfective first-stage (L1 and infective third-stage (L3i larvae of parasitic nematode Strongyloides stercoralis at the molecular level are relatively uncharacterized. DNA microarrays were developed and utilized for this purpose.Oligonucleotide hybridization probes for the array were designed to bind 3,571 putative mRNA transcripts predicted by analysis of 11,335 expressed sequence tags (ESTs obtained as part of the Nematode EST project. RNA obtained from S. stercoralis L3i and L1 was co-hybridized to each array after labeling the individual samples with different fluorescent tags. Bioinformatic predictions of gene function were developed using a novel cDNA Annotation System software. We identified 935 differentially expressed genes (469 L3i-biased; 466 L1-biased having two-fold expression differences or greater and microarray signals with a p value<0.01. Based on a functional analysis, L1 larvae have a larger number of genes putatively involved in transcription (p = 0.004, and L3i larvae have biased expression of putative heat shock proteins (such as hsp-90. Genes with products known to be immunoreactive in S. stercoralis-infected humans (such as SsIR and NIE had L3i biased expression. Abundantly expressed L3i contigs of interest included S. stercoralis orthologs of cytochrome oxidase ucr 2.1 and hsp-90, which may be potential chemotherapeutic targets. The S. stercoralis ortholog of fatty acid and retinol binding protein-1, successfully used in a vaccine against Ancylostoma ceylanicum, was identified among the 25 most highly expressed L3i genes. The sperm-containing glycoprotein domain, utilized in a vaccine against the nematode Cooperia punctata, was exclusively found in L3i biased genes and may be a valuable S. stercoralis target of interest.A new DNA microarray tool for the examination of S. stercoralis biology has been developed and provides new and valuable insights regarding differences between infective and

RNA-seq de novo Assembly Reveals Differential Gene Expression in Glossina palpalis gambiensis Infected with Trypanosoma brucei gambiense vs. Non-Infected and Self-Cured Flies.

Science.gov (United States)

Hamidou Soumana, Illiassou; Klopp, Christophe; Ravel, Sophie; Nabihoudine, Ibouniyamine; Tchicaya, Bernadette; Parrinello, Hugues; Abate, Luc; Rialle, Stéphanie; Geiger, Anne

2015-01-01

Trypanosoma brucei gambiense (Tbg), causing the sleeping sickness chronic form, completes its developmental cycle within the tsetse fly vector Glossina palpalis gambiensis (Gpg) before its transmission to humans. Within the framework of an anti-vector disease control strategy, a global gene expression profiling of trypanosome infected (susceptible), non-infected, and self-cured (refractory) tsetse flies was performed, on their midguts, to determine differential genes expression resulting from in vivo trypanosomes, tsetse flies (and their microbiome) interactions. An RNAseq de novo assembly was achieved. The assembled transcripts were mapped to reference sequences for functional annotation. Twenty-four percent of the 16,936 contigs could not be annotated, possibly representing untranslated mRNA regions, or Gpg- or Tbg-specific ORFs. The remaining contigs were classified into 65 functional groups. Only a few transposable elements were present in the Gpg midgut transcriptome, which may represent active transpositions and play regulatory roles. One thousand three hundred and seventy three genes differentially expressed (DEGs) between stimulated and non-stimulated flies were identified at day-3 post-feeding; 52 and 1025 between infected and self-cured flies at 10 and 20 days post-feeding, respectively. The possible roles of several DEGs regarding fly susceptibility and refractoriness are discussed. The results provide new means to decipher fly infection mechanisms, crucial to develop anti-vector control strategies.

Fiber mediated receptor masking in non-infected bystander cells restricts adenovirus cell killing effect but promotes adenovirus host co-existence.

Directory of Open Access Journals (Sweden)

Johan Rebetz

Full Text Available The basic concept of conditionally replicating adenoviruses (CRAD as oncolytic agents is that progenies generated from each round of infection will disperse, infect and kill new cancer cells. However, CRAD has only inhibited, but not eradicated tumor growth in xenograft tumor therapy, and CRAD therapy has had only marginal clinical benefit to cancer patients. Here, we found that CRAD propagation and cancer cell survival co-existed for long periods of time when infection was initiated at low multiplicity of infection (MOI, and cancer cell killing was inefficient and slow compared to the assumed cell killing effect upon infection at high MOI. Excessive production of fiber molecules from initial CRAD infection of only 1 to 2% cancer cells and their release prior to the viral particle itself caused a tropism-specific receptor masking in both infected and non-infected bystander cells. Consequently, the non-infected bystander cells were inefficiently bound and infected by CRAD progenies. Further, fiber overproduction with concomitant restriction of adenovirus spread was observed in xenograft cancer therapy models. Besides the CAR-binding Ad4, Ad5, and Ad37, infection with CD46-binding Ad35 and Ad11 also caused receptor masking. Fiber overproduction and its resulting receptor masking thus play a key role in limiting CRAD functionality, but potentially promote adenovirus and host cell co-existence. These findings also give important clues for understanding mechanisms underlying the natural infection course of various adenoviruses.

HIV-infected mental health patients: characteristics and comparison with HIV-infected patients from the general population and non-infected mental health patients

Directory of Open Access Journals (Sweden)

Schadé Annemiek

2013-01-01

Full Text Available Abstract Objectives HIV-infected patients are at increased risk of developing mental health symptoms, which negatively influence the treatment of the HIV-infection. Mental health problems in HIV-infected patients may affect public health. Psychopathology, including depression and substance abuse, can increase hazardous sexual behaviour and, with it, the chance of spreading HIV. Therefore, it is important to develop an optimal treatment plan for HIV-infected patients with mental health problems. The majority of HIV-infected patients in the Netherlands (almost 60% are homosexual men. The main objectives of this study were to describe the clinical and demographic characteristics of patients with HIV who seek treatment for their mental health symptoms in the Netherlands. Secondly, we tested whether HIV infected and non-infected homosexual patients with a lifetime depressive disorder differed on several mental health symptoms. Methods We compared a cohort of 196 patients who visited the outpatient clinic for HIV and Mental Health with HIV-infected patients in the general population in Amsterdam (ATHENA-study and with non-HIV infected mental health patients (NESDA-study. DSM-IV diagnoses were determined, and several self-report questionnaires were used to assess mental health symptoms. Results Depressive disorders were the most commonly occurring diagnoses in the cohort and frequent drug use was common. HIV-infected homosexual men with a depressive disorder showed no difference in depressive symptoms or sleep disturbance, compared with non-infected depressive men. However, HIV-positive patients did express more symptoms like fear, anger and guilt. Although they showed significantly more suicidal ideation, suicide attempts were not more prevalent among HIV-infected patients. Finally, the HIV-infected depressive patients displayed a considerably higher level of drug use than the HIV-negative group. Conclusion Habitual drug use is a risk factor for

Proceedings of the Twenty-Eighth General Assembly Beijing 2012

Science.gov (United States)

Montmerle, Thierry

2015-09-01

Preface; 1. Inaugural ceremony; 2. Twenty-eighth General Assembly business sessions; 3. Closing ceremony; 4. Resolutions; 5. Report of Executive Committee, 2009-2012; 6. Reports on Division, Commission, and Working Group meetings; 7. Statutes, bye-laws, and working rules; 8. New members admitted at the General Assembly; 9. Divisions and their Commissions.

Circulating levels of 3-hydroxymyristate, a direct quantification of endotoxemia in non-infected cirrhotic patients.

Science.gov (United States)

Weil, Delphine; Pais de Barros, Jean-Paul; Mourey, Guillaume; Laheurte, Caroline; Cypriani, Benoit; Badet, Nicolas; Delabrousse, Eric; Grandclément, Emilie; Di Martino, Vincent; Saas, Philippe; Lagrost, Laurent; Thévenot, Thierry

2018-06-22

The quantification of lipopolysaccharide (LPS) in biological fluids is challenging. We aimed to measure plasma LPS concentration using a new method of direct quantification of 3-hydroxymyristate (3-HM), a lipid component of LPS, and to evaluate correlations between 3-HM and markers of liver function, endothelial activation, portal hypertension and enterocyte damage. Plasma from 90 non-infected cirrhotic patients (30 Child-Pugh [CP]-A, 30 CP-B, 30 CP-C) was prospectively collected. The concentration of 3-HM was determined by High Performance Liquid Chromatography coupled with Mass Spectrometry. 3-HM levels were higher in CP-C patients (CP-A/CP-B/CP-C: 68/70/103 ng/mL, p=0.005). Patients with severe acute alcoholic hepatitis (n=16; 113 vs 74 ng/mL,p=0.012), diabetic patients (n=22; 99 vs 70 ng/mL, p=0.028) and those not receiving beta-blockers (n=44; 98 vs 72 ng/mL, p=0.034) had higher levels of 3-HM. We observed a trend towards higher baseline levels of 3-HM in patients with hepatic encephalopathy (n=7; 144 vs 76 ng/mL, p=0.45) or SIRS (n=10; 106 vs 75 ng/mL, p=0.114). In multivariate analysis, high levels of 3-HM were associated with CP (OR=4.39; 95%CI=1.79-10.76) or MELD (OR=8.24; 95%CI=3.19-21.32) scores. Patients dying from liver insufficiency (n=6) during a 12-month follow-up had higher baseline levels of 3-HM (106 vs 75 ng/mL, p=0.089). In non-infected cirrhotic patients, 3-HM arises more frequently with impairment of liver function, heavy alcohol consumption, diabetic status, non-use of beta-blockers, and a trend towards poorer outcome is also observed. The direct mass-measurement of LPS using 3-HM appears reliable to detect transient endotoxemia and promising to manage the follow-up of cirrhotic patients. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

A twenty-seven kilometre film

CERN Multimedia

2009-01-01

For the past two weeks, Bram Conjaerts, a Belgian filmmaker, has been touring the CERN sites and surrounding countryside conducting research for his new documentary. The film will follow the entire 27 Km length of the LHC ring, but unlike most documentaries about the LHC, it will take place mostly above ground! Bram Conjaerts during his visit to CERN.While working towards his film degree in 2008, Bram Conjaerts won an award at the International Documentary Festival for his documentary "Henri and the Islands", an anthropological documentary about the smallest village in Belgium. In an unlikely change of subject matter he decided to use the prize money to make a film about the LHC. "With the money granted by the Flemish government, I wanted to create a documentary about something adventurous and something that I did not know about, " explains Conjaerts. "I started doing research about the LHC and CERN and I came across the fantasy of...

Diffusion-Weighted Magnetic Resonance Diagnosis of Local Recurrences of Prostate Cancer after Radical Prostatectomy: Preliminary Evaluation on Twenty-Seven Cases

Directory of Open Access Journals (Sweden)

Salvatore Francesco Carbone

2014-01-01

Full Text Available Objectives. To assess the diagnostic performance of diffusion-weighted MR imaging (DWI in patients affected by prostatic fossa (PF relapse after radical prostatectomy (RP for prostatic carcinoma (PC. Methods. Twenty-seven patients showing a nodular lesion in the PF at T2-weighted MR imaging after RP, with diagnosis of PC relapse established by biopsy or PSA determinations, were investigated by DWI. Two readers evaluated the DWI results in consensus and the apparent diffusion coefficient (ADC of the nodules, separately; a mean value was obtained (ADCm. Results. Relapses did not significantly differ in size in respect of postsurgical benign nodules. The DWI qualitative evaluation showed sensitivity, specificity, accuracy, ppv, and npv values, respectively, of 83.3%, 88.9%, 85.2%, 93.7%, and 72.7% (100%, 87.5%, 95.6%, 93.7%, and 100%, for nodules >6 mm. The intraclass correlation coefficient (ICC for ADC evaluation between the two readers was 0.852 (95% CI 0.661–0.935; P=0.0001. The ADCm values for relapses and benign nodules were, respectively, 0.98±0.21×10−3 mm2/sec and 1.24±0.32×10−3 mm2/sec (P=0.006. Sensitivity, specificity, accuracy, ppv and npv of ADCm were, respectively, 77.8%, 88.9%, 81.8%, 93.3%, and 66.7% (93.3%, 87.5%, 85.4%, 93.3%, and 87.5% for nodules >6 mm. Conclusions. Diffusion-weighted MR imaging is a promising tool in the management of a hyperintense nodule detected by T2-weighted sequences. This might have a relevant importance in contouring radiotherapy treatment volumes.

Molecular diversity among seven Solanum (eggplant and relatives ...

African Journals Online (AJOL)

Admin

2012-11-08

Nov 8, 2012 ... Seven Solanum species (eggplants) were investigated for molecular diversity. Besides its ... Eggplant comprises three closely related cultivated species .... generated with SSR data was submitted to 2-way Mantel test (Man-.

De novo transcriptome analysis of immune response on cobia (Rachycentron canadum) infected with Photobacterium damselae subsp. piscicida revealed inhibition of complement components and involvement of MyD88-independent pathway.

Science.gov (United States)

Tran, Hung Bao; Lee, Yen-Hung; Guo, Jiin-Ju; Cheng, Ta-Chih

2018-06-01

Cobia, Rachycentron canadum, one of the most important aquatic species in Taiwan, has suffered heavy losses from Photobacterium damselae subsp. piscicida, which is the causal agent of photobacteriosis. In this study, the transcriptomic profiles of livers and spleens from Pdp-infected and non-infected cobia were obtained for the first time by Illumina-based paired-end sequencing method with a focus on immune-related genes. In total, 164,882 high quality unigenes were obtained in four libraries. Following Pdp infection, 7302 differentially expressed unigenes from liver and 8600 differentially expressed unigenes from spleen were identified. Twenty-seven of the differently expressed genes were further validated by RT-qPCR (average correlation coefficient 0.839, p-value cobia. Copyright © 2018 Elsevier Ltd. All rights reserved.

Low CD4+ T-cell levels and B-cell apoptosis in vertically HIV-exposed noninfected children and adolescents.

Science.gov (United States)

Miyamoto, Maristela; Pessoa, Silvana D; Ono, Erika; Machado, Daisy M; Salomão, Reinaldo; Succi, Regina C de M; Pahwa, Savita; de Moraes-Pinto, Maria Isabel

2010-12-01

Lymphocyte subsets, activation markers and apoptosis were assessed in 20 HIV-exposed noninfected (ENI) children born to HIV-infected women who were or not exposed to antiretroviral (ARV) drugs during pregnancy and early infancy. ENI children and adolescents were aged 6-18 years and they were compared to 25 age-matched healthy non-HIV-exposed children and adolescents (Control). ENI individuals presented lower CD4(+) T cells/mm(3) than Control group (control: 1120.3 vs. ENI: 876.3; t-test, p = 0.030). ENI individuals had higher B-cell apoptosis than Control group (Control: 36.6%, ARV exposed: 82.3%, ARV nonexposed: 68.5%; Kruskal-Wallis, p ENI and in Control children and adolescents. Subtle long-term immune alterations might persist among ENI individuals, but the clinical consequences if any are unknown, and these children require continued monitoring.

Variation in calculated human exposure. Comparison of calculations with seven European human exposure models

NARCIS (Netherlands)

Swartjes F; ECO

2003-01-01

Twenty scenarios, differing with respect to land use, soil type and contaminant, formed the basis for calculating human exposure from soil contaminants with the use of models contributed by seven European countries (one model per country). Here, the human exposures to children and children

Demonstration of airborne transmission of Actinobacillus pleuropneumoniae serotype 2 between simulated pig units located at close range

DEFF Research Database (Denmark)

Kristensen, C.S.; Angen, Øystein; Andreasen, M.

2004-01-01

Airborne transmission of Actinobacillus pleuropneumoniae was studied as the percentage of air needed to establish airborne transmission from an infected pig unit into a neighbouring non-infected pig unit. The experiment was carried out in two containers constructed as pig units, placed 1 m apart...... and connected by pipes. By manipulating the air pressure in the two units, the amount of ventilation air transferred from the infected pigs (unit A) to the non-infected pigs (unit B) was controlled and measured. In three experiments, between 48 and 50 specific pathogen free-pigs were randomly assigned to each...... of the two units. In unit A, five pigs (experiment 1) or eight pigs (experiments 2 and 3) were inoculated with A. pleuropneumoniae serotype 2. In experiments 1 and 3, 10% of the air was transferred from unit A to B; in experiment 2, 70% of the air was transferred. In the non-infected unit (B), 36...

Pilot Study Comparing Closed Versus Open Tracheal Suctioning in Postoperative Neonates and Infants With Complex Congenital Heart Disease.

Science.gov (United States)

Tume, Lyvonne N; Baines, Paul B; Guerrero, Rafael; Hurley, Margaret A; Johnson, Robert; Kalantre, Atul; Ramaraj, Ram; Ritson, Paul C; Walsh, Laura; Arnold, Philip D

2017-07-01

To determine the hemodynamic effect of tracheal suction method in the first 36 hours after high-risk infant heart surgery on the PICU and to compare open and closed suctioning techniques. Pilot randomized crossover study. Single PICU in United Kingdom. Infants undergoing surgical palliation with Norwood Sano, modified Blalock-Taussig shunt, or pulmonary artery banding in the first 36 hours postoperatively. Infants were randomized to receive open or closed (in-line) tracheal suctioning either for their first or second study tracheal suction in the first 36 hours postoperatively. Twenty-four infants were enrolled over 18 months, 11 after modified Blalock-Taussig shunt, seven after Norwood Sano, and six after pulmonary artery banding. Thirteen patients received the open suction method first followed by the closed suction method second, and 11 patients received the closed suction method first followed by the open suction method second in the first 36 hours after their surgery. There were statistically significant larger changes in heart rate (p = 0.002), systolic blood pressure (p = 0.022), diastolic blood pressure (p = 0.009), mean blood pressure (p = 0.007), and arterial saturation (p = 0.040) using the open suction method, compared with closed suctioning, although none were clinically significant (defined as requiring any intervention). There were no clinically significant differences between closed and open tracheal suction methods; however, there were statistically significant greater changes in some hemodynamic variables with open tracheal suctioning, suggesting that closed technique may be safer in children with more precarious physiology.

Autonomy and Togetherness in Close Relationships: A Study of Seven Nations.

Science.gov (United States)

Buunk, Bram; Hupka, Ralph B.

The necessity of balancing the need for togetherness and the need for separateness in intimate relationships has been well documented in family research. To investigate cross national differences in the value placed on autonomy versus togetherness in close relationships, 2,079 college students from Hungary, Ireland, Mexico, the Netherlands, the…

New Korean Record of Twenty Eight Species of the Family Ichneumonidae (Hymenoptera

Directory of Open Access Journals (Sweden)

Choi, Jin-Kyung

2014-04-01

Full Text Available We report twenty eight ichneumonid species new to Korea. These species belong to seven subfamilies. Among them five subfamilies, Diacritinae Townes, 1965, Microleptinae Townes, 1958, Orthocentrinae F$\\ddot{o} $ 수식 이미지rster, 1869, Orthopelmatinae Schmiedeknecht, 1910, Phrudinae Townes and Townes, 1949, are newly introduced to Korean fauna. All specimens are based on the insect collection of animal systematic laboratory at the Yeungnam University Gyeongsan Campus. Photographs of habitus of newly recorded subfamilies, diagnosis of 28 species and host information are provided.

Nike Twins Seven Seven: Nigerian Batik Artist.

Science.gov (United States)

LaDuke, Betty

1987-01-01

Chronicles the personal and professional life of Nike Twins Seven Seven (born 1951), a Nigerian batik artist, and her husband, Twins Seven Seven, a musician-artist, both of whom have received international acclaim. (BJV)

RT-PCR for detection of all seven genotypes of Lyssavirus genus.

Science.gov (United States)

Vázquez-Morón, S; Avellón, A; Echevarría, J E

2006-08-01

The Lyssavirus genus includes seven species or genotypes named 1-7. Rabies genotypes correlate with geographical distribution and specific hosts. Co-circulation of different lyssaviruses, imported cases, and the presence of unknown viruses, such as Aravan, Khujand, Irkut and West Caucasian Bat Virus, make it necessary to use generic methods able to detect all lyssaviruses. Primer sequences were chosen from conserved regions in all genotypes in order to optimise a generic RT-PCR. Serial dilutions of 12 RNA extracts from all seven Lyssavirus genotypes were examined to compare the sensitivity of the RT-PCR standardised in this study with a published RT-PCR optimised for EBLV1 detection and capable of amplifying RNA from all seven lyssaviruses. All seven genotypes were detected by both RT-PCRs, however, the sensitivity was higher with the new version of the test. Twenty samples submitted for rabies diagnosis were tested by the new RT-PCR. Eight out of 20 samples from six dogs, one horse and one bat were found positive, in agreement with immunofluorescence results. Seven samples from terrestrial mammals were genotype 1 and one from a bat was genotype 5. In conclusion, this method can be used to complement immunofluorescence for the diagnosis of rabies, enabling the detection of unexpected lyssaviruses during rabies surveillance.

An Empirical Comparison of Seven Iterative and Evolutionary Function Optimization Heuristics

Science.gov (United States)

Baluja, Shumeet

1995-01-01

This report is a repository of the results obtained from a large scale empirical comparison of seven iterative and evolution-based optimization heuristics. Twenty-seven static optimization problems, spanning six sets of problem classes which are commonly explored in genetic algorithm literature, are examined. The problem sets include job-shop scheduling, traveling salesman, knapsack, binpacking, neural network weight optimization, and standard numerical optimization. The search spaces in these problems range from 2368 to 22040. The results indicate that using genetic algorithms for the optimization of static functions does not yield a benefit, in terms of the final answer obtained, over simpler optimization heuristics. Descriptions of the algorithms tested and the encodings of the problems are described in detail for reproducibility.

Closed central slip injuries--a missed diagnosis?

LENUS (Irish Health Repository)

Nugent, N

2011-09-01

The extensor apparatus of the finger is a complex structure and injury can lead to significant digital dysfunction. Closed central slip injuries may be missed or diagnosis delayed because of lack of an open wound and often no radiographic abnormality, and can result in boutonniere deformities if untreated. This study aimed to quantify the number of patients attending with closed central slip injuries and to ascertain if the initial diagnosis was correct. The number of patients presenting to us over a 6 month period was recorded. The original diagnosis, time to diagnosis of central slip injury and the presence\\/absence of a boutonniere deformity were recorded. Ten patients were included in the study. Seven (70%) injuries were due to sport. Eight (80%) had a delayed diagnosis of central slip injury. Six (60%) had previously presented to general practitioners or emergency departments. Seven (70%) had boutonniere deformities. Closed central slip injuries can be missed. Simple clinical tests can diagnose central slip disruption.

Home-Based Risk of Falling Assessment Test Using a Closed-Loop Balance Model.

Science.gov (United States)

Ayena, Johannes C; Zaibi, Helmi; Otis, Martin J-D; Menelas, Bob-Antoine J

2016-12-01

The aim of this study is to improve and facilitate the methods used to assess risk of falling at home among older people through the computation of a risk of falling in real time in daily activities. In order to increase a real time computation of the risk of falling, a closed-loop balance model is proposed and compared with One-Leg Standing Test (OLST). This balance model allows studying the postural response of a person having an unpredictable perturbation. Twenty-nine volunteers participated in this study for evaluating the effectiveness of the proposed system which includes seventeen elder participants: ten healthy elderly ( 68.4 ±5.5 years), seven Parkinson's disease (PD) subjects ( 66.28 ±8.9 years), and twelve healthy young adults ( 28.27 ±3.74 years). Our work suggests that there is a relationship between OLST score and the risk of falling based on center of pressure measurement with four low cost force sensors located inside an instrumented insole, which could be predicted using our suggested closed-loop balance model. For long term monitoring at home, this system could be included in a medical electronic record and could be useful as a diagnostic aid tool.

78 FR 39691 - Closed Captioning of Internet Protocol-Delivered Video Programming: Implementation of the Twenty...

Science.gov (United States)

2013-07-02

...'') support synchronization. 4. Specifically, we seek information on whether apparatus may cause closed... currently the only significant holders of OVS certifications or local OVS franchises. The Commission does...

76 FR 59963 - Closed Captioning of Internet Protocol-Delivered Video Programming: Implementation of the Twenty...

Science.gov (United States)

2011-09-28

... words, captions may identify speakers, sound effects, music, and laughter.\\23\\ \\19\\ See Closed... captioning increased somewhat, through the voluntary efforts of the video programming industry.\\26\\ As the...

Identification and characterization of twenty-seven short ...

Indian Academy of Sciences (India)

They have been successfully applied to resolve phylo- genetic relationships among various groups at different tax- onomic ranks (Nikaido et al. 2003; Chen et al. .... nizable flanking direct repeats (DRs) that are diagnostic of amplification via RNA intermediates during retrotransposi- tion (Weiner et al. 1986; Deininger 1989) ...

Seven Trends Driving U.S. Food Demands

OpenAIRE

Kinsey, Jean D.

1992-01-01

Seven trends have a great deal to say about how demand for food will evolve into the 21 st century. They relate to the slow growth in total food demand, diversity in foods, global homogenization of food consumption patterns, demand for convenience, public services related to food, relationships between food production and its distribution to the environment, and, better health. Paying close attention to these factors can help distinguish between fads that will soon be gone and more fundamenta...

Ferrets’ (Mustela putorius furo) enrichment priorities and preferences as determined in a seven-chamber consumer demand study

NARCIS (Netherlands)

Reijgwart, Marsinah Lusanne; Vinke, C.M.; Hendriksen, C.F.M.; Van Der Meer, Miriam; Schoemaker, N.J.; van Zeeland, Y.R.A.

Knowledge of species-specific motivation and preferences for enrichment options is necessary to put in place an appropriate enrichment plan. This knowledge is currently lacking for ferrets. Therefore, seven female ferrets were consecutively housed in a seven-chamber closed economy consumer demand

Neocortical electrical stimulation for epilepsy : Closed-loop versus open-loop

NARCIS (Netherlands)

Vassileva, Albena; van Blooijs, Dorien; Leijten, Frans; Huiskamp, Geertjan

2018-01-01

The aim of this review is to evaluate whether open-loop or closed-loop neocortical electrical stimulation should be the preferred approach to manage seizures in intractable epilepsy. Twenty cases of open-loop neocortical stimulation with an implanted device have been reported, in 5 case studies.

Capabilities of Seven Species of Aquatic Macrophytes for Phytoremediation of Pentachlorophenol Contaminated Sediment

Science.gov (United States)

Zhao, Liangyuan; Guo, Weijie; Li, Qingyun; Li, Huan; Zhao, Weihua; Cao, Xiaohuan

2017-01-01

Sediments are regarded as the ultimate sink of pentachlorophenol(PCP) in aquatic environment, and capabilities of seven species of aquatic macrophytes for remediating PCP contaminated sediment were investigated. Seven species of aquatic macrophytes could significantly accelerate the degradation of PCP in sediments. Among all, canna indica L., Acorus calamus L. and Iris tectorum Maxim. can be used as efficient alternative plants for remediation of PCP contaminated sediment, which attained 98%, 92% and 88% of PCP removal in sediments, respectively. PCP was detected only in root tissues and the uptake was closely related to the root lipid contents of seven plants. The presence of seven aquatic macrophytes significantly increased microbial populations and the activities of dehydrogenase compared with control sediments, indicating that rhizosphere microorganism played important role in the remediation process. In conclusion, seven species of aquatic macrophytes may act as promising tools for the PCP phytoremediation in aquatic environment, especially Canna indica L., Acorus calamus L. and Iris tectorum Maxim.

Outlook: The Next Twenty Years

Energy Technology Data Exchange (ETDEWEB)

Murayama, Hitoshi

2003-12-07

I present an outlook for the next twenty years in particle physics. I start with the big questions in our field, broken down into four categories: horizontal, vertical, heaven, and hell. Then I discuss how we attack the bigquestions in each category during the next twenty years. I argue for a synergy between many different approaches taken in our field.

Predisposition of cows to mastitis in non-infected mammary glands: effects of dietary-induced negative energy balance during mid-lactation on immune-related genes

DEFF Research Database (Denmark)

Moyes, Kasey; Drackley, James K; Morin, Dawn E

2011-01-01

Cows experiencing severe postpartal negative energy balance (NEB) are at greater risk of developing mastitis than cows in positive energy balance (PEB). Our objectives were to compare mammary tissue gene expression profiles between lactating cows (n = 5/treatment) subjected to feed restriction...... to induce NEB and cows fed ad libitum to maintain PEB in order to identify genes involved in immune response and cellular metabolism that may predispose cows to an intramammary infection in non-infected mammary gland. The NEB cows were feed-restricted to 60% of calculated net energy for lactation...... requirements, and cows fed PEB cows were fed the same diet ad libitum. At 5 days after feed restriction, one rear mammary gland from all cows was biopsied for RNA extraction and transcript profiling using microarray and quantitative PCR. Energy balance (NEB vs. PEB) resulted in 278 differentially expressed...

Timelike Killing spinors in seven dimensions

International Nuclear Information System (INIS)

Cariglia, Marco; Conamhna, Oisin A.P. Mac

2004-01-01

We employ the G-structure formalism to study supersymmetric solutions of minimal and SU(2) gauged supergravities in seven dimensions admitting Killing spinors with an associated timelike Killing vector. The most general such Killing spinor defines a SU(3) structure. We deduce necessary and sufficient conditions for the existence of a timelike Killing spinor on the bosonic fields of the theories, and find that such configurations generically preserve one out of 16 supersymmetries. Using our general supersymmetric ansatz we obtain numerous new solutions, including squashed or deformed anti-de Sitter solutions of the gauged theory, and a large class of Goedel-like solutions with closed timelike curves

Twenty Practices of an Entrepreneurial University

DEFF Research Database (Denmark)

Gjerding, Allan Næs; Wilderom, Celeste P.M.; Cameron, Shona P.B.

2006-01-01

studies twenty organisational practices against which a University's entrepreneurship can be measured. These twenty practices or factors in effect formed the basis for an entrepreneurship audit. During a series of interviews, the extent to which the universities are seen as entrepreneurial...

Long-term results after cardiac surgery in patients infected with the human immunodeficiency virus type-1 (HIV-1).

Science.gov (United States)

Mestres, Carlos A; Chuquiure, Javier E; Claramonte, Xavier; Muñoz, Josefa; Benito, Natividad; Castro, Miguel A; Pomar, José L; Miró, José M

2003-06-01

Assessment of long-term results of immunodeficiency virus type-1 (HIV-1)-infected patients undergoing cardiac surgery. Retrospective analysis of profile and outcomes of 31 HIV-1-infected patients (35 operations, 1985-2002). Twenty-seven males and four females (mean age 34.67) in three groups: acute infective endocarditis (AIE) 21 (67.74%), coronary (CAD) 5 (16.13%) and non-infective valvular disease (NIVD) 5 (16.13%). HIV factors: drug addiction (23-74.19%), homosexuality (5-16.12%), heterosexuality (3-9.67%), hemodialysis (1-3.22%). HIV stage: A (17), B (2), C (2) in AIE; A (2), B (3) in CAD and A (3), C (2) in NIVD. Mean preoperative CD4 count was 278 cells/microL (12infected patients requiring cardiac surgery, a decrease in AIE, however NIVD and CAD increasingly seen. Cardiac surgery did not blunt CD4 response induced by antiretrovirals. The late cause of death were not AIDS-related events.

Orthopaedic resident preparedness for closed reduction and pinning of pediatric supracondylar fractures is improved by e-learning: a multisite randomized controlled study.

Science.gov (United States)

Hearty, Thomas; Maizels, Max; Pring, Maya; Mazur, John; Liu, Raymond; Sarwark, John; Janicki, Joseph

2013-09-04

There is a need to provide more efficient surgical training methods for orthopaedic residents. E-learning could possibly increase resident surgical preparedness, confidence, and comfort for surgery. Using closed reduction and pinning of pediatric supracondylar humeral fractures as the index case, we hypothesized that e-learning could increase resident knowledge acquisition for case preparation in the operating room. An e-learning surgical training module was created on the Computer Enhanced Visual Learning platform. The module provides a detailed and focused road map of the procedure utilizing a multimedia format. A multisite prospective randomized controlled study design compared residents who used a textbook for case preparation (control group) with residents who used the same textbook plus completed the e-learning module (test group). All subjects completed a sixty-question test on the theory and methods of the case. After completion of the test, the control group then completed the module as well. All subjects were surveyed on their opinion regarding the effectiveness of the module after performing an actual surgical case. Twenty-eight subjects with no previous experience in this surgery were enrolled at four academic centers. Subjects were randomized into two equal groups. The test group scored significantly better (p < 0.001) and demonstrated competence on the test compared with the control group; the mean correct test score (and standard deviation) was 90.9% ± 6.8% for the test group and 73.5% ± 6.4% for the control group. All residents surveyed (n = 27) agreed that the module is a useful supplement to traditional methods for case preparation and twenty-two of twenty-seven residents agreed that it reduced their anxiety during the case and improved their attention to surgical detail. E-learning using the Computer Enhanced Visual Learning platform significantly improved preparedness, confidence, and comfort with percutaneous closed reduction and pinning of a

Immunomodulatory effects of pCramoll and rCramoll on peritoneal exudate cells (PECs) infected and non-infected with Staphylococcus aureus.

Science.gov (United States)

da Silva, Luís Cláudio Nascimento; Alves, Neyla Maria Pereira; de Castro, Maria Carolina Accioly Brelaz; Pereira, Valéria Rêgo Alves; da Paz, Nathalia Varejão Nogueira; Coelho, Luana Cassandra Breitenbach Barroso; de Figueiredo, Regina Célia Bressan Queiroz; Correia, Maria Tereza dos Santos

2015-01-01

Peritoneal exudate cells (PECs) play important roles in host defense against Staphylococcus aureus and other pathogens. In this study we evaluated the potentials of native (pCramoll or Cramoll 1,4) and recombinant (rCramoll) lectins from seeds of Cratylia mollis as immunomodulatory tools on mice PECs infected and non-infected with S. aureus. Both lectins significantly enhanced nitric oxide, superoxide and cytokines (IL-1β, IL-6, IFN-γ and TNF-α). pCramoll and rCramoll downregulated the induction of TNF-α and IL-6 and upregulated the expression of IL-1β, IFN-γ in S. aureus infected PECs. Phagocytic activity of S. aureus was also enhanced in 27.1% and 22.47% by pCramoll and rCramoll, respectively. Our results showed that pCramoll induced stronger effects than rCramoll, which could be explained by the different hemagglutinating activities of C. mollis isolectins and nature fragmentation, although the biologic meaning should be studied in detail using in vivo models. Future works will be focused on the molecular mechanisms involved in these actions, using in vitro and in vivo models, to support the use of these lectins as biotechnological tool in immunological studies.

Percutaneous gastrostomy -a report of twenty-seven cases-

International Nuclear Information System (INIS)

Kim, Tae Ho; Lee, Ho Suk; Kim, Yong Joo; Kim, Tae Hun; Suh, Kyung Jin; Kang, Duk Sik

1991-01-01

Nutritional support by gastrostomy feeding is an important treatment adjunct when major swallowing difficulty or debilitating diseases is present. This technique for percutaneous placement of a gastric feeding tube now provides many patients with a simple, safe, and well-tolerated alternative to surgical feeding gastrostomy. We experienced 27 cases of percutaneous gastrostomy from January 1989 to February 1991 at Kyungpook National University Hospital. The underlying diseases of the patients were esophageal cancer (11), pyriform sinus cancer (4), laryngeal cancer (3), tongue cancer (2), lye stricture (1), lung cancer (1), chordoma (1), lethal midline granuloma (1), malignant lymphoma (1), maxillary cancer (1), and tonsil cancer (1). Selding method was used in all cases. In five patients it was difficult to insert the nasogastric tube for air insufflation, and one patient had subtotal gastrectomy with gastrojejunostomy, but gastrostomy was performed in all cases. The general condition improved in all patients. We experienced one case of mild peritonitis, but no other significant complications were observed. Gastrostomy tubes were patient in all patients during their survival period, except two patients who experienced obstruction 2 and 6 months after the procedure. Percutaneous gastrostomy can be used safely and effectively in such patients who have pharyngoesophageal or CNS lesions precluding oral intake

Capital in the Twenty-First Century

DEFF Research Database (Denmark)

Hansen, Per H.

2014-01-01

Review essay on: Capital in the Twenty-First Century. By Thomas Piketty . Translated by Arthur Goldhammer . Cambridge, Mass.: The Belknap Press of Harvard University Press, 2014. viii + 685 pp......Review essay on: Capital in the Twenty-First Century. By Thomas Piketty . Translated by Arthur Goldhammer . Cambridge, Mass.: The Belknap Press of Harvard University Press, 2014. viii + 685 pp...

High-Intensity Focused Ultrasound for the Treatment of Wrinkles and Skin Laxity in Seven Different Facial Areas

OpenAIRE

Park, Hyunchul; Kim, Eunjin; Kim, Jeongeun; Ro, Youngsuck; Ko, Jooyeon

2015-01-01

Background High-intensity focused ultrasound (HIFU) treatment has recently emerged in response to the increasing demand for noninvasive procedures for skin lifting and tightening. Objective This study was aimed at evaluating the clinical efficacy of and patient satisfaction with HIFU treatment for wrinkles and laxity in seven different areas of the face in Asian skin. Methods Twenty Korean patients with facial wrinkle and laxity were analyzed after a single session of HIFU treatment. Two inde...

Injuries and noninfective health disorders of veterinarians

Directory of Open Access Journals (Sweden)

Vučinić Marijana

2011-01-01

Full Text Available In professional and scientific journals there are many published results on different prevalence, patterns and risk factors of animal-related injuries and occupational disorders among veterinarians. Veterinary medicine is hazardous. Veterinarians work under uncomfortable and unsafe conditions not only in animal housing units but also in their clinics, stations and surgeries with wet and slippery floors. They work closely with animals. Veterinarians are a high-risk group for significant injury from animal contacts. Veterinarians perform procedures that cause the animal pain, distress, and protective reactions of animals in different forms, such as biting, kicking, scratching or other trauma from the animals. They are exposed to different risk materials, equipment and many other risk factors such as radiation, oncogenic viruses, sharp instruments, anaesthetics gases, pesticides (insecticides, long working hours and occupational stressors. Veterinarians work with unknown animals, unknown people and demanding clients. Veterinarian are not only at increased risk of occupational diseases and injuries but also at increased risk of death from workrelated injuries, motor vehicle accidents, malignant diseases and suicide.

The FAA's postmortem forensic toxicology self-evaluated proficiency test program: the second seven years.

Science.gov (United States)

Chaturvedi, Arvind K; Craft, Kristi J; Cardona, Patrick S; Rogers, Paul B; Canfield, Dennis V

2009-05-01

During toxicological evaluations of samples from fatally injured pilots involved in civil aviation accidents, a high degree of quality control/quality assurance (QC/QA) is maintained. Under this philosophy, the Federal Aviation Administration (FAA) started a forensic toxicology proficiency-testing (PT) program in July 1991. In continuation of the first seven years of the PT findings reported earlier, PT findings of the next seven years are summarized herein. Twenty-eight survey samples (12 urine, 9 blood, and 7 tissue homogenate) with/without alcohols/volatiles, drugs, and/or putrefactive amine(s) were submitted to an average of 31 laboratories, of which an average of 25 participants returned their results. Analytes in survey samples were correctly identified and quantitated by a large number of participants, but some false positives of concern were reported. It is anticipated that the FAA's PT program will continue to serve the forensic toxicology community through this important part of the QC/QA for laboratory accreditations.

CLOSING MACULAR HOLES WITH "MACULAR PLUG" WITHOUT GAS TAMPONADE AND POSTOPERATIVE POSTURING.

Science.gov (United States)

Chakrabarti, Meena; Benjamin, Preethi; Chakrabarti, Keya; Chakrabarti, Arup

2017-03-01

To investigate the surgical results of macular hole surgery without gas tamponade or postoperative posturing in patients with Stage 3 and Stage 4 macular holes with ≥500 μm mean base diameter. Retrospective interventional case series. Twenty-six patients with Stage 3 and Stage 4 macular holes. Twenty-six eyes of 26 patients with Stage 3 and Stage 4 macular holes and a mean base diameter of 892.8 ± 349 μm underwent pars plana 23-gauge vitrectomy with broad internal limiting membrane peel (ILM peel), inverted ILM flap repositioning (ILMR), and use of autologous gluconated blood clumps as a macular plug to close the macular hole. No fluid-air exchange, endotamponade, or postoperative posturing was used. The subjects were followed up for 12 months. The anatomical outcome of the procedure was evaluated by fundus examination and optical coherence tomography. Spectral domain optical coherence tomography was used to study the restoration of the outer retinal layer integrity in the postoperative period. The preoperative and postoperative best-corrected visual acuities in logMAR units were compared to evaluate functional outcome. Macular hole closure and best-corrected visual acuity before and after surgery. Twenty-six patients with mean age 62.8 ± 7.3 years, preoperative median best-corrected visual acuity 6/60 (1.0 logMAR units), and a mean base diameter of 892.8 ± 349 μm underwent surgery to close macular holes without gas tamponade or postoperative posturing. Twenty patients (76.9%) were phakic. Twenty eyes (76.92%) had Stage 3 macular holes and 6 eyes (23.10%) had Stage 4 macular holes. After a single surgery, hole closure was achieved in 100% of eyes. The median best-corrected visual acuity improved from 6/60 (1.0 logMAR units) to 6/18 (0.50 logMAR units) (P hole closure with statically significant functional improvement for large Stage 3 and Stage 4 macular holes.

Space power technology for the twenty-first century (SPT21)

International Nuclear Information System (INIS)

Borger, W.U.; Massie, L.D.

1988-01-01

During the spring and summer months of 1987, the Aero Propulsion Laboratory of the Air Force Wright Aeronautical Laboratories, Wright-Patterson AFB, Ohio in cooperation with the Air Force Space Technology Center at Kirtland AFB, New Mexico, undertook an initiative to develop a Strategic Plan for Space Power Technology Development. The initiative was called SPT21, Space Power Technology for the Twenty-First Century. The planning process involved the participation of other Government organizations (U.S. Army, Navy, DOE and NASA) along with major aerospace companies and universities. Following an SPT21 kickoff meeting on 28 May 1987, detailed strategic planning was accomplished through seven (7) Space Power Technology Discipline Workshops commencing in June 1987 and concluding in August 1987. Technology Discipline Workshops were conducted in the following areas: (1) Solar Thermal Dynamic Power Systems (2) Solar Photovoltaic Cells and Arrays (3) Thermal Management Technology (4) Energy Storage Technology (5) Nuclear Power Systems Technology (6) Power Conditioning, Distribution and Control and (7) Systems Technology/Advanced Concepts. This technical paper summarizes the planning process and describes the salient findings and conclusions of the workshops

'Where of is mad al mankynde' : an edition of and introduction to the twenty-four poems in Oxford, Bodleian Library, MS Digby 102

NARCIS (Netherlands)

Verheij, Louis Johan Philip

2009-01-01

'Where of is Mad al Mankynde' represents a new critical edition of the collection of twenty-four late-medieval anonymous poems contained, among other pieces, in Oxford, Bodleian Library, MS Digby 102. Each poem is introduced with a brief summary and closes with line-for-line explanatory comments.

Cutaneous manifestations of non-Hodgkin's lymphoma.

Science.gov (United States)

Kumar, S S; Kuruvilla, M; Pai, G S; Dinesh, M

2003-01-01

Thirty-two confirmed cases of non -Hodgkin's lymphoma (NHL) were examined for cutaneous manifestations for a period of 2 years from November 1998 in KMC Hospital Attavar, Mangalore. Cutaneous manifestations in the study group were compared to a control group of 32 patients. Specific infiltrates were present in all (5/5) CTCL patients and one out of twenty-seven patients with low grade NHL. Morphologically they presented as papules, plaques, nodules and erythroderma. Infective conditions seen in the study group were superficial fungal (7/32) and viral infections (2/ 32). Non-infective conditions were acquired ichthyosis (10/32), generalised pruritus (5/32), insect bite reaction (1/32) and drug eruption (1/32). When compared to control patients only acquired ichthyosis and generalised pruritus were found to be statistically significant. The study group also showed changes due to chemotherapy like diffuse alopecia (24/29), bluish pigmentation of proximal part of nail (4/29), localised pigmentation of palms and soles (1 /29), diffuse pigmentation at injection site (1 /29), pigmentation at scar site (1 /29) and stomatitis (4/29).

The clinical characteristics of twenty-eight idiopathic pulmonary fibrosis cases

International Nuclear Information System (INIS)

Yu Yong; Shi Minhua; Hu Huacheng

2007-01-01

Objective: To summarize the clinical characteristics of idiopathic pulmonary fibrosis (IPF). Methods: The clinical characteristics of twenty-eight cases diagnosed as IPF between 1991 and 2006 were studied retrospectively. Results: Most IPF patients had an insidious onset of progressive dyspnea and non-productive cough. Inspiratory crackles and finger clubbing were also noted in most patients. The most impressive appearance of their radiography was peripheral reticular and nodular opacities, distributed largely at the lung bases. Pulmonary function test showed restrictive impairment and impaired oxygen diffusion. The arterial blood gas analysis revealed type I respiratory failure. One IPF case was complicated with lung cancer. The symptoms of fifteen cases(71.4%) were relieved under the therapy with glucocorticoid. Seven patients died as yet in our group and the middle duration was 24 months. Conclusions: The diagnosis of IPF relies mostly on the clinical characteristics, radiography, pulmonary function test, blood gas analysis and exclusion of other ILD. Atypical cases need lung biopsy to do further the diagnosis. Therapy with glucocorticoid may be effective in some cases. Prognosis in IPF cases complicated with lung cancer is poor. (authors)

Rhizobia symbiosis of seven leguminous species growing along Xindian riverbank of Northern Taiwan

Directory of Open Access Journals (Sweden)

Cheng-Tai Huang

2018-01-01

Full Text Available Legume-rhizobia symbioses of seven leguminous species growing along Xindian riverbank of Northern Taiwan were investigated in this study. These legumes form either determinate or indeterminate types of root nodules. The determinate nodules of Alysicarpus vaginalis, Desmodium. triflorum, D. heterophyllum, Sesbania cannabina and the indeterminate nodules of Mimosa pudica harbored bacteroids of morphological uniformity (length of 1-3 μm, while the indeterminate nodules of Crotalaria zanzibarica and Trifolium repens contained bacteroids of highly pleomorphism (size varying from 1 to 5 μm. The enclosed bacteria were isolated from respective nodules, and twenty slow-growing and nine fast-growing rhizobial isolates were recovered. The slow-growing isolates were classified to the genus Bradyrhizobium based on the 16S rRNA sequences, whereas the fast-growing rhizobia comprise four genera, Neorhizobium, Rhizobium, Cupriavidus and Paraburkholderia. Results of stable isotope analyses revealed that the seven leguminous species had similar and consistently negative δ15N values in leaves (mean of -1.2 ‰, whereas the values were positive (varying from 3.7 to 7.3 ‰ in the nodules. These values were significantly higher in the indeterminate nodules than those in the determinate ones. In addition, variations in the values of leaf δ13C (varying from -29 to -34‰ among the seven legumes were measured, indicating their photosynthetic water use efficiencies were different. This is the first field survey to report the rhizobial diversity and the nutrient relationships of sympatric legume in Taiwan.

Analysis of genetic diversity and differentiation of seven stocks of Litopenaeus vannamei using microsatellite markers

Science.gov (United States)

Zhang, Kai; Wang, Weiji; Li, Weiya; Zhang, Quanqi; Kong, Jie

2014-08-01

Seven microsatellite markers were used to evaluate the genetic diversity and differentiation of seven stocks of Litopenaeus vannamei, which were introduced from Central and South America to China. All seven microsatellite loci were polymorphic, with polymorphism information content ( PIC) values ranging from 0.593 to 0.952. Totally 92 alleles were identified, and the number of alleles ( Na) and effective alleles ( Ne) varied between 4 and 21 and 2.7 and 14.6, respectively. Observed heterozygosity ( H o) values were lower than the expected heterozygosity ( H e) values (0.526-0.754), which indicated that the seven stocks possessed a rich genetic diversity. Thirty-seven tests were detected for reasonable significant deviation from Hardy-Weinberg equilibrium. F is values were positive at five loci, suggesting that there was a relatively high degree of inbreeding within stocks. Pairwise F st values ranged from 0.0225 to 0.151, and most of the stock pairs were moderately differentiated. Genetic distance and cluster analysis using UPGMA revealed a close genetic relationship of L. vannamei between Pop2 and Pop3. AMOVA indicated that the genetic variation among stocks (11.3%) was much lower than that within stocks (88.7%). Although the seven stocks had a certain degree of genetic differentiation and a rich genetic diversity, there is an increasing risk of decreased performance due to inbreeding in subsequent generations.

Spontaneous Pneumothorax: A retrospective study of twenty-five patients and literature review

International Nuclear Information System (INIS)

Batouk, A.; Jastaniah, S.; Grillo, I.A.; Malatani, T.S.; Al-Saigh, A.H.; Al-Shehri, M.Y.; Softah, A.; Ali, K.A.M.; Teklu, B.

1996-01-01

We present a retrospective study of 25 patients with spontaneous pneumothorax (three recurrent) comprising 16 Saudis (nine males and seven females) and eight non-Saudi's (eight males and one female), seen at the Asir Central Hospital, Abha, over a period of 45 months. Almost one-third of patients (9/25) had no underlying cause discernible by our investigational facilities (chest x-ray, ultrasonography, computed tomographic scan and flexible bronchofiberscopy). Underlying pneumonia (three patients), pulmonary tuberculosis (two patients), lung abscess (one patient) and congenital bullae (one patient) constituted the etiology in another third of the spontaneous pneumothorax patients. Other underlying pulmonary diseases, precipitating spontaneous pneumothorax in the group included pulmonary fibrosis, metastatic mesothelioma and immunosuppression in a medulloblastoma patient undergoing chemotherapy with the development of chickenpox. Closed thoracostomy tube drainage was the only method of treatment in 20 out of 25 patients, with three failures of closed thoracostomy tube drainage needing thoractomy and resection of blebs/bullae. The only complication was empyema in two of the patients. Two patients were successfully treated conservatively with observation alone. (author)

Science policy up close

CERN Document Server

Marburger, John H

2015-01-01

In a career that included tenures as president of Stony Brook University, director of Brookhaven National Laboratory, and science advisor to President George W. Bush, John Marburger (1941 2011) found himself on the front line of battles that pulled science ever deeper into the political arena. From nuclear power to global warming and stem cell research, science controversies, he discovered, are never just about science. Science Policy Up Close" presents Marburger s reflections on the challenges science administrators face in the twenty-first century. In each phase of public service Marburger came into contact with a new dimension of science policy. The Shoreham Commission exposed him to the problem of handling a volatile public controversy over nuclear power. The Superconducting Super Collider episode gave him insights into the collision between government requirements and scientists expectations and feelings of entitlement. The Directorship of Brookhaven taught him how to talk to the public about the risks ...

The design and performance of a twenty barrel hydrogen pellet injector for Alcator C-Mod

International Nuclear Information System (INIS)

Urbahn, J.A.

1994-05-01

A twenty barrel hydrogen pellet injector has been designed, built and tested both in the laboratory and on the Alcator C-Mod Tokamak at MIT. The injector functions by firing pellets of frozen hydrogen or deuterium deep into the plasma discharge for the purpose of fueling the plasma, modifying the density profile and increasing the global energy confinement time. The design goals of the injector are: (1) Operational flexibility, (2) High reliability, (3) Remote operation with minimal maintenance. These requirements have lead to a single stage, pipe gun design with twenty barrels. Pellets are formed by in- situ condensation of the fuel gas, thus avoiding moving parts at cryogenic temperatures. The injector is the first to dispense with the need for cryogenic fluids and instead uses a closed cycle refrigerator to cool the thermal system components. The twenty barrels of the injector produce pellets of four different size groups and allow for a high degree of flexibility in fueling experiments. Operation of the injector is under PLC control allowing for remote operation, interlocked safety features and automated pellet manufacturing. The injector has been extrusively tested and shown to produce pellets reliably with velocities up to 1400 m/sec. During the period from September to November of 1993, the injector was successfully used to fire pellets into over fifty plasma discharges. Experimental results include data on the pellet penetration into the plasma using an advanced pellet tracking diagnostic with improved time and spatial response. Data from the tracker indicates pellet penetrations were between 30 and 86 percent of the plasma minor radius

Air Force Research Laboratory Spacecraft Cryocooler Endurance Evaluation Facility Closing Report

Science.gov (United States)

Armstrong, J.; Martin, K. W.; Fraser, T.

2015-12-01

The Air Force Research Laboratory (AFRL) Spacecraft Component Thermal Research Group has been devoted to evaluating lifetime performance of space cryocooler technology for over twenty years. Long-life data is essential for confirming design lifetimes for space cryocoolers. Continuous operation in a simulated space environment is the only accepted method to test for degradation. AFRL has provided raw data and detailed evaluations to cryocooler developers for advancing the technology, correcting discovered deficiencies, and improving cryocooler designs. At AFRL, units of varying design and refrigeration cycles were instrumented in state-of-the-art experiment stands to provide spacelike conditions and were equipped with software data acquisition to track critical cryocooler operating parameters. This data allowed an assessment of the technology's ability to meet the desired lifetime and documented any long-term changes in performance. This paper will outline a final report of the various flight cryocoolers tested in our laboratory. The data summarized includes the seven cryocoolers tested during 2014-2015. These seven coolers have a combined total of 433,326 hours (49.5 years) of operation.

Isolation of Borrelia burgdorferi from the blood of seven patients with Lyme disease.

Science.gov (United States)

Nadelman, R B; Pavia, C S; Magnarelli, L A; Wormser, G P

1990-01-01

Borrelia burgdorferi, the etiologic agent of Lyme disease, has rarely been successfully cultured from blood. We report on seven patients from Westchester County, New York, with B. burgdorferi bacteremia diagnosed between April 1987 and August 1987. One hundred thirty-two attempts to isolate spirochetes were made on blood specimens obtained from 104 patients. Twenty-two of these specimens were obtained from nine patients who had recently been bitten by Ixodes ticks but who were asymptomatic. Heparinized blood or serum specimens (0.2 to 0.4 mL) were inoculated onto 6 mL of modified Barbour-Stoenner-Kelly medium. Lyme serology was performed by enzyme-linked immunosorbent polyvalent, IgM, and IgG assays, fluorescent immunoassay, and microhemagglutination. Four of the seven patients had erythema migrans, two had facial nerve palsy, and one had a flu-like syndrome without rash. These patients represented 21% (four of 19) of all patients with the characteristic skin lesion who had blood cultures for B. burgdorferi, and 40% (two of five) of all those with facial nerve palsy. Serologic testing was frequently nonreactive; two patients had no detectable antibody on multiple sera by five different assays. All patients improved with antibiotic treatment, and had negative subsequent blood cultures, but five of seven had persistent complaints after completion of therapy. Culturing blood for B. burgdorferi may be useful in confirming the diagnosis of Lyme disease in selected patients. Use of spirochete blood cultures may facilitate a better understanding of the pathogenesis and natural history of Lyme disease.

Children with moderate-high infection with Entamoeba coli have higher percentage of body and abdominal fat than non-infected children.

Science.gov (United States)

Zavala, G A; García, O P; Campos-Ponce, M; Ronquillo, D; Caamaño, M C; Doak, C M; Rosado, J L

2016-12-01

Intestinal parasites, virus and bacterial infections are positively associated with obesity and adiposity in vitro and in animal models, but conclusive evidence of this relationship in humans is lacking. The aim of this cross-sectional study was to determine differences in adiposity between infected and non-infected children, with a high prevalence of intestinal parasitic infection and obesity. A total of 296 school-aged children (8.0 ± 1.5 years) from a rural area in Querétaro, Mexico, participated in this study. Anthropometry (weight, height and waist circumference) and body fat (DXA) were measured in all children. A fresh stool sample was collected from each child and analysed for parasites. Questionnaires related to socioeconomic status and clinical history were completed by caretakers. Approximately 11% of the children were obese, and 19% were overweight. The overall prevalence of infection was 61%. Ascaris lumbricoides was the most prevalent soil transmitted helminth (16%) followed by hookworm. Entamoeba coli was the predominant protozoa (20%) followed by Endolimax nana, Balantidium coli, Entamoeba histolytica/dispar, Iodamoeba bütschlii and Giardia lamblia. Children with moderate-heavy infection of E. coli had significantly higher waist circumference, waist-to-height ratio, body and abdominal fat than children not infected or with light-intensity infection (p fat deposition and thereby have long-term consequences on human health. Further studies are needed to better understand if E. coli contributes directly to fat deposition and possible mechanisms. © 2015 World Obesity Federation.

Eco-epidemiology of Bovine Tuberculosis (bTB) in an African savanna

NARCIS (Netherlands)

Dejene, Sintayehu Workeneh

2017-01-01

Bovine tuberculosis (bTB) is a zoonotic disease, and remains a cause of concern for livestock, wildlife and human health, especially in Ethiopia. It is a contagious disease, so close contact between animals or sharing of feed between infected and non-infected animals are major risk factors for

Seven challenges for neuroscience.

Science.gov (United States)

Markram, Henry

2013-01-01

Although twenty-first century neuroscience is a major scientific enterprise, advances in basic research have not yet translated into benefits for society. In this paper, I outline seven fundamental challenges that need to be overcome. First, neuroscience has to become "big science" - we need big teams with the resources and competences to tackle the big problems. Second, we need to create interlinked sets of data providing a complete picture of single areas of the brain at their different levels of organization with "rungs" linking the descriptions for humans and other species. Such "data ladders" will help us to meet the third challenge - the development of efficient predictive tools, enabling us to drastically increase the information we can extract from expensive experiments. The fourth challenge goes one step further: we have to develop novel hardware and software sufficiently powerful to simulate the brain. In the future, supercomputer-based brain simulation will enable us to make in silico manipulations and recordings, which are currently completely impossible in the lab. The fifth and sixth challenges are translational. On the one hand we need to develop new ways of classifying and simulating brain disease, leading to better diagnosis and more effective drug discovery. On the other, we have to exploit our knowledge to build new brain-inspired technologies, with potentially huge benefits for industry and for society. This leads to the seventh challenge. Neuroscience can indeed deliver huge benefits but we have to be aware of widespread social concern about our work. We need to recognize the fears that exist, lay them to rest, and actively build public support for neuroscience research. We have to set goals for ourselves that the public can recognize and share. And then we have to deliver on our promises. Only in this way, will we receive the support and funding we need.

High-dose chemotherapy and immunotherapy in adult Burkitt lymphoma: comparison of results in human immunodeficiency virus-infected and noninfected patients.

Science.gov (United States)

Oriol, Albert; Ribera, Josep-Maria; Bergua, Juan; Giménez Mesa, Eduardo; Grande, Carlos; Esteve, Jordi; Brunet, Salut; Moreno, Maria-Jose; Escoda, Lourdes; Hernandez-Rivas, Jesus-Maria; Hoelzer, Dieter

2008-07-01

It has been recognized that cure is possible for human immunodeficiency virus (HIV)-infected patients with Burkitt lymphoma/leukemia (BL) if appropriate chemotherapy is used. The introduction of rituximab in BL therapeutic schemes has been scarcely explored. The outcome and toxicity of HIV-positive patients with BL treated in a rituximab and intensive chemotherapy-based trial was evaluated. Thirty-six consecutive patients, 15 to 55 years of age, diagnosed with advanced stage BL were recruited from July 2003 to August 2006, stratified according to HIV infection status and treated with 6 cycles of intensive chemotherapy including 8 doses of rituximab. Nineteen of the patients (53%) were HIV-infected. Their clinical characteristics were comparable to those of the HIV-negative patients. Complete remission (CR) rates were 88% and 84%, respectively, for HIV-negative and -positive patients. Twenty-seven patients (82% and 68%, respectively, for HIV-negative and -positive patients) completed the 6 protocol scheduled cycles. HIV-infected patients presented higher incidences of grade 3-4 mucositis (27% vs 7% of cycles, P = .0005) and severe infectious episodes (26% vs 8%, P = .0025). However, there were no statistically significant differences in 2-year overall survival (82%, 95% confidence interval [CI], 65%-99% and 73%, 95% CI, 54%-92%, respectively) or 2-year disease-free survival (93%, 95% CI, 82%-99% and 87%, 95% CI 72%-99%, respectively). Intensive immunochemotherapy can be administered safely to patients with HIV infection. Despite a higher incidence of severe mucositis and infections the remission and survival rates are comparable to those observed in HIV-negative patients. (Copyright) 2008 American Cancer Society.

Parents' Perspectives of Closeness and Separation With Their Preterm Infants in the NICU.

Science.gov (United States)

Treherne, Stephanie C; Feeley, Nancy; Charbonneau, Lyne; Axelin, Anna

To discover parents' perceptions of closeness to and separation from their preterm infants in the NICU. Qualitative descriptive. Urban Level III NICU. Twenty parents of preterm infants in the NICU. After ethics approval, data were collected with a smartphone application created for this study. Parents recorded their descriptions of moments of closeness and separation over a 24-hour period in the NICU. Data were transcribed verbatim and content was analyzed. Five themes related to parents' perceptions of closeness and separation were identified: Having a role as a parent: Feeling autonomous and making decisions; Providing for and getting to know the infant: Feeding, holding, and interacting; Support from staff; Reluctantly leaving the infant's bedside; and NICU environment. Autonomy is a key element of a parent's perception of closeness. Staff in the NICU can facilitate autonomy by involving parents in the care of their preterm infants as much as possible to reinforce the parental role. Parents described leaving their infants' bedsides as very difficult. Copyright © 2017 AWHONN, the Association of Women's Health, Obstetric and Neonatal Nurses. Published by Elsevier Inc. All rights reserved.

Twenty novel polymorphic microsatellite primers in the critically endangered Melastoma tetramerum var. tetramerum (Melastomataceae).

Science.gov (United States)

Narita, Ayu; Izuno, Ayako; Komaki, Yoshiteru; Tanaka, Takefumi; Murata, Jin; Isagi, Yuji

2016-09-01

Microsatellite markers were identified for Melastoma tetramerum var. tetramerum (Melastomataceae), a critically endangered shrub endemic to the Bonin Islands, to reveal genetic characteristics in wild and restored populations. Using next-generation sequencing, 27 microsatellite markers were identified. Twenty of these markers were polymorphic in M. tetramerum var. tetramerum, with two to nine alleles per locus and expected heterozygosity ranging from 0.10 to 0.71. Among the 20 polymorphic markers, 15 were applicable to other closely related taxa, namely M. tetramerum var. pentapetalum, M. candidum var. candidum, and M. candidum var. alessandrense. These markers can be potentially useful to investigate the genetic diversity, population genetic structure, and reproductive ecology of M. tetramerum var. tetramerum as well as of the three related taxa to provide appropriate genetic information for conservation.

The twenty-eight lodges (xiu 宿)

OpenAIRE

Morgan, Daniel Patrick

2018-01-01

The twenty-eight lodges (xiu 宿). Named and numbered in the central circle, the twenty-eight lodges, represent uneven orange-segment-like divisions of the celestial sphere running from pole to pole through the ‘guide stars’ (juxing 距星) at/near the western extremity of the constellations after which they are named. In the inner circle are the modern identifications of those guide stars. In the outer circle are the equatorial lodge widths in contemporary use in du 度 / days, where the number of d...

Proceedings: Twenty years of energy policy: Looking toward the twenty-first century

International Nuclear Information System (INIS)

1992-01-01

In 1973, immediately following the Arab Oil Embargo, the Energy Resources Center, University of Illinois at Chicago initiated an innovative annual public service program called the Illinois Energy Conference. The objective was to provide a public forum each year to address an energy or environmental issue critical to the state, region and nation. Twenty years have passed since that inaugural program, and during that period we have covered a broad spectrum of issues including energy conservation nuclear power, Illinois coal, energy policy options, natural gas, alternative fuels, new energy technologies, utility deregulation and the National Energy Strategy

Proceedings: Twenty years of energy policy: Looking toward the twenty-first century

Energy Technology Data Exchange (ETDEWEB)

1992-12-31

In 1973, immediately following the Arab Oil Embargo, the Energy Resources Center, University of Illinois at Chicago initiated an innovative annual public service program called the Illinois Energy Conference. The objective was to provide a public forum each year to address an energy or environmental issue critical to the state, region and nation. Twenty years have passed since that inaugural program, and during that period we have covered a broad spectrum of issues including energy conservation nuclear power, Illinois coal, energy policy options, natural gas, alternative fuels, new energy technologies, utility deregulation and the National Energy Strategy.

Why the American public supports twenty-first century learning.

Science.gov (United States)

Sacconaghi, Michele

2006-01-01

Aware that constituent support is essential to any educational endeavor, the AOL Time Warner Foundation (now the Time Warner Foundation), in conjunction with two respected national research firms, measured Americans' attitudes toward the implementation of twenty-first century skills. The foundation's national research survey was intended to explore public perceptions of the need for changes in the educational system, in school and after school, with respect to the teaching of twenty-first century skills. The author summarizes the findings of the survey, which were released by the foundation in June 2003. One thousand adults were surveyed by telephone, including African Americans, Latinos, teachers, and business executives. In general, the survey found that Americans believe today's students need a "basics-plus" education, meaning communication, technology, and critical thinking skills in addition to the traditional basics of reading, writing, and math. In fact, 92 percent of respondents stated that students today need different skills from those of ten to twenty years ago. Also, after-school programs were found to be an appropriate vehicle to teach these skills. Furthermore, the survey explored how well the public perceives schools to be preparing youth for the workforce and postsecondary education, which twenty-first century skills are seen as being taught effectively, and the level of need for after-school and summer programs. The survey results provide conclusive evidence of national support for basics-plus education. Thus, a clear opportunity exists to build momentum for a new model of education for the twenty-first century.

Twenty lectures on thermodynamics

CERN Document Server

Buchdahl, H A

2013-01-01

Twenty Lectures on Thermodynamics is a course of lectures, parts of which the author has given various times over the last few years. The book gives the readers a bird's eye view of phenomenological and statistical thermodynamics. The book covers many areas in thermodynamics such as states and transition; adiabatic isolation; irreversibility; the first, second, third and Zeroth laws of thermodynamics; entropy and entropy law; the idea of the application of thermodynamics; pseudo-states; the quantum-static al canonical and grand canonical ensembles; and semi-classical gaseous systems. The text

Reliability of Videoconferencing Administration of a Communication Questionnaire to People With Traumatic Brain Injury and Their Close Others.

Science.gov (United States)

Rietdijk, Rachael; Power, Emma; Brunner, Melissa; Togher, Leanne

To compare in-person with videoconferencing administration of a communication questionnaire for people with traumatic brain injury (TBI) and their close others. Repeated-measures design with randomized order of administration. Twenty adults with severe TBI and their close others. Both participants with TBI and their close others completed the La Trobe Communication Questionnaire (LCQ) via interview with a clinician, once via Skype and once during a home visit. Total LCQ score and time taken for completion. There were no significant differences between videoconferencing and in-person conditions in the total scores or time taken to complete the questionnaire. Videoconferencing-based administration of the LCQ is as reliable and efficient as in-person administration.

The Twenty Statement Test in Teacher Development

Directory of Open Access Journals (Sweden)

Ahmet Aypay

2011-10-01

Full Text Available The purpose of this study is to describe teacher characteristics using Twenty Statements Test (TST. Study group includes a total of thirty-five individuals, including teachers, guidance and counselors and research assistants. The study used a qualitative approach on teacher identity. TST is one of the qualitative methods that were used to determine individual self-conceptualization. Study group were requested to write twenty statements that describe themselves responding to the question “Who I am?” in a free format. The findings indicated that teachers were overwhelmingly in group c (reflective. No differences were found in terms of gender and profession. Only few significant differences have been found based on marital status. The utility of TST in teacher training and development was discussed.

The Twenty Statement Test in Teacher Development

Directory of Open Access Journals (Sweden)

Ahmet Aypay

2011-04-01

Full Text Available The purpose of this study is to describe teacher characteristics using Twenty Statements Test (TST. Study group includes a total of thirty-five individuals, including teachers, guidance and counselors and research assistants. The study used a qualitative approach on teacher identity. TST is one of the qualitative methods that were used to determine individual self-conceptualization. Study group were requested to write twenty statements that describe themselves responding to the question “Who I am?” in a free format. The findings indicated that teachers were overwhelmingly in group c (reflective. No differences were found in terms of gender and profession. Only few significant differences have been found based on marital status. The utility of TST in teacher training and development was discussed

Performance indicators related to points scoring and winning in international rugby sevens.

Science.gov (United States)

Higham, Dean G; Hopkins, Will G; Pyne, David B; Anson, Judith M

2014-05-01

Identification of performance indicators related to scoring points and winning is needed to inform tactical approaches to international rugby sevens competition. The aim of this study was to characterize team performance indicators in international rugby sevens and quantify their relationship with a team's points scored and probability of winning. Performance indicators of each team during 196 matches of the 2011/2012 International Rugby Board Sevens World Series were modeled for their linear relationships with points scored and likelihood of winning within (changes in team values from match to match) and between (differences between team values averaged over all matches) teams. Relationships were evaluated as the change and difference in points and probability of winning associated with a two within- and between-team standard deviations increase in performance indicator values. Inferences about relationships were assessed using a smallest meaningful difference of one point and a 10% probability of a team changing the outcome of a close match. All indicators exhibited high within-team match-to-match variability (intraclass correlation coefficients ranged from 0.00 to 0.23). Excluding indicators representing points-scoring actions or events occurring on average less than once per match, 13 of 17 indicators had substantial clear within-team relationships with points scored and/or likelihood of victory. Relationships between teams were generally similar in magnitude but unclear. Tactics that increase points scoring and likelihood of winning should be based on greater ball possession, fewer rucks, mauls, turnovers, penalties and free kicks, and limited passing. Key pointsSuccessful international rugby sevens teams tend to maintain ball possession; more frequently avoid taking the ball into contact; concede fewer turnovers, penalties and free kicks; retain possession in scrums, rucks and mauls; and limit passing the ball.Selected performance indicators may be used to

Evaluation of Occupational Closed Globe Eye Injuries

Directory of Open Access Journals (Sweden)

Berna Akova-Budak

2016-01-01

Full Text Available Aim: To evaluate closed glob injuries related to occupational accidents of patients who had official occupational accident records. Material and Method: The medical records of patients with ocular injuries who referred to Department of Ophthalmology or emergency of Uludag University, School of Medicine between January 2010 and December 2013 with official occupational accident report were retrospectively reviewed. The patients with closed globe injuries following trauma were included. Age, sex, the injured eye, the cause of the trauma, whether the precautions were taken or not by the patient, the damage due to trauma were recorded. Results: According to the official records, 108 patients referred to our clinic with closed globe injury related to occupational accident. One hundred twenty eyes of 108 patients ( 2 females, 106 males were evaluated. The mean age of the patients was 33±8.6 years. The most frequent cause of injury was foreign bodies on the ocular surface followed by blunt trauma. The mean age of the patients injured with foreign bodies was found to be significantly lower than the patients injured with blunt objects (p=0.039. Thirteen patients reported that they had used preventive equipment. Discussion: It is of utmost importance that the awareness of the workers should be raised and they should be educated about the use of preventive equipment to prevent the occupational eye injuries. The education of particularly the younger patients about the occupational injuries when they begin to work may decrease the rate of occupational accident related eye injuries.

Establishing the R&D Agenda for Twenty-First Century Learning

Science.gov (United States)

Kay, Ken; Honey, Margaret

2006-01-01

Much ink has flowed over the past few years describing the need to incorporate twenty-first century skills into K-12 education. Preparing students to succeed as citizens, thinkers, and workers--the bedrock of any educational system--in this environment means arming them with more than a list of facts and important dates. Infusing twenty-first…

The next twenty years - IAEA's role

International Nuclear Information System (INIS)

Tape, G.F.

1977-01-01

The twentieth anniversary of an institution is an appropriate time to look back and to ask what has been achieved. It is also an appropriate time to look ahead and to ask what should be the mission for the future. How can the strengths of the International Atomic Energy Agency (IAEA) be best utilized, what new opportunities should be seized upon, and what challenges should the IAEA be prepared to meet in the next twenty years? Forward planning is a very necessary activity in today's world. There are so many demands on national or institutional resources that careful analysis of options is necessary to establish priorities and ultimately to provide for implementation. But such planning must be done carefully with full appreciation for the validity and sensitivity of the input assumptions and data. Furthermore, today's plan, while setting goals and directions, cannot be so inflexible that it cannot be responsive to ever-changing political, economic and technical constraints or opportunities. Thus in looking ahead, the plan must contain provisions for flexibility to provide for further modifications in the light of ever-changing knowledge, attitudes, and world conditions. The experience of the past five years in the energy field, and especially in nuclear energy, underscores this need. In looking ahead for the next twenty years, we are attempting to describe the International Atomic Energy Agency and its role through the twentieth century. In doing so, we are automatically laying the base for the Agency's work going into the twenty-first century. In short, we are trying to visualize a programme that can serve the coming generation and, in doing so, creating a base from which the needs of the succeeding generation can be met. This is a large order and the crystal ball is less than clear. (author)

Ultrasonographic findings of intestinal intussusception in seven cats.

Science.gov (United States)

Patsikas, M N; Papazoglou, L G; Papaioannou, N G; Savvas, I; Kazakos, G M; Dessiris, A K

2003-12-01

The medical records of seven cats with intestinal intussusception that were diagnosed by abdominal ultrasonography and exploratory laparotomy were reviewed. In transverse ultrasonographic sections the intussusception appeared as a target-like mass consisting of one, two or more hyperechoic and hypoechoic concentric rings surrounding a C-shaped, circular or non-specific shaped hyperechoic centre. Part of the intestine representing the inner intussusceptum, located close to the hyperechoic centre and surrounded by concentric rings, was also detected. In longitudinal sections the intussusception appeared as multiple hyperechoic and hypoechoic parallel lines in four cases and as an ovoid mass in three cases. In one case the ovoid mass had a 'kidney' configuration. Additional ultrasonographic findings associated with intestinal intussusception included an intestinal neoplasm in one cat. The results of the present study demonstrate that the ultrasonographic findings of intestinal intussusception in cats bear some similarities to those described in dogs and humans, are relatively consistent, and facilitate a specific diagnosis.

Changing ideas in forestry: A comparison of concepts in Swedish and American forestry journals during the early twentieth and twenty-first centuries.

Science.gov (United States)

Mårald, Erland; Langston, Nancy; Sténs, Anna; Moen, Jon

2016-02-01

By combining digital humanities text-mining tools and a qualitative approach, we examine changing concepts in forestry journals in Sweden and the United States (US) in the early twentieth and early twenty-first centuries. Our first hypothesis is that foresters at the beginning of the twentieth century were more concerned with production and less concerned with ecology than foresters at the beginning of the twenty-first century. Our second hypothesis is that US foresters in the early twentieth century were less concerned with local site conditions than Swedish foresters. We find that early foresters in both countries had broader-and often ecologically focused-concerns than hypothesized. Ecological concerns in the forestry literature have increased, but in the Nordic countries, production concerns have increased as well. In both regions and both time periods, timber management is closely connected to concerns about governance and state power, but the forms that governance takes have changed.

Twenty-One at TREC-8: using Language Technology for Information Retrieval

NARCIS (Netherlands)

Kraaij, Wessel; Pohlmann, Renée; Hiemstra, Djoerd; Voorhees, E.M; Harman, D.K.

2000-01-01

This paper describes the official runs of the Twenty-One group for TREC-8. The Twenty-One group participated in the Ad-hoc, CLIR, Adaptive Filtering and SDR tracks. The main focus of our experiments is the development and evaluation of retrieval methods that are motivated by natural language

Chemical composition and antioxidant activity of seven cultivars of guava (Psidium guajava) fruits.

Science.gov (United States)

Flores, Gema; Wu, Shi-Biao; Negrin, Adam; Kennelly, Edward J

2015-03-01

The antioxidant activity and identification of phenolic compounds of seven edible guava (Psidium guajava) cultivars that varied in colour from white to pink were examined. In the DPPH assay all four pink-pulp guavas (Barbie Pink, Homestead, Sardina 1, Sardina 2) included in the study showed higher activity than the white pulp cultivars (Yen 2 and Sayla) and less than the red pulp guava cultivar (Thai Maroon). In the ABTS(+) assay this trend was the same up to 20 min, but from 20 to 40 min Barbie Pink showed lower activity than the white guavas. Twenty-one compounds were characterised in the cultivars, and ten of them are reported for the first time in this fruit. Principle component analysis was performed to identify differences in chemistry among these cultivars. Our results suggest that the antioxidant activity and phytochemical composition of P. guajava vary significantly according to the cultivar and pulp colour. Copyright © 2014. Published by Elsevier Ltd.

The Association Study between Twenty One Polymorphisms in Seven Candidate Genes and Coronary Heart Diseases in Chinese Han Population.

Directory of Open Access Journals (Sweden)

Barrak F Alobeidy

Full Text Available Previous genome-wide association studies (GWAS in multiple populations identified several genetic loci for coronary heart diseases (CHD. Here we utilized a 2-stage candidate gene association strategy in Chinese Han population to shed light on the putative association between several metabolic-related candidate genes and CHD. At the 1(st stage, 190 patients with CHD and 190 controls were genotyped through the MassARRAY platform. At the 2(nd stage, a larger sample including 400 patients and 392 controls was genotyped by the High Resolution Melt (HRM method to confirm or rule out the associations with CHD. MLXIP expression level was quantified by the real time PCR in 65 peripheral blood samples. From the 21 studied single nucleotide polymorphisms (SNPs of seven candidate genes: MLXIPL, MLXIP, MLX, ADIPOR1, VDR, SREBF1 and NR1H3, only one tag SNP rs4758685 (T→C was found to be statistically associated with CHD (P-value = 0.02, Odds ratio (OR of 0.83. After adjustment for the age, sex, lipid levels and diabetes, the association remained significant (P-value = 0.03. After adjustment for the hypertension, P-value became 0.20 although there was a significant difference in the allele distribution between the CHD patients with hypertension and the controls (P-value = 0.04, 406 vs 582. In conclusion, among the 21 tested SNPs, we identified a novel association between rs4758685 of MLXIP gene and CHD. The C allele of common variant rs4758685 interacted with hypertension, and was found to be protective against CHD in both allelic and genotypic models in Chinese Han population.

Strategic Leader Competencies for the Twenty-First Century

National Research Council Canada - National Science Library

Becker, Bradley A

2007-01-01

...: interpersonal skills, conceptual skills, and technical skills. From these three primary strategic leadership skills, there is a list of twenty-one competencies that a strategic leader should posses...

Influence of gap and overlap paradigms on saccade latencies and vergence eye movements in seven-year-old children.

Science.gov (United States)

Bucci, Maria Pia; Pouvreau, Nathalie; Yang, Qing; Kapoula, Zoï

2005-07-01

The latency of eye movements is influenced by the fixation task; when the fixation stimulus is switched off before the target presentation (gap paradigm) the latency becomes short and express movements occur. In contrast, when the fixation stimulus remains on when the target appears (overlap paradigm), eye movement latency is longer. Several previous studies have shown increased rates of express saccades in children; however the presence of an express type of latency for vergence and combined movements in children has never been explored. The present study examines the effects of the gap and the overlap paradigms on horizontal saccades at far (150 cm) and at close (20 cm) viewing distances, on vergence along the median plane, and on saccades combined with convergence or divergence in 15 normal seven-year-old children. The results show that the gap paradigm produced shorter latency for all eye movements than the overlap paradigm, but the difference was only significant for saccades at close viewing distances, for divergence (pure and combined), and for saccades combined with vergence. The gap paradigm produced significantly higher rates of express latencies for saccades at close viewing distances, for divergence, and for saccades combined with divergence; in contrast, the frequencies of express latencies for saccades at far viewing distances and for convergence (pure or combined) were similar in the gap and the overlap paradigms. Interestingly, the rate of anticipatory latencies (gap paradigm. Our collective findings suggest that the initiation of saccades at close viewing distances and of divergence is more reflexive, particularly in the gap paradigm. The finding of frequent anticipatory divergence that occurs at similar rates for seven-year-old children (this study) and for adults (Coubard et al., 2004, Exp Brain Res 154:368-381) indicates that predictive initiation of divergence is dominant.

Genetic analysis and antigenic characterization of swine origin influenza viruses isolated from humans in the United States, 1990-2010.

Science.gov (United States)

Shu, Bo; Garten, Rebecca; Emery, Shannon; Balish, Amanda; Cooper, Lynn; Sessions, Wendy; Deyde, Varough; Smith, Catherine; Berman, LaShondra; Klimov, Alexander; Lindstrom, Stephen; Xu, Xiyan

2012-01-05

Swine influenza viruses (SIV) have been recognized as important pathogens for pigs and occasional human infections with swine origin influenza viruses (SOIV) have been reported. Between 1990 and 2010, a total of twenty seven human cases of SOIV infections have been identified in the United States. Six viruses isolated from 1990 to 1995 were recognized as classical SOIV (cSOIV) A(H1N1). After 1998, twenty-one SOIV recovered from human cases were characterized as triple reassortant (tr_SOIV) inheriting genes from classical swine, avian and human influenza viruses. Of those twenty-one tr_SOIV, thirteen were of A(H1N1), one of A(H1N2), and seven of A(H3N2) subtype. SOIV characterized were antigenically and genetically closely related to the subtypes of influenza viruses circulating in pigs but distinct from contemporary influenza viruses circulating in humans. The diversity of subtypes and genetic lineages in SOIV cases highlights the importance of continued surveillance at the animal-human interface. Copyright © 2011. Published by Elsevier Inc.

Gene : CBRC-PABE-07-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-82 48% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-130 78% MINDSYFSGFILLGFT...QIFIDVALYSVECILLAMMSCDRLNAICKPLHHMTIMNLQLCQGLVVISWVVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAA

Gene : CBRC-PTRO-07-0026 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-79 50% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-120 76% MINDSRFSGFILLGFT...QLFIDVALYSVECILLSMMSYDRLNAICKPLHHMTIMNLQLCQGLVVISWIVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAFGTCSSHLIVVSIFYGTVRYMYTQPGNSPSQDEGKLLHIFYSIFTPTLNPSH ...

Twenty-One at TREC-7: ad-hoc and cross-language track

NARCIS (Netherlands)

Hiemstra, Djoerd; Kraaij, Wessel; Voorhees, E.M; Harman, D.K.

1999-01-01

This paper describes the official runs of the Twenty-One group for TREC-7. The Twenty-One group participated in the ad-hoc and the cross-language track and made the following accomplishments: We developed a new weighting algorithm, which outperforms the popular Cornell version of BM25 on the ad-hoc

Accurate and Practical Identification of 20 Fusarium Species by Seven-Locus Sequence Analysis and Reverse Line Blot Hybridization, and an In Vitro Antifungal Susceptibility Study▿†

Science.gov (United States)

Wang, He; Xiao, Meng; Kong, Fanrong; Chen, Sharon; Dou, Hong-Tao; Sorrell, Tania; Li, Ruo-Yu; Xu, Ying-Chun

2011-01-01

Eleven reference and 25 clinical isolates of Fusarium were subject to multilocus DNA sequence analysis to determine the species and haplotypes of the fusarial isolates from Beijing and Shandong, China. Seven loci were analyzed: the translation elongation factor 1 alpha gene (EF-1α); the nuclear rRNA internal transcribed spacer (ITS), large subunit (LSU), and intergenic spacer (IGS) regions; the second largest subunit of the RNA polymerase gene (RPB2); the calmodulin gene (CAM); and the mitochondrial small subunit (mtSSU) rRNA gene. We also evaluated an IGS-targeted PCR/reverse line blot (RLB) assay for species/haplotype identification of Fusarium. Twenty Fusarium species and seven species complexes were identified. Of 25 clinical isolates (10 species), the Gibberella (Fusarium) fujikuroi species complex was the commonest (40%) and was followed by the Fusarium solani species complex (FSSC) (36%) and the F. incarnatum-F. equiseti species complex (12%). Six FSSC isolates were identified to the species level as FSSC-3+4, and three as FSSC-5. Twenty-nine IGS, 27 EF-1α, 26 RPB2, 24 CAM, 18 ITS, 19 LSU, and 18 mtSSU haplotypes were identified; 29 were unique, and haplotypes for 24 clinical strains were novel. By parsimony informative character analysis, the IGS locus was the most phylogenetically informative, and the rRNA gene regions were the least. Results by RLB were concordant with multilocus sequence analysis for all isolates. Amphotericin B was the most active drug against all species. Voriconazole MICs were high (>8 μg/ml) for 15 (42%) isolates, including FSSC. Analysis of larger numbers of isolates is required to determine the clinical utility of the seven-locus sequence analysis and RLB assay in species classification of fusaria. PMID:21389150

Seven wood-inhabiting new species of the genus Trichoderma (Fungi, Ascomycota) in Viride clade.

Science.gov (United States)

Qin, Wen-Tao; Zhuang, Wen-Ying

2016-06-01

More than 200 recent collections of Trichoderma from China were examined and 16 species belonging to the Viride clade were identified based on integrated studies of phenotypic and molecular data. Among them, seven wood-inhabiting new species, T. albofulvopsis, T. densum, T. laevisporum, T. sinokoningii, T. sparsum, T. sphaerosporum and T. subviride, are found. They form trichoderma- to verticillium-like conidiophores, lageniform to subulate phialides and globose to ellipsoidal conidia, but vary greatly in colony features, growth rates, and sizes of phialides and conidia. To explore their taxonomic positions, the phylogenetic tree including all the known species of the Viride clade is constructed based on sequence analyses of the combined RNA polymerase II subunit b and translation elongation factor 1 alpha exon genes. Our results indicated that the seven new species were well-located in the Koningii, Rogersonii and Neorufum subclades as well as a few independent terminal branches. They are clearly distinguishable from any existing species. Morphological distinctions and sequence divergences between the new species and their close relatives were discussed.

Peri-ictal signal changes in seven patients with status epilepticus: interesting MRI observations

Energy Technology Data Exchange (ETDEWEB)

Goyal, Manoj K; Sinha, Sanjib [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neurology, Bangalore, Karnataka (India); Ravishankar, Shivshankar; Shivshankar, Jai Jai [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neuroimaging and Interventional Radiology, Bangalore (India)

2009-03-15

Transient peri-ictal changes on imaging had been described following status epilepticus (SE), but its cause is not very well understood. We analyzed the magnetic resonance imaging (MRI) findings in SE patients in order to elucidate such changes including peri-ictal signal. This prospective study involved 34 patients (M/F 23:11, mean age 25.8 {+-} 17.2 years) who experienced SE. MRI was performed during or within 96 h of cessation of seizures. Twenty-five patients had generalized convulsive status epilectus (GCSE; ten secondary GCSE and 15 primary GCSE). Seven patients had epilepsia partialis continua and two patients non-convulsive SE. Eight patients had a history of seizures and three patients previous SE. The mean duration of SE prior to MRI was 89.2 {+-} 105.3 h (range 2-360 h). MRI provided diagnosis in 17 patients, and in 13 patients, no structural cause was identified. Peri-ictal focal signal changes with restricted diffusion on apparent diffusion coefficient maps were present in seven (20.6%) patients with SE (generalized convulsive, three; partial, three; non-convulsive, one). The changes were observed when MRI was performed during SE in 3/10 (30%) patients, or within 24 h in 1/7 (14.3%), 48 h in 1/5 (20%), 72 h in 1/6 (16.7%), or 96 h in 1/6 (16.7%) patients after cessation of seizures. Repeat MRI revealed disappearance of signal changes in two patients. Peri-ictal MR changes with restricted diffusion appear to be an effect rather than the cause of SE. (orig.)

Peri-ictal signal changes in seven patients with status epilepticus: interesting MRI observations

International Nuclear Information System (INIS)

Goyal, Manoj K.; Sinha, Sanjib; Ravishankar, Shivshankar; Shivshankar, Jai Jai

2009-01-01

Transient peri-ictal changes on imaging had been described following status epilepticus (SE), but its cause is not very well understood. We analyzed the magnetic resonance imaging (MRI) findings in SE patients in order to elucidate such changes including peri-ictal signal. This prospective study involved 34 patients (M/F 23:11, mean age 25.8 ± 17.2 years) who experienced SE. MRI was performed during or within 96 h of cessation of seizures. Twenty-five patients had generalized convulsive status epilectus (GCSE; ten secondary GCSE and 15 primary GCSE). Seven patients had epilepsia partialis continua and two patients non-convulsive SE. Eight patients had a history of seizures and three patients previous SE. The mean duration of SE prior to MRI was 89.2 ± 105.3 h (range 2-360 h). MRI provided diagnosis in 17 patients, and in 13 patients, no structural cause was identified. Peri-ictal focal signal changes with restricted diffusion on apparent diffusion coefficient maps were present in seven (20.6%) patients with SE (generalized convulsive, three; partial, three; non-convulsive, one). The changes were observed when MRI was performed during SE in 3/10 (30%) patients, or within 24 h in 1/7 (14.3%), 48 h in 1/5 (20%), 72 h in 1/6 (16.7%), or 96 h in 1/6 (16.7%) patients after cessation of seizures. Repeat MRI revealed disappearance of signal changes in two patients. Peri-ictal MR changes with restricted diffusion appear to be an effect rather than the cause of SE. (orig.)

The Seven Sisters

DEFF Research Database (Denmark)

Söderqvist, Thomas

2011-01-01

Today, scientific biography is primarily thought of as a way of writing contextual history of science. But the genre has other functions as well. This article discusses seven kinds of ideal-typical subgenres of scientific biography. In addition to its mainstream function as an ancilla historiae...

Evaluation of a New Surgical Technique for Closing Oroantral Fistula Using Auto-transplanted Upper Third Molar: A 1-Year Follow-Up Study.

Science.gov (United States)

Assad, Mounzer; Alkhaled, Maysaa; Alhajj, Mohammed N

2018-03-01

Oroantral fistula (OAF) is considered a frequent complication in dental practice. Many surgical techniques/methods have been proposed to close it. The aim of this study was to evaluate the auto-transplantation of upper third molar for closing OAF. Twenty patients participated in this study aged between 20 and 40 years old. The OAF was closed by auto-transplantation of upper third molar placed directly in the socket of the extracted tooth. Results were evaluated clinically and radiographically through the period of observation which lasted for 1 year. Final results showed that the success rate of closing OAF was 95% while the success rate of upper third molar auto-transplantation was 90%. This technique is simple, applicable, provides immediate replacement of the missing tooth, and does not require complicated instruments or procedures.

Confronting quasi-exponential inflation with WMAP seven

International Nuclear Information System (INIS)

Pal, Barun Kumar; Pal, Supratik; Basu, B.

2012-01-01

We confront quasi-exponential models of inflation with WMAP seven years dataset using Hamilton Jacobi formalism. With a phenomenological Hubble parameter, representing quasi exponential inflation, we develop the formalism and subject the analysis to confrontation with WMAP seven using the publicly available code CAMB. The observable parameters are found to fair extremely well with WMAP seven. We also obtain a ratio of tensor to scalar amplitudes which may be detectable in PLANCK

Game Demands of Seven-A-Side Soccer in Young Players.

Science.gov (United States)

Barbero-Alvarez, José C; Gómez-López, Maite; Castagna, Carlo; Barbero-Alvarez, Verónica; Romero, David V; Blanchfield, Anthony W; Nakamura, Fábio Y

2017-07-01

Barbero-Alvarez, JC, Gómez-López, M, Castagna, C, Barbero-Alvarez, V, Romero, DV, Blanchfield, AW, and Nakamura, FY. Game demands of seven-a-side soccer in young players. J Strength Cond Res 31(7): 1771-1779, 2017-The aim of this study was to examine the activity patterns and physiological demands of 7-a-side youth soccer matches across 2 chronological age categories (U12 and U14). Twenty-two soccer players of a national youth soccer academy were investigated. Players of each age category performed 2 training matches (2 × 25 minutes) and were monitored by global positioning system and heart rate monitor units. Players of both categories covered similar total distance (5,348 ± 307 m), at similar mean heart rate values (86 ± 4% of maximum). However, the number of high-intensity runs (82.5 ± 17.4 vs. 69.7 ± 15.2) and total distance covered during sprints (264 ± 207 vs. 128 ± 74 m) were significantly (p ≤ 0.05) higher in U14 compared with U12. The results suggest a highly demanding nature of 7-a-side soccer for skilled players, with physical maturity possibly influencing the match-related high-intensity performance at these ages.

Twenty-First Century Literacy: A Matter of Scale from Micro to Mega

Science.gov (United States)

Brown, Abbie; Slagter van Tryon, Patricia J.

2010-01-01

Twenty-first century technologies require educators to look for new ways to teach literacy skills. Current communication methods are combinations of traditional and newer, network-driven forms. This article describes the changes twenty-first century technologies cause in the perception of time, size, distance, audience, and available data, and…

Genetic diversity and relatedness among seven red deer (Cervus elaphus populations

Directory of Open Access Journals (Sweden)

Lenka Maršálková

2014-02-01

Full Text Available Deer (Cervidae recently belongs to the most important species. The aim of presenting study was evaluation of genetic diversity and relationship within and among seven red deer populations from different origins - Czech Republic, Hungary, hybrids Hungary x New Zealand, Lithuania, New Zealand, Poland and Slovak Republic. This study was conducted to determine the levels of genetic variability and relationships among deer populations from a total of 637 animals originating from seven countries Czech Republic (50, Hungary (35, Hungary x New Zealand hybrids (67, Lithuania (26, New Zealand (82, Poland (347 and Slovak Republic (30.  We used the hair bulbs as a source of DNA.  In total, 213 alleles were observed from the 10 loci surveyed. The number of alleles per locus ranged from 11 (IOBT965 to 35 (T156, RT13. Genetic diversity and relatedness among red deer populations has been performed on a total of 637 animals. A panel of 10 microsatellite markers used in deer were optimized. On the basis of this panel of microsatellites we were investigated genetic variability and relationships by using statistical and graphical programmes. We evaluated how close populations are to each other and their genetic admixture. Molecular genetic data combined with evaluation in statistical programmes could lead to a complex view of populations. 

Afterword: Victorian Sculpture for the Twenty-First Century

Directory of Open Access Journals (Sweden)

David J. Getsy

2016-06-01

Full Text Available Commenting on the directions proposed by this issue of '19', the afterword discusses the broad trends in twenty-first century studies of Victorian sculpture and the opportunity for debate arising from the first attempt at a comprehensive exhibition.

Open Adoption Placement by Birth Mothers in Their Twenties.

Science.gov (United States)

Clutter, Lynn B

The purpose of this study was to summarize birth mothers' descriptions of unplanned pregnancy experienced in their twenties and how open adoption influenced their lives. Naturalistic inquiry was used with purposive sampling from one agency and telephone interviews of women who experienced unplanned pregnancy in their twenties and relinquishment through open adoption. Recorded, transcribed, and deidentified interviews were analyzed for qualitative themes. Fifteen participants judiciously weighed the open adoption decision. Over half parented other children prior to placement. Most knew they could not have parented this child due to life stressors. Placement was a hard decision, but ongoing contact with birth child and adoptive family was valued. Open adoption processes made them stronger by being happy that their child experienced family life with greater opportunities than birth mothers could offer at the time. Summarized themes used the acronym COMMITTED: C-care deeply about what is best for the child, O-ongoing open adoption: good and hard, M-meeting together regularly, M-moving on in personal growth, accomplishments, and milestones, I-independence from previous stressors or crises, T-transitions, T-therapeutic support, E-emotions, D-depression giving way to deepened strength and personal direction. Open adoption is reinforced as a positive resolution of unintended pregnancy for birth mothers in their twenties.

Normal Health-Related Quality of Life and Ability to Work Twenty-nine Years After in Situ Arthrodesis for High-Grade Isthmic Spondylolisthesis.

Science.gov (United States)

Joelson, Anders; Hedlund, Rune; Frennered, Karin

2014-06-18

The purpose of this mixed prospective and retrospective case series was to evaluate the long-term health-related quality of life and physical disability after in situ arthrodesis for high-grade isthmic spondylolisthesis. Thirty-five of forty consecutive patients who had in situ spinal arthrodesis for high-grade isthmic spondylolisthesis at a mean age of fifteen years (range, nine to twenty-five years) completed validated questionnaires (Short Form-36 [SF-36], EuroQol-5 Dimensions [EQ-5D], Zung depression scale, Oswestry disability index [ODI], Million score, and back and leg pain visual analog scale [VAS]) and underwent physical examination twenty-nine years (range, twenty-three to thirty-five years) after surgery. The mean age at the time of follow-up was forty-three years (range, thirty-seven to fifty-one years). In the absence of a formal control group, the scores on the SF-36 and EQ-5D were compared with Swedish normative data. The proportion of patients at work was compared with an age-matched control group derived from official statistics of Sweden. The Million score at the long-term follow-up was compared with the corresponding results at the mid-term follow-up of the same patients at a mean age of twenty-two years. The scores on the SF-36 and EQ-5D were similar to the scores of the general Swedish population. The mean Zung depression scale score was 30 (range, 20 to 52), the mean ODI score was 10 (range, 0 to 34), the mean back pain VAS score was 13 (range, 0 to 72), and the mean leg pain VAS score was 9 (range, 0 to 60). The Million score averaged 28 (range, 0 to 109) and was slightly worsened compared with the score of 19 (range, 0 to 94) at the mid-term follow-up (p = 0.034). The proportion of patients at work was the same as that for the age-matched general Swedish population. Our study shows good outcomes in health-related quality of life, disability, pain, and ability to work at up to twenty-nine years after in situ lumbar spine arthrodesis for high

Seven-laser diode end-pumped Nd

International Nuclear Information System (INIS)

Berger, J.; Welch, D.F.; Streifer, W.; Scifres, D.R.; Smith, J.J.; Hoffman, H.J.; Peisley, D.; Radecki, D.

1988-01-01

End pumping of solid-state lasers by single semiconductor laser diode arrays (LDAs) is efficient, but the maximum pump power is limited by the source brightness and matching the TEM/sub 00/ Nd:YAG cavity mode. To increase the output power from a solid-state Nd:YAG laser, one option is to employ a multiplicity of LDA to provide more pump power than is available from a single source. The authors report herein a 660-mW cw TEM/sub 00/ Nd:YAG laser, end-pumped by seven LDA, with bundled optical fibers coupling the light from each diode to the Nd:YAG rod end. The maximum electrical-to-optical conversion efficiency attained was 4.7% at 560-mW Nd:YAG output power. The LDAs (SDL-2430-C, 100 μm wide) were mounted on separate thermoelectric coolers to tune emission wavelength to the Nd:YAG absorption bands. The diodes were operated at their rated output power (50,000 h mean time to failure). The 110/125-μm diam 0.37-N.A. fibers were butt coupled to the lasers and glued together into a hexagonal close pack. The authors have obtained the highest average power demonstrated to date in the TEM/sub 00/ mode from a Nd:YAG laser, reliably end-pumped by multiple laser diodes with good efficiency

Nuclear power in the twenty-first century - An assessment (Part 1)

OpenAIRE

von Hirschhausen, Christian

2017-01-01

Nuclear power was one of the most important discoveries of the twentieth century, and it continues to play an important role in twenty-first century discussions about the future energy mix, climate change, innovation, proliferation, geopolitics, and many other crucial policy topics. This paper addresses some key issues around the emergence of nuclear power in the twentieth century and perspectives going forward in the twenty-first, including questions of economics and competitiveness, the str...

Twenty-first workshop on geothermal reservoir engineering: Proceedings

Energy Technology Data Exchange (ETDEWEB)

None

1996-01-26

PREFACE The Twenty-First Workshop on Geothermal Reservoir Engineering was held at the Holiday Inn, Palo Alto on January 22-24, 1996. There were one-hundred fifty-five registered participants. Participants came from twenty foreign countries: Argentina, Austria, Canada, Costa Rica, El Salvador, France, Iceland, Indonesia, Italy, Japan, Mexico, The Netherlands, New Zealand, Nicaragua, the Philippines, Romania, Russia, Switzerland, Turkey and the UK. The performance of many geothermal reservoirs outside the United States was described in several of the papers. Professor Roland N. Horne opened the meeting and welcomed visitors. The key note speaker was Marshall Reed, who gave a brief overview of the Department of Energy's current plan. Sixty-six papers were presented in the technical sessions of the workshop. Technical papers were organized into twenty sessions concerning: reservoir assessment, modeling, geology/geochemistry, fracture modeling hot dry rock, geoscience, low enthalpy, injection, well testing, drilling, adsorption and stimulation. Session chairmen were major contributors to the workshop, and we thank: Ben Barker, Bobbie Bishop-Gollan, Tom Box, Jim Combs, John Counsil, Sabodh Garg, Malcolm Grant, Marcel0 Lippmann, Jim Lovekin, John Pritchett, Marshall Reed, Joel Renner, Subir Sanyal, Mike Shook, Alfred Truesdell and Ken Williamson. Jim Lovekin gave the post-dinner speech at the banquet and highlighted the exciting developments in the geothermal field which are taking place worldwide. The Workshop was organized by the Stanford Geothermal Program faculty, staff, and graduate students. We wish to thank our students who operated the audiovisual equipment. Shaun D. Fitzgerald Program Manager.

Summary record of the twenty-seventh meeting

International Nuclear Information System (INIS)

Young, P.

1990-01-01

The topics presented and discussed at the twenty-seventh international meeting of the Nuclear Data Committee of the Nuclear Energy Agency are summarized. Relations with other committees and reports of data centers are analyzed. Problems concerning nuclear model codes are underlined. National evaluation efforts on data library and data file are reported. Reports from several laboratories and subcommittees are summarized

Clostridium difficile infection in Chilean patients submitted to hematopoietic stem cell transplantation

Directory of Open Access Journals (Sweden)

Javier Pilcante

2015-12-01

Full Text Available ABSTRACT Introduction: Patients submitted to hematopoietic stem cell transplantation have an increased risk of Clostridium difficile infection and multiple risk factors have been identi- fied. Published reports have indicated an incidence from 9% to 30% of transplant patients however to date there is no information about infection in these patients in Chile. Methods: A retrospective analysis was performed of patients who developed C. difficile infection after hematopoietic stem cell transplantations from 2000 to 2013. Statistical analysis used the Statistical Package for the Social Sciences software. Results: Two hundred and fifty patients were studied (mean age: 39 years; range: 17-69, with 147 (59% receiving allogeneic transplants and 103 (41% receiving autologous trans- plants. One hundred and ninety-two (77% patients had diarrhea, with 25 (10% cases of C. difficile infection being confirmed. Twenty infected patients had undergone allogeneic trans- plants, of which ten had acute lymphoblastic leukemia, three had acute myeloid leukemia and seven had other diseases (myelodysplastic syndrome, chronic myeloid leukemia, severe aplastic anemia. In the autologous transplant group, five patients had C. difficile infection; two had multiple myeloma, one had amyloidosis, one had acute myeloid leukemia and one had germinal carcinoma. The overall incidence of C. difficile infection was 4% within the first week, 6.4% in the first month and 10% in one year, with no difference in overall survival between infected and non-infected groups (72.0% vs. 67.6%, respectively; p-value = 0.56. Patients infected after allogeneic transplants had a slower time to neutrophil engraftment compared to non-infected patients (17.5 vs. 14.9 days, respectively; p-value = 0.008. In the autologous transplant group there was no significant difference in the neutrophil engraftment time between infected and non-infected patients (12.5 days vs. 11.8 days, respectively; p

MR features of bursitis around the hip

International Nuclear Information System (INIS)

Lee, Kyung Joo; Sung, Mi Sook; Yu, Won Jong; You, Ie Ryung; Yang, Hae Jeom; Lee, Hae Giu; Im, Jung Ik

1998-01-01

To determine the usefulness of MR imaging for differentiation between infectious and non-infectious bursitis. MR images of 16 patients (18 lesions) in whom bursitis around the hip had been diagnosed were analyzed for homogeneity of the bursa, the presence of septation, the enhancement pattern, and associated findings. Clinical data (symptoms and signs, laboratory data, aspiration of the bursa, and surgical findings) were available for correlation. The location of bursitis was trochanteric (n=3D9), ischiogluteal (n=3D5), iliopsoas (n=3D3), or ischiotrochanteric (n=3D1). Etiologies included infection in seven cases (3 pyogenic; 4 tuberculous) and noninfection in 11 (6 inflammation; 3 hemorrhage; 2 metabolic disease). In seven patients with infectious bursitis, T1-weighted enhanced image revealed thick rim enhancement of the bursa (n=3D7) association with changes in bone marrow signal intensity (n=3D2), bone erosion (n=3D2), and cellulitis (n=3D1). Of 11 cases of noninfectious bursitis, three demonstrated typical signal characteristics of hematoma within the distended bursa. In six of seven patients who underwent contrast-enhancement, thick and thin peripheral enhancement of the bursa was noted. Bone erosion was found in one case of tuberculous bursitis and two of metabolic disease. Internal septation (n=3D4) and internal debris (n=3D3) were found in both infected and noninfected patients. MR imaging plays an important role in the diagnosis of bursitis around the hip. MR findings of thick rim enhancement, associated cellulitis, and changes in bone marrow signal intensity are suggestive of infectious bursitis.=20

MR features of bursitis around the hip

Energy Technology Data Exchange (ETDEWEB)

Lee, Kyung Joo; Sung, Mi Sook; Yu, Won Jong; You, Ie Ryung; Yang, Hae Jeom; Lee, Hae Giu; Im, Jung Ik [The Catholic Univ. of Korea Holy Family Hospital, Puchun (Korea, Republic of)

1998-12-01

To determine the usefulness of MR imaging for differentiation between infectious and non-infectious bursitis. MR images of 16 patients (18 lesions) in whom bursitis around the hip had been diagnosed were analyzed for homogeneity of the bursa, the presence of septation, the enhancement pattern, and associated findings. Clinical data (symptoms and signs, laboratory data, aspiration of the bursa, and surgical findings) were available for correlation. The location of bursitis was trochanteric (n=3D9), ischiogluteal (n=3D5), iliopsoas (n=3D3), or ischiotrochanteric (n=3D1). Etiologies included infection in seven cases (3 pyogenic; 4 tuberculous) and noninfection in 11 (6 inflammation; 3 hemorrhage; 2 metabolic disease). In seven patients with infectious bursitis, T1-weighted enhanced image revealed thick rim enhancement of the bursa (n=3D7) association with changes in bone marrow signal intensity (n=3D2), bone erosion (n=3D2), and cellulitis (n=3D1). Of 11 cases of noninfectious bursitis, three demonstrated typical signal characteristics of hematoma within the distended bursa. In six of seven patients who underwent contrast-enhancement, thick and thin peripheral enhancement of the bursa was noted. Bone erosion was found in one case of tuberculous bursitis and two of metabolic disease. Internal septation (n=3D4) and internal debris (n=3D3) were found in both infected and noninfected patients. MR imaging plays an important role in the diagnosis of bursitis around the hip. MR findings of thick rim enhancement, associated cellulitis, and changes in bone marrow signal intensity are suggestive of infectious bursitis.=20.

Impotence after mesorectal and close rectal dissection for inflammatory bowel disease.

Science.gov (United States)

Lindsey, I; George, B D; Kettlewell, M G; Mortensen, N J

2001-06-01

Close rectal dissection is a surgical technique used by some surgeons in inflammatory bowel disease. It is performed within the mesorectum, close to the rectal muscle wall, with the aim of minimizing damage to the pelvic sexual nerves. Other surgeons dissect in the more anatomical mesorectal plane. Our aim was to determine whether close rectal dissection is more protective of the pelvic sexual nerves than mesorectal dissection. Patients undergoing surgery for inflammatory bowel disease were entered prospectively into a database. Male patients were mailed a standardized, validated, urologic impotence questionnaire: the International Index of Erectile Function. There was an 81 percent response rate. Six of 156 assessable patients were totally impotent (3.8 percent). They were all in the 50-year-old to 70-year-old age group, with no impotence in patients younger than 50 years old. Twenty-one patients complained of minor diminution of erectile function (13.5 percent), where sexual activity was still possible. There was no statistical difference in the rate of complete (2.2 percent vs. 4.5 percent, P = 0.67) or partial (13.5 percent vs. 13.3 percent, P = 0.99) impotence between close rectal and mesorectal dissection (Fisher's exact test). There were no ejaculatory difficulties. The time elapsed since surgery ranged from 2.7 months to 192.7 months, with a median of 74.5 months. Rectal excision for inflammatory bowel disease can be conducted with low rates of impotence. Minor degrees of erectile dysfunction may be more common than currently recognized. We could not demonstrate that close rectal dissection significantly protects the patient from impotence compared with operating in the anatomical mesorectal plane. Age appears to be the most important risk factor for postoperative impotence.

On H-closed and U-closed functions | Cammaroto | Quaestiones ...

African Journals Online (AJOL)

In this article, we extend the work on H-closed functions started by Cammaroto, Fedorchuk and Porter in 1998. Also, U-closed functions are introduced and characterized in terms of filters and adherence. The hereditary and productivity properties are examined and developed for both H-closed and U-closed functions.

An informatics research agenda to support precision medicine: seven key areas.

Science.gov (United States)

Tenenbaum, Jessica D; Avillach, Paul; Benham-Hutchins, Marge; Breitenstein, Matthew K; Crowgey, Erin L; Hoffman, Mark A; Jiang, Xia; Madhavan, Subha; Mattison, John E; Nagarajan, Radhakrishnan; Ray, Bisakha; Shin, Dmitriy; Visweswaran, Shyam; Zhao, Zhongming; Freimuth, Robert R

2016-07-01

The recent announcement of the Precision Medicine Initiative by President Obama has brought precision medicine (PM) to the forefront for healthcare providers, researchers, regulators, innovators, and funders alike. As technologies continue to evolve and datasets grow in magnitude, a strong computational infrastructure will be essential to realize PM's vision of improved healthcare derived from personal data. In addition, informatics research and innovation affords a tremendous opportunity to drive the science underlying PM. The informatics community must lead the development of technologies and methodologies that will increase the discovery and application of biomedical knowledge through close collaboration between researchers, clinicians, and patients. This perspective highlights seven key areas that are in need of further informatics research and innovation to support the realization of PM. © The Author 2016. Published by Oxford University Press on behalf of the American Medical Informatics Association.

Digital earth applications in the twenty-first century

NARCIS (Netherlands)

de By, R.A.; Georgiadou, P.Y.

2014-01-01

In these early years of the twenty-first century, we must look at how the truly cross-cutting information technology supports other innovations, and how it will fundamentally change the information positions of government, private sector and the scientific domain as well as the citizen. In those

Radiation curing - twenty five years on

International Nuclear Information System (INIS)

Garnett, J.L.

1995-01-01

Progress in UV/EB curing during the past twenty five years is briefly reviewed. During this time developments in unique polymer chemistry, novel equipment design and the introduction of relevant educational programmes has enabled radiation curing to become an established technology with specific strengths in certain industries. Possible reasons for the emergence of the technology in these niche markets are discussed. Despite the worldwide recession, radiation curing is shown to be expanding at 5% per annum with the prospect of higher growth with improving economic conditions. (Author)

Early twenty-first-century droughts during the warmest climate

Directory of Open Access Journals (Sweden)

Felix Kogan

2016-01-01

Full Text Available The first 13 years of the twenty-first century have begun with a series of widespread, long and intensive droughts around the world. Extreme and severe-to-extreme intensity droughts covered 2%–6% and 7%–16% of the world land, respectively, affecting environment, economies and humans. These droughts reduced agricultural production, leading to food shortages, human health deterioration, poverty, regional disturbances, population migration and death. This feature article is a travelogue of the twenty-first-century global and regional droughts during the warmest years of the past 100 years. These droughts were identified and monitored with the National Oceanic and Atmospheric Administration operational space technology, called vegetation health (VH, which has the longest period of observation and provides good data quality. The VH method was used for assessment of vegetation condition or health, including drought early detection and monitoring. The VH method is based on operational satellites data estimating both land surface greenness (NDVI and thermal conditions. The twenty-first-century droughts in the USA, Russia, Australia and Horn of Africa were intensive, long, covered large areas and caused huge losses in agricultural production, which affected food security and led to food riots in some countries. This research also investigates drought dynamics presenting no definite conclusion about drought intensification or/and expansion during the time of the warmest globe.

Safety regulation - twenty years after Chernobyl accident

International Nuclear Information System (INIS)

Aleksashin, P.P.; Bukrinskij, A.M.; Gordon, B.G.

2006-01-01

Main stages of development, successes, achievements and shortcomings of activity of supervision body after the Chernobyl NPP accident are analysed. The estimation of the realized variations of the functions of the state supervision department is carried out. Results of the twenty year period of improvement of the supervision body are summed up. The measures for increasing the efficiency of the supervision body operation are outlined [ru

Nitrogen recycling and methane production using Gracilaria tikvahiae: a closed system approach

Energy Technology Data Exchange (ETDEWEB)

Habig, C.; Andrews, D.A.; Ryther, J.H.

1984-01-01

The macroalga Gracilaria tikvahiae (Rhodophyta) was used in a closed system of materials to study methane production and nitrogen recycling. Twenty liter carboys served as digesters. The performance of these digesters mirrors results obtained with two- and four litre Gracilaria digesters with respect to optimal retention times for biogas production, methane content, and bioconversion efficiency to methane. Three groups of Gracilaria were cultivated in 850-L vaults to compare growth performance under three different enrichment treatments. These treatments consisted of an unfertilized group, a group raised on a typical commercial enrichment regime, and a group raised on the residues removed from the digester when additional substrate was loaded into the digester. The results indicate that growth of Gracilaria on the digester residue enrichment scheme is statistically similar to growth using a commercial enrichment mixture. In addition, the nitrogen content of the digester residue is described, along with nitrogen assimilation by Gracilaria and nitrogen recycling efficiencies. Both nitrogen assimilation and recycling efficiency closely parallel the ammonium content of the residue enrichment media. (Refs. 18).

Characteristic Processes in Close Peer Friendships of Preterm Infants at Age 12

Directory of Open Access Journals (Sweden)

Mary C. Sullivan

2012-01-01

Full Text Available Close friendships become important at middle-school age and are unexplored in adolescents born prematurely. The study aimed to characterize friendship behaviors of formerly preterm infants at age 12 and explore similarities and differences between preterm and full-term peers on dyadic friendship types. From the full sample of N=186, one hundred sixty-six 12-year-old adolescents (40 born full term, 126 born preterm invited a close friend to a 1.5 hour videotaped laboratory play session. Twenty adolescents were unable to participate due to scheduling conflicts or developmental disability. Characteristic friendship behaviors were identified by Q-sort followed by Q-factoring analysis. Friendship duration, age, and contact differed between the full-term and preterm groups but friendship activities, behaviors, and quality were similar despite school service use. Three Q-factors, leadership, distancing, and mutual playfulness, were most characteristic of all dyads, regardless of prematurity. These prospective, longitudinal findings demonstrate diminished prematurity effects at adolescence in peer friendship behavior and reveal interpersonal dyadic processes that are important to peer group affiliation and other areas of competence.

Simultaneous Determination of Seven Constituents in Herbal ...

African Journals Online (AJOL)

Simultaneous Determination of Seven Constituents in Herbal Prescription Jaeumganghwa-Tang Using HPLC-PDA. CS Seo, JH Kim, HK Shin. Abstract. A simple and accurate high-performance liquid chromatographic method was applied to the quantitative analysis of seven components of the traditional herbal prescription ...

High-Intensity Focused Ultrasound for the Treatment of Wrinkles and Skin Laxity in Seven Different Facial Areas.

Science.gov (United States)

Park, Hyunchul; Kim, Eunjin; Kim, Jeongeun; Ro, Youngsuck; Ko, Jooyeon

2015-12-01

High-intensity focused ultrasound (HIFU) treatment has recently emerged in response to the increasing demand for noninvasive procedures for skin lifting and tightening. This study was aimed at evaluating the clinical efficacy of and patient satisfaction with HIFU treatment for wrinkles and laxity in seven different areas of the face in Asian skin. Twenty Korean patients with facial wrinkle and laxity were analyzed after a single session of HIFU treatment. Two independent, blinded clinicians evaluated the clinical improvement in seven areas of the face by comparison of standardized photographs obtained before, and at 3 and 6 months after treatment. Assessment of subjective satisfaction and adverse effects of treatment were done by using questionnaires. The physicians' evaluation and patients' satisfaction with the clinical effects of HIFU in each area were similar regardless of the number of treatment shots. The jawline, cheek, and perioral areas were the sites where HIFU was most effective, in decreasing order. The adverse effects included erythema and swelling in six cases, and purpura and bruising in two cases. However, the adverse effects were mild and transient. HIFU could be a safe, effective, and noninvasive procedure that can be used to improve facial wrinkles and skin laxity in Asian skin. It is particularly effective for clinical improvement in the jawline, cheek, and perioral areas.

Simultaneous quantification of seven hippocampal neurotransmitters in depression mice by LC-MS/MS.

Science.gov (United States)

Huang, Fei; Li, Jia; Shi, Hai-Lian; Wang, Ting-ting; Muhtar, Wahaf; Du, Min; Zhang, Bei-bei; Wu, Hui; Yang, Li; Hu, Zhi-bi; Wu, Xiao-jun

2014-05-30

There is no method available to simultaneously detect GABA, Glu, Epi, NE, DA, 5-HT and 5-HIAA in mouse hippocampus. A rapid and sensitive LC-MS/MS method has been developed for simultaneously measuring seven neurotransmitters in mouse hippocampus. The analytes were detected in positive mode with multiple reaction monitoring (MRM) and the procedure was completed in less than 9min. This method exhibited excellent linearity for all of the analytes with regression coefficients higher than 0.99, and showed good intra- and inter-day precisions (RSDneurotransmitters in a mouse depression model induced by successive methylprednisolone injections. The results indicated that this depression model was closely associated with the decreased level of Epi (p=0.002) and elevated ratio of 5-HIAA/5-HT (p=0.01), which has never been reported elsewhere. Compared with previous methods, current approach is more convenient without any pre-column derivatization of the analytes but enhances detectability with incremental neurotransmitter profile and shortens detection time. This work represents the first accurate simultaneous determination of seven neurotransmitters in the mouse depression model induced by methylprednisolone. The reliable method will benefit the research of neurological diseases with the altered neurotransmitter profile in brain. Copyright © 2014 Elsevier B.V. All rights reserved.

Close or positive margins after surgical resection for the head and neck cancer patient: the addition of brachytherapy improves local control

International Nuclear Information System (INIS)

Beitler, Jonathan J.; Smith, Richard V.; Silver, Carl E.; Quish, Astrid; Deore, Shivaji M.; Mullokandov, Eduard; Fontenla, Doracy P.; Wadler, Scott; Hayes, Mary Katherine; Vikram, Bhadrasain

1998-01-01

Purpose: Microscopically positive or close margins after surgical resection results in an approximately 21-26% local failure rate despite excellent postoperative external radiation therapy. We sought to demonstrate improved local control in head and neck cancer patients who had a resection with curative intent, and had unexpected, microscopically positive or close surgical margins. Methods and Materials: Twenty-nine patients with microscopically close or positive margins after curative surgery were given definitive, adjuvant external radiation therapy and 125 I brachytherapy. All 29 patients had squamous cell cancer and tonsil was the most common subsite within the head and neck region. After external radiation therapy and thorough discussions with the attending surgeon and pathologists, the slides, gross specimens, and appropriate radiographs were reviewed and a target volume was determined. The target volume was the region of the margin in question and varied in size based on the surgery and pathologic results. Once the target volume was identified the patient was taken back to the operating room for insertion of 125 I seeds. Activity implanted (range 2.9-21.5 millicuries) was designed to administer a cumulative lifetime dose of 120-160 Gy. Results: Twenty-nine patients were followed for a median of 26 months (range 5-86 months). Two-year actuarial local control was 92%. Conclusion: 125 I, after external radiation therapy, is an excellent method to improve local control in the subset of patients with unexpectedly unsatisfactory margins

Seven years after Chernobyl

International Nuclear Information System (INIS)

Siwicki, R.

1993-01-01

The paper contains information of the WHO about the state of public health in Russia, Ukraine and Belarus seven years after the Chernobyl accident. The results of medical investigations obtained after two years run of IPHECA project have been also presented

Seven Deadliest Wireless Technologies Attacks

CERN Document Server

Haines, Brad

2010-01-01

How can an information security professional keep up with all of the hacks, attacks, and exploits? One way to find out what the worst of the worst are is to read the seven books in our Seven Deadliest Attacks Series. Not only do we let you in on the anatomy of these attacks but we also tell you how to get rid of them and how to defend against them in the future. Countermeasures are detailed so that you can fight against similar attacks as they evolve. Attacks featured in this book include:Bluetooth AttacksCredit Card, Access Card, and Passport AttacksBad Encryption

A conserved aromatic lock for the tryptophan rotameric switch in TM-VI of seven-transmembrane receptors

DEFF Research Database (Denmark)

Holst, Birgitte; Nygaard, Rie; Hansen, Louise Valentin

2010-01-01

simulations in rhodopsin demonstrated that rotation around the chi1 torsion angle of Trp-VI:13 brings its side chain close to the equally highly conserved Phe-V:13 (Phe-5.47) in TM-V. In the ghrelin receptor, engineering of high affinity metal-ion sites between these positions confirmed their close spatial...... degree as observed in the constructs where Trp-VI:13 itself was mutated, but again without affecting agonist potency. In a proposed active receptor conformation generated by molecular simulations, where the extracellular segment of TM-VI is tilted inwards in the main ligand-binding pocket, Trp-VI:13......The conserved tryptophan in position 13 of TM-VI (Trp-VI:13 or Trp-6.48) of the CWXP motif located at the bottom of the main ligand-binding pocket in TM-VI is believed to function as a rotameric microswitch in the activation process of seven-transmembrane (7TM) receptors. Molecular dynamics...

Biosphere II: engineering of manned, closed ecological systems.

Science.gov (United States)

Dempster, W F

1991-01-01

Space Biospheres and Ventures, a private, for-profit firm, has undertaken a major research and development project in the study of biospheres, with the objective of creating and producing biospheres. Biosphere II-scheduled for completion in March 1991-will be essentially isolated from the existing biosphere by a closed structure, composed of components derived from the existing biosphere. Like the biosphere of the Earth, Biosphere II will be essentially closed to exchanges of material or living organisms with the surrounding environment and open to energy and information exchanges. Also, like the biosphere of the Earth, Biosphere II will contain five kingdoms of life, a variety of ecosystems, plus humankind, culture, and technics. The system is designed to be complex, stable and evolving throughout its intended 100-year lifespan, rather than static. Biosphere II will cover approximately 1.3 hectare and contain 200,000 m3 in volume, with seven major biomes: tropical rainforest, tropical savannah, marsh, marine, desert, intensive agriculture, and human habitat. An interdisciplinary team of leading scientific, ecological, management, architectural, and engineering consultants have been contracted by Space Biospheres Ventures for the project. Potential applications for biospheric systems include scientific and ecological management research, refuges for endangered species, and life habitats for manned stations on spacecraft or other planets.

Seven durable ideas.

Science.gov (United States)

Glaser, John P

2008-01-01

Partners Healthcare, and its affiliated hospitals, have a long track record of accomplishments in clinical information systems implementations and research. Seven ideas have shaped the information systems strategies and tactics at Partners; centrality of processes, organizational partnerships, progressive incrementalism, agility, architecture, embedded research, and engage the field. This article reviews the ideas and discusses the rationale and steps taken to put the ideas into practice.

Child abuse and neglect as seen in General Hospital, Kuala Lumpur--a two year study.

Science.gov (United States)

Kassim, M S; George, R; Kassim, K; Begum, M; Cherian, M P; Tajudin, A K; Chandran, V; Anan, A; Reddy, R; Singh, J

1989-06-01

Eighty-six children diagnosed as child abuse and/or neglect were admitted to the Paediatric wards of the General Hospital, Kuala Lumpur during 1985 and 1986. Of these cases, 62 were of physical abuse, six of sexual abuse, one case of both physical and sexual abuse and 17 of neglect. There were 25 boys and 61 girls. Thirty-four of these children were Malays, 16 Chinese, 26 Indians, three mixed and seven illegal immigrants. Twenty-one were below the age of one year, 24 from one to four years, 25 from five to nine years and 16 were ten years and above. The abusers were mainly close members of the family. Of these children, 24 were sent back to their parents and 11 to their relatives home. Twenty-seven were taken into care by the Ministry of Social Welfare and the remaining seven children who were illegal immigrants, were deported with their parents. Only one child was successfully fostered. Eleven children were taken away from the hospital by their parents or guardians without the knowledge of the health staff. There were five deaths in the series.

SEAPOWER: A GUIDE FOR THE TWENTY- FIRST CENTURY

African Journals Online (AJOL)

Abel

$154,37 (amazon.com hardback). With the publication of Seapower: A Guide for the Twenty-First Century. Geoffrey Till has set the standard for publications on all things maritime. The updated and expanded new edition of the book is an essential guide for students of naval history and maritime strategy and provides ...

Twenty-five years of modeling multiphase flow and heat transfer

International Nuclear Information System (INIS)

Lyczkowski, R.W.

1999-01-01

This presentation will cover some of the highlights of multiphase modeling in collaboration with Professor Dimitri Gidaspow (DG) over the last roughly twenty-five years. It all started in 1972 in Idaho Falls with Charles Solbrig, who planned and initiated a project for the former USAEC to develop a computer code to replace RELAP4 to analyze the loss of coolant accident (LOCA). DG spent his sabbatical on the project in 1973. One highlight was the discovery of complex characteristics, the implications of which are still pondered by some. Fluidization research began in 1978 when the author collaboratively developed a step-by-step building-block approach to understanding the hydrodynamics of fluidized beds, an approach closely coupled to validation experiments. A grant from the USDOE to study solids circulation around a jet in a fluidized bed was awarded to DG in 1978. Following that, grants from GRI, NSF, and a contract from Westinghouse Electric Corp. allowed the early work to continue. Progress was slow since computer costs were high. Subsequent continuing support from the USDOE, NSF, EPRI, and industry has allowed research to continue, as has his collaboration. A highlight of this collaboration was the development of the monolayer energy dissipation (MED) erosion model. Multiphase flow and fluidization theory took quantum leaps with the publication of DG's Multiphase Flow and Fluidization: Continuum and Kinetic Theory Descriptions (MFF), Academic Press, San Diego (1994), for which there is essentially no competition. Only the late Professor S.L. Soo's Particulates and Continuum: Multiphase Fluid Dynamics, Hemisphere Publishing Corp., New York (1989), a textbook version of the classic monograph Multiphase Fluid Dynamics, Science Press, Beijing, China (1990), comes close. In MFF, the kinetic theory of granular flow has evolved as a potentially viable adjunct to the continuum multiphase theory, of which fluidization is one important manifestation. It must be

Twenty-first century vaccines

Science.gov (United States)

Rappuoli, Rino

2011-01-01

In the twentieth century, vaccination has been possibly the greatest revolution in health. Together with hygiene and antibiotics, vaccination led to the elimination of many childhood infectious diseases and contributed to the increase in disability-free life expectancy that in Western societies rose from 50 to 78–85 years (Crimmins, E. M. & Finch, C. E. 2006 Proc. Natl Acad. Sci. USA 103, 498–503; Kirkwood, T. B. 2008 Nat. Med 10, 1177–1185). In the twenty-first century, vaccination will be expected to eliminate the remaining childhood infectious diseases, such as meningococcal meningitis, respiratory syncytial virus, group A streptococcus, and will address the health challenges of this century such as those associated with ageing, antibiotic resistance, emerging infectious diseases and poverty. However, for this to happen, we need to increase the public trust in vaccination so that vaccines can be perceived as the best insurance against most diseases across all ages. PMID:21893537

Vesico-vaginal fistula repair: experience with first twenty-three ...

African Journals Online (AJOL)

Vesico-vaginal fistula repair: experience with first twenty-three patients seen at a tertiary hospital in north-central Nigeria. Stephen D. Ngwan, Bassey E. Edem, Ajen S. Anzaku, Barnabas A. Eke, Mohammed A. Shittu, Solomon A. Obekpa ...

Deformation quantization: Twenty years after

International Nuclear Information System (INIS)

Sternheimer, Daniel

1998-01-01

We first review the historical developments, both in physics and in mathematics, that preceded (and in some sense provided the background of) deformation quantization. Then we describe the birth of the latter theory and its evolution in the past twenty years, insisting on the main conceptual developments and keeping here as much as possible on the physical side. For the physical part the accent is put on its relations to, and relevance for, 'conventional' physics. For the mathematical part we concentrate on the questions of existence and equivalence, including most recent developments for general Poisson manifolds; we touch also noncommutative geometry and index theorems, and relations with group theory, including quantum groups. An extensive (though very incomplete) bibliography is appended and includes background mathematical literature

Policies for closing down nuclear power plants. A Spanish review

International Nuclear Information System (INIS)

Ruiz del Olmo, G.A.

2000-01-01

A review of policies concerned with closing down the Spanish nuclear power plants is described, together with the role of Spanish Group of Municipalities affected by NPPs (AMAC) since its establishment in 1988. Currently there are 9 nuclear reactors operating in seven cities, contributing to the national network bu 39.3% of gross power generation, and one reactor dismantled after the accident in Vandellos in 1989. The main objectives of AMAC activity are concerned with security, economic development and transparency. It has an important role in improvement of the quality of life of the population in municipalities with operating NPPs. It is involved in solving the problems related to radioactive waste management and disposal

Irrigation quality of ground water of twenty villages in Lahore district

Directory of Open Access Journals (Sweden)

M.S. Ali

2009-05-01

Full Text Available study was conducted in twenty villages of Lahore district to assess the suitability of ground water for irrigation. Three water samples were collected from each of twenty villages and were analyzed for electrical conductivity (EC, sodium adsorption ratio (SAR, residual sodium carbonate (RSC and chloride concentration. Out of total 60 water samples, 7 (11.7% were fit, 7 (11.7% were marginally fit, and remaining 46 (76.6% were unfit for irrigation. Twenty eight samples (46.6% had electrical conductivity higher than permissible limit (i.e. >1250 µS cm-1, 19 samples (31.6% were found with high SAR (i.e. >10 (m mol L-10. 5, 44 samples (73.3% had high RSC (i.e. >2.5 me L-1 and 10 samples (16.6% were found unfit for irrigation due to high concentration of chloride (i.e. >3.9 me L-1. It can be inferred from data that quality of available ground water in most ofthe villages is not suitable for sustainable crop production and soil health.

CoRoT’s first seven planets: An overview*

Directory of Open Access Journals (Sweden)

Barge P.

2011-07-01

Full Text Available The up to 150 day uninterrupted high-precision photometry of about 100000 stars – provided so far by the exoplanet channel of the CoRoT space telescope – gave a new perspective on the planet population of our galactic neighbourhood. The seven planets with very accurate parameters widen the range of known planet properties in almost any respect. Giant planets have been detected at low metallicity, rapidly rotating and active, spotted stars. CoRoT-3 populated the brown dwarf desert and closed the gap of measured physical properties between standard giant planets and very low mass stars. CoRoT extended the known range of planet masses down-to 5 Earth masses and up to 21 Jupiter masses, the radii to less than 2 Earth radii and up to the most inflated hot Jupiter found so far, and the periods of planets discovered by transits to 9 days. Two CoRoT planets have host stars with the lowest content of heavy elements known to show a transit hinting towards a different planet-host-star-metallicity relation then the one found by radial-velocity search programs. Finally the properties of the CoRoT-7b prove that terrestrial planets with a density close to Earth exist outside the Solar System. The detection of the secondary transit of CoRoT-1 at the 10−5-level and the very clear detection of the 1.7 Earth radii of CoRoT-7b at 3.5 10−4 relative flux are promising evidence of CoRoT being able to detect even smaller, Earth sized planets.

LHC: seven golden suppliers

CERN Multimedia

2005-01-01

The fourth CERN Golden Hadron awards saw seven of the LHC's best suppliers receive recognition for the high quality of their work, compliance with delivery deadlines, flexibility and adaptability to the demanding working conditions of the project. The representatives of the seven companies which received awards during the Golden Hadron ceremony, standing with Lyn Evans, LHC Project Leader. 'The Golden Hadron awards are a symbol of our appreciation of not only the quality and timely delivery of components but also the collaborative and flexible way the firms have contributed to this very difficult project,' said Lyn Evans, head of the LHC project. The awards went to Kemppi-Kempower (Finland), Metso Powdermet (Finland), Transtechnik (Germany), Babcock Noell Nuclear (Germany), Iniziative Industriali (Italy), ZTS VVU Kosice (Slovakia), and Jehier (France). Babock Noell Nuclear (BNN) successfully produced one-third (416 cold dipole masses) of the LHC's superconducting dipole magnets, one of the most critical an...

Disease management for chronically ill beneficiaries in traditional Medicare.

Science.gov (United States)

Bott, David M; Kapp, Mary C; Johnson, Lorraine B; Magno, Linda M

2009-01-01

We summarize the Centers for Medicare and Medicaid Services' (CMS's) experience with disease management (DM) in fee-for-service Medicare. Since 1999, the CMS has conducted seven DM demonstrations involving some 300,000 beneficiaries in thirty-five programs. Programs include provider-based, third-party, and hybrid models. Reducing costs sufficient to cover program fees has proved particularly challenging. Final evaluations on twenty programs found three with evidence of quality improvement at or near budget-neutrality, net of fees. Interim monitoring covering at least twenty-one months on the remaining fifteen programs suggests that four are close to covering their fees. Characteristics of the traditional Medicare program present a challenge to these DM models.

Seven Issues, Revisited

OpenAIRE

Whitehead, Jim; De Bra, Paul; Grønbæk, Kaj; Larsen, Deena; Legget, John; schraefel, monica m.c.

2002-01-01

It has been 15 years since the original presentation by Frank Halasz at Hypertext'87 on seven issues for the next generation of hypertext systems. These issues are: Search and Query Composites Virtual Structures Computation in/over hypertext network Versioning Collaborative Work Extensibility and Tailorability Since that time, these issues have formed the nucleus of multiple research agendas within the Hypertext community. Befitting this direction-setting role, the issues have been revisited ...

Twenty years of diffraction at the Tevatron

International Nuclear Information System (INIS)

Goulianos, K.; Rockefeller U.

2005-01-01

Results on diffractive particle interactions from the Fermilab Tevatron (bar p)p collider are placed in perspective through a QCD inspired phenomenological approach, which exploits scaling and factorization properties observed in data. The results discussed are those obtained by the CDF Collaboration from a comprehensive set of single, double, and multigap soft and hard diffraction processes studied during the twenty year period since 1985, when the CDF diffractive program was proposed and the first Blois Workshop was held

Close Approach Prediction Analysis of the Earth Science Constellation with the Fengyun-1C Debris

Science.gov (United States)

Duncan, Matthew; Rand, David K.

2008-01-01

Routine satellite operations for the Earth Science Constellation (ESC) include collision risk assessment between members of the constellation and other orbiting space objects. Each day, close approach predictions are generated by a U.S. Department of Defense Joint Space Operations Center Orbital Safety Analyst using the high accuracy Space Object Catalog maintained by the Air Force's 1" Space Control Squadron. Prediction results and other ancillary data such as state vector information are sent to NASAJGoddard Space Flight Center's (GSFC's) Collision Risk Assessment analysis team for review. Collision analysis is performed and the GSFC team works with the ESC member missions to develop risk reduction strategies as necessary. This paper presents various close approach statistics for the ESC. The ESC missions have been affected by debris from the recent anti-satellite test which destroyed the Chinese Fengyun- 1 C satellite. The paper also presents the percentage of close approach events induced by the Fengyun-1C debris, and presents analysis results which predict the future effects on the ESC caused by this event. Specifically, the Fengyun-1C debris is propagated for twenty years using high-performance computing technology and close approach predictions are generated for the ESC. The percent increase in the total number of conjunction events is considered to be an estimate of the collision risk due to the Fengyun-1C break- UP.

Toxicity of twenty-two plant essential oils against pathogenic bacteria of vegetables and mushrooms.

Science.gov (United States)

Todorović, Biljana; Potočnik, Ivana; Rekanović, Emil; Stepanović, Miloš; Kostić, Miroslav; Ristić, Mihajlo; Milijašević-Marčić, Svetlana

2016-12-01

ASBTRACT Toxicity of twenty-two essential oils to three bacterial pathogens in different horticultural systems: Xanthomonas campestris pv. phaseoli (causing blight of bean), Clavibacter michiganensis subsp. michiganensis (bacterial wilt and canker of tomato), and Pseudomonas tolaasii (causal agent of bacterial brown blotch on cultivated mushrooms) was tested. Control of bacterial diseases is very difficult due to antibiotic resistance and ineffectiveness of chemical products, to that essential oils offer a promising alternative. Minimal inhibitory and bactericidal concentrations are determined by applying a single drop of oil onto the inner side of each plate cover in macrodilution assays. Among all tested substances, the strongest and broadest activity was shown by the oils of wintergreen (Gaultheria procumbens), oregano (Origanum vulgare), and lemongrass (Cymbopogon flexuosus. Carvacrol (64.0-75.8%) was the dominant component of oregano oils, while geranial (40.7%) and neral (26.7%) were the major constituents of lemongrass oil. Xanthomonas campestris pv. phaseoli was the most sensitive to plant essential oils, being susceptible to 19 oils, while 11 oils were bactericidal to the pathogen. Sixteen oils inhibited the growth of Clavibacter michiganensis subsp. michiganensis and seven oils showed bactericidal effects to the pathogen. The least sensitive species was Pseudomonas tolaasii as five oils inhibited bacterial growth and two oils were bactericidal. Wintergreen, oregano, and lemongrass oils should be formulated as potential biochemical bactericides against different horticultural pathogens.

Melatonin Does Not Affect Oxidative/Inflammatory Biomarkers in a Closed-Chest Porcine Model of Acute Myocardial Infarction

DEFF Research Database (Denmark)

Halladin, Natalie L.; Ekelof, Sarah; Jensen, Svend Eggert

2014-01-01

Aim: To test whether melatonin reduces oxidative and inflammatory biomarkers in a closed-chest porcine model of acute myocardial infarction. Materials and Methods: Twenty pigs were randomized to receive a total dosage of 200 mg (0.4 mg/ml) of melatonin, or placebo immediately prior to reperfusion....... There was an increase in hs-TnT, but no significant difference between the melatonin-treated and placebo-treated groups. There were no significant differences in development of any of the circulating plasma markers between the two groups. Conclusion: Melatonin treatment did not result in reduction of inflammatory...

2006 Annual Report Summer Research Institute Interfacial and Condensed Phase Chemical Physics

Energy Technology Data Exchange (ETDEWEB)

Avery, Nikki B.; Barlow, Stephan E.

2006-11-10

The Pacific Northwest National Laboratory (PNNL) hosted its third annual Summer Research Institute in Interfacial and Condensed Phase Chemical Physics from May through September 2006. During this period, twenty PNNL scientists hosted twenty-seven scientists from twenty-five different universities. Of the twenty-seven participants, one was a graduating senior; twenty-one were graduate students; one was a postdoctoral fellow; and four were university faculty members.

Applicability and Effectiveness of Closed Reduction of Nasal Fractures under Local Anesthesia

Directory of Open Access Journals (Sweden)

Vilela, Fernando

2014-03-01

Full Text Available Introduction A significant portion of patients treated in emergency departments have nasal fracture. It is important that the otolaryngologist know how to treat such damage. Objectives To evaluate the effectiveness of nasal fracture reduction under local anesthesia and tolerance to the procedure. Methods Twenty-four patients treated in the emergency department with closed reduction under local anesthesia were prospectively followed. Epidemiologic information and data regarding pain and complications during the management were noted. The degree of satisfaction was researched by visual analog scale. Results The majority of patients were male (75%, and the most common cause of injury was motor vehicle accident. We found a significant association between time to reduction and referred pain during the procedure. In patients in whom the procedure was delayed (over 3 days, there was less pain, and those who bled during the procedure had a shorter average time to reduction than the group of patients who did not bleed. Most patients were very satisfied, with more than 95% of these willing to undergo the same process again, if necessary. Conclusions The closed approach in the clinic under local anesthesia was effective and safe in restoration of the nose.

Twenty-five years of simulator training

International Nuclear Information System (INIS)

Anon.

2002-01-01

The first training simulator for nuclear power plant personnel in Germany was commissioned twenty-five years ago. The strategy of training by simulators was developed and pursued consistently and continuously in order to ensure sound training of nuclear power plant personnel. The present thirteen simulators cover a broad range of plants. A systematic training concept also helps to ensure a high level of competence and permanent qualification of plant personnel. The anniversary was marked by a festive event at which Erich K. Steiner read a paper on 'The Importance of Simulator Training', and Professor Dr. Adolf Birkhofer spoke about 'Nuclear Technology Education and Training'. (orig.)

The Handicapped Worker: Seven Myths.

Science.gov (United States)

Lester, Rick A.; Caudill, Donald W.

1987-01-01

Refutes seven myths that keep employers from welcoming disabled persons into the workplace. Myths include higher turnover, lower productivity, greater safety risk, higher cost, more demanding, embarrassment, and incompatibility. Makes recommendations for managers. (CH)

The Seven Step Strategy

Science.gov (United States)

Schaffer, Connie

2017-01-01

Many well-intended instructors use Socratic or leveled questioning to facilitate the discussion of an assigned reading. While this engages a few students, most can opt to remain silent. The seven step strategy described in this article provides an alternative to classroom silence and engages all students. Students discuss a single reading as they…

77 FR 26550 - Notice of Need To File Updated Information for Some Closed Captioning Exemption Petitions

Science.gov (United States)

2012-05-04

...In this document, the Commission, via the Consumer and Governmental Affairs Bureau (Bureau) alerts certain entities that filed petitions for exemption from the Commission's closed captioning rules prior to the passage of the Twenty-First Century Communications and Video Accessibility Act of 2010 (CVAA), of the need to either (1) affirm that the information provided in their previously submitted petition is still accurate and up-to-date, (2) update previously submitted petitions with the information indicated below, or (3) withdraw their previously submitted petitions. The intended action is to ensure that information provided in each petition is current and accurate.

Intraoperative stroke volume optimization using stroke volume, arterial pressure, and heart rate: closed-loop (learning intravenous resuscitator) versus anesthesiologists.

Science.gov (United States)

Rinehart, Joseph; Chung, Elena; Canales, Cecilia; Cannesson, Maxime

2012-10-01

The authors compared the performance of a group of anesthesia providers to closed-loop (Learning Intravenous Resuscitator [LIR]) management in a simulated hemorrhage scenario using cardiac output monitoring. A prospective cohort study. In silico simulation. University hospital anesthesiologists and the LIR closed-loop fluid administration system. Using a patient simulator, a 90-minute simulated hemorrhage protocol was run, which included a 1,200-mL blood loss over 30 minutes. Twenty practicing anesthesiology providers were asked to manage this scenario by providing fluids and vasopressor medication at their discretion. The simulation program was also run 20 times with the LIR closed-loop algorithm managing fluids and an additional 20 times with no intervention. Simulated patient weight, height, heart rate, mean arterial pressure, and cardiac output (CO) were similar at baseline. The mean stroke volume, the mean arterial pressure, CO, and the final CO were higher in the closed-loop group than in the practitioners group, and the coefficient of variance was lower. The closed-loop group received slightly more fluid (2.1 v 1.9 L, p closed-loop maintained more stable hemodynamics than the practitioners primarily because the fluid was given earlier in the protocol and CO optimized before the hemorrhage began, whereas practitioners tended to resuscitate well but only after significant hemodynamic change indicated the need. Overall, these data support the potential usefulness of this closed-loop algorithm in clinical settings in which dynamic predictors are not available or applicable. Published by Elsevier Inc.

Technological sciences society of the twenty-first century

International Nuclear Information System (INIS)

1999-04-01

This book introduces information-oriented society of the twenty-first century connected to computer network for example memory of dream : F-ram, information-oriented society : New media, communications network for next generation ; ISDN on what is IDSN?, development of information service industry, from office automation to an intelligent building in the future, home shopping and home banking and rock that hinders information-oriented society.

Software quality assurance - seven years experience

International Nuclear Information System (INIS)

Malsbury, J.A.

1987-01-01

This paper describes seven years experience with software quality assurance at PPPL. It covers the early attempts of 1980 and 1981 to establish software quality assurance; the first attempt of 1982 to develop a complete software quality assurance plan; the significant modifications of this plan in 1985; and the future. In addition, the paper describes the role of the Quality Assurance organization within each plan. The scope of this paper is limited to discussions of the software development procedures used in the seven year period. Other software quality topics, such as configuration control or problem identification and resolution, are not discussed

Book Review: Africa and Europe in the Twenty-First Century ...

African Journals Online (AJOL)

Abstract. Title: Africa and Europe in the Twenty-First Century. Author: Osita C. Eze and Amadu Sesay. Publisher: Nigerian Institute of International Affairs, 2010, xvi + 397pp, Tables, Index. ISBN: 978-002-102-7 ...

Ununited fracture neck of femur treated with closed reduction and internal fixation with cancellous screw and fibular strut graft

Directory of Open Access Journals (Sweden)

Singh Daria

2006-01-01

Full Text Available Background: Ununited fracture neck of femur in young adults has been tackled in various ways. Methods: Twenty five patients of ununited fracture neck of femur in age group 21-55 years were treated by closed reduction, cancellous screw fixation and fibular strut graft and followed up for 2-6 years. Time gap between injury and operation was 6 weeks to 58 weeks. Five cases were previously fixed with various fixation devices. Results: Osseous union was achieved in 24 cases with average time of 18.16 weeks. Main complication encountered in follow-up was avascular necrosis of femoral head, others were joint stiffness and shortening. Functional end results were good to excellent in 24 cases. Conclusion: Closed reduction with internal fixation by cancellous screw and fibular strut grafting is easy and useful procedure.

China's iGeneration - Cinema and Moving Image Culture for the Twenty-First Century

OpenAIRE

Johnson, Matthew D.; Wagner, Keith B.; Yu, Tianqui; Vulpiani, Luke

2014-01-01

Collection of essays on twenty-first century Chinese cinema and moving image culture. This innovative collection of essays on twenty-first century Chinese cinema and moving image culture features contributions from an international community of scholars, critics, and practitioners. Taken together, their perspectives make a compelling case that the past decade has witnessed a radical transformation of conventional notions of cinema. Following China's accession to the WTO in 2001, personal ...

Guidelines to design engineering education in the twenty-first century for supporting innovative product development

Science.gov (United States)

Violante, Maria Grazia; Vezzetti, Enrico

2017-11-01

In the twenty-first century, meeting our technological challenges demands educational excellence, a skilled populace that is ready for the critical challenges society faces. There is widespread consensus, however, that education systems are failing to adequately prepare all students with the essential twenty-first century knowledge and skills necessary to succeed in life, career, and citizenship. The purpose of this paper is to understand how twenty-first century knowledge and skills can be appropriately embedded in engineering education finalised to innovative product development by using additive manufacturing (AM). The study designs a learning model by which to achieve effective AM education to address the requirements of twenty-first century and to offer students the occasion to experiment with STEM (Science, technology, engineering, and mathematics) concepts. The study is conducted using the quality function deployment (QFD) methodology.

45 CFR 5.68 - Exemption seven: Law enforcement.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Exemption seven: Law enforcement. 5.68 Section 5... INFORMATION REGULATIONS Reasons for Withholding Some Records § 5.68 Exemption seven: Law enforcement. We are not required to disclose information or records that the government has compiled for law enforcement...

The Seven Brothers. The changing world of petrochemical multinationals

International Nuclear Information System (INIS)

Van Ammelrooij, A.

2000-01-01

Since the eighties oil companies do not build their own drilling installations and refineries, but contract out such construction activities to engineering contractors. An overview is given of the market of the so-called Seven Brother (analogue to Seven Sisters for the oil companies) and the changes that are taking place at the moment. The Seven Brothers are Asea Brown Boveri (USA), Fluor Corp (US), Kvaerner ASA (Norway), Foster Wheeler (UK), Jacobs (USA), Morrison Knudsen (USA), and Parsons (UK)

Designing Vaccines for the Twenty-First Century Society

OpenAIRE

Finco, Oretta; Rappuoli, Rino

2014-01-01

The history of vaccination clearly demonstrates that vaccines have been highly successful in preventing infectious diseases, reducing significantly the incidence of childhood diseases and mortality. However, many infections are still not preventable with the currently available vaccines and they represent a major cause of mortality worldwide. In the twenty-first century, the innovation brought by novel technologies in antigen discovery and formulation together with a deeper knowledge of the h...

Gene : CBRC-DNOV-01-2512 [SEVENS

Lifescience Database Archive (English)

Full Text Available _HUMAN 2e-39 39% ref|XP_001364675.1| PREDICTED: similar to seven transmembrane helix receptor [Monodelphis d...LTVVSYVYIISTILKIPSGQD*RKASATCASHFTVVSMGYGISIFVYVCPSQKSSLHLSKILFIPSQCHHTSPKSLHLLSME ...

Gene : CBRC-GGOR-01-1244 [SEVENS

Lifescience Database Archive (English)

Full Text Available 97% ref|XP_521992.2| PREDICTED: similar to seven transmembrane helix receptor [Pan troglodytes] 3e-70 98% MV...ECFLLAVMAYDRYVAIRNPLLYTVAERNGTERNGTERNSMEWNGMEWNSMEWNGIQWNGMEWNGTVRNGTERNGMEFHGMEWNGMEFHGMEFNAMQRXXXXXXALLAQARTIELEIFLIT ...

Changes in the Proteome of Xylem Sap in Brassica oleracea in Response to Fusarium oxysporum Stress.

Science.gov (United States)

Pu, Zijing; Ino, Yoko; Kimura, Yayoi; Tago, Asumi; Shimizu, Motoki; Natsume, Satoshi; Sano, Yoshitaka; Fujimoto, Ryo; Kaneko, Kentaro; Shea, Daniel J; Fukai, Eigo; Fuji, Shin-Ichi; Hirano, Hisashi; Okazaki, Keiichi

2016-01-01

Fusarium oxysporum f.sp. conlutinans (Foc) is a serious root-invading and xylem-colonizing fungus that causes yellowing in Brassica oleracea. To comprehensively understand the interaction between F. oxysporum and B. oleracea, composition of the xylem sap proteome of the non-infected and Foc-infected plants was investigated in both resistant and susceptible cultivars using liquid chromatography-tandem mass spectrometry (LC-MS/MS) after in-solution digestion of xylem sap proteins. Whole genome sequencing of Foc was carried out and generated a predicted Foc protein database. The predicted Foc protein database was then combined with the public B. oleracea and B. rapa protein databases downloaded from Uniprot and used for protein identification. About 200 plant proteins were identified in the xylem sap of susceptible and resistant plants. Comparison between the non-infected and Foc-infected samples revealed that Foc infection causes changes to the protein composition in B. oleracea xylem sap where repressed proteins accounted for a greater proportion than those of induced in both the susceptible and resistant reactions. The analysis on the proteins with concentration change > = 2-fold indicated a large portion of up- and down-regulated proteins were those acting on carbohydrates. Proteins with leucine-rich repeats and legume lectin domains were mainly induced in both resistant and susceptible system, so was the case of thaumatins. Twenty-five Foc proteins were identified in the infected xylem sap and 10 of them were cysteine-containing secreted small proteins that are good candidates for virulence and/or avirulence effectors. The findings of differential response of protein contents in the xylem sap between the non-infected and Foc-infected samples as well as the Foc candidate effectors secreted in xylem provide valuable insights into B. oleracea-Foc interactions.

Changes in the proteome of xylem sap in Brassica oleracea in response to Fusarium oxysporum stress

Directory of Open Access Journals (Sweden)

Zijing ePu

2016-02-01

Full Text Available Fusarium oxysporum f. sp. conlutinans (Foc is a serious root-invading and xylem-colonizing fungus that causes yellowing in Brassica oleracea. To comprehensively understand the interaction between F. oxysporum and B. oleracea, composition of the xylem sap proteome of the non-infected and Foc-infected plants was investigated in both resistant and susceptible cultivars using liquid chromatography-tandem mass spectrometry (LC-MS/MS after in-solution digestion of xylem sap proteins. Whole genome sequencing of Foc was carried out and generated a predicted Foc protein database. The predicted Foc protein database was then combined with the public B. oleracea and B. rapa protein databases downloaded from Uniprot and used for protein identification. About 200 plant proteins were identified in the xylem sap of susceptible and resistant plants. Comparison between the non-infected and Foc-infected samples revealed that Foc infection causes changes to the protein composition in B. oleracea xylem sap where repressed proteins accounted for a greater proportion than those of induced in both the susceptible and resistant reactions. The analysis on the proteins with concentration change >=2 fold indicated a large portion of up- and down-regulated proteins were those acting on carbohydrates. Proteins with leucine-rich repeats and legume lectin domains were mainly induced in both resistant and susceptible system, so was the case of thaumatins. Twenty-five Foc proteins were identified in the infected xylem sap and ten of them were cysteine-containing secreted small proteins that are good candidates for virulence and/or avirulence effectors. The findings of differential response of protein contents in the xylem sap between the non-infected and Foc-infected samples as well as the Foc candidate effectors secreted in xylem provide valuable insights into B. oleracea-Foc interactions.

Comparative evaluation of Amblyomma ovale ticks infected and noninfected by Rickettsia sp. strain Atlantic rainforest, the agent of an emerging rickettsiosis in Brazil.

Science.gov (United States)

Krawczak, Felipe S; Agostinho, Washington C; Polo, Gina; Moraes-Filho, Jonas; Labruna, Marcelo B

2016-04-01

In 2010, a novel spotted fever group rickettsiosis was reported in the Atlantic rainforest coast of Brazil. The etiological agent was identified as Rickettsia sp. strain Atlantic rainforest, and the tick Amblyomma ovale was incriminated as the presumed vector. The present study evaluated under laboratory conditions four colonies of A. ovale: two started from engorged females that were naturally infected by Rickettsia sp. strain Atlantic rainforest (designated as infected groups); the two others started from noninfected females (designated as control groups). All colonies were reared in parallel from F0 engorged female to F2 unfed nymphs. Tick-naïve vesper mice (Calomys callosus) or domestic rabbits were used for feeding of each tick stage. Rickettsia sp. strain Atlantic rainforest was preserved by transstadial maintenance and transovarial transmission in A. ovale ticks for at least 2 generations (from F0 females to F2 nymphs), because nearly 100% of the tested larvae, nymphs, and adults from the infected groups were shown by PCR to contain rickettsial DNA. All vesper mice and rabbits infested by larvae and nymphs, and 50% of the rabbits infested by adults from the infected groups seroconverted, indicating that these tick stages were vector competent for Rickettsia sp. strain Atlantic rainforest. Expressive differences in mortality rates and reproductive performance were observed between engorged females from the infected and control groups, as indicated by 75.0% and 97.1% oviposition success, respectively, and significantly lower egg mass weight, conversion efficiency index, and percentage of egg hatching for the infected groups. Our results indicate that A. ovale can act as a natural reservoir for Rickettsia sp. strain Atlantic rainforest. However, due to deleterious effect caused by this rickettsial agent on engorged females, amplifier vertebrate hosts might be necessary for persistent perpetuation of Rickettsia sp. strain Atlantic rainforest in A. ovale under

A Collaborative Study of Disproportionate Chemical Risks in Seven Delaware Communities

Science.gov (United States)

Dryden, O.; Goldman, G. T.; White, R.; Moore, D.; Roberts, M.; Thomas, J.; Johnson, C.

2017-12-01

Studies have found that, compared to national averages, a significantly greater percentage of Blacks (African-Americans), Latinos (Hispanics), and people at or near poverty levels tend to live near industrial facilities that use large quantities of toxic chemicals and present a risk of major chemical disasters with potentially severe consequences for nearby communities. The Union of Concerned Scientists, the Environmental Justice Health Alliance for Chemical Policy Reform, and Delaware Concerned Residents for Environmental Justice collaborated on a study to examine the potential for cumulative impacts from health and safety risks for seven Delaware communities with a percentage of people of color and/or poverty levels greater than the Delaware average located along an industrial corridor in the northern portion of Delaware's New Castle County. These risks include close proximity to major industrial sources, as well as facilities that use large quantities of toxic, flammable or explosive chemicals and pose a high risk of a major chemical release or catastrophic incident. Additionally, proximity to contaminated waste sites was assessed, as well as the risk of cancer and potential for respiratory disease impacts from exposure to toxic air pollution. We found that people in these seven communities face a substantial cumulative health risk from exposure to toxic air pollution, proximity to polluting industrial facilities and hazardous chemical facilities, as well as contaminated waste sites. These health risks are substantially greater when compared to a wealthier and predominantly White Delaware community and for Delaware as a whole. Significant and expedited improvements in regulatory and public policy are needed at the national, state, and municipal levels to address the health and well-being of at-risk communities in Delaware and elsewhere.

Critical Remarks on Piketty's 'Capital in the Twenty-first Century'

OpenAIRE

Homburg, Stefan

2014-01-01

This paper discusses the central macroeconomic claims that are made in Thomas Piketty's book 'Capital in the Twenty-first Century'. The paper aims to show that Piketty's contentions are not only logically flawed but also contradicted by his own data.

Gene : CBRC-MMUR-01-1612 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1e-56 41% ref|XP_001497978.2| PREDICTED: similar to seven transmembrane helix receptor [Equus caballus] 5e-6...IPPVLRLACADTTEVEAIVFSSSALLILFTVMVILLSYAYILVTICSMRSLEAQGKALSTCASHLTIICLFYGTITFMYAQPSSHNSMEQNKVVSVVYTVVIPMLNPLIYSLRNKDVKHALKRRCQGKLPS ...

Contextual complexity: The professional learning experiences of seven classroom teachers when engaged in “quality teaching”

Directory of Open Access Journals (Sweden)

Ken Edge

2015-12-01

Full Text Available This research study interrogates the self-reported perceptions of seven experienced Human Society and Its Environment (HSIE teachers about the professional learning influencing their classroom teaching after being involved in a number of initiatives to improve their teaching in New South Wales (Australia. The results indicated that the teachers’ professional learning experiences, ways of thinking about professional learning and responses to implementation of new approaches to professional learning were dominated by traditional training models even while operating under a new state-wide professional learning model (Quality Teaching approach. While the teachers acknowledged the value of reflective practice, collaborative networking and teaming, they found that difficulties in implementing these strategies within faculties and across schools lessened their impact. It was apparent that local institutional history, context and politics had an enormous impact on the success of the professional learning programme. The findings of this study are significant because leadership aimed at acknowledging and addressing the teaching context at the school level is a critical factor if we are to develop twenty-first-century teachers.

Utility of immediate postoperative hip MRI in developmental hip dysplasia: closed vs. open reduction.

Science.gov (United States)

Jadhav, Siddharth P; More, Snehal R; Shenava, Vinitha; Zhang, Wei; Kan, J Herman

2018-04-25

Magnetic resonance imaging (MRI) of the hips is being increasingly used to confirm hip reduction after surgery and spica cast placement for developmental dysplasia of the hip (DDH). To review a single institutional experience with post-spica MRI in children undergoing closed or open hip reduction and describe the utility of MRI in directing the need for re-intervention. Seventy-four patients (52 female, 22 male) who underwent post-spica hip MRI over a 6-year period were retrospectively reviewed. One hundred and seven hips were included. Data reviewed included age at intervention, gender, type of intervention performed, MRI findings, the need for re-intervention and the interval between interventions. Gender was compared between the closed and open reduction groups via the Fisher exact test. Age at the first procedure was compared via the Wilcoxon rank test. Rates of re-intervention after closed and open reduction were calculated and the reasons for re-intervention were reviewed. The mean age at the time of the first intervention was 16.4 months (range: 4 to 63 months). Mean age for the closed reduction group was 10.5 months (range: 4-24 months) and for the open reduction group was 23.7 months (range: 5-63 months), which was significant (P-value open reduction, MRI was useful in deciding re-intervention in only 1 (2%). This patient had prior multiple failed closed and open reductions at an outside institute. Post intervention hip spica MRI is useful in determining the need for re-intervention after closed hip reduction, but its role after open reduction is questionable.

Gene : CBRC-OPRI-01-0327 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4e-59 85% ref|XP_521803.2| PREDICTED: similar to seven transmembrane helix receptor [Pan troglodytes] 2e-60 ...87% MMSLSNSSWRLPQPTFFLVGIPGLEESQHWIALLLAVLYFLALSGNVTILFIVWVDSSLHQPMYLFLAMLAAIDLVLASSTAPKALAVLLIHAHEIGYICCLVQMFFIHAFSSMESGVLVAMALDRYVAYCTLCTTXXXXXXXX ...

Borehole locations on seven interior salt domes

International Nuclear Information System (INIS)

Simcox, A.C.; Wampler, S.L.

1982-08-01

This report is designed as an inventory of all wells known to have been drilled within a five-mile radius of each of seven salt domes within the Interior Salt Basin in east Texas, northern Louisiana and Mississippi. There are 72 boreholes that entered salt above an elevation of -3000 feet mean sea level. For these, details of location, drilling dates, depth of casing and cement, elevation of top of caprock and salt, etc., are given on tables in the appendix. Of the seven domes, Oakwood has the largest number of boreholes, thirty-eight (including two sidetracked wells) that enter the salt stock above -3000 feet mean sea level; another dome in northeast Texas, Keechi, has eight; in northern Louisiana, Rayburn's has four and Vacherie has five; in southern Mississippi, Cypress Creek has seven, Lampton has one, and Richton has nine. In addition, all wells known outside the supra-domal area, but within a five-mile radius of the center of the 7 domes are separately catalogued

[Phylogenetic analysis of closely related Leuconostoc citreum species based on partial housekeeping genes].

Science.gov (United States)

Lv, Qiang; Chen, Ming; Xu, Haiyan; Song, Yuqin; Sun, Zhihong; Dan, Tong; Sun, Tiansong

2013-07-04

Using the 16S rRNA, dnaA, murC and pyrG gene sequences, we identified the phylogenetic relationship among closely related Leuconostoc citreum species. Seven Leu. citreum strains originally isolated from sourdough were characterized by PCR methods to amplify the dnaA, murC and pyrG gene sequences, which were determined to assess the suitability as phylogenetic markers. Then, we estimated the genetic distance and constructed the phylogenetic trees including 16S rRNA and above mentioned three housekeeping genes combining with published corresponding sequences. By comparing the phylogenetic trees, the topology of three housekeeping genes trees were consistent with that of 16S rRNA gene. The homology of closely related Leu. citreum species among dnaA, murC, pyrG and 16S rRNA gene sequences were different, ranged from75.5% to 97.2%, 50.2% to 99.7%, 65.0% to 99.8% and 98.5% 100%, respectively. The phylogenetic relationship of three housekeeping genes sequences were highly consistent with the results of 16S rRNA gene sequence, while the genetic distance of these housekeeping genes were extremely high than 16S rRNA gene. Consequently, the dnaA, murC and pyrG gene are suitable for classification and identification closely related Leu. citreum species.

Complicated grief and bereavement in young adults following close friend and sibling loss.

Science.gov (United States)

Herberman Mash, Holly B; Fullerton, Carol S; Ursano, Robert J

2013-12-01

This study examined the association between types of loss (i.e., sibling or close friend) and relationship quality (i.e., depth and conflict) with complicated grief, depression, somatic symptoms, and world assumptions in bereaved young adults. Participants were 107 young adults aged 17-29 years who were either bereaved or had never experienced a loss. Among bereaved participants, 66 lost a close friend and seven lost a sibling within the past 3 years (M = 1.63 years). Nineteen percent of the young adults met criteria for complicated grief and 31% had mild to severe depression. Participants with a deceased sibling reported greater depth in the relationship as compared to those who lost a friend. They were also more likely to have complicated grief (57% versus 15%) and report significantly higher levels of grief, depression, and somatic symptoms. Those who lost a sibling reported a lower sense of meaningfulness and benevolence of the world and self-worth as compared with those who lost a close friend or had not experienced a loss. Complicated grief and depression are common among bereaved young adults. Sibling loss is particularly distressing to young adults, due in part to the high level of relationship depth, and is associated with increased psychological and physical symptoms postloss. © 2013 Wiley Periodicals, Inc.

Guidelines to Design Engineering Education in the Twenty-First Century for Supporting Innovative Product Development

Science.gov (United States)

Violante, Maria Grazia; Vezzetti, Enrico

2017-01-01

In the twenty-first century, meeting our technological challenges demands educational excellence, a skilled populace that is ready for the critical challenges society faces. There is widespread consensus, however, that education systems are failing to adequately prepare all students with the essential twenty-first century knowledge and skills…

Psychological stress in undergraduate dental students: baseline results from seven European dental schools.

Science.gov (United States)

Humphris, Gerry; Blinkhorn, Andy; Freeman, Ruth; Gorter, Ronald; Hoad-Reddick, Gillian; Murtomaa, Heikki; O'Sullivan, Robin; Splieth, Christian

2002-02-01

To determine the degree of psychological distress, the experience of emotional exhaustion, and the extent of stress associated with course work in dental students and to compare these measurements among seven European dental schools. Multi-centred survey. Dental Schools at Amsterdam, Belfast, Cork, Greifswald, Helsinki, Liverpool and Manchester. 333 undergraduate first-year dental students. General Health Questionnaire (GHQ12), Maslach Burnout Inventory (MBI), Dental Environment Stress Questionnaire (DES), demographic variables. Questionnaire administered to all students attending first year course. Completed questionnaires sent to central office for processing. Seventy-nine percent of the sampled students responded. Over a third of the students (36%) reported significant psychological distress (morbidity) at the recommended cut-off point (>3 on GHQ). These scores were similar to those reported for medical undergraduates. Twenty-two percent recorded comparatively high scores on emotional exhaustion. A wide variation in these 2 measurements was found across schools (p'sStress levels indicated by the DES were less variable (p>0.5). Some evidence showed that contact with patients and the level of support afforded by living at home may be protective. Higher than expected levels of emotional exhaustion were found in a large sample of first-year undergraduate dental students in Europe.

Gene : CBRC-CPOR-01-1484 [SEVENS

Lifescience Database Archive (English)

Full Text Available 2e-35 41% ref|XP_870944.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 6e-71 60% M...SIPKATNQSKKITLHILFLSTLFIISNTLRQPRCPSMETCECAFYSSVVVPKLLENLLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTRFRAVCHPLLYMVAY

Validation of the OMNI RPE Seven Day Exertional Recall Questionnaire

Science.gov (United States)

Schafer, Mark A.; Robertson, Robert J.; Thekkada, Savitha J.; Gallagher, Michael, Jr.; Hunt, Sarah E.; Goss, Fredric L.; Aaron, Deborah J.

2013-01-01

Purpose: The present study examined the validity of the Seven Day Recall Questionnaire among recreationally active men and women. Method: Initially, participants completed a level walk (2.5 mph [4.0 kph]), hill walk (3.5 mph [5.6 kph], 5% grade), and run (5.0 mph [8.0 kph], 2.5% grade). Seven days later, participants were given the Seven Day…

Gene : CBRC-DNOV-01-1811 [SEVENS

Lifescience Database Archive (English)

Full Text Available _HUMAN 1e-69 68% ref|XP_588566.3| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 2e-7...9 78% MQHCLSSWCPSWTLNSTLLCIFFLSHFSFLDLCFLSSIIPQLLVNLKCSDKSITYVDCMIQLYVSLVMGYTECIHLAVMTYDHYVAVCHPLHYIFFMHLWLRHVLASME

Proceedings of the Twenty-Third Annual Software Engineering Workshop

Science.gov (United States)

1999-01-01

The Twenty-third Annual Software Engineering Workshop (SEW) provided 20 presentations designed to further the goals of the Software Engineering Laboratory (SEL) of the NASA-GSFC. The presentations were selected on their creativity. The sessions which were held on 2-3 of December 1998, centered on the SEL, Experimentation, Inspections, Fault Prediction, Verification and Validation, and Embedded Systems and Safety-Critical Systems.

Proceedings of the Twenty Second Nordic Seminar on Computational Mechanics

DEFF Research Database (Denmark)

This book contains the proceedings of the Twenty Second Nordic Seminar on Computational Mechanics (NSCM22), taking event 22-23 October 2009 at Aalborg University, Denmark. The papers presented at the Optimization Seminar in Honour of Niels Olhoff, held 21 October 2009 at Aalborg University, Denmark...

Management of twenty patients with neck trauma in Khartoum ENT ...

African Journals Online (AJOL)

Background: Neck trauma is a great surgical challenge, because there are multi organ and systems involved. Objective: To study the clinical presentation, management and outcome of twenty patients presented to Khartoum ENT Hospital with neck trauma. Methods: This is a prospective study conducted in Khartoum ENT ...

A Critical Feminist and Race Critique of Thomas Piketty's "Capital in the Twenty-First Century"

Science.gov (United States)

Moeller, Kathryn

2016-01-01

Thomas Piketty's "Capital in the Twenty-first Century" documents the foreboding nature of rising wealth inequality in the twenty-first century. In an effort to promote a more just and democratic global society and rein in the unfettered accumulation of wealth by the few, Piketty calls for a global progressive annual tax on corporate…

Risk factors for avascular necrosis after closed reduction for developmental dysplasia of the hip.

Science.gov (United States)

Schur, Mathew D; Lee, Christopher; Arkader, Alexandre; Catalano, Anthony; Choi, Paul D

2016-06-01

The purpose of this study was to identify and evaluate risk factors of avascular necrosis (AVN) after closed treatment for developmental dysplasia of the hip (DDH). A retrospective review of children diagnosed with DDH at a tertiary-care children's hospital between 1986 and 2009 was performed. The presence of AVN was assessed according to Salter's classification system. Eighty-two affected hips in 70 children with an average age of 10 months at closed reduction (range 1-31 months) and 5 years (range 2-19 years) of follow-up met the inclusion criteria. Twenty-nine (of 82, 35 %) affected hips developed AVN. The use of pre-reduction traction (p = 0.019) increased the risk of AVN, while preoperative Pavlik harness or brace trial (p = 0.28), presence of ossific nucleus at the time of closed reduction (p = 0.16), and adductor tenotomy (p = 0.37) were not significant factors. Laterality (right vs. left) was also not a significant risk factor (p = 0.75), but patients who underwent closed reduction for bilateral DDH were less likely to develop AVN (p = 0.027). Overall, the degree of abduction did not affect the rate of AVN (p = 0.87). However, in patients treated with closed reduction younger than 6 months of age, the rate of AVN was increased with abduction ≥50° (9/15, 60 %) compared to abduction AVN were more likely to require subsequent surgery (p = 0.034) and more likely to report a fair/poor clinical outcome (p = 0.049). The risk of AVN (35 %) following closed reduction and spica casting for DDH is high. The degree of abduction in spica casts appears to be a risk factor in patients ≤6 months old. The authors recommend that abduction in spica casts should be limited to <50° in children younger than 6 months of age. IV.

Peer assessment in university teaching: Evaluating seven course designs

NARCIS (Netherlands)

van den Berg, I.|info:eu-repo/dai/nl/288125797; Admiraal, W.|info:eu-repo/dai/nl/120226340; Pilot, A.|info:eu-repo/dai/nl/068350880

2006-01-01

Peer assessment in university teaching: evaluating seven course designs Abstract Peer assessment is understood to be an arrangement with students assessing the quality of their fellow students’ writings and giving feedback to each other. This multiple-case study of seven designs of peer assessment

The experimental study on bowel ischemia in closed loop obstruction by using multi-phase spiral CT

International Nuclear Information System (INIS)

Zhang Xiaoming; Yang Hanfeng; Huang Xiaohua; Tang Xianying; Jian Pu; Yang Zhengwei; Zhou Jiyong; Zhao Zongwen

2005-01-01

Objective: To evaluate the bowel ischemia in experimental closed loop obstruction by using multi-phase spiral CT. Methods: Twenty-four New Zealand rabbits of both sexes (mean age, 4 months, and mean body weight, 2.5-3.0 kg) were divided randomly into three groups with each group containing 8 rabbits. After clamping 10-15 cm segments of small bowel and their veins for 0.5 hours (Group A), 1-2 hours (Group B), and 3-5 hours (Group C), respectively, multi-phase spiral CT was performed at baseline, and at arterial, venous, and delayed phases after intravenous contrast administration. Then the rabbits were sacrificed to observe their surgical and histological changes. Two radiologists, blinded to the animal model classification and their histological results, individually reviewed the CT images to observe the CT appearances of the closed loop. Statistical significance criteria was determined by P 0.05) at baseline, however, they were significantly different (P<0.05) at all phases after enhancement. Among rabbits without necrotic closed loop, 11 of 13 had continuous enhancement at all phases, while only 1 of 11 rabbits with necrotic closed loop showed continuous enhancement (P<0.05). Conclusion: The ischemia of bowel wall in different phases after clamping small bowel and their veins can be evaluated by using enhanced multi-phase spiral CT. Continuous enhancement of bowel wall in multi-phase spiral CT can be seen prominently in the early bowel ischemia, but necrotic bowel shows no enhancement. (authors)

Seven Habits of Reclaiming Relationships.

Science.gov (United States)

Laursen, Erik K.

2002-01-01

Describes an ethnographic study undertaken with 23 youth, in residential treatment centers, to explore the effect of caring relationships on their lives. Seven elements of caring relationships were identified: trust; attention; empathy; availability; affirmation; respect; and virtue. Describes how the components of successful caring can be used to…

Twenty-Seven Years Experience With Transvenous Pacemaker Implantation in Children Weighing <10 kg.

Science.gov (United States)

Konta, Laura; Chubb, Mark Henry; Bostock, Julian; Rogers, Jan; Rosenthal, Eric

2016-02-01

Epicardial pacemaker implantation is the favored approach in children weighing pacemaker implantation in neonates and infants from 1987. To date there have been no long-term follow-up reports of what is for many a controversial strategy. Between 1987 and 2003, 37 neonates and infants-median age 6.7 months (1 day to 3 years) and median weight 4.6 kg (2.7-10 kg)-had a permanent transvenous pacing system implanted. Pacing leads were placed into the right ventricular apex/outflow tract through a subclavian vein puncture with a redundant loop in the atrium. Three patients were lost to follow-up, 4 patients died from complications of cardiac surgery, and 2 patients had their system removed. At long-term follow-up in 28 patients at a median of 17.2 (range, 11.2-27.4) years, 10 patients have a single chamber ventricular pacemaker, 14 a dual chamber pacemaker, 3 a biventricular pacemaker, and 1 has a single chamber implantable cardioverter defibrillator. Subclavian vein patency was assessed in 26 patients. The overall subclavian vein occlusion rate was 10 of 13 (77%) 5 kg during long-term follow-up. After a median of 14.3 (range, 13.4-17.6) years of pacing, 7 patients continue with their original lead. Transvenous pacing in infants <10 kg results in encouraging short- and long-term clinical outcomes. Subclavian vein occlusion remains an important complication, occurring predominantly in those weighing <5 kg. © 2016 American Heart Association, Inc.

Community Energy Systems and the Law of Public Utilities. Volume Twenty-seven. Missouri

Energy Technology Data Exchange (ETDEWEB)

Feurer, D.A.; Weaver, C.L.

1981-01-01

A detailed description is given of the laws and programs of the State of Missouri governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.

Twenty-first century learning for teachers: helping educators bring new skills into the classroom.

Science.gov (United States)

Wilson, John I

2006-01-01

The motivation behind every educator's dedication and hard work in the classroom is the knowledge that his or her teaching will result in students' success in life. Educators are committed to implementing twenty-first century skills; they have no question that students need such skills to be equipped for life beyond school. Members of the National Education Association are enthusiastic about the Partnership for 21st Century Skills framework, yet express frustration that many schools do not have adequate resources to make the necessary changes. Teaching these skills poses significant new responsibilities for schools and educators. To make it possible for teachers to build twenty-first century skills into the curriculum, physical and policy infrastructures must exist, professional development and curriculum materials must be offered, and meaningful assessments must be available. With an established understanding of what skills need to be infused into the classroom-problem solving, analysis, and com- munications-and educators' commitment to the new skill set, this chapter explores how to make such a dramatic reform happen. The author discusses existing strategies that will guide educators in infusing twenty-first century skills into traditional content areas such as math, English, geography, and science. Ultimately, public policy regarding educational standards, professional development, assessments, and physical school structures must exist to enable educators to employ twenty-first century skills, leading to student success in contemporary life. Any concern about the cost of bringing this nation's educational system up to par internationally should be offset by the price that not making twenty-first century skills a priority in the classroom will have on future economic well-being.

The conundrum of religious schools in twenty-first-century Europe

NARCIS (Netherlands)

Merry, M.S.

2015-01-01

In this paper Merry examines in detail the continued - and curious - popularity of religious schools in an otherwise ‘secular’ twenty-first century Europe. To do this he considers a number of motivations underwriting the decision to place one's child in a religious school and delineates what are

Personal value preferences, group identifications, and cultural practices of Palestinian Israelis working in close contact with Jewish Israelis.

Science.gov (United States)

Tartakovsky, Eugene; Abu Kheit, Ayat

2017-01-01

The present study investigates the connection between personal value preferences, group identifications, and cultural practices among Palestinian Israelis working in close contact with the Jewish population in Israel. One hundred twenty-two Palestinian Israelis participated in the study. The participants were employed in different professional positions in the Tel Aviv Metropolitan area and were recruited to the study using the snowball technique. A stronger national identification was associated with a higher preference for the security and conformity values, and a lower preference for the humility values. A stronger ethnic identification was associated with a lower preference for the security, power, and stimulation values. Group identifications mediated the connection between personal value preferences and cultural practices. A longer time working in close contact with the majority group and less frequent visits home were associated with a greater adherence to the majority group's cultural practices but not with adherence to the ethnic group's practices and not with the group identifications.

Building On Builder: The Persistent Icarus Syndrome at Twenty Years

Science.gov (United States)

2013-06-01

mission of the United States Air Force is to "fly, fight, and win…in air, space and cyberspace"--as an intergral member of the Joint team that...Scenarios: A Military Futurist Explores War in the Twenty-First Century (New York: Bantam Books Trade Paperbacksl, 2009), 17. 33 Carl H. Builder

Improving the temporal transposability of lumped hydrological models on twenty diversified U.S. watersheds

Directory of Open Access Journals (Sweden)

G. Seiller

2015-03-01

Full Text Available Study region: Twenty diversified U.S. watersheds. Study focus: Identifying optimal parameter sets for hydrological modeling on a specific catchment remains an important challenge for numerous applied and research projects. This is particularly the case when working under contrasted climate conditions that question the temporal transposability of the parameters. Methodologies exist, mainly based on Differential Split Sample Tests, to examine this concern. This work assesses the improved temporal transposability of a multimodel implementation, based on twenty dissimilar lumped conceptual structures and on twenty U.S. watersheds, over the performance of the individual models. New hydrological insights for the region: Individual and collective temporal transposabilities are analyzed and compared on the twenty studied watersheds. Results show that individual models performances on contrasted climate conditions are very dissimilar depending on test period and watershed, without the possibility to identify a best solution in all circumstances. They also confirm that performance and robustness are clearly enhanced using an ensemble of rainfall-runoff models instead of individual ones. The use of (calibrated weight averaged multimodels further improves temporal transposability over simple averaged ensemble, in most instances, confirming added-value of this approach but also the need to evaluate how individual models compensate each other errors. Keywords: Rainfall-runoff modeling, Multimodel approach, Differential Split Sample Test, Deterministic combination, Outputs averaging

The «Group of Twenty», IMF and EU and Reforming of Global Governance

Directory of Open Access Journals (Sweden)

Evgeniy J. Il'in

2014-01-01

Full Text Available This article is devoted to the process of reforming the global financial system and world economic organizations since the foundation of the International Monetary Fund at the Bretton Woods Conference in 1944 to present time. Special attention is given to results of cooperation of the IMF and the "Group of Twenty"in the context of the world financial crisis 2008-2009. This article mentions the key benchmarks of the historical development of world economy: foundation of the Bretton Woods financial system, rejection of the gold standard at the Jamaica Conference, transition to the floating exchange rates, the wave of crises in the 1990-s, the world financial crisis of 2008-2009. The process of evolution of the IMF within the framework of these global events is considered here. The cooperation of EU, IMF and "Group of Twenty" is considered. The reforms of the IMF and their results are analyzed. The policy of the IMF at different historical stages of its evolution is estimated. As well as it results, the article also deals with the formation and development of the "Group of Twenty". The increasing role of the "Group of Twenty" in the global economic governance and reforming the IMF is considered. Especially is marked the necessity of the further reforms of the IMF and increasing of participation of the "G-20" in the world economic and politic system.

Proceedings of the twenty-first LAMPF users group meeting

International Nuclear Information System (INIS)

1988-04-01

The Twenty-First Annual LAMPF Users Group Meeting was held November 9-10, 1987, at the Clinton P. Anderson Meson Physics Facility. The program included a number of invited talks on various aspects of nuclear and particle physics as well as status reports on LAMPF and discussions of upgrade options. The LAMPF working groups met and discussed plans for the secondary beam lines, experimental programs, and computing facilities

Proceedings of the twenty-second LAMPF users groupd meeting

International Nuclear Information System (INIS)

Marinuzzi, R.

1989-04-01

The Twenty-Second Annual LAMPF Users Group Meeting was held October 17--18, 1988, at the Clinton P. Anderson Meson Physics Facility. The program included a number of invited talks on various aspects of nuclear and particle physics as well as status reports on LAMPF and discussions of upgrade options. The LAMPF working groups met and discussed plans for the secondary beam lines, experimental programs, and computing facilities

NATO’s Relevance in the Twenty-First Century

Science.gov (United States)

2012-03-22

reporting burden for this collection of information is estimated to average 1 hour per response, including the time for reviewing instructions, searching...5d. PROJECT NUMBER Colonel John K. Jones 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Christopher Coker, Globalisation and Insecurity in the Twenty-first Century: NATO and the Management of Risk (The International Institute for Strategic

Closing the sensorimotor loop: haptic feedback facilitates decoding of motor imagery

Science.gov (United States)

Gomez-Rodriguez, M.; Peters, J.; Hill, J.; Schölkopf, B.; Gharabaghi, A.; Grosse-Wentrup, M.

2011-06-01

The combination of brain-computer interfaces (BCIs) with robot-assisted physical therapy constitutes a promising approach to neurorehabilitation of patients with severe hemiparetic syndromes caused by cerebrovascular brain damage (e.g. stroke) and other neurological conditions. In such a scenario, a key aspect is how to reestablish the disrupted sensorimotor feedback loop. However, to date it is an open question how artificially closing the sensorimotor feedback loop influences the decoding performance of a BCI. In this paper, we answer this issue by studying six healthy subjects and two stroke patients. We present empirical evidence that haptic feedback, provided by a seven degrees of freedom robotic arm, facilitates online decoding of arm movement intention. The results support the feasibility of future rehabilitative treatments based on the combination of robot-assisted physical therapy with BCIs.

Overview the Seven Stars Rating in Hotel Industry

Directory of Open Access Journals (Sweden)

Agung Gita Subakti

2012-11-01

Full Text Available Picking the right hotel can be tricky especially in today’s world of multiple rating systems. A luxury hotel rating once topped out at five stars but in the war to snag vacationers certain hotels that sing tunes of opulence and luxurious pleasure have started to accumulate seven stars. Star rating systems vary from continentto continent, country to country, and in a country. Hotel ratings have become a subjective assessment of amenities depending on the hotel and location. But the big question that is how they rate a seven stars Hotel. What makes it different from five stars Hotel or any fine establishment alike. In this case, the author is over viewing some of the Hotels in the world that are known for its seven stars reputation and taking a closer look on how they get their reputation for being the most luxurious Hotels in the world.

Twenty-first century learning in schools: A case study of New Technology High School in Napa, California.

Science.gov (United States)

Pearlman, Bob

2006-01-01

The most pertinent question concerning teaching and learning in the twenty-first century is not what knowledge and skills students need--that laundry list was identified over a decade ago--but rather how to foster twenty-first century learning. What curricula, experiences, assessments, environments, and technology best support twenty-first century learning? New Technology High School (NTHS) in Napa, California, is one example of a successful twenty-first century school. In this chapter, the author describes the components of this exemplary high school, illustrating an environment that will cultivate twenty-first century student learning. New Technology High School began by defining eight learning outcomes, aligned with the standards of the Partnership for 21st Century Skills; to graduate, students demonstrate mastery of these outcomes through an online portfolio. To help students achieve the outcomes, NTHS employs project- and problem-based learning. Whereas in traditional classrooms students work alone on short-term assignments that do not lend themselves to deep understanding, the project-based learning approach has students working in teams on long-term, in-depth, rigorous projects. Students' work is supported by the school's workplace-like environment and effectiv use of technology. Meaningful assessment is essential to project-based learning; students receive continuous feedback, helping them become self-directed learners. In fact, NTHS uses outcome-based grading through which students constantly know how they are performing on the twenty-first century outcomes. Research has shown that NTHS graduates are better prepared for postsecondary education, careers, and citizenship than their peers from other schools. To facilitate twenty-first century learning, all schools need to rethink their approach to teaching and learning. New Technology High School is one way to do so.

Humanities: The Unexpected Success Story of the Twenty-First Century

Science.gov (United States)

Davis, Virginia

2012-01-01

Humanities within universities faced challenges in the latter half of the twentieth century as their value in the modern world was questioned. This paper argues that there is strong potential for the humanities to thrive in the twenty-first century university sector. It outlines some of the managerial implications necessary to ensure that this…

Twenty Years of French "Didactique" Viewed from the United States

Science.gov (United States)

Kilpatrick, Jeremy

2003-01-01

One cannot begin considering the topic of this colloquium without asking, why twenty years? Why not two hundred? Two hundred years ago, Silvestre Franois Lacroix was about to be named chief officer of the Commission Executive de L'Instruction Publique. Out of that experience, together with his long career in instruction, especially as professor of…

Dam safety at Seven Sisters Generating Station

International Nuclear Information System (INIS)

Carson, R. W.; Gupta, R. C.

1996-01-01

A safety surveillance program for all hydraulic structures in Manitoba was first implemented in 1979, and updated in 1988. This contribution describes the current status of the program, and the nature of the issues that the program was designed to address. The Seven Sisters Station's dam on the Winnipeg River, about 90 km northeast of the City of Winnipeg, was used as an example. Extensive reviews of flood risks and downstream inundation potential at Seven Sisters' revealed a number of deficiencies; these findings will be incorporated into a corporate plan of overall remediation. Updating the program will also include efforts to ensure adherence to national dam safety guidelines. 5 figs

Accelerators for the twenty-first century a review

CERN Document Server

Wilson, Edmund J N

1990-01-01

The development of the synchrotron, and later the storage ring, was based upon the electrical technology at the turn of this century, aided by the microwave radar techniques of World War II. This method of acceleration seems to have reached its limit. Even superconductivity is not likely to lead to devices that will satisfy physics needs into the twenty-first century. Unless a new principle for accelerating elementary particles is discovered soon, it is difficult to imagine that high-energy physics will continue to reach out to higher energies and luminosities.

Rotavirus NSP4 is secreted from infected cells as an oligomeric lipoprotein and binds to glycosaminoglycans on the surface of non-infected cells

Directory of Open Access Journals (Sweden)

Didsbury Alicia

2011-12-01

Full Text Available Abstract Background Nonstructural glycoprotein 4 (NSP4 encoded by rotavirus is the only viral protein currently believed to function as an enterotoxin. NSP4 is synthesized as an intracellular transmembrane glycoprotein and as such is essential for virus assembly. Infection of polarized Caco-2 cells with rotavirus also results in the secretion of glycosylated NSP4 apparently in a soluble form despite retention of its transmembrane domain. We have examined the structure, solubility and cell-binding properties of this secreted form of NSP4 to further understand the biochemical basis for its enterotoxic function. We show here that NSP4 is secreted as discrete detergent-sensitive oligomers in a complex with phospholipids and demonstrate that this secreted form of NSP4 can bind to glycosaminoglycans present on the surface of a range of different cell types. Methods NSP4 was purified from the medium of infected cells after ultracentrifugation and ultrafiltration by successive lectin-affinity and ion exchange chromatography. Oligomerisation of NSP4 was examined by density gradient centrifugation and chemical crosslinking and the lipid content was assessed by analytical thin layer chromatography and flame ionization detection. Binding of NSP4 to various cell lines was measured using a flow cytometric-based assay. Results Secreted NSP4 formed oligomers that contained phospholipid but dissociated to a dimeric species in the presence of non-ionic detergent. The purified glycoprotein binds to the surface of various non-infected cells of distinct lineage. Binding of NSP4 to HT-29, a cell line of intestinal origin, is saturable and independent of divalent cations. Complementary biochemical approaches reveal that NSP4 binds to sulfated glycosaminoglycans on the plasma membrane. Conclusion Our study is the first to analyze an authentic (i.e. non-recombinant form of NSP4 that is secreted from virus-infected cells. Despite retention of the transmembrane domain

Investigating the Twenty Year Lag in the Vocational Rehabilitation Process.

Science.gov (United States)

Lowitt, Julian

In the rehabilitation workshop there is insufficient attention to job development oriented to the current and future needs of industry. Many types of work which were done in vocational workshops in contract from industrial firms are now done by automation. Semiskilled labor is thus in diminished demand. There is a twenty year lag in the industrial…

Behaviour and design considerations for continuous flow closed-open-closed liquid microchannels.

Science.gov (United States)

Melin, Jessica; van der Wijngaart, Wouter; Stemme, Göran

2005-06-01

This paper introduces a method of combining open and closed microchannels in a single component in a novel way which couples the benefits of both open and closed microfluidic systems and introduces interesting on-chip microfluidic behaviour. Fluid behaviour in such a component, based on continuous pressure driven flow and surface tension, is discussed in terms of cross sectional flow behaviour, robustness, flow-pressure performance, and its application to microfluidic interfacing. The closed-open-closed microchannel possesses the versatility of upstream and downstream closed microfluidics along with open fluidic direct access. The device has the advantage of eliminating gas bubbles present upstream when these enter the open channel section. The unique behaviour of this device opens the door to applications including direct liquid sample interfacing without the need for additional and bulky sample tubing.

Twenty-four hour care for schizophrenia.

Science.gov (United States)

Macpherson, Rob; Edwards, Thomas Rhys; Chilvers, Rupatharshini; David, Chris; Elliott, Helen J

2009-04-15

Despite modern treatment approaches and a focus on community care, there remains a group of people who cannot easily be discharged from psychiatric hospital directly into the community. Twenty-four hour residential rehabilitation (a 'ward-in-a-house') is one model of care that has evolved in association with psychiatric hospital closure programmes. To determine the effects of 24 hour residential rehabilitation compared with standard treatment within a hospital setting. We searched the Cochrane Schizophrenia Group Trials Register (May 2002 and February 2004). We included all randomised or quasi-randomised trials that compared 24 hour residential rehabilitation with standard care for people with severe mental illness. Studies were reliably selected, quality assessed and data extracted. Data were excluded where more than 50% of participants in any group were lost to follow-up. For binary outcomes we calculated the relative risk and its 95% confidence interval. We identified and included one study with 22 participants with important methodological shortcomings and limitations of reporting. The two-year controlled study evaluated "new long stay patients" in a hostel ward in the UK. One outcome 'unable to manage in the placement' provided usable data (n=22, RR 7.0 CI 0.4 to 121.4). The trial reported that hostel ward residents developed superior domestic skills, used more facilities in the community and were more likely to engage in constructive activities than those in hospital - although usable numerical data were not reported. These potential advantages were not purchased at a price. The limited economic data was not good but the cost of providing 24 hour care did not seem clearly different from the standard care provided by the hospital - and it may have been less. From the single, small and ill-reported, included study, the hostel ward type of facility appeared cheaper and positively effective. Currently, the value of this way of supporting people - which could be

76 FR 51381 - Supplemental Awards to Seven Unaccompanied Alien Shelter Care Providers

Science.gov (United States)

2011-08-18

... Seven Unaccompanied Alien Shelter Care Providers AGENCY: Office of Refugee Resettlement, ACF, HHS... grants to seven Unaccompanied Alien Shelter Care Providers. CFDA Number: 93.676. Statutory Authority...) announces the award of single-source expansion supplement grants to seven unaccompanied alien shelter care...

Scintigraphic detection of acute experimental endocarditis with the technetium-99m labelled glycoprotein IIb/IIIa receptor antagonist DMP444

Energy Technology Data Exchange (ETDEWEB)

Oyen, W.J.G.; Boerman, O.C.; Corstens, F.H.M. [Department of Nuclear Medicine, University Hospital Nijmegen, Nijmegen (Netherlands); Brouwers, F.M. [Department of Nuclear Medicine, University Hospital Nijmegen, Nijmegen (Netherlands); Department of Internal Medicine, University Hospital Nijmegen, Nijmegen (Netherlands); Barrett, J.A. [DuPont Pharmaceutical Company, Radiopharmaceutical Division, North Billerica, MA (United States); Verheugt, F.W.A. [Department of Cardiology, University Hospital Nijmegen, Nijmegen (Netherlands); Ruiter, D.J. [Department of Pathology, University Hospital Nijmegen, Nijmegen (Netherlands); Meer, J.W.M. van der [Department of Internal Medicine, University Hospital Nijmegen, Nijmegen (Netherlands)

2000-04-01

Bacterial endocarditis is an important clinical problem that may result in persistent bacteraemia and irreversible cardiac damage. Since endocarditis is characterized by aggregation of activated platelets, fibrin and bacteria, we studied DMP444, a technetium-99m labelled high-affinity antagonist of the GP IIb/IIIa receptor that is expressed on activated platelets. In seven Beagle dogs (11-15 kg), the left ventricle was catheterized via the right carotid artery. One hour later, 5 x 10{sup 7} colony forming units of Staphylococcus aureus were injected intracardially. Half an hour later, the catheter was removed. Two extra dogs underwent a complete sham procedure. One day after the intervention, five infected and the two non-infected dogs were injected with 37 MBq/kg {sup 99m}Tc-DMP444 and two infected dogs with 37 MBq/kg {sup 99m}Tc-IgG (used as a non-specific control agent) and imaged up to 4 h after injection. Samples were obtained for tissue counting, microbiology and histology. From 1 to 2 h post injection onward, there was clear focal accumulation of DMP444 in the aortic valve region when endocarditis was present, and this accumulation increased with time. The non-infected and the {sup 99m}Tc-IgG injected dogs showed only persisting blood pool activity without any focal abnormality. At 4 h post injection, the in vivo valve-to-blood pool ratios were 1.87{+-}0.18 in endocarditis, 1.01{+-}0.05 in non-infected controls and 1.09{+-}0.02 in {sup 99m}Tc-IgG injected dogs (P<0.05). It is concluded that targeting activated platelets with the {sup 99m}Tc-labelled GP IIb/IIIa antagonist DMP444 allows a final diagnosis of experimental bacterial endocarditis within 4 h owing to high, specific and fast in vivo uptake. (orig.)

Scintigraphic detection of acute experimental endocarditis with the technetium-99m labelled glycoprotein IIb/IIIa receptor antagonist DMP444

International Nuclear Information System (INIS)

Oyen, W.J.G.; Boerman, O.C.; Corstens, F.H.M.; Brouwers, F.M.; Barrett, J.A.; Verheugt, F.W.A.; Ruiter, D.J.; Meer, J.W.M. van der

2000-01-01

Bacterial endocarditis is an important clinical problem that may result in persistent bacteraemia and irreversible cardiac damage. Since endocarditis is characterized by aggregation of activated platelets, fibrin and bacteria, we studied DMP444, a technetium-99m labelled high-affinity antagonist of the GP IIb/IIIa receptor that is expressed on activated platelets. In seven Beagle dogs (11-15 kg), the left ventricle was catheterized via the right carotid artery. One hour later, 5 x 10 7 colony forming units of Staphylococcus aureus were injected intracardially. Half an hour later, the catheter was removed. Two extra dogs underwent a complete sham procedure. One day after the intervention, five infected and the two non-infected dogs were injected with 37 MBq/kg 99m Tc-DMP444 and two infected dogs with 37 MBq/kg 99m Tc-IgG (used as a non-specific control agent) and imaged up to 4 h after injection. Samples were obtained for tissue counting, microbiology and histology. From 1 to 2 h post injection onward, there was clear focal accumulation of DMP444 in the aortic valve region when endocarditis was present, and this accumulation increased with time. The non-infected and the 99m Tc-IgG injected dogs showed only persisting blood pool activity without any focal abnormality. At 4 h post injection, the in vivo valve-to-blood pool ratios were 1.87±0.18 in endocarditis, 1.01±0.05 in non-infected controls and 1.09±0.02 in 99m Tc-IgG injected dogs (P 99m Tc-labelled GP IIb/IIIa antagonist DMP444 allows a final diagnosis of experimental bacterial endocarditis within 4 h owing to high, specific and fast in vivo uptake. (orig.)

Seven Deadliest Microsoft Attacks

CERN Document Server

Kraus, Rob; Borkin, Mike; Alpern, Naomi

2010-01-01

Do you need to keep up with the latest hacks, attacks, and exploits effecting Microsoft products? Then you need Seven Deadliest Microsoft Attacks. This book pinpoints the most dangerous hacks and exploits specific to Microsoft applications, laying out the anatomy of these attacks including how to make your system more secure. You will discover the best ways to defend against these vicious hacks with step-by-step instruction and learn techniques to make your computer and network impenetrable. Windows Operating System-Password AttacksActive Directory-Escalat

Twenty five years of fundamental theory

International Nuclear Information System (INIS)

Bell, J.S.

1980-01-01

In reviewing the last twenty five years in fundamental physics theory it is stated that there has been no revolution in this field. In the absence of gravitation, Lorentz invariance remains a requirement on fundamental laws. Einstein's theory of gravitation inspires increasing conviction on the astronomical scale. Quantum theory remains the framework for all serious effort in microphysics, and quantum electrodynamics remains the model of a fully articulated microphysical theory, completely successful in its domain. However,a number of ideas have appeared, of great theoretical interest and some phenomenological success, which may well contribute to the next decisive step. Recent work on the following topics is mentioned; gravitational radiation, singularites, black body radiation from black holes, gauge and hidden symmetry in quantum electrodynamics, the renormalization of electromagnetic and weak interaction theory, non-Abelian gauge theories, magnetic monopoles as the most striking example of solitons, and supersymmetry. (UK)

Validation of the Seven Up Seven Down Inventory in bipolar offspring : screening and prediction of mood disorders. Findings from the Dutch Bipolar Offspring Study

NARCIS (Netherlands)

Mesman, E; Youngstrom, E A; Juliana, N K; Nolen, W A; Hillegers, M H J

2016-01-01

OBJECTIVE: To validate the Seven Up Seven Down (7U7D), an abbreviated version of the General Behavior Inventory (GBI), as screener for mood disorders and test its ability to predict mood disorders over time in individuals at risk for bipolar disorder (BD). METHODS: Bipolar offspring (n=108) were

Validation of the Seven Up Seven Down Inventory in bipolar offspring : screening and prediction of mood disorders. Findings from the Dutch Bipolar Offspring Study

NARCIS (Netherlands)

Mesman, Esther; Youngstrom, E. A.; Juliana, N. K.; Nolen, W. A.; Hillegers, M. H. J.

2017-01-01

Objective: To validate the Seven Up Seven Down (7U7D), an abbreviated version of the General Behavior Inventory (GBI), as screener for mood disorders and test its ability to predict mood disorders over time in individuals at risk for bipolar disorder (BD). Methods: Bipolar offspring (n=108) were

Destructive spondyloarthropathy and radiographic follow-up in hemodialysis patients

International Nuclear Information System (INIS)

Orzincolo, C.; Cardona, P.; Bedani, P.L.; Gilli, P.; Scutellari, P.N.; Trotta, F.

1990-01-01

Nine patients undergoing regular dialytic treatment for more than 60 months showed clinical and radiologic features of a noninfective and destructive spondyloarthropathy. Typically, radiographs and CT scans revealed narrowing of intervertebral spaces, with destruction or sclerosis of the subchondral bone of the vertebral plate. A radiographic follow-up of the cervical spine was performed in seven patients after a period of 12 months and showed that the bone destruction in DSA is very rapid and progressive. The lower biocompatibility of the cuprophan membranes of dialyzers is probably the factor most responsible for hyperproduction of β 2 -m and subsequently osteoarticular deposition of a new type of amyloidosis. (orig./DG)

Pipe closing device

International Nuclear Information System (INIS)

Klahn, F.C.; Nolan, J.H.; Wills, C.

1979-01-01

The closing device closes the upper end of a support tube for monitoring samples. It meshes with the upper connecting piece of the monitorung sample capsule, and loads the capsule within the bore of the support tube, so that it is fixed but can be released. The closing device consists of an interlocking component with a chamber and several ratchets which hang down. The interlocking component surrounds the actuating component for positioning the ratchets. The interlocking and actuating components are movable axially relative to each other. (DG) [de

Induced release of a plant-defense volatile 'deceptively' attracts insect vectors to plants infected with a bacterial pathogen.

Directory of Open Access Journals (Sweden)

Rajinder S Mann

Full Text Available Transmission of plant pathogens by insect vectors is a complex biological process involving interactions between the plant, insect, and pathogen. Pathogen-induced plant responses can include changes in volatile and nonvolatile secondary metabolites as well as major plant nutrients. Experiments were conducted to understand how a plant pathogenic bacterium, Candidatus Liberibacter asiaticus (Las, affects host preference behavior of its psyllid (Diaphorina citri Kuwayama vector. D. citri were attracted to volatiles from pathogen-infected plants more than to those from non-infected counterparts. Las-infected plants were more attractive to D. citri adults than non-infected plants initially; however after feeding, psyllids subsequently dispersed to non-infected rather than infected plants as their preferred settling point. Experiments with Las-infected and non-infected plants under complete darkness yielded similar results to those recorded under light. The behavior of psyllids in response to infected versus non-infected plants was not influenced by whether or not they were carriers of the pathogen. Quantification of volatile release from non-infected and infected plants supported the hypothesis that odorants mediate psyllid preference. Significantly more methyl salicylate, yet less methyl anthranilate and D-limonene, was released by infected than non-infected plants. Methyl salicylate was attractive to psyllids, while methyl anthranilate did not affect their behavior. Feeding on citrus by D. citri adults also induced release of methyl salicylate, suggesting that it may be a cue revealing location of conspecifics on host plants. Infected plants were characterized by lower levels of nitrogen, phosphorus, sulfur, zinc, and iron, as well as, higher levels of potassium and boron than non-infected plants. Collectively, our results suggest that host selection behavior of D. citri may be modified by bacterial infection of plants, which alters release of

Induced Release of a Plant-Defense Volatile ‘Deceptively’ Attracts Insect Vectors to Plants Infected with a Bacterial Pathogen

Science.gov (United States)

Mann, Rajinder S.; Ali, Jared G.; Hermann, Sara L.; Tiwari, Siddharth; Pelz-Stelinski, Kirsten S.; Alborn, Hans T.; Stelinski, Lukasz L.

2012-01-01

Transmission of plant pathogens by insect vectors is a complex biological process involving interactions between the plant, insect, and pathogen. Pathogen-induced plant responses can include changes in volatile and nonvolatile secondary metabolites as well as major plant nutrients. Experiments were conducted to understand how a plant pathogenic bacterium, Candidatus Liberibacter asiaticus (Las), affects host preference behavior of its psyllid (Diaphorina citri Kuwayama) vector. D. citri were attracted to volatiles from pathogen-infected plants more than to those from non-infected counterparts. Las-infected plants were more attractive to D. citri adults than non-infected plants initially; however after feeding, psyllids subsequently dispersed to non-infected rather than infected plants as their preferred settling point. Experiments with Las-infected and non-infected plants under complete darkness yielded similar results to those recorded under light. The behavior of psyllids in response to infected versus non-infected plants was not influenced by whether or not they were carriers of the pathogen. Quantification of volatile release from non-infected and infected plants supported the hypothesis that odorants mediate psyllid preference. Significantly more methyl salicylate, yet less methyl anthranilate and D-limonene, was released by infected than non-infected plants. Methyl salicylate was attractive to psyllids, while methyl anthranilate did not affect their behavior. Feeding on citrus by D. citri adults also induced release of methyl salicylate, suggesting that it may be a cue revealing location of conspecifics on host plants. Infected plants were characterized by lower levels of nitrogen, phosphorus, sulfur, zinc, and iron, as well as, higher levels of potassium and boron than non-infected plants. Collectively, our results suggest that host selection behavior of D. citri may be modified by bacterial infection of plants, which alters release of specific headspace

An investigation of twenty-one cases of low-frequency noise complaints

DEFF Research Database (Denmark)

Pedersen, Christian Sejer; Møller, Henrik; Persson-Waye, Kerstin

2007-01-01

Twenty-one cases of low-frequency noise complaints were thoroughly investigated with the aim of answering the question whether it is real physical sound or low-frequency tinnitus that causes the annoyance. Noise recordings were made in the homes of the complainants taking the spatial variation...

Seven-parameter statistical model for BRDF in the UV band.

Science.gov (United States)

Bai, Lu; Wu, Zhensen; Zou, Xiren; Cao, Yunhua

2012-05-21

A new semi-empirical seven-parameter BRDF model is developed in the UV band using experimentally measured data. The model is based on the five-parameter model of Wu and the fourteen-parameter model of Renhorn and Boreman. Surface scatter, bulk scatter and retro-reflection scatter are considered. An optimizing modeling method, the artificial immune network genetic algorithm, is used to fit the BRDF measurement data over a wide range of incident angles. The calculation time and accuracy of the five- and seven-parameter models are compared. After fixing the seven parameters, the model can well describe scattering data in the UV band.

Twenty five years of clusters -- from Bochum to Strasbourg

International Nuclear Information System (INIS)

Betts, R.R.; Chicago Univ., IL

1994-01-01

Developments in the area of clustering aspects of nuclear structure and reactions over the past twenty-five years are reviewed. The viewpoint is that the nucleus is an assembly of clusters. The question is whether clusters actually exist in the nucleus. Although there is abundant evidence for this in light nuclei, the situation for more complex clusters in heavier nuclei is much worse. Differential cross sections for scattering of alpha particles and heavy ions are shown

Global Feminism from Page to Stage: Teaching "Half the Sky" and "Seven"

Science.gov (United States)

Capo, Beth Widmaier

2012-01-01

The documentary play "Seven" is the collaboration of seven female playwrights with seven women activists connected in 2006 by the Vital Voices Global Partnership, a nonprofit nongovernmental organization supporting the development of female leaders (Vital). The stated mission of Vital Voices is to "identify, invest in and bring…

7 CFR 1755.370 - RUS specification for seven wire galvanized steel strand.

Science.gov (United States)

2010-01-01

... 7 Agriculture 11 2010-01-01 2010-01-01 false RUS specification for seven wire galvanized steel..., ACCEPTABLE MATERIALS, AND STANDARD CONTRACT FORMS § 1755.370 RUS specification for seven wire galvanized... Steel Wire Strand, issued May 1978. All seven wire galvanized steel strand purchased after April 1, 1990...

Seven Salutary Suggestions for Counselor Stamina

Science.gov (United States)

Osborn, Cynthia J.

2004-01-01

Counselor stamina is deemed essential in the midst of a consistently challenging, complex, and changing mental health care environment. Rather than perpetuating conversations about "burnout" and "burnout prevention," this article provides a salutary or health-promoting perspective. Seven suggestions for counselor stamina are presented and…

A seven-gene CpG-island methylation panel predicts breast cancer progression

International Nuclear Information System (INIS)

Li, Yan; Melnikov, Anatoliy A.; Levenson, Victor; Guerra, Emanuela; Simeone, Pasquale; Alberti, Saverio; Deng, Youping

2015-01-01

DNA methylation regulates gene expression, through the inhibition/activation of gene transcription of methylated/unmethylated genes. Hence, DNA methylation profiling can capture pivotal features of gene expression in cancer tissues from patients at the time of diagnosis. In this work, we analyzed a breast cancer case series, to identify DNA methylation determinants of metastatic versus non-metastatic tumors. CpG-island methylation was evaluated on a 56-gene cancer-specific biomarker microarray in metastatic versus non-metastatic breast cancers in a multi-institutional case series of 123 breast cancer patients. Global statistical modeling and unsupervised hierarchical clustering were applied to identify a multi-gene binary classifier with high sensitivity and specificity. Network analysis was utilized to quantify the connectivity of the identified genes. Seven genes (BRCA1, DAPK1, MSH2, CDKN2A, PGR, PRKCDBP, RANKL) were found informative for prognosis of metastatic diffusion and were used to calculate classifier accuracy versus the entire data-set. Individual-gene performances showed sensitivities of 63–79 %, 53–84 % specificities, positive predictive values of 59–83 % and negative predictive values of 63–80 %. When modelled together, these seven genes reached a sensitivity of 93 %, 100 % specificity, a positive predictive value of 100 % and a negative predictive value of 93 %, with high statistical power. Unsupervised hierarchical clustering independently confirmed these findings, in close agreement with the accuracy measurements. Network analyses indicated tight interrelationship between the identified genes, suggesting this to be a functionally-coordinated module, linked to breast cancer progression. Our findings identify CpG-island methylation profiles with deep impact on clinical outcome, paving the way for use as novel prognostic assays in clinical settings. The online version of this article (doi:10.1186/s12885-015-1412-9) contains supplementary

YEDİ ULU OZAN’IN “YEDİ” SEMBOLİZMİ [THE SYMBOLISM OF “SEVEN” OF SEVEN GRAND POETS

Directory of Open Access Journals (Sweden)

Reyhan Keleş

2017-09-01

Full Text Available Sayı sembolizmi, kadim milletlerden bugüne hemen her toplum tarafından ilgi ile karşılanmış, sadece toplumlarda değil dinlerde de önem arz etmiştir. Genelde Pisagorasçı felsefeden etkilenen kültürlerin sayılara yükledikleri anlamlar farklı olmakla birlikte pek çok hususta bir anlam birliği de dikkat çekmektedir. Sayı sembolizmi sadece yabancı kültürleri değil Türk ve İslam kültürlerini de etkilemiştir. Bu kültürlerde özellikle bir, üç, beş, yedi, dokuz, yirmi sekiz, otuz iki, kırk sayıları biraz daha ön plandadır. Bu çalışmada sayı sembolizmi hakkında genel bir malumat verildikten sonra, yedi sayısı üzerinde durulacaktır. Yedi sayısının sembolizmi hakkında çeşitli dinlerden milletlere ne anlamlar taşıdığı hususu tartışıldıktan sonra sayı simgeciliği denilince ilk akla gelenlerden ve ayrıca Yedi Ulu Ozan’dan biri sayılan Nesîmî’nin de temsil ettiği Hurufililerin ve Alevi-Bektaşi çevrelerinin yedi sayısına yükledikleri anlamlardan bahsedilecektir. Ayrıca bu çalışmada Alevi-Bektaşi kültüründe Yedi Ulu Ozan diye adlandırılan ve temsilcileri arasında ismi zikredilen Nesîmî, Hatâî, Fuzûlî, Yemînî, Pîr Sultan Abdal, Virânî ve Kul Himmet hakkında bilgi verilecek ve bu şairlerin divanlarındaki şiirlerden hareketle yedi sayısına yükledikleri anlamlar üzerinde durulacaktır. Number symbolism has attracted attention of almost all societies since ancient times up to our day, and also has been important not only for the societies but also for the religions. In general, meanings attributed to numbers by cultures influenced from Pythagorean philosophy are different, however a unity of meaning in many points draws attention, as well. Number symbolism has influenced not only foreign cultures but also the Turkish and Islamic cultures. In these cultures, the numbers one, three, five, seven, nine, twenty-eight, thirty-two and forty are especially at the

Twenty-fourth Semiannual Report of the Commission to the Congress, July 1958

Energy Technology Data Exchange (ETDEWEB)

Strauss, Lewis L.; McCone, John A.

1958-07-31

The document represents the twenty-fourth semiannual Atomic Energy Commission (AEC) report to Congress. The report sums up the major activities and developments in the national atomic energy program covering the period January - June 1958.

Twenty-second Semiannual Report of the Commission to the Congress, July 1957

Energy Technology Data Exchange (ETDEWEB)

Strauss, Lewis L.

1957-07-31

The document represents the twenty-second semiannual Atomic Energy Commission (AEC) report to Congress. The report sums up the major activities and developments in the national atomic energy program covering the period January - June 1957.

Twenty years of society of medical informatics of b&h and the journal acta informatica medica.

Science.gov (United States)

Masic, Izet

2012-03-01

In 2012, Health/Medical informatics profession celebrates five jubilees in Bosnia and Herzegovina: a) Thirty five years from the introduction of the first automatic manipulation of data; b) Twenty five years from establishing Society for Medical Informatics BiH; c) Twenty years from establishing scientific and professional journal of the Society for Medical Informatics of Bosnia and Herzegovina "Acta Informatica Medica"; d) Twenty years from establishing first Cathdra for Medical Informatics on biomedical faculties in Bosnia and Herzegovina and e) Ten years from the introduction of "Distance learning" in medical curriculum. All of the five mentioned activities in the area of Medical informatics had special importance and gave appropriate contribution in the development of Health/Medical informatics in Bosnia And Herzegovina.

After Twenty-Five Years: A Twenty-Five Year Follow-up Study of Middlesex County Vocational and Technical High School Graduates of the Class of June 1953.

Science.gov (United States)

Rogers, William; Zanzalari, J. Henry

A twenty-five-year follow-up study was conducted to determine the occupational, educational, marital and armed forces experiences of the graduating class of 1953 from the Middlesex County Vocational and Technical high schools located in New Brunswick, Perth, Amboy, and Woodbridge, New Jersey. Data, in the form of questionnaire responses, were…

A waste walk through clinical pharmacy: how do the 'seven wastes' of Lean techniques apply to the practice of clinical pharmacists.

Science.gov (United States)

Green, Christopher F; Crawford, Victoria; Bresnen, Gaynor; Rowe, Philip H

2015-02-01

This study used a 'Lean' technique, the 'waste walk' to evaluate the activities of clinical pharmacists with reference to the seven wastes described in 'Lean' including 'defects', 'unnecessary motion', 'overproduction', 'transport of products or material', 'unnecessary waiting', 'unnecessary inventory' and 'inappropriate processing'. The objectives of the study were to categorise the activities of ward-based clinical pharmacists into waste and non-waste, provide detail around what constitutes waste activity and quantify the proportion of time attributed to each category. This study was carried out in a district general hospital in the North West of England. Staff were observed using work-sampling techniques, to categorise activity into waste and non-waste, with waste activities being allocated to each of the seven wastes described earlier and subdivided into recurrent themes. Twenty different pharmacists were observed for 1 h on two separate occasions. Of 1440 observations, 342 (23.8%) were categorised as waste with 'defects' and 'unnecessary motion' accounting for the largest proportions of waste activity. Observation of clinical pharmacists' activities has identified that a significant proportion of their time could be categorised as 'waste'. There are practical steps that could be implemented in order to ensure their time is used as productively as possible. Given the challenges facing the UK National Health Service, the adoption of 'Lean' techniques provides an opportunity to improve quality and productivity while reducing costs. © 2014 Royal Pharmaceutical Society.

Side effect experiences of South Korean women in their twenties and thirties after facial plastic surgery

Directory of Open Access Journals (Sweden)

Kim YA

2018-06-01

Full Text Available Young A Kim,1 Hyang-In Cho Chung2 1Department of Nursing, Jeju National University College of Nursing, Jeju-si, Republic of Korea; 2Department of Nursing, Chonnam National University College of Nursing, Gwangju, Republic of Korea Background: Rates of plastic surgery procedures have increased dramatically over the past several decades, especially for the women in South Korea.Purpose: The purpose of this study was to explore the subjective experience of South Korean women in their twenties and thirties with facial plastic surgery (FPS side effects.Participants and methods: Seven women who have suffered from FPS side effects participated in this study. Data were collected from July to September 2015 through individual in-depth interviews using open-ended questions and analyzed using Colaizzi’s method, which is a Husserlian phenomenological approach.Results: Six themes, and 25 subthemes, were found. Major themes were “choosing FPS to gain a new self”, “facing an unintended self”, “trying to accept a changed self”, “making efforts to overcome the situation”, “coming to know a new world”, and “pursuing a new lifestyle”.Conclusion: This study raises social awareness on the risk of plastic surgery side effects, which could prevent unnecessary plastic surgery. It also suggests the need for a deeper understanding of women’s biopsychosocial suffering from plastic surgery side effects. Keywords: cosmetic surgery, aesthetic plastic surgery, qualitative research, interview 

TPACK Updated to Measure Pre-Service Teachers' Twenty-First Century Skills

Science.gov (United States)

Valtonen, Teemu; Sointu, Erkko; Kukkonen, Jari; Kontkanen, Sini; Lambert, Matthew C.; Mäkitalo-Siegl, Kati

2017-01-01

Twenty-first century skills have attracted significant attention in recent years. Students of today and the future are expected to have the skills necessary for collaborating, problem solving, creative and innovative thinking, and the ability to take advantage of information and communication technology (ICT) applications. Teachers must be…

Why American business demands twenty-first century skills: an industry perspective.

Science.gov (United States)

Bruett, Karen

2006-01-01

Public education is the key to individual and business prosperity. With a vested stake in education, educators, employers, parents, policymakers, and the public should question how this nation's public education system is faring. Knowing that recent international assessments have shown little or no gains in American students' achievement, the author asserts the clear need for change. As both a large American corporate employer and a provider of technology for schools, Dell is concerned with ensuring that youth will thrive in their adult lives. Changing workplace expectations lead to a new list of skills students will need to acquire before completing their schooling. Through technology, Dell supports schools in meeting educational goals, striving to supply students with the necessary skills, referred to as twenty-first century skills. The Partnership for 21st Century Skills, of which Dell is a member, has led an initiative to define what twenty-first century learning should entail. Through extensive research, the partnership has built a framework outlining twenty-first century skills: analytical thinking, communication, collaboration, global awareness, and technological and economic literacy. Dell and the partnership are working state by state to promote the integration of these skills into curricula, professional development for teachers, and classroom environments. The authors describe two current initiatives, one in Virginia, the other in Texas, which both use technology to help student learning. All stakeholders can take part in preparing young people to compete in the global economy. Educators and administrators, legislators, parents, and employers must play their role in helping students be ready for what the workforce and the world has in store for them.

Association between fundus autofluorescence and visual outcome in surgically closed macular holes.

Science.gov (United States)

Lee, Young Seob; Yu, Seung-Young; Cho, Nam Suk; Kim, Moo Sang; Kim, Young Gyun; Kim, Eung Suk; Kwak, Hyung Woo

2013-06-01

To investigate the association between fundus autofluorescence (FAF) and visual acuity, recovery of foveal microstructure, and FAF in surgically closed macular holes. Twenty-six eyes with surgically closed macular hole were classified into two groups based on foveal FAF: normal autofluorescence (NAF) or increased autofluorescence (IAF). The association between foveal FAF and visual acuity was analyzed. In addition, we examined the relationship between recovery of the foveal microstructure assessed by spectral domain optical coherence tomography and FAF after macular hole surgery. At 1 month and 6 months after surgery, there were 9 NAF eyes and 17 IAF eyes. There were no differences between NAF and IAF eyes at 1 month and 6 months after surgery. Preoperative best-corrected visual acuity (logarithm of the minimum angle of resolution) did not differ between groups. Best-corrected visual acuity was significantly higher in the NAF group than in the IAF group at 1 month postoperatively (0.59 ± 0.34 vs. 0.91 ± 0.36, P = 0.044) and tended to be higher at 6 months (0.37 ± 0.38 vs. 0.69 ± 0.53, P = 0.126). Restoration of photoreceptor external limiting membrane differed significantly in 8 NAF eyes (89%) and 4 IAF eyes (24%) at postoperation 1 month (P = 0.001). After 6 months, external limiting membrane was restored in all 9 NAF eyes (100%) and in only 11 IAF eyes (65%) (P = 0.042). Fundus autofluorescence findings observed in surgically closed macular holes correlated with visual improvement and photoreceptor status. Eyes with visual improvement had restoration of normal foveal autofluorescence and retinal microstructure, whereas eyes with persistent foveal hyperautofluorescence did not achieve complete restoration of the retinal microstructure, and visual improvement was not as significant.

Seven Pitfalls in Organisation Literature

Directory of Open Access Journals (Sweden)

Jon Aarum Andersen

2012-05-01

Full Text Available Current organisation literature is rife with several incorrect and confusing assertions which continually create problems for students and researchers alike. Seven of these unfortunate beliefs are presented here and provocatively called ‘pitfalls’. The aim of this article is to draw attention to some of these theoretically incorrect assertions and how they can be avoided in scholarly work. The implications for managers are also presented.

Mind the gap; seven reasons to close fragmented genome assemblies.

Science.gov (United States)

Thomma, Bart P H J; Seidl, Michael F; Shi-Kunne, Xiaoqian; Cook, David E; Bolton, Melvin D; van Kan, Jan A L; Faino, Luigi

2016-05-01

Like other domains of life, research into the biology of filamentous microbes has greatly benefited from the advent of whole-genome sequencing. Next-generation sequencing (NGS) technologies have revolutionized sequencing, making genomic sciences accessible to many academic laboratories including those that study non-model organisms. Thus, hundreds of fungal genomes have been sequenced and are publically available today, although these initiatives have typically yielded considerably fragmented genome assemblies that often lack large contiguous genomic regions. Many important genomic features are contained in intergenic DNA that is often missing in current genome assemblies, and recent studies underscore the significance of non-coding regions and repetitive elements for the life style, adaptability and evolution of many organisms. The study of particular types of genetic elements, such as telomeres, centromeres, repetitive elements, effectors, and clusters of co-regulated genes, but also of phenomena such as structural rearrangements, genome compartmentalization and epigenetics, greatly benefits from having a contiguous and high-quality, preferably even complete and gapless, genome assembly. Here we discuss a number of important reasons to produce gapless, finished, genome assemblies to help answer important biological questions. Copyright © 2015 Elsevier Inc. All rights reserved.

Seven Billion People: Fostering Productive Struggle

Science.gov (United States)

Murawska, Jaclyn M.

2018-01-01

How can a cognitively demanding real-world task such as the Seven Billion People problem promote productive struggle "and" help shape students' mathematical dispositions? Driving home from school one evening, Jaclyn Murawska heard a commentator on the radio announce three statements: (1) experts had determined that the world population…

Epidemiology of injuries in senior male rugby union sevens: a systematic review.

Science.gov (United States)

Cruz-Ferreira, Antonio; Cruz-Ferreira, Eduardo; Santiago, Luiz; Taborda Barata, Luis

2017-02-01

In 2016 the Rugby Union variant of sevens will enter the official Olympic Programme. Until now, most of injury surveillance studies in Rugby Union focus on elite 15-a-side cohorts, with reported injury incidence rates reaching 96 per 1000 player-match-hours, and mean severity set at 20 days. Sparse data is available regarding rugby sevens. The aim of this study was to systematically review available data regarding the epidemiology of injuries in senior male rugby sevens. Electronic databases (Pubmed, Google Scholar, SCOPUS, Scielo and IndexRMP) were searched in September 2015, complemented by manual searches of bibliographies and relevant "grey literature". Seven prospective cohort original articles addressing injuries in senior male rugby sevens players were included in this review. Overall injury incidence rates in elite rugby sevens tournaments ranged 101.5 to 119.8 per 1000 player-match-hours. Mean severity was greater than 34.1 days. Lower limb and joint/ligament injuries were the most frequent in elite players. The only study on amateur players revealed a lower injury incidence rate (74.7 per 1000 player-match-hours), and a higher proportion of muscle/tendon (37.5 %) injuries. Injury incidence rates in rugby sevens are higher than those reported for the 15-a-side variant, at the same level of competition. Injuries are also more severe, resulting in longer absence periods. This might result from the fact that rugby sevens is played with greater speed, leading to an increase in energy transfers during tackles, more running and turning manoeuvers, that can possibly cause more severe injuries.

School Closings in Philadelphia

Science.gov (United States)

Jack, James; Sludden, John

2013-01-01

In 2012, the School District of Philadelphia closed six schools. In 2013, it closed 24. The closure of 30 schools has occurred amid a financial crisis, headlined by the district's $1.35 billion deficit. School closures are one piece of the district's plan to cut expenditures and close its budget gap. The closures are also intended to make…

Assessing twenty-first century skills through a teacher created video game for high school biology students

Science.gov (United States)

Annetta, Leonard A.; Cheng, Meng-Tzu; Holmes, Shawn

2010-07-01

As twenty-first century skills become a greater focus in K-12 education, an infusion of technology that meets the needs of today's students is paramount. This study looks at the design and creation of a Multiplayer Educational Gaming Application (MEGA) for high school biology students. The quasi-experimental, qualitative design assessed the twenty-first century skills of digital age literacy, inventive thinking, high productivity, and effective communication techniques of the students exposed to a MEGA. Three factors, as they pertained to these skills, emerged from classroom observations. Interaction with the teacher, discussion with peers, and engagement/time-on-task while playing the MEGA suggested that students playing an educational video game exhibited all of the projected twenty-first century skills while being engrossed in the embedded science content.

Celiac Disease: Four Inches and Seven Pounds...

Science.gov (United States)

... Disease" Articles Celiac Disease Changes Everything / What is Celiac Disease? / Symptoms, Diagnosis & Treatment / Four Inches and Seven Pounds… / Learning to Live Well with Celiac Disease / Living Gluten-Free Spring 2015 Issue: Volume 10 ...

Seven Posers in the Constructivist Classroom

Science.gov (United States)

Kotzee, Ben

2010-01-01

In education, "constructivism" constitutes the "grand unified theory" of the moment. In this article, I maintain that constructivism as a theory of knowledge and constructivism as pedagogy are distinct and that the question of what constructivism about knowledge implies for teaching is under-theorised. Seven classroom scenarios are sketched that…

Thomas Piketty – The Adam Smith of the Twenty-First Century?

Directory of Open Access Journals (Sweden)

Jacob Dahl Rendtorff

2014-11-01

Full Text Available Piketty’s book, Capital in the Twenty-First Century (2014 has become a bestseller in the world. Two month after its publication, it had sold more than 200.000 copies, and this success will surely continue for a long time. Piketty has established a new platform to discuss political economy.

Twenty-One Ways to Use Music in Teaching the Language Arts.

Science.gov (United States)

Cardarelli, Aldo F.

Twenty-one activities that integrate music and the language arts in order to capitalize on children's interests are described in this paper. Topics of the activities are as follows: alphabetical order, pantomime, vocabulary building from words of a favorite song, words that are "the most (whatever)" from songs, mood words, a configuration clue…

Seven deadliest USB attacks

CERN Document Server

Anderson, Brian

2010-01-01

Do you need to keep up with the latest hacks, attacks, and exploits effecting USB technology? Then you need Seven Deadliest USB Attacks. This book pinpoints the most dangerous hacks and exploits specific to USB, laying out the anatomy of these attacks including how to make your system more secure. You will discover the best ways to defend against these vicious hacks with step-by-step instruction and learn techniques to make your computer and network impenetrable. Attacks detailed in this book include: USB Hacksaw USB Switchblade USB Based Virus/Malicous Code Launch USB Device Overflow RAMdum

Projected Changes on the Global Surface Wave Drift Climate towards the END of the Twenty-First Century

Science.gov (United States)

Carrasco, Ana; Semedo, Alvaro; Behrens, Arno; Weisse, Ralf; Breivik, Øyvind; Saetra, Øyvind; Håkon Christensen, Kai

2016-04-01

The global wave-induced current (the Stokes Drift - SD) is an important feature of the ocean surface, with mean values close to 10 cm/s along the extra-tropical storm tracks in both hemispheres. Besides the horizontal displacement of large volumes of water the SD also plays an important role in the ocean mix-layer turbulence structure, particularly in stormy or high wind speed areas. The role of the wave-induced currents in the ocean mix-layer and in the sea surface temperature (SST) is currently a hot topic of air-sea interaction research, from forecast to climate ranges. The SD is mostly driven by wind sea waves and highly sensitive to changes in the overlaying wind speed and direction. The impact of climate change in the global wave-induced current climate will be presented. The wave model WAM has been forced by the global climate model (GCM) ECHAM5 wind speed (at 10 m height) and ice, for present-day and potential future climate conditions towards the end of the end of the twenty-first century, represented by the Intergovernmental Panel for Climate Change (IPCC) CMIP3 (Coupled Model Inter-comparison Project phase 3) A1B greenhouse gas emission scenario (usually referred to as a ''medium-high emissions'' scenario). Several wave parameters were stored as output in the WAM model simulations, including the wave spectra. The 6 hourly and 0.5°×0.5°, temporal and space resolution, wave spectra were used to compute the SD global climate of two 32-yr periods, representative of the end of the twentieth (1959-1990) and twenty-first (1969-2100) centuries. Comparisons of the present climate run with the ECMWF (European Centre for Medium-Range Weather Forecasts) ERA-40 reanalysis are used to assess the capability of the WAM-ECHAM5 runs to produce realistic SD results. This study is part of the WRCP-JCOMM COWCLIP (Coordinated Ocean Wave Climate Project) effort.

Twenty-First Water Reaction Safety Information Meeting

International Nuclear Information System (INIS)

Monteleone, S.

1994-04-01

This three-volume report contains 90 papers out of the 102 that were presented at the Twenty-First Water Reactor Safety Information Meeting held at the Bethesda Marriott Hotel, Bethesda, Maryland, during the week of October 25--27, 1993. The papers are printed in the order of their presentation in each session and describe progress and results of programs in nuclear safety research conducted in this country and abroad. Foreign participation in the meeting included papers presented by researchers from France, Germany, Japan, Russia, Switzerland, Taiwan, and United Kingdom. The titles of the papers and the names of the authors have been updated and may differ from those that appeared in the final program of the meeting. Individual papers have been cataloged separately. This document, Volume 2, presents papers on severe accident research

Twenty-First Water Reactor Safety Information Meeting

International Nuclear Information System (INIS)

Monteleone, S.

1994-04-01

This three-volume report contains 90 papers out of the 102 that were presented at the Twenty-First Water Reactor Safety Information Meeting held at the Bethesda Marriott Hotel, Bethesda, Maryland, during the week of October 25-27, 1993. The papers are printed in the order of their presentation in each session and describe progress and results of programs in nuclear safety research conducted in this country and abroad. Foreign participation in the meeting included papers presented by researchers from France, Germany, Japan, Russia, Switzerland, Taiwan, and United Kingdom. The titles of the papers and the names of the authors have been updated and may differ from those that appeared in the final program of the meeting. Selected papers were indexed separately for inclusion in the Energy Science and Technology Database

Peer assessment in university teaching: Evaluating seven course designs

OpenAIRE

van den Berg, I.; Admiraal, W.; Pilot, A.

2006-01-01

Peer assessment in university teaching: evaluating seven course designs Abstract Peer assessment is understood to be an arrangement with students assessing the quality of their fellow students’ writings and giving feedback to each other. This multiple-case study of seven designs of peer assessment focuses on the contribution of peer assessment to the acquisition of undergraduates’ writing skills. Its aim is to arrive at an optimal design of peer assessment. Factors included in this study are:...

Renovation and uprating of seven hydropower plants in Java

International Nuclear Information System (INIS)

Nuessli, W.

1991-01-01

The Indonesian Power Authority is planning to renovate and uprate seven hydropower stations in Java to expand plant life expectancy, ensure operating safety and reliability, and increase power and generation within economical limits. The power plants were constructed in the early 1920s and extended between 1945 and 1950. Their capacities vary between 4 and 20 MW. For the renovation project, Colenco Power Consulting Ltd. is acting as a consultant to PLN. In February 1990, Colenco inspected all seven power plants. The results of the inspections served as the basis for the development of renovation plans for each of the seven hydropower plants. To determine the cost of the proposed renovation plans, appraisers had to determine a method for comparing the value of an existing plant to that of a renovated one. The two different evaluation methods used for these comparisons are the focus of this paper

Twenty years of analysis of light elements at the LARN

International Nuclear Information System (INIS)

Demortier, G.

1992-01-01

We review the applications of ion beam analysis of light elements performed in the LARN during the last twenty years. The works mainly concern: helium bubbles in aluminum foils, Li in aluminum alloys, carbon in high purity MgO crystals and in olivines, nitrogen bubbles in glass and implanted nitrogen in iron and aluminum, oxygen in YBaCuO superconductors, fluorine in tooth enamel and implanted fluorine in metals. (orig.)

Twenty First Century Education: Transformative Education for Sustainability and Responsible Citizenship

Science.gov (United States)

Bell, David V. J.

2016-01-01

Many ministries of education focus on twenty-first century education but unless they are looking at this topic through a sustainability lens, they will be missing some of its most important elements. The usual emphasis on developing skills for employability in the current global economy begs the question whether the global economy is itself…

How Do Students Value the Importance of Twenty-First Century Skills?

Science.gov (United States)

Ahonen, Arto Kalevi; Kinnunen, Päivi

2015-01-01

Frameworks of twenty-first century skills have attained a central role in school development and curriculum changes all over the world. There is a common understanding of the need for meta-skills such as problem solving, reasoning, collaboration, and self-regulation. This article presents results from a Finnish study, in which 718 school pupils…

Therapeutic efficacy of ranitidine bismuth citrate with clarithromycin for seven days in the eradication of Helicobacter pylori in Brazilian peptic ulcer patients

Directory of Open Access Journals (Sweden)

Jaime Natan Eisig

Full Text Available CONTEXT: The curative treatment of peptic ulcer is made available nowadays through the eradication of the bacterium Helicobacter pylori, which is associated with it, but the best therapeutic regimen is yet to be determined. OBJECTIVE: To assess the efficacy of a therapeutic regimen with 400 mg ranitidine bismuth citrate associated with 500 mg clarithromycin given twice a day for seven days in a cohort of Brazilian patients with peptic ulcer. TYPE OF STUDY: Cross-sectional study. SETTING: Tertiary-care hospital. PATIENTS: One hundred and twenty nine outpatients, with active or healed peptic ulcers infected by Helicobacter pylori, diagnosed via endoscopy with confirmation via the urease test and histological examination, who had never undergone a regimen for the eradication of the bacterium. PROCEDURE: Administration of 400 mg ranitidine-bismuth and 500 mg clarithromycin twice a day, for seven days. MAIN MEASUREMENTS: Efficacy of the treatment, with a check on the cure done via another endoscopy eight weeks after drug administration. The eradication of the bacterium was determined via the urease test and histological examination. Patients who were negative for both were considered to be cured. RESULTS: Eight patients failed to complete the study. The eradication rate according to intention to treat was 81% (104/129 and per protocol was 86% (104/121. CONCLUSION: The bismuth ranitidine compound associated with clarithromycin used for one week was shown to be a simple, effective and well-tolerated therapeutic regimen for the eradication of Helicobacter pylori.

Cervical spinal cord, root, and bony spine injuries: a closed claims analysis.

Science.gov (United States)

Hindman, Bradley J; Palecek, John P; Posner, Karen L; Traynelis, Vincent C; Lee, Lorri A; Sawin, Paul D; Tredway, Trent L; Todd, Michael M; Domino, Karen B

2011-04-01

The aim of this study was to characterize cervical cord, root, and bony spine claims in the American Society of Anesthesiologists Closed Claims database to formulate hypotheses regarding mechanisms of injury. All general anesthesia claims (1970-2007) in the Closed Claims database were searched to identify cervical injuries. Three independent teams, each consisting of an anesthesiologist and neurosurgeon, used a standardized review form to extract data from claim summaries and judge probable contributors to injury. Cervical injury claims (n = 48; mean ± SD age 47 ± 15 yr; 73% male) comprised less than 1% of all general anesthesia claims. When compared with other general anesthesia claims (19%), cervical injury claims were more often permanent and disabling (69%; P cervical stenosis) were often present, cord injuries usually occurred in the absence of traumatic injury (81%) or cervical spine instability (76%). Cord injury occurred with cervical spine (65%) and noncervical spine (35%) procedures. Twenty-four percent of cord injuries were associated with the sitting position. Probable contributors to cord injury included anatomic abnormalities (81%), direct surgical complications (24% [38%, cervical spine procedures]), preprocedural symptomatic cord injury (19%), intraoperative head/neck position (19%), and airway management (11%). Most cervical cord injuries occurred in the absence of traumatic injury, instability, and airway difficulties. Cervical spine procedures and/or sitting procedures appear to predominate. In the absence of instability, cervical spondylosis was the most common factor associated with cord injury.

Science Teacher Education in the Twenty-First Century: a Pedagogical Framework for Technology-Integrated Social Constructivism

Science.gov (United States)

Barak, Miri

2017-04-01

Changes in our global world have shifted the skill demands from acquisition of structured knowledge to mastery of skills, often referred to as twenty-first century competencies. Given these changes, a sequential explanatory mixed methods study was undertaken to (a) examine predominant instructional methods and technologies used by teacher educators, (b) identify attributes for learning and teaching in the twenty-first century, and (c) develop a pedagogical framework for promoting meaningful usage of advanced technologies. Quantitative and qualitative data were collected via an online survey, personal interviews, and written reflections with science teacher educators and student teachers. Findings indicated that teacher educators do not provide sufficient models for the promotion of reform-based practice via web 2.0 environments, such as Wikis, blogs, social networks, or other cloud technologies. Findings also indicated four attributes for teaching and learning in the twenty-first century: (a) adapting to frequent changes and uncertain situations, (b) collaborating and communicating in decentralized environments, (c) generating data and managing information, and (d) releasing control by encouraging exploration. Guided by social constructivist paradigms and twenty-first century teaching attributes, this study suggests a pedagogical framework for fostering meaningful usage of advanced technologies in science teacher education courses.

Over Twenty Years Of Experience In ITU TRIGA MARK-II Reactor

International Nuclear Information System (INIS)

Yavuz, Hasbi

2008-01-01

I.T.U. TRIGA MARK-II Training and Research Reactor, rated at 250 kW steady-state and 1200 MW pulsing power is the only research and training reactor owned and operated by a university in Turkey. Reactor has been operating since March 11, 1979; therefore the reactor has been operating successfully for more than twenty years. Over the twenty years of operation: - The tangential beam tube was equipped with a neutron radiography facility, which consists of a divergent collimator and exposure room; - A computerized data acquisition system was designed and installed such that all parameters of the reactor, which are observed from the console, could be monitored both in normal and pulse operations; - An electrical power calibration system was built for the thermal power calibration of the reactor; - Publications related with I.T.U. TRIGA MARK-II Training and Research Reactor are listed in Appendix; - Two majors undesired shutdown occurred; - The I.T.U. TRIGA MARK-II Training and Research Reactor is still in operation at the moment. (authors)

An experts survey on sustainability across twenty-seven extensive European systems of grassland management.

Science.gov (United States)

Caballero, Rafael; Gil, Angel; Fernández-Santos, Xavier

2008-08-01

European Large Scale Grazing Systems (LSGS) are at a crossroad with environmental, agronomic, and social factors interacting on their future viability. This research assesses the current environmental and socio-economic status of a wide range of European LSGS according to an agreed subset of sustainability criteria and indicators, which have been recognized by corresponding experts and privileged observers on their respective case-study system. A survey questionnaire was drafted containing five main criteria (pastoral use, environmental, economic, social, and market and development), with four conceptual-scored variables (indicators) within each criterion. Descriptive, analytical and clustering statistical techniques helped to draw a synthesis of the main result and to standardize sustainability variables across different biogeographical regions and management situations. The results show large multicollinearity among the 20 variables proposed. This dependence was revealed by the reduction to six main factor-components, which accounted for about 73% of the total variance in responses. Aggregation of point-score indicators across criteria to obtain a sustainability index can be of less policy relevance than responses to specific criteria or indicators. Affinity between case-study systems, as judged by collaborative-expert responses, was not related to biogeographical location, operating livestock sector, or population density in their areas. The results show larger weaknesses and constraints in the economic and social criteria than in the pastoral and environmental criteria, and the large heterogeneity of responses appears in the social criterion.

Close binary stars

International Nuclear Information System (INIS)

Larsson-Leander, G.

1979-01-01

Studies of close binary stars are being persued more vigorously than ever, with about 3000 research papers and notes pertaining to the field being published during the triennium 1976-1978. Many major advances and spectacular discoveries were made, mostly due to increased observational efficiency and precision, especially in the X-ray, radio, and ultraviolet domains. Progress reports are presented in the following areas: observational techniques, methods of analyzing light curves, observational data, physical data, structure and models of close binaries, statistical investigations, and origin and evolution of close binaries. Reports from the Coordinates Programs Committee, the Committee for Extra-Terrestrial Observations and the Working Group on RS CVn binaries are included. (Auth./C.F.)

75 FR 7370 - Closed Captioning of Video Programming; Closed Captioning Requirements for Digital Television...

Science.gov (United States)

2010-02-19

... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 79 [CG Docket No. 05-231; ET Docket No. 99-254; FCC 08-255] Closed Captioning of Video Programming; Closed Captioning Requirements for Digital Television... Captioning of Video Programming; Closed Captioning Requirements for Digital Television Receivers, Declaratory...

The Best Aircraft for Close Air Support in the Twenty First Century

Science.gov (United States)

2016-09-01

movement of those forces.”8 In addition to CAS, the Air Force em - ploys its aircraft to perform a myriad of roles during combat operations, such as offen...distance to bombing ranges, and so forth.14 Once these figures are accumulated for each major com- mand’s fleet, the second step is developing a CPFH...the GBU-39 small diameter bomb and the AGM-176 Griffin missile, it is still in operational test and development.26 The new squadron (replacement

Twenty Years of Australian Educational Computing: A Call for Modern Traditionalism

Science.gov (United States)

McDougall, Anne

2005-01-01

This article reflects on twenty or more years of development and research in educational computing. It argues that the emphasis on exploiting the technology in the service of contemporary ideas about learning held by many of the early workers has been lost to a focus on the technology itself and its capabilities. In schools this has led to an…

An analysis of players\\' performances in the first cricket Twenty20 ...

African Journals Online (AJOL)

The purpose of this paper is to show how batting and bowling performance measures for one-day internationals can be adapted for use in Twenty20 matches, specifically in the case of a very small number of matches played. These measures are then used to give rankings of the batsmen and bowlers who performed best in ...

Rapid Identification of Seven Waterborne Exophiala Species by RCA DNA Padlock Probes.

Science.gov (United States)

Najafzadeh, M J; Vicente, V A; Feng, Peiying; Naseri, A; Sun, Jiufeng; Rezaei-Matehkolaei, A; de Hoog, G S

2018-03-05

The black yeast genus Exophiala includes numerous potential opportunistic species that potentially cause systematic and disseminated infections in immunocompetent individuals. Species causing systemic disease have ability to grow at 37-40 °C, while others consistently lack thermotolerance and are involved in diseases of cold-blooded, waterborne vertebrates and occasionally invertebrates. We explain a fast and sensitive assay for recognition and identification of waterborne Exophiala species without sequencing. The ITS rDNA region of seven Exophiala species (E. equina, E. salmonis, E. opportunistica, E. pisciphila, E. aquamarina, E. angulospora and E. castellanii) along with the close relative Veronaea botryosa was sequenced and aligned for the design of specific padlock probes for the detection of characteristic single-nucleotide polymorphisms. The assay demonstrated to successfully amplify DNA of target fungi, allowing detection at the species level. Amplification products were visualized on 1% agarose gels to confirm specificity of probe-template binding. Amounts of reagents were reduced to prevent the generation of false positive results. The simplicity, tenderness, robustness and low expenses provide padlock probe assay (RCA) a definite place as a very practical method among isothermal approaches for DNA diagnostics.

Student Opinions about the Seven-Step Procedure in Problem-Based Hospitality Management Education

Science.gov (United States)

Zwaal, Wichard; Otting, Hans

2014-01-01

This study investigates how hospitality management students appreciate the role and application of the seven-step procedure in problem-based learning. A survey was developed containing sections about personal characteristics, recall of the seven steps, overall report marks, and 30 statements about the seven-step procedure. The survey was…

The twenty-first century in space

CERN Document Server

Evans, Ben

2015-01-01

This final entry in the History of Human Space Exploration mini-series by Ben Evans continues with an in-depth look at the latter part of the 20th century and the start of the new millennium. Picking up where Partnership in Space left off, the story commemorating the evolution of manned space exploration unfolds in further detail. More than fifty years after Yuri Gagarin’s pioneering journey into space, Evans extends his overview of how that momentous voyage continued through the decades which followed. The Twenty-first Century in Space, the sixth book in the series, explores how the fledgling partnership between the United States and Russia in the 1990s gradually bore fruit and laid the groundwork for today’s International Space Station. The narrative follows the convergence of the Shuttle and Mir programs, together with standalone missions, including servicing the Hubble Space Telescope, many of whose technical and human lessons enabled the first efforts to build the ISS in orbit. The book also looks to...

The Microcirculation is Preserved in Emergency Department Low‐acuity Sepsis Patients Without Hypotension

DEFF Research Database (Denmark)

Skibsted, Simon; Filbin, Michael; Hou, Peter

2014-01-01

-acuity sepsis patients. The hypothesis was that patients with sepsis, but without hypotension, will demonstrate signs of flow abnormalities compared to noninfected control patients. Methods This was a prospective, observational study in a convenience sample of patients with sepsis and noninfected controls...

IE Information Notice No. 85-93: Westinghouse Type DS circuit breakers, potential failure of electric closing feature because of broken spring release latch lever

International Nuclear Information System (INIS)

Jordan, E.L.

1992-01-01

On April 14, 1985, the Westinghouse Nuclear Services Integration Division (NSID) issued Technical Bulletin No. NSID-TB-85-17 advising their customers of a potential malfunction in Westinghouse Type DS Class 1E circuit breakers because of broken spring release latch levers. These electrically operated type DS breakers will not close electrically when the spring release latch lever has been broken off. Twenty-five broken levers have been reported and evaluated. This evaluation shows concentrations of incidents traceable to manufacturing in the following periods of time: early 1975, April 1976, and early 1978. This circuit breaker failure, as discussed, adversely affects the safety function (closing on demand) when the circuit breaker is used in the Engineered Safety Features Systems. However, this failure mode will not affect the safety trip function when it is used in the reactor protection system

Fast-food consumption among 17-year-olds in the Birth to Twenty ...

African Journals Online (AJOL)

Objectives: Assessment of fast-food consumption in urban black adolescents. Design: The current research was a descriptive cross-sectional study. Setting: Subjects attending the Birth to Twenty (Bt20) research facility at the Chris Hani Baragwanath Hospital in Soweto, Johannesburg between September 2007 and May ...

Twenty years of punishment (and democracy) in South Africa

African Journals Online (AJOL)

in 2004, South Africa has the highest incarceration rate in Africa and one of the highest in the world.2 In. 2013, the number of people serving life imprisonment stood at 11 000, as opposed to 400 in 1994.3. Democratisation has thus brought with it a dramatic increase in long-term prison sentences, ranging from seven years ...

Approach for selecting the best remediation option for a closed uranium mine in Slovenia

International Nuclear Information System (INIS)

Kontiae, B.

1999-01-01

For uranium mine and mill at Zirovski vrh, Slovenia, which stopped operating in July 1990, four remediation options were evaluated. Basically, these options were close-down alternatives focusing on final disposition of the residues, primarily mill tailings. A multi-attribute evaluation approach was applied for the comparison between alternatives and as a decision support. The main considerations were given to the economy of the alternatives and their environmental and health impacts. Altogether, fifty seven basic attributes, organized in an evaluation (decision) tree, were applied. In the paper, results of the first two iterations of the evaluation are presented. The third iteration, which is presently under execution and involves more thorough long-term performance and uncertainty assessment associated to mill tailings disposal, are also briefly discussed. (author)

The EU(7)-PIM list: a list of potentially inappropriate medications for older people consented by experts from seven European countries.

Science.gov (United States)

Renom-Guiteras, Anna; Meyer, Gabriele; Thürmann, Petra A

2015-07-01

The aim of the study was to develop a European list of potentially inappropriate medications (PIM) for older people, which can be used for the analysis and comparison of prescribing patterns across European countries and for clinical practice. A preliminary PIM list was developed, based on the German PRISCUS list of potentially inappropriate medications and other PIM lists from the USA, Canada and France. Thirty experts on geriatric prescribing from Estonia, Finland, France, the Netherlands, Spain and Sweden participated; eight experts performed a structured expansion of the list, suggesting further medications; twenty-seven experts participated in a two-round Delphi survey assessing the appropriateness of drugs and suggesting dose adjustments and therapeutic alternatives. Finally, twelve experts completed a brief final survey to decide upon issues requiring further consensus. Experts reached a consensus that 282 chemical substances or drug classes from 34 therapeutic groups are PIM for older people; some PIM are restricted to a certain dose or duration of use. The PIM list contains suggestions for dose adjustments and therapeutic alternatives. The European Union (EU)(7)-PIM list is a screening tool, developed with participation of experts from seven European countries, that allows identification and comparison of PIM prescribing patterns for older people across European countries. It can also be used as a guide in clinical practice, although it does not substitute the decision-making process of individualised prescribing for older people. Further research is needed to investigate the feasibility and applicability and, finally, the clinical benefits of the newly developed list.

The Seven Challenges for Transitioning into a Bio-based Circular Economy in the Agri-food Sector.

Science.gov (United States)

Borrello, Massimiliano; Lombardi, Alessia; Pascucci, Stefano; Cembalo, Luigi

2016-01-01

Closed-loop agri-food supply chains have a high potential to reduce environmental and economic costs resulting from food waste disposal. This paper illustrates an alternative to the traditional supply chain of bread based on the principles of a circular economy. Six circular interactions among seven actors (grain farmers, bread producers, retailers, compostable packaging manufacturers, insect breeders, livestock farmers, consumers) of the circular filière are created in order to achieve the goal of "zero waste". In the model, two radical technological innovations are considered: insects used as animal feed and polylactic acid compostable packaging. The main challenges for the implementation of the new supply chain are identified. Finally, some recent patents related to bread sustainable production, investigated in the current paper, are considered. Recommendations are given to academics and practitioners interested in the bio-based circular economy model approach for transforming agri-food supply chains.

Testing Students under Cognitive Capitalism: Knowledge Production of Twenty-First Century Skills

Science.gov (United States)

Morgan, Clara

2016-01-01

Scholars studying the global governance of education have noted the increasingly important role corporations play in educational policy making. I contribute to this scholarship by examining the Assessment and Teaching of twenty-first century skills (ATC21S™) project, a knowledge production apparatus operating under cognitive capitalism. I analyze…

Border Crossing in Contemporary Brazilian Culture: Global Perspectives from the Twenty-First Century Literary Scene

Directory of Open Access Journals (Sweden)

Cimara Valim de Melo

2016-06-01

Full Text Available Abstract: This paper investigates the process of internationalisation of Brazilian literature in the twenty-first century from the perspective of the publishing market. For this, we analyse how Brazil has responded to globalisation and what effects of cultural globalisation can be seen in the Brazilian literary scene, focusing on the novel. Observing the movement of the novelists throughout the globe, the reception of Brazilian literature in the United Kingdom and the relations between art and the literary market in Brazil, we intend to provoke some reflections on Brazilian cultural history in the light of the twenty-first century.

Closed reduction of slipped capital femoral epiphysis: high-risk factor for avascular necrosis.

Science.gov (United States)

Kitano, Toshio; Nakagawa, Keisuke; Wada, Mayuko; Moriyama, Michiko

2015-07-01

How should we treat acute/unstable slipped capital femoral epiphysis (SCFE) without the development of avascular necrosis (AVN)? To answer this question, we investigated the risk factors of AVN development after SCFE. Seventy-six hips of 64 patients were classified using two kinds of classification systems, Loder's classification based on instability and the conventional classification based on the duration of symptom, because both classifications are related to AVN development. Of 21 unstable SCFEs, seven hips developed AVN. Of 35 hips defined as acute or acute on chronic, nine hips developed AVN. Two stable SCFEs of Loder's classification developed AVN, one was acute and the other was acute on chronic. No hips of chronic SCFE developed AVN. The factor that had influenced AVN development was only closed reduction, whether purposefully or inadvertently, in an acute or unstable SCFE. On the basis of the findings of this study, one should not embark on any modality of closed reduction for an unstable or acute form of SCFE, as there is a high risk for occurrence of AVN. For the same reason, a traction table should not be used for SCFE fixation, so as to avoid an inadvertent reduction or force that can lead to AVN.

Twenty-first-century medical microbiology services in the UK.

Science.gov (United States)

Duerden, Brian

2005-12-01

With infection once again a high priority for the UK National Health Service (NHS), the medical microbiology and infection-control services require increased technology resources and more multidisciplinary staff. Clinical care and health protection need a coordinated network of microbiology services working to consistent standards, provided locally by NHS Trusts and supported by the regional expertise and national reference laboratories of the new Health Protection Agency. Here, I outline my thoughts on the need for these new resources and the ways in which clinical microbiology services in the UK can best meet the demands of the twenty-first century.

The characterization of twenty sequenced human genomes.

Directory of Open Access Journals (Sweden)

Kimberly Pelak

2010-09-01

Full Text Available We present the analysis of twenty human genomes to evaluate the prospects for identifying rare functional variants that contribute to a phenotype of interest. We sequenced at high coverage ten "case" genomes from individuals with severe hemophilia A and ten "control" genomes. We summarize the number of genetic variants emerging from a study of this magnitude, and provide a proof of concept for the identification of rare and highly-penetrant functional variants by confirming that the cause of hemophilia A is easily recognizable in this data set. We also show that the number of novel single nucleotide variants (SNVs discovered per genome seems to stabilize at about 144,000 new variants per genome, after the first 15 individuals have been sequenced. Finally, we find that, on average, each genome carries 165 homozygous protein-truncating or stop loss variants in genes representing a diverse set of pathways.

27 CFR 44.146 - Closing.

Science.gov (United States)

2010-04-01

... PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Operations by Export Warehouse Proprietors Inventories § 44.146 Closing. A closing inventory shall be made by the export warehouse proprietor when he transfers ownership or concludes business. Where the proprietor transfers ownership the closing inventory shall be made...

Pärt, Arvo: Seven Magnificat Antiphons / Barry Witherden

Index Scriptorium Estoniae

Witherden, Barry

1996-01-01

Uuest heliplaadist "Pärt, Arvo: Seven Magnificat Antiphons. Magnificat. Summa; Tormis, Veljo: The Curse Upon Iron. Karelian Destiny. BBC Singers, Bo Holton". Collins Classics 1472-2 (61 minutes: DDD)

Strategies for Teaching Maritime Archaeology in the Twenty First Century

Science.gov (United States)

Staniforth, Mark

2008-12-01

Maritime archaeology is a multi-faceted discipline that requires both theoretical learning and practical skills training. In the past most universities have approached the teaching of maritime archaeology as a full-time on-campus activity designed for ‘traditional’ graduate students; primarily those in their early twenties who have recently come from full-time undergraduate study and who are able to study on-campus. The needs of mature-age and other students who work and live in different places (or countries) and therefore cannot attend lectures on a regular basis (or at all) have largely been ignored. This paper provides a case study in the teaching of maritime archaeology from Australia that, in addition to ‘traditional’ on-campus teaching, includes four main components: (1) learning field methods through field schools; (2) skills training through the AIMA/NAS avocational training program; (3) distance learning topics available through CD-ROM and using the Internet; and (4) practicums, internships and fellowships. The author argues that programs to teach maritime archaeology in the twenty first century need to be flexible and to address the diverse needs of students who do not fit the ‘traditional’ model. This involves collaborative partnerships with other universities as well as government underwater cultural heritage management agencies and museums, primarily through field schools, practicums and internships.

Twenty-first Semiannual Report of the Commission to the Congress, January 1957

Energy Technology Data Exchange (ETDEWEB)

Strauss, Lewis L.

1957-01-31

The document represents the twenty-first semiannual Atomic Energy Commission (AEC) report to Congress. The report sums up the major activities and developments in the national atomic energy program covering the period July - December 1956. A special part two of this semiannual report addresses specifically Radiation Safety in Atomic Energy Activities.

Measurement of opening and closing angles of aortic valve prostheses in vivo using dual-source computed tomography: Comparison with those of manufacturers' in 10 different types

International Nuclear Information System (INIS)

Suh, Young Joo; Kim, Young Jin; Hong, Yoo Jin; Lee, Hye Jeong; Hur, Jin; Im, Dong Jin; Kim, Yun Jung; Choi, Byoung Wook

2015-01-01

The aims of this study were to compare opening and closing angles of normally functioning mechanical aortic valves measured on dual-source computed tomography (CT) with the manufacturers' values and to compare CT-measured opening angles according to valve function. A total of 140 patients with 10 different types of mechanical aortic valves, who underwent dual-source cardiac CT, were included. Opening and closing angles were measured on CT images. Agreement between angles in normally functioning valves and the manufacturer values was assessed using the interclass coefficient and the Bland-Altman method. CT-measured opening angles were compared between normal functioning valves and suspected dysfunctioning valves. The CT-measured opening angles of normally functioning valves and manufacturers' values showed excellent agreement for seven valve types (intraclass coefficient [ICC], 0.977; 95% confidence interval [CI], 0.962-0.987). The mean differences in opening angles between the CT measurements and the manufacturers' values were 1.2° in seven types of valves, 11.0° in On-X valves, and 15.5° in ATS valves. The manufacturers' closing angles and those measured by CT showed excellent agreement for all valve types (ICC, 0.953; 95% CI, 0.920-0.972). Among valves with suspected dysfunction, those with limitation of motion (LOM) and an increased pressure gradient (PG) had smaller opening angles than those with LOM only (p < 0.05). Dual-source cardiac CT accurately measures opening and closing angles in most types of mechanical aortic valves, compared with the manufacturers' values. Opening angles on CT differ according to the type of valve dysfunction and a decreased opening angle may suggest an elevated PG

27 CFR 40.426 - Closing.

Science.gov (United States)

2010-04-01

... TOBACCO Manufacture of Cigarette Papers and Tubes Operations by Manufacturers § 40.426 Closing. A closing report, covering the period from the first of the month to the date of the closing inventory, shall be made with such inventory. (72 Stat. 1422; 26 U.S.C. 5722) Inventories ...

Professional Learning 101: A Syllabus of Seven Protocols

Science.gov (United States)

Fogarty, Robin; Pete, Brian

2010-01-01

Seven elements found in professional development research are necessary for successful professional development programs. High-quality professional learning must be sustained, job-embedded, collegial, interactive, integrative, practical, and results-oriented.

7 CFR 1927.56 - Scheduling loan closing.

Science.gov (United States)

2010-01-01

... REGULATIONS TITLE CLEARANCE AND LOAN CLOSING Real Estate Title Clearance and Loan Closing § 1927.56 Scheduling loan closing. The agency, in coordination with the closing agent, will arrange a loan closing and send loan closing instructions, on an agency form to the closing agent when the agency determines that the...

Seven principle of highly effective Nuclear Energy Programs

International Nuclear Information System (INIS)

Ferguson, Ch.D.; Reed, Ph.D.

2010-01-01

This paper presents seven principles that demand consideration for any country using a nuclear power program or wanting to acquire such a program. These principles are assessing the overall energy system, determining effective use of financial resources for energy development, ensuring high safety standards, implementing best security practices, preventing the spread of nuclear weapons, managing radioactive waste in a safe and secure manner, and enacting a legal framework that encompasses the other principle areas. The paper applies management methods that underscore development of strong independent national capabilities integrated within an interdependent international system. The paper discusses the individual responsibilities of states in all seven principles and offers recommendations for how states can benefit from greater international cooperation in nuclear energy development

Improving Working Memory and Processing Speed of Students with Dyslexia in Nigeria

Science.gov (United States)

Adubasim, Ijeoma

2018-01-01

This study investigated effective strategies for improving working memory and processing speed of students identified with dyslexia in Nigeria. The study adopted a quasi-experimental research design with the population made up of twenty four thousand seven hundred and twenty seven (24,727) senior secondary school students (S.S.2) in all the public…

Seven Deadliest Unified Communications Attacks

CERN Document Server

York, Dan

2010-01-01

Do you need to keep up with the latest hacks, attacks, and exploits effecting Unified Communications technology? Then you need Seven Deadliest Unified Communication Attacks. This book pinpoints the most dangerous hacks and exploits specific to Unified Communications, laying out the anatomy of these attacks including how to make your system more secure. You will discover the best ways to defend against these vicious hacks with step-by-step instruction and learn techniques to make your computer and network impenetrable. Attacks featured in this book include: UC Ecosystem Attacks Insecure Endpo

Seven Deadliest Social Network Attacks

CERN Document Server

Timm, Carl

2010-01-01

Do you need to keep up with the latest hacks, attacks, and exploits effecting social networks? Then you need Seven Deadliest Social Network Attacks. This book pinpoints the most dangerous hacks and exploits specific to social networks like Facebook, Twitter, and MySpace, laying out the anatomy of these attacks including how to make your system more secure. You will discover the best ways to defend against these vicious hacks with step-by-step instruction and learn techniques to make your computer and network impenetrable. Attacks detailed in this book include: Social Networking Infrastruct

Restaurants closed over Christmas

CERN Multimedia

2011-01-01

The restaurants will be closed during the Christmas holiday period : please note that all three CERN Restaurants will be closed from 5 p.m. on Wednesday, 21 December until Wednesday, 4 January inclusive. The Restaurants will reopen on Thursday, 5 January 2012.

76 FR 72240 - Twenty-Seventh Meeting: RTCA Special Committee 206: Aeronautical Information and Meteorological...

Science.gov (United States)

2011-11-22

... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Twenty-Seventh Meeting: RTCA Special... Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 206..., 2011 FRAC OSED [[Page 72241

The Summit of «Group of Twenty» – 2016: geopolitical assessments

Directory of Open Access Journals (Sweden)

O. S. Vonsovych

2016-08-01

Full Text Available The article investigated the geopolitical assessments of the results of the Summit of «Group of Twenty», which took place in Hangzhou from 4 till 5 September, 2016. The main idea of this event was the development of  innovation, healthy, coherent and inclusive economy. Moreover, important for the geopolitical consolidation of efforts of member countries in the context of further development of the world economy was making such documents as: Contours of the innovative growth of «Group of Twenty», Action plan of «Group of Twenty» in connection with a new industrial revolution, Hangzhou action plan, which set out a strategy for overall and confident growth and also initiative of «Group of twenty» in development and cooperation in the field of digital economy. Important thing is that analysis of the Summit’s results for world regions is important from a geopolitical point of view. We can predict that in the future geopolitical dialogue between the EU and the US in the economy will become more vital for both sides, and will enable to contribute to the implementation of more global challenges of the global economy. We should mention that Summit of «Group of Twenty» largely determined the prospects of global economic processes and build a new world economic order with the introduction of innovative approaches and elements of the digital economy. Activity on the functioning of the global economy should be based on the collective efforts of all participants and take into account all the realities on the international stage. No less important is that the Summit proved the presence of leading geopolitical centers that affect not only the balance of power in the world, but also the further development of key economic processes. Each of these centers sees its future not only the global economy but the global system as a whole as well as its geopolitical influence in certain regions and countries. On the one hand, as for the development of

78 FR 20168 - Twenty Fourth Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems

Science.gov (United States)

2013-04-03

... Washington, DC, on March 28, 2013. Paige Williams, Management Analyst, NextGen, Business Operations Group... Introductions Review Meeting Agenda Review/Approval of Twenty Third Plenary Meeting Summary Leadership Update... for Unmanned Aircraft Systems and Minimum Aviation System Performance Standards Other Business Adjourn...

Theoretical Contexts and Conceptual Frames for the Study of Twenty-First Century Capitalism

DEFF Research Database (Denmark)

Hull Kristensen, Peer; Morgan, Glenn

2012-01-01

This chapter argues that the comparative institutionalist approach requires rethinking in the light of developments in the twenty-first century. The chapter emphasizes the following features of the new environment: first, the rise of the BRIC and the emerging economies; secondly, the changed...

METHYLMERCURY BIOACCUMULATION DEPENDENCE ON NORTHERN PIKE AGE AND SIZE IN TWENTY MINNESOTA LAKES

Science.gov (United States)

Mercury accumulation in northern pike muscle tissue (fillets) was found to be directly related to fish age and size. Measurements were made on 173 individual northern pike specimens from twenty lakes across Minnesota. Best fit regressions of mercury fillet concentration (wet wt.)...

Teachers' Critical Reflective Practice in the Context of Twenty-First Century Learning

Science.gov (United States)

Benade, Leon

2015-01-01

In the twenty-first century, learning and teaching at school must prepare young people for engaging in a complex and dynamic world deeply influenced by globalisation and the revolution in digital technology. In addition to the use of digital technologies, is the development of flexible learning spaces. It is claimed that these developments demand,…

Minding the close relationship.

Science.gov (United States)

Harvey, J H; Omarzu, J

1997-01-01

In this theoretical analysis, we argue that a process referred to as minding is essential for a couple to feel mutually close and satisfied in a close relationship over a long period Minding represents a package of mutual self-disclosure, other forms of goal-oriented behavior aimed at facilitating the relationship, and attributions about self's and other's motivations, intentions, and Mort in the relationship. Self-disclosure and attribution activities in minding are aimed at getting to know the other, trying to understand the other's motivations and deeper disposition as they pertain to the relationship, and showing respect and acceptance for knowledge gained about other. We link the concept of minding to other major ideas and literatures about how couples achieve closeness: self-disclosure and social penetration, intimacy, empathy and empathic accuracy, and love and self-expansion. We argue that the minding process articulated here has not previously been delineated and that it is a useful composite notion about essential steps in bonding among humans. We also argue that the minding concept stretches our understanding of the interface of attribution and close relationships. We present research possibilities and implications and consider possible alternative positions and counter arguments about the merits of the minding idea for close relationship satisfaction.

Proof of Concept of Automated Collision Detection Technology in Rugby Sevens.

Science.gov (United States)

Clarke, Anthea C; Anson, Judith M; Pyne, David B

2017-04-01

Clarke, AC, Anson, JM, and Pyne, DB. Proof of concept of automated collision detection technology in rugby sevens. J Strength Cond Res 31(4): 1116-1120, 2017-Developments in microsensor technology allow for automated detection of collisions in various codes of football, removing the need for time-consuming postprocessing of video footage. However, little research is available on the ability of microsensor technology to be used across various sports or genders. Game video footage was matched with microsensor-detected collisions (GPSports) in one men's (n = 12 players) and one women's (n = 12) rugby sevens match. True-positive, false-positive, and false-negative events between video and microsensor-detected collisions were used to calculate recall (ability to detect a collision) and precision (accurately identify a collision). The precision was similar between the men's and women's rugby sevens game (∼0.72; scale 0.00-1.00); however, the recall in the women's game (0.45) was less than that for the men's game (0.69). This resulted in 45% of collisions for men and 62% of collisions for women being incorrectly labeled. Currently, the automated collision detection system in GPSports microtechnology units has only modest utility in rugby sevens, and it seems that a rugby sevens-specific algorithm is needed. Differences in measures between the men's and women's game may be a result of physical size, and strength, and physicality, as well as technical and tactical factors.

Chemical, Bioactive, and Antioxidant Potential of Twenty Wild Culinary Mushroom Species

OpenAIRE

Sharma, S. K.; Gautam, N.

2015-01-01

The chemical, bioactive, and antioxidant potential of twenty wild culinary mushroom species being consumed by the people of northern Himalayan regions has been evaluated for the first time in the present study. Nutrients analyzed include protein, crude fat, fibres, carbohydrates, and monosaccharides. Besides, preliminary study on the detection of toxic compounds was done on these species. Bioactive compounds evaluated are fatty acids, amino acids, tocopherol content, carotenoids (β-carotene, ...

Automation and robotics for Space Station in the twenty-first century

Science.gov (United States)

Willshire, K. F.; Pivirotto, D. L.

1986-01-01

Space Station telerobotics will evolve beyond the initial capability into a smarter and more capable system as we enter the twenty-first century. Current technology programs including several proposed ground and flight experiments to enable development of this system are described. Advancements in the areas of machine vision, smart sensors, advanced control architecture, manipulator joint design, end effector design, and artificial intelligence will provide increasingly more autonomous telerobotic systems.

Managing the twenty-first century reference department challenges and prospects

CERN Document Server

Katz, Linda S

2014-01-01

Learn the skills needed to update and manage a reference department that efficiently meets the needs of clients today?and tomorrow! Managing the Twenty-First Century Reference Department: Challenges and Prospects provides librarians with the knowledge and skills they need to manage an effective reference service. Full of useful and practical ideas, this book presents successful methods for recruiting and retaining capable reference department staff and management, training new employees and adapting current services to an evolving field. Expert practitioners address the changing role of the r

Trends in CPAP adherence over twenty years of data collection: a flattened curve.

Science.gov (United States)

Rotenberg, Brian W; Murariu, Dorian; Pang, Kenny P

2016-08-19

Obstructive sleep apnea (OSA) is a common disorder, and continuous airway positive pressure (CPAP) is considered to be the gold standard of therapy. CPAP however is known to have problems with adherence, with many patients eventually abandoning the device. The purpose of this paper is to assess secular trends in CPAP adherence over the long term to see if there have been meaningful improvements in adherence in light of the multiple interventions proposed to do so. A comprehensive systematic literature review was conducted using the Medline-Ovid, Embase, and Pubmed databases, searching for data regarding CPAP adherence over a twenty year timeframe (1994-2015). Data was assessed for quality and then extracted. The main outcome measure was reported CPAP non-adherence. Secondary outcomes included changes in CPAP non-adherence when comparing short versus long-term, and changes in terms of behavioral counseling. Eighty-two papers met study inclusion/exclusion criteria. The overall CPAP non-adherence rate based on a 7-h/night sleep time that was reported in studies conducted over the twenty year time frame was 34.1 %. There was no significant improvement over the time frame. Behavioral intervention improved adherence rates by ~1 h per night on average. The rate of CPAP adherence remains persistently low over twenty years worth of reported data. No clinically significant improvement in CPAP adherence was seen even in recent years despite efforts toward behavioral intervention and patient coaching. This low rate of adherence is problematic, and calls into question the concept of CPAP as gold-standard of therapy for OSA.

7 CFR 764.402 - Loan closing.

Science.gov (United States)

2010-01-01

... SPECIAL PROGRAMS DIRECT LOAN MAKING Loan Decision and Closing § 764.402 Loan closing. (a) Signature... information for the Agency to reconfirm approval and proceed with loan closing. (3) The Agency or closing... account will be used according to subpart B of part 761 of this chapter when these processes are not...

[Infection-induced urinary calculi in children; current therapeutic schedule and prevention of recurrence].

Science.gov (United States)

Bach, D; Brühl, P; Hesse, A

1988-01-01

Infection stones have an outstanding position in childhood urolithiasis. In non-infection stones one can mostly find a certain--for example metabolic--causes of stone formation. In infection stones, the urease-producing and thus urea-cleaving properties of some gram-negative bacteria are responsible for alkalization of the urine and lead especially in combination with disturbances of urine transport to the staghorn calculi. Therefore in such children early diagnosis, adequate therapy and consequent maintenance is the crucial point for good life quality in future. Preliminary condition for therapeutic success is a close coworking between pediatric nephrologist, pediatric urologist, family doctor and parents.

Salaryfax 1974-75 for Seven School Districts.

Science.gov (United States)

Albuquerque Public Schools, NM.

This study compares salaries as well as benefits of school district personnel in the seven metropolitan school districts that include Albuquerque, New Mexico; Denver, Colorado; Phoenix and Tucson, Arizona; Wichita, Kansas; and Mobile, Alabama. The tables aggregate all the elements in the total compensation package for each category of employee and…

The Next Twenty Years in Management Education

Science.gov (United States)

Ansoff, H. Igor

1973-01-01

The concern in this article is with the manner in which education serves the managerial needs of organizations. It is the managerial needs of organizations that provide the demand function to educational institutions. Presently, the state of management education lags behind managerial needs, and prospects of closing the gap are doubtful. (41…

Seven Global Goals. 2013 annual report, Southwestern Power Administration

Energy Technology Data Exchange (ETDEWEB)

none,

2014-09-01

For over 70 years, Southwestern has marketed and delivered reliable, renewable, and affordable hydropower, partnering with Federal power stakeholders and others in the industry to make sure the lights stay on. This kind of effective, efficient, and cost conscious operation is made possible only by hard work and dedication. Southwestern employees work individually and as a team to meet seven comprehensive agency goals that touch on all aspects of the agency’s operations. Dubbed the “Seven Global Goals” by Administrator Chris Turner, these objectives identify specific, measurable targets that support Southwestern’s mission and reinforce its responsibilities toward its customers and the Nation.

Closed string field theory

International Nuclear Information System (INIS)

Strominger, A.

1987-01-01

A gauge invariant cubic action describing bosonic closed string field theory is constructed. The gauge symmetries include local spacetime diffeomorphisms. The conventional closed string spectrum and trilinear couplings are reproduced after spontaneous symmetry breaking. The action S is constructed from the usual ''open string'' field of ghost number minus one half. It is given by the associator of the string field product which is non-vanishing because of associativity anomalies. S does not describe open string propagation because open string states associate and can thereby be shifted away. A field theory of closed and open strings can be obtained by adding to S the cubic open string action. (orig.)

Thirty-Seven Years of Service with ESO!

Science.gov (United States)

Breysacher, J.

2002-12-01

On December 1st, 2002, after thirty- seven years of service, first in Chile and then in Garching, Ms. Christa Euler will leave ESO to enjoy a welldeserved retirement. Among the current staff, she is probably the only person who started her career at ESO just four years after the Organization was founded.

Investigating the relationship between Malaysian rugby sevens ...

African Journals Online (AJOL)

The objective of this study is is to investigate the relationship between rugbgby match officials physical fitness to their perfor formance. 132 rugby side match official seven wewere selected as the respondent of the study. ANOANOVA indicated no significant differences [F = (3, 128) = 0.322, p = 0.809] in physical fitness ac ...

Study of thirty-one economically important traits in twenty silkworm ...

African Journals Online (AJOL)

Rice straw was used as cocoon frames for spinning in each replication separately. Seven days after the starting of cocoon spinning, obtained cocoons were gathered and sorted on the basis of form, thickness, clarity, etc., into four classes including good, middle, double and low cocoons. The ratio of each cocoon class was ...

Do expanded seven-day NHS services improve clinical outcomes? Analysis of comparative institutional performance from the ?NHS Services, Seven Days a Week? project 2013?2016

OpenAIRE

Gan, Hoong-Wei; Wong, Danny Jon Nian; Dean, Benjamin John Floyd; Hall, Alistair Scott

2017-01-01

Background The cause of adverse weekend clinical outcomes remains unknown. In 2013, the ?NHS Services, Seven Days a Week? project was initiated to improve access to services across the seven-day week. Three years on, we sought to analyse the impact of such changes across the English NHS. Methods Aggregated trust-level data on crude mortality rates, Summary Hospital-Level Mortality Indicator (SHMI), mean length of stay (LOS), A&E admission and four-hour breach rates were obtained from national...

Do expanded seven-day NHS services improve clinical outcomes? Analysis of comparative institutional performance from the "NHS Services, Seven Days a Week" project 2013-2016

OpenAIRE

Gan, H-W; Wong, D. J. N.; Dean, B. J. F.; Hall, A. S.

2017-01-01

Background: The cause of adverse weekend clinical outcomes remains unknown. In 2013, the “NHS Services, Seven Days a Week” project was initiated to improve access to services across the seven-day week. Three years on, we sought to analyse the impact of such changes across the English NHS. Methods: Aggregated trust-level data on crude mortality rates, Summary Hospital-Level Mortality Indicator (SHMI), mean length of stay (LOS), A&E admission and four-hour breach rates were obtained f...

Avoid Vaccine Administration Errors with Seven Simple Steps

Centers for Disease Control (CDC) Podcasts

2012-02-16

This podcast discusses seven simple ways to avoid vaccine administration errors in health care settings.  Created: 2/16/2012 by National Center for Immunization and Respiratory Diseases (NCIRD).   Date Released: 2/16/2012.

Three-coloring graphs with no induced seven-vertex path II : using a triangle

OpenAIRE

Chudnovsky, Maria; Maceli, Peter; Zhong, Mingxian

2015-01-01

In this paper, we give a polynomial time algorithm which determines if a given graph containing a triangle and no induced seven-vertex path is 3-colorable, and gives an explicit coloring if one exists. In previous work, we gave a polynomial time algorithm for three-coloring triangle-free graphs with no induced seven-vertex path. Combined, our work shows that three-coloring a graph with no induced seven-vertex path can be done in polynomial time.

Nutrients, technological properties and genetic relationships among twenty cowpea landraces cultivated in West Africa

NARCIS (Netherlands)

Madode, Y.E.E.; Linnemann, A.R.; Nout, M.J.R.; Vosman, B.J.; Hounhouigan, D.J.; Boekel, van T.

2012-01-01

The genetic relationships among twenty phenotypically different cowpea landraces were unravelled regarding their suitability for preparing West African dishes. Amplified fragment length polymorphism classified unpigmented landraces (UPs) as highly similar (65%, one cluster), contrary to pigmented

Comparison of absolute speed of screen-film systems measured in seven institutions

International Nuclear Information System (INIS)

Yoshida, Ken-ichi; Murakami, Yasunori; Asahara, Masaki; Nakamura, Satoru; Honda, Mitsugi; Morishita, Junji; Higashida, Yoshiharu; Otsuka, Akiyoshi; Yoshida, Akira.

1998-01-01

We compared the differences in absolute speed of four screen-film systems in seven institutions. Four different screens (HR-4, Fuji; Lanex Medium, Kodak; Lanex 250, Kodak; and HR-12, Fuji) combined with super HRS-30 (Fuji) film and a beam quality of 80 kV tube voltage with a 20 mm aluminum filter were employed. Absolute speeds of the HR-4, Lanex Medium, Lanex 250, and HR-12 in combination with super HRS-30 were 1.83 mR -1 , 2.72 mR -1 , 2.79 mR -1 , and 5.35 mR -1 (average of seven institutions), respectively. The variation in speed was about ±10% for the seven institutions. Two factors (film processor and densitometer) affecting absolute speed were analyzed. The absolute speed measured in seven institutions varied ±14% depending on the film processor (development conditions) and ±3% depending on the densitometer employed in each institution. (author)

PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

African Journals Online (AJOL)

GB

Forty seven percent of those who practiced oral sex and 29% of those who practiced anal sex did not consider their ... religiosity, puberty age, peer relations, school performance ... single population proportion formula was used at a confidence ...

Validity and reliability of in-situ air conduction thresholds measured through hearing aids coupled to closed and open instant-fit tips.

Science.gov (United States)

O'Brien, Anna; Keidser, Gitte; Yeend, Ingrid; Hartley, Lisa; Dillon, Harvey

2010-12-01

Audiometric measurements through a hearing aid ('in-situ') may facilitate provision of hearing services where these are limited. This study investigated the validity and reliability of in-situ air conduction hearing thresholds measured with closed and open domes relative to thresholds measured with insert earphones, and explored sources of variability in the measures. Twenty-four adults with sensorineural hearing impairment attended two sessions in which thresholds and real-ear-to-dial-difference (REDD) values were measured. Without correction, significantly higher low-frequency thresholds in dB HL were measured in-situ than with insert earphones. Differences were due predominantly to differences in ear canal SPL, as measured with the REDD, which were attributed to leaking low-frequency energy. Test-retest data yielded higher variability with the closed dome coupling due to inconsistent seals achieved with this tip. For all three conditions, inter-participant variability in the REDD values was greater than intra-participant variability. Overall, in-situ audiometry is as valid and reliable as conventional audiometry provided appropriate REDD corrections are made and ambient sound in the test environment is controlled.

Seven Steps in Identifying Local Climate Change Responses for Agriculture in Vietnam

NARCIS (Netherlands)

Bosma, R.H.; Ngo, An T.; Huynh, Chuong V.; Le, Huong T.; Dang, Nhan K.; Van, Tri P.D.; Halsema, van G.E.

2016-01-01

This study presents a seven-step approach to identify and support local climate change (CC) responses in agriculture. The following seven steps comprise this approach: 1. Analyse past trends on the climatic factors and model the future trends. 2. Simulate the possible impacts of CC on the selected

The seven CanMEDS roles in postgraduate medical education should be revised

DEFF Research Database (Denmark)

Malling, Bente Vigh; Sørensen, Jette Led; Mikines, Kári J

2013-01-01

The seven CanMEDS roles were adopted by the Danish reform in postgraduate medical education in 2004. The roles have become a natural part of defining specialist competence. However, the definition of the seven roles from 2000 might not be aligned with the perception of good medical practice anno...

Seven remarkable days

CERN Document Server

This has been a truly remarkable seven days for CERN. Things have moved so fast that it has sometimes been hard to separate fact from fiction – all the more so since facts have often seemed too good to be true. It’s been a week of many firsts. Monday was the first time we’ve had two captured beams in the LHC. It’s the first time the LHC has functioned as a particle accelerator, boosting particles to the highest beam energy so far achieved at CERN. And it’s been a week in which we’ve seen the highest energy proton-proton collisions ever produced at CERN: our last hadron collider, the SPS was a proton-antiproton collider, a technically simpler machine than the LHC. This week’s successes are all the more remarkable precisely because of the complexity of the LHC. Unlike the SPS collider, it is two accelerators not one, making the job of commissioning nearly twice as difficult. I’d like to express my heartfelt thanks and congra...

Visual Literacy: Does It Enhance Leadership Abilities Required for the Twenty-First Century?

Science.gov (United States)

Bintz, Carol

2016-01-01

The twenty-first century hosts a well-established global economy, where leaders are required to have increasingly complex skills that include creativity, innovation, vision, relatability, critical thinking and well-honed communications methods. The experience gained by learning to be visually literate includes the ability to see, observe, analyze,…

Control and synchronisation of a novel seven-dimensional ...

Indian Academy of Sciences (India)

METIN VARAN

2018-03-16

Mar 16, 2018 ... This paper is organised as follows: In §2, seven- ..... Intelligent Control and Automation (Hangzhou, 2004). Vol. ... [42] M A Franchek, M W Ryan and R J Bernhard, J. Sound ... Chaotic systems, artificial neural networks, random.

Control and synchronisation of a novel seven-dimensional hyperchaotic system with active control

Science.gov (United States)

Varan, Metin; Akgul, Akif

2018-04-01

In this work, active control method is proposed for controlling and synchronising seven-dimensional (7D) hyperchaotic systems. The seven-dimensional hyperchaotic system is considered for the implementation. Seven-dimensional hyperchaotic system is also investigated via time series, phase portraits and bifurcation diagrams. For understanding the impact of active controllers on global asymptotic stability of synchronisation and control errors, the Lyapunov function is used. Numerical analysis is done to reveal the effectiveness of applied active control method and the results are discussed.

A Note on the Seven Bridges of Königsberg Problem

Directory of Open Access Journals (Sweden)

Naumowicz Adam

2015-02-01

Full Text Available In this paper we account for the formalization of the seven bridges of Königsberg puzzle. The problem originally posed and solved by Euler in 1735 is historically notable for having laid the foundations of graph theory, cf. [7]. Our formalization utilizes a simple set-theoretical graph representation with four distinct sets for the graph’s vertices and another seven sets that represent the edges (bridges. The work appends the article by Nakamura and Rudnicki [10] by introducing the classic example of a graph that does not contain an Eulerian path.

Seven methods to measure ground moisture

International Nuclear Information System (INIS)

Anon.

1983-01-01

The correct irrigation methods are of great importance to the deciduous fruit grower. The article discusses seven methods for the measuring of ground humidity. These methods are based on gravimetry, electric resistance, gamma attenuation, neutron humidity measurement, tensiometers and a study of the correlation between ground humidity and water evaporation. At this stage, the last technique is regarded as the most practicle method. Neutron moisture gages might be used if adhered to the regulations of NUCOR

Serial murder in America: case studies of seven offenders.

Science.gov (United States)

Beasley, James O

2004-01-01

This article summarizes and compares information on seven interviewed serial killers in an ongoing project designed to study similarities and differences among these individuals. The aim of this article is to increase our collective knowledge of the dynamics of serial murder by examining the perpetrators' backgrounds, as well as the unique ways in which they view themselves and the world around them. Although qualitative interview research alone is not sufficient to fully understand such behavior, it is useful in many ways. Some of the information discussed based on the seven offenders interviewed is compared with broader epidemiological studies, and the strengths and limitations of each type of research are discussed. Published in 2004 by John Wiley & Sons, Ltd.

The Turn to Precarity in Twenty-First Century Fiction

Directory of Open Access Journals (Sweden)

Morrison Jago

2014-01-01

Full Text Available Recent years have seen several attempts by writers and critics to understand the changed sensibility in post-9/11 fiction through a variety of new -isms. This essay explores this cultural shift in a different way, finding a ‘turn to precarity’ in twenty-first century fiction characterised by a renewal of interest in the flow and foreclosure of affect, the resurgence of questions about vulnerability and our relationships to the other, and a heightened awareness of the social dynamics of seeing. The essay draws these tendencies together via the work of Judith Butler in Frames of War, in an analysis of Trezza Azzopardi’s quasi-biographical study of precarious life, Remember Me.

Simultaneous Validation of Seven Physical Activity Questionnaires Used in Japanese Cohorts for Estimating Energy Expenditure: A Doubly Labeled Water Study.

Science.gov (United States)

Sasai, Hiroyuki; Nakata, Yoshio; Murakami, Haruka; Kawakami, Ryoko; Nakae, Satoshi; Tanaka, Shigeho; Ishikawa-Takata, Kazuko; Yamada, Yosuke; Miyachi, Motohiko

2018-04-28

Physical activity questionnaires (PAQs) used in large-scale Japanese cohorts have rarely been simultaneously validated against the gold standard doubly labeled water (DLW) method. This study examined the validity of seven PAQs used in Japan for estimating energy expenditure against the DLW method. Twenty healthy Japanese adults (9 men; mean age, 32.4 [standard deviation {SD}, 9.4] years, mainly researchers and students) participated in this study. Fifteen-day daily total energy expenditure (TEE) and basal metabolic rate (BMR) were measured using the DLW method and a metabolic chamber, respectively. Activity energy expenditure (AEE) was calculated as TEE - BMR - 0.1 × TEE. Seven PAQs were self-administered to estimate TEE and AEE. The mean measured values of TEE and AEE were 2,294 (SD, 318) kcal/day and 721 (SD, 161) kcal/day, respectively. All of the PAQs indicated moderate-to-strong correlations with the DLW method in TEE (rho = 0.57-0.84). Two PAQs (Japan Public Health Center Study [JPHC]-PAQ Short and JPHC-PAQ Long) showed significant equivalence in TEE and moderate intra-class correlation coefficients (ICC). None of the PAQs showed significantly equivalent AEE estimates, with differences ranging from -547 to 77 kcal/day. Correlations and ICCs in AEE were mostly weak or fair (rho = 0.02-0.54, and ICC = 0.00-0.44). Only JPHC-PAQ Short provided significant and fair agreement with the DLW method. TEE estimated by the PAQs showed moderate or strong correlations with the results of DLW. Two PAQs showed equivalent TEE and moderate agreement. None of the PAQs showed equivalent AEE estimation to the gold standard, with weak-to-fair correlations and agreements. Further studies with larger sample sizes are needed to confirm these findings.

Contribution to the knowledge of Stenochironomus Kieffer (Diptera, Chironomidae) from Brazil: seven new species and description of females and immatures of some previously known species.

Science.gov (United States)

Dantas, Galileu P S; Hamada, Neusa; Mendes, Humberto F

2016-05-30

Twenty two species of Stenochironomus Kieffer are known from Brazil, 19 of which occur in the Amazon region. In order to increase knowledge of the taxonomy of this genus in the Amazon region, collections were carried out in streams located in Presidente Figueiredo, Manaus and Itacoatiara municipalities, Amazonas State. Leaves and wood mined by Stenochironomus larvae were collected and transported to the laboratory where they were kept until adult emergence. Seven new species were found, one of which is described in the immature stages and as adults of both sexes (S. amazonicus sp. n.), one as immatures and adult male (S. liviae sp. n.), four as male and pupa (S. bare sp. n., S. figueiredoensis sp. n., S. gracilis sp. nov. and S. manauara sp. n.) and one only as male (S. suzanae sp. n.). Additionally, the female, pupa and larva of S. impendens Borkent, pupa and larva of S. jubatus Borkent, female and pupa of S. zonarius Borkent and female of S. palliaculeatus Borkent were described.

Performance of the Seven-step Procedure in Problem-based Hospitality Management Education

Directory of Open Access Journals (Sweden)

Wichard Zwaal

2016-12-01

Full Text Available The study focuses on the seven-step procedure (SSP in problem-based learning (PBL. The way students apply the seven-step procedure will help us understand how students work in a problem-based learning curriculum. So far, little is known about how students rate the performance and importance of the different steps, the amount of time they spend on each step and the perceived quality of execution of the procedure. A survey was administered to a sample of 101 students enrolled in a problem-based hospitality management program. Results show that students consider step 6 (Collect additional information outside the group to be most important. The highest performance-rating is for step two (Define the problem and the lowest for step four (Draw a systemic inventory of explanations from step three. Step seven is classified as low in performance and high in importance implicating urgent attention. The average amount of time spent on the seven steps is 133 minutes with the largest part of the time spent on self-study outside the group (42 minutes. The assessment of the execution of a set of specific guidelines (the Blue Card did not completely match with the overall performance ratings for the seven steps. The SSP could be improved by reducing the number of steps and incorporating more attention to group dynamics.

The dynamic interdependence of international financial markets: An empirical study on twenty-seven stock markets

Science.gov (United States)

Zhang, Xingwei; Zheng, Xiaolong; Zeng, Daniel Dajun

2017-04-01

In this paper, we aim to investigate the dynamic interdependence of international financial markets. Based on the data regarding daily returns of each market during the period 2006-2015 from Yahoo finance, we mainly focus on examining 27 markets from three continents, including Asia, America and Europe. By checking the dynamic interdependence between those markets, we find that markets from different continents have strong correlation at specific time shift. We also obtain that markets from different continents not only have a strong linkage with others at same day, but at a delay of one day, especially between Asia, Europe and Asia, America. In addition, we further analyze the time-varying influence strength between each two continents and observe that this value has abnormal changes during the financial crisis. These findings can provide us significant insights to understand the underlying dynamic interdependency of international financial markets and further help us make corresponding reasonable decisions.

Proceedings of Twenty-Seventh Annual Institute on Mining Health, Safety and Research

Energy Technology Data Exchange (ETDEWEB)

Bockosh, G.R. [ed.] [Pittsburgh Research Center, US Dept. of Energy (United States); Langton, J. [ed.] [Mine Safety and Health Administration, US Dept. of Labor (United States); Karmis, M. [ed.] [Virginia Polytechnic Institute and State University. Dept. of Mining and Minerals Engineering, Blacksburg (United States)

1996-12-31

This Proceedings contains the presentations made during the program of the Twenty-Seventh Annual Institute on Mining Health, Safety and Research held at Virginia Polytechnic Institute and State University, Blacksburg, Virginia, on August 26-28, 1996. The Twenty-Seventh Annual Institute on Mining, Health, Safety and Research was the latest in a series of conferences held at Virginia Polytechnic Institute and State University, cosponsored by the Mine Safety and Health Administration, United States Department of Labor, and the Pittsburgh Research Center, United States Department of Energy (formerly part of the Bureau of Mines, U. S. Department of Interior). The Institute provides an information forum for mine operators, managers, superintendents, safety directors, engineers, inspectors, researchers, teachers, state agency officials, and others with a responsible interest in the important field of mining health, safety and research. In particular, the Institute is designed to help mine operating personnel gain a broader knowledge and understanding of the various aspects of mining health and safety, and to present them with methods of control and solutions developed through research. Selected papers have been processed separately for inclusion in the Energy Science and Technology database.

Why are there so few Rickettsia conorii conorii-infected Rhipicephalus sanguineus ticks in the wild?

Directory of Open Access Journals (Sweden)

Cristina Socolovschi

Full Text Available Rickettsia conorii conorii is the etiological agent of Mediterranean spotted fever, which is transmitted by the brown dog tick, Rhipicephalus sanguineus. The relationship between the Rickettsia and its tick vector are still poorly understood one century after the first description of this disease.An entomological survey was organized in Algeria to collect ticks from the houses of patients with spotted fever signs. Colonies of R. conorii conorii-infected and non-infected ticks were established under laboratory conditions. Gimenez staining and electron microscopy on the ovaries of infected ticks indicated heavy rickettsial infection. The transovarial transmission of R. conorii conorii in naturally infected Rh. sanguineus ticks was 100% at eleven generations, and the filial infection rate was up to 99% according to molecular analyses. No differences in life cycle duration were observed between infected and non-infected ticks held at 25°C, but the average weight of engorged females and eggs was significantly lower in infected ticks than in non-infected ticks. The eggs, larvae and unfed nymphs of infected and non-infected ticks could not tolerate low (4°C or high (37°C temperatures or long starvation periods. R. conorii conorii-infected engorged nymphs that were exposed to a low or high temperature for one month experienced higher mortality when they were transferred to 25°C than non-infected ticks after similar exposure. High mortality was observed in infected adults that were maintained for one month at a low or high temperature after tick-feeding on rabbits.These preliminary results suggest that infected quiescent ticks may not survive the winter and may help explain the low prevalence of infected Rh. sanguineus in nature. Further investigations on the influence of extrinsic factors on diapaused R. conorii-infected and non-infected ticks are required.

ON NANO Λg-CLOSED SETS

OpenAIRE

Rajasekaran, Ilangovan; Nethaji, Ochanan

2017-01-01

Abstaract−In this paper, we introduce nano ∧g-closed sets in nano topological spaces. Some properties of nano ∧g-closed sets and nano ∧g-open sets are weaker forms of nano closed sets and nano open sets

Seven Possible Cave Skylights on Mars

Science.gov (United States)

2007-01-01

[figure removed for brevity, see original site] Figure 1 Seven very dark holes on the north slope of a Martian volcano have been proposed as possible cave skylights, based on day-night temperature patterns suggesting they are openings to subsurface spaces. These six excerpts of images taken in visible-wavelength light by the Thermal Emission Imaging System camera on NASA's Mars Odyssey orbiter show the seven openings. Solar illumination comes from the left in each frame. The volcano is Arsia Mons, at 9 degrees south latitude, 239 degrees east longitude. The features have been given informal names to aid comparative discussion (see figure 1). They range in diameter from about 100 meters (328 feet) to about 225 meters (738 feet). The candidate cave skylights are (A) 'Dena,' (B) 'Chloe,' (C) 'Wendy,' (D) 'Annie,' (E) 'Abby' (left) and 'Nikki,' and (F) 'Jeanne.' Arrows signify north and the direction of illumination. Mars Odyssey is managed by NASA's Jet Propulsion Laboratory, a division of the California Institute of Technology, Pasadena, for NASA's Science Mission Directorate, Washington. Lockheed Martin Space Systems, Denver, is the prime contractor for the project and built the spacecraft. The orbiter's Thermal Emission Imaging System was developed by Arizona State University, Tempe, in collaboration with Raytheon Santa Barbara Remote Sensing, Santa Barbara, Calif., and is operated by Arizona State University.

Restaurant Dining: Seven Tips for Staying Gluten Free

Science.gov (United States)

GiG Education Bulletin Restaurant Dining: Seven Tips for Staying Gluten-Free Updated May 2014 Tips for Dining Away from Home 1. Selection of ... a number of factors, including the type of restaurant you choose. • Be careful in restaurants where language ...

Building the vision, a series of AZTech ITS model deployment success stories for the Phoenix metropolitan area : number seven : spectacular views sharing closed circuit TV between operations centers

Science.gov (United States)

1998-01-01

Advanced communications technology is the engine that continually moves AZTech closer to its goal of integrating transportation systems throughout the region. At the heart of this technology is a state-of-the-art Closed Circuit Television (CCTV) syst...

Seven Myths about Beginners' Language

DEFF Research Database (Denmark)

Lund, Karen; Kirkebæk, Mads Jakob

2015-01-01

In the article the authors have selected seven myths about beginners’ language for discussion, reflection and possible rejection. These are (1) the myth about the necessity of mastering the system before being able to speak the language, (2) the myth about limited capacity on the ‘hard disc’, (3......) the myth about ‘the only thing’ (the method), (4) the myth about “we tried that before”, (5) the myth about “one people and one teaching method, (6) the myth about easy and difficult languages, and (7) the myth about students with no competences and a worthless past. The article suggests language teachers...

Twenty years of energy policy: What should we have learned?

International Nuclear Information System (INIS)

Greene, D.L.

1994-07-01

This report examines the past twenty years of energy market events and energy policies to determine what may be useful for the future. The author focuses on two important lessons that should have been learned but which the author feels have been seriously misunderstood. The first is that oil price shocks were a very big and very real problem for oil importing countries, a problem the has not gone away. The second is that automobile fuel economy regulation has worked and worked effectively to reduce oil consumption and the externalities associated with it, and can still work effectively in the future

Twenty years of energy policy: What should we have learned?

Energy Technology Data Exchange (ETDEWEB)

Greene, D.L. [Oak Ridge National Lab., TN (United States). Center for Transportation Analysis

1994-07-01

This report examines the past twenty years of energy market events and energy policies to determine what may be useful for the future. The author focuses on two important lessons that should have been learned but which the author feels have been seriously misunderstood. The first is that oil price shocks were a very big and very real problem for oil importing countries, a problem the has not gone away. The second is that automobile fuel economy regulation has worked and worked effectively to reduce oil consumption and the externalities associated with it, and can still work effectively in the future.

A study on subsequent neurologic complications in children with acute leukemia

International Nuclear Information System (INIS)

Kobayashi, Naoaki; Shimazaki, Haruyo; Hoshi, Yasutaka; Akatsuka, Jun-ichi

1989-01-01

Twenty-seven children with acute leukemia were studied in order to detect the subsequent neurologic complications due to chemotherapy and radiation therapy. Twenty-four patients with ALL received central nervous system prophylaxis including cranial irradiation. The methods of evaluation consisted of electroencephalogram (EEG), computed tomography of the head (CT scan), soft neurological sign, intelligence quotient (IQ) and Bender Gestalt test. The patients with relapse showed severe abnormalities in various kinds of examinations. Younger children at diagnosis were associated with a higher abnormality rate of soft neurological signs and Bender Gestalt test. Factors which were found to be closely associated with a lower IQ score included younger children at diagnosis and longer duration of remission time. These results indicate the need for caution for the dosage of cranial irradiation for younger patients in CNS prophylaxis, and improvement of a lower IQ score in long-term survivors requires further investigation as to the appropriate intellectual environment for their development after remission. (author)

Study on subsequent neurologic complications in children with acute leukemia

Energy Technology Data Exchange (ETDEWEB)

Kobayashi, Naoaki; Shimazaki, Haruyo; Hoshi, Yasutaka; Akatsuka, Jun-ichi (Jikei Univ., Tokyo (Japan). School of Medicine)

1989-06-01

Twenty-seven children with acute leukemia were studied in order to detect the subsequent neurologic complications due to chemotherapy and radiation therapy. Twenty-four patients with ALL received central nervous system prophylaxis including cranial irradiation. The methods of evaluation consisted of electroencephalogram (EEG), computed tomography of the head (CT scan), soft neurological sign, intelligence quotient (IQ) and Bender Gestalt test. The patients with relapse showed severe abnormalities in various kinds of examinations. Younger children at diagnosis were associated with a higher abnormality rate of soft neurological signs and Bender Gestalt test. Factors which were found to be closely associated with a lower IQ score included younger children at diagnosis and longer duration of remission time. These results indicate the need for caution for the dosage of cranial irradiation for younger patients in CNS prophylaxis, and improvement of a lower IQ score in long-term survivors requires further investigation as to the appropriate intellectual environment for their development after remission. (author).

Seven new calochroid and fulvoid species of Cortinarius

DEFF Research Database (Denmark)

Frøslev, Tobias Guldberg; Jeppesen, T.S.; Læssøe, Thomas

2006-01-01

We describe seven new European species of Cortinarius. All species are based on analyses of morphological and DNA sequence data. They all belong to a well-supported clade comprising most species traditionally treated in Cortinarius subgenus Phlegmacium sections Fulvi and Calochroi (i.e. the...

Oriented open-closed string theory revisited

International Nuclear Information System (INIS)

Zwiebach, B.

1998-01-01

String theory on D-brane backgrounds is open-closed string theory. Given the relevance of this fact, we give details and elaborate upon our earlier construction of oriented open-closed string field theory. In order to incorporate explicitly closed strings, the classical sector of this theory is open strings with a homotopy associative A ∞ algebraic structure. We build a suitable Batalin-Vilkovisky algebra on moduli spaces of bordered Ricmann surfaces, the construction of which involves a few subtleties arising from the open string punctures and cyclicity conditions. All vertices coupling open and closed strings through disks are described explicitly. Subalgebras of the algebra of surfaces with boundaries are used to discuss symmetries of classical open string theory induced by the closed string sector, and to write classical open string field theory on general closed string backgrounds. We give a preliminary analysis of the ghost-dilaton theorem. copyright 1998 Academic Press, Inc

Transactions of the Twenty-Seventh Conference of Army Mathematicians.

Science.gov (United States)

1982-01-01

number of moderate size such devices exist in the U.S. and abroad with the largest and newest in Gramat , France. This device is schematically illustrated...Reference 1 as an example. B. A Blast Simulator Model. The Gramat Facility in France1 consists of a driven tube with a nominal diameter of 12 m. In order to...the Gramat Facility as shown in Figure 3. Although only four tubes are shown, Gramat actually has seven 1. The decaying wave in this facility is

Quality evaluation of Shenmaidihuang Pills based on the chromatographic fingerprints and simultaneous determination of seven bioactive constituents.

Science.gov (United States)

Liu, Sifei; Zhang, Guangrui; Qiu, Ying; Wang, Xiaobo; Guo, Lihan; Zhao, Yanxin; Tong, Meng; Wei, Lan; Sun, Lixin

2016-12-01

In this study, we aimed to establish a comprehensive and practical quality evaluation system for Shenmaidihuang pills. A simple and reliable high-performance liquid chromatography coupled with photodiode array detection method was developed both for fingerprint analysis and quantitative determination. In fingerprint analysis, relative retention time and relative peak area were used to identify the common peaks in 18 samples for investigation. Twenty one peaks were selected as the common peaks to evaluate the similarities of 18 Shenmaidihuang pills samples with different manufacture dates. Furthermore, similarity analysis was applied to evaluate the similarity of samples. Hierarchical cluster analysis and principal component analysis were also performed to evaluate the variation of Shenmaidihuang pills. In quantitative analysis, linear regressions, injection precisions, recovery, repeatability and sample stability were all tested and good results were obtained to simultaneously determine the seven identified compounds, namely, 5-hydroxymethylfurfural, morroniside, loganin, paeonol, paeoniflorin, psoralen, isopsoralen in Shenmaidihuang pills. The contents of some analytes in different batches of samples indicated significant difference, especially for 5-hydroxymethylfurfural. So, it was concluded that the chromatographic fingerprint method obtained by high-performance liquid chromatography coupled with photodiode array detection associated with multiple compounds determination is a powerful and meaningful tool to comprehensively conduct the quality control of Shenmaidihuang pills. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Altered functional connectivity during self- and close other-reflection in patients with bipolar disorder with past psychosis and patients with schizophrenia.

Science.gov (United States)

Zhang, Liwen; Vander Meer, Lisette; Opmeer, Esther M; Marsman, Jan-Bernard C; Ruhé, Henricus G; Aleman, André

2016-12-01

Disturbances in implicit self-processing have been reported both in psychotic patients with bipolar disorder (BD) and schizophrenia. It remains unclear whether these two psychotic disorders show disturbed functional connectivity during explicit self-reflection, which is associated with social functioning and illness symptoms. Therefore, we investigated functional connectivity during explicit self-reflection in BD with past psychosis and schizophrenia. Twenty-three BD-patients, 17 schizophrenia-patients and 21 health controls (HC) performed a self-reflection task, including the conditions self-reflection, close other-reflection and semantic control. Functional connectivity was investigated with generalized psycho-physiological interaction (gPPI). During self-reflection compared to semantic, BD-patients had decreased connectivity between several cortical-midline structures (CMS) nodes (i.e., anterior cingulate cortex, ventromedial prefrontal cortex), the insula and the head of the caudate while HC showed increased connectivities. Schizophrenia-patients, during close other-reflection compared to semantic, demonstrated reduced ventral-anterior insula-precuneus/posterior cingulate cortex (PCC) functional connectivity, whereas this was increased in HC. There were no differences between BD and schizophrenia during self- and close other-reflection. We propose that decreased functional connectivity between the CMS nodes/insula and head of the caudate in BD-patients may imply a reduced involvement of the motivational system during self-reflection; and the reduced functional connectivity between the ventral-anterior insula and precuneus/PCC during close other-reflection in schizophrenia-patients may subserve difficulties in information integration of autobiographical memory and emotional awareness in relation to close others. These distinctive impaired patterns of functional connectivity in BD and schizophrenia (compared to HC) deserve further investigation to determine their

The Dialectics of Discrimination in the Twenty-First Century

Directory of Open Access Journals (Sweden)

John Stone

2007-12-01

Full Text Available This article explores some of the latest developments in the scholarship on race relations and nationalism that seek to address the impact of globalization and the changed geo-political relations of the first decade of the twenty-first century. New patterns of identification, some of which challenge existing group boundaries and others that reinforce them, can be seen to flow from the effects of global market changes and the political counter-movements against them. The impact of the “war on terrorism”, the limits of the utility of hard power, and the need for new mechanisms of inter-racial and inter-ethnic conflict resolution are evaluated to emphasize the complexity of these group relations in the new world disorder.

Closed recirculation-Water treatment

International Nuclear Information System (INIS)

Hamza, Hamza B.; Ben Ali, Salah; Saad, Mohamed A.; Traish, Massud R.

2005-01-01

This water treatment is a practical work applied in the center, for a closed recirculation-water system. The system had experienced a serious corrosion problem, due to the use of inadequate water. This work includes chemical preparation for the system. Water treatment, special additives, and follow-up, which resulted in the stability of the case. This work can be applied specially for closed recirculation warm, normal, and chilled water. (author)

The South African Surgical Outcomes Study: a seven-day ...

African Journals Online (AJOL)

LR Mathivha, TR Mokoena, S Monokoane, Rui Moreno, David ... Method: A seven-day national, multicentre, prospective, observational cohort study was conducted in 50 government-funded hospitals in South .... Dr George Mukhari Hospital.

Reduced antibody responses against Plasmodium falciparum vaccine candidate antigens in the presence of Trichuris trichiura

DEFF Research Database (Denmark)

Esen, Meral; Mordmüller, Benjamin; de Salazar, Pablo Martinez

2012-01-01

BACKGROUND: Helminth infections are highly prevalent in the tropics and may have an effect on immune responses to vaccines due to their immunomodulatory effect. The prevalence of helminth infections in young children, the target group for malaria and most other vaccines, is high. Therefore we...... assessed the influence of helminth infection on vaccine-induced immune responses in a phase I clinical trial of the malaria vaccine candidate GMZ2. METHODS: Twenty Gabonese preschool-age children were vaccinated with GMZ2, a blood stage malaria vaccine candidate. Humoral immune response against the vaccine...... antigens and parasitological status were assessed. Vaccine-specific antibody concentrations and memory B-cell numbers were compared in worm infected and non-infected participants. RESULTS: Antibody response to GMZ2 was 3.4-fold (95% confidence interval: 1.6, 7.4) higher in Trichuris trichiura negative...

High current vacuum closing switch

International Nuclear Information System (INIS)

Dolgachev, G.I.; Maslennikov, D.D.; Romanov, A.S.; Ushakov, A.G.

2005-01-01

The paper proposes a powerful pulsed closing vacuum switch for high current commutation consisting of series of the vacuum diodes with near 1 mm gaps having closing time determined by the gaps shortening with the near-electrode plasmas [ru

A Novel Three Phase to Seven Phase Conversion Technique Using Transformer Winding Connections

Directory of Open Access Journals (Sweden)

M. Tabrez

2017-10-01

Full Text Available This paper proposes a novel multiphase transformer connection scheme which converts three phase balanced AC input to seven phase balanced AC output. Generalized theory to convert a three phase utility supply into any number of phases is presented. Based on the proposed generalized principle, a three phase to seven phase power converting transformer design is presented with connection scheme, analysis and simulation and experimental results of the proposed three phase to seven phase conversion transformer. The proposed transformer in this paper is analyzed and compared with the connection scheme for seven phase available in the literature. The connection scheme is found to have higher power density, lower core area and lower core requirement as compared to the available connection scheme of the same rating. Impedance mismatching between different phases of the transformer is observed in the three phase to seven phase transformer available in the literature. As this mismatching introduces error in study of per phase equivalent circuit diagrams as well as imbalance in voltage and currents. The present design also addresses the impedance mismatching issue and reduces mismatching in the proposed transformer design. A prototype of the proposed system is developed and waveforms are presented. The proposed design is verified using simulation and validated using experimental approach.

Ecomorphological correlates of twenty dominant fish species of Amazonian floodplain lakes

Directory of Open Access Journals (Sweden)

F. K. Siqueira-Souza

Full Text Available Abstract Fishes inhabiting Amazonian floodplain lakes exhibits a great variety of body shape, which was a key advantage to colonize the several habitats that compose these areas adjacent to the large Amazon rivers. In this paper, we did an ecomorphological analysis of twenty abundant species, sampled in May and August 2011, into two floodplain lakes of the lower stretch of the Solimões River. The analysis detected differences among species, which could be probably associated with swimming ability and habitat use preferences.

Twenty natural organic pigments for application in dye sensitized solar cells

Science.gov (United States)

Castillo, D.; Sánchez Juárez, A.; Espinosa Tapia, S.; Guaman, A.; Obregón Calderón, D.

2016-09-01

In this work we present the results of a study of twenty natural pigments obtained from plants and insects from southern Ecuador. Many of them will be considered as a potential natural sensitizer for the construction of DSSCs. The results indicate that these pigments have a good performance in the absorbance and wavelength spectra. Were selected four best pigments for the construction of DSSCs, Rumex tolimensis Wedd, Raphanus sativus, Hibiscus sabdariffa, and Prunus serótina, however the conversion efficiency is lower than 1%.

A virtual closed loop method for closed loop identification

NARCIS (Netherlands)

Agüero, J.C.; Goodwin, G.C.; Hof, Van den P.M.J.

2011-01-01

Indirect methods for the identification of linear plant models on the basis of closed loop data are based on the use of (reconstructed) input signals that are uncorrelated with the noise. This generally requires exact (linear) controller knowledge. On the other hand, direct identification requires

Oxygen permeability (Dk) of thirty-seven rigid contact lens materials.

Science.gov (United States)

Benjamin, William J; Cappelli, Quido A

2002-02-01

Oxygen permeability (Dk) was determined for 37 available rigid contact lens materials in a masked fashion. The results were compared with those of an earlier study that included different lots of 14 test materials assessed in the current study. Six lenses of different thicknesses in each test and reference material were obtained. Test materials were arranged in sets of six to eight materials per set. Each set of materials, with inclusion of at least two reference materials for the purpose of simultaneous calibration, was measured to obtain preliminary amperages. Four preliminary measures were performed per thickness, resulting in 24 per material, in a schedule designed to spread the potential effects of machine drift and other factors. The mean preliminary amperages were used to derive corrected Dk values according to American National Standards Institute (ANSI) Z80.20-1998, and the values were linearly calibrated using the measured and established Dk values of the reference materials. The resistance (t/Dk) vs. thickness (t) plots for the 37 test and seven reference materials were approximated linearly. In 54 of 57 linear regressions, the coefficients of determination (R2) were >0.96, and in 48 instances were >0.98. Fourteen Dk values from the current study and an earlier study were linearly correlated (R2 = 0.9846), with a slope close to unity (+1.056) and intercept close to zero (-0.292). Ten of the current values fell within 10% of their corresponding earlier values. Only three current Dk values fell outside of the ANSI Z80.20-1998 tolerance for Dk (+/-20%). Two of these Dk values met the product tolerance when an obvious outlying point was graphically identified and omitted from the linear resistance (t/Dk) vs. thickness (t) regression. Omission of a single outlying point from a linear resistance vs. thickness regression can help provide a more valid Dk value. The ANSI Z80.20-1998 tolerance of +/-20% on Dk and the measurement reproducibility of +/-10% were

7 CFR 1927.58 - Closing the transaction.

Science.gov (United States)

2010-01-01

... REGULATIONS TITLE CLEARANCE AND LOAN CLOSING Real Estate Title Clearance and Loan Closing § 1927.58 Closing the transaction. The closing agent will cooperate with the approval official, borrower, seller, and... when a loan is being made to a borrower who already owns the real estate to be mortgaged. This...

On some properties of conjugacy closed loops

International Nuclear Information System (INIS)

Adeniran, John Olusola

2002-07-01

It is shown that central loops are not conjugacy closed loops but instead are loops of units in their loop algebras that are conjugacy closed. It is also shown that certain inner mappings of a conjugacy closed loop are nuclear. Some invariants of left conjugacy closed loops are obtained. (author)

Uncertainty in Twenty-First-Century CMIP5 Sea Level Projections

Science.gov (United States)

Little, Christopher M.; Horton, Radley M.; Kopp, Robert E.; Oppenheimer, Michael; Yip, Stan

2015-01-01

The representative concentration pathway (RCP) simulations included in phase 5 of the Coupled Model Intercomparison Project (CMIP5) quantify the response of the climate system to different natural and anthropogenic forcing scenarios. These simulations differ because of 1) forcing, 2) the representation of the climate system in atmosphere-ocean general circulation models (AOGCMs), and 3) the presence of unforced (internal) variability. Global and local sea level rise projections derived from these simulations, and the emergence of distinct responses to the four RCPs depend on the relative magnitude of these sources of uncertainty at different lead times. Here, the uncertainty in CMIP5 projections of sea level is partitioned at global and local scales, using a 164-member ensemble of twenty-first-century simulations. Local projections at New York City (NYSL) are highlighted. The partition between model uncertainty, scenario uncertainty, and internal variability in global mean sea level (GMSL) is qualitatively consistent with that of surface air temperature, with model uncertainty dominant for most of the twenty-first century. Locally, model uncertainty is dominant through 2100, with maxima in the North Atlantic and the Arctic Ocean. The model spread is driven largely by 4 of the 16 AOGCMs in the ensemble; these models exhibit outlying behavior in all RCPs and in both GMSL and NYSL. The magnitude of internal variability varies widely by location and across models, leading to differences of several decades in the local emergence of RCPs. The AOGCM spread, and its sensitivity to model exclusion and/or weighting, has important implications for sea level assessments, especially if a local risk management approach is utilized.

EXOGENOUS CHALLENGES FOR THE TOURISM INDUSTRY IN THE BEGINNING OF THE TWENTY FIRST CENTURY

Directory of Open Access Journals (Sweden)

Akosz Ozan

2009-05-01

Full Text Available Tourism is one of the fastest growing industries in the world. Besides its sustained growth the tourism industry has shown in the first years of the twenty first century that it can deal with political, military and natural disasters. The present paper ac

Twenty-year trends in the prevalence of Down syndrome and other trisomies in Europe

DEFF Research Database (Denmark)

Loane, Maria; Morris, Joan K; Addor, Marie-Claude

2013-01-01

This study examines trends and geographical differences in total and live birth prevalence of trisomies 21, 18 and 13 with regard to increasing maternal age and prenatal diagnosis in Europe. Twenty-one population-based EUROCAT registries covering 6.1 million births between 1990 and 2009 participa...

Prevention and treatment of Encephalitozoon cuniculi infection in immunosuppressed rabbits with fenbendazole.

Science.gov (United States)

Abu-Akkada, S S; Oda, S S

2016-01-01

This study was conducted to evaluate the efficacy of oral administration of fenbendazole (20 mg/kg body weight) prior to and after experimental infection of immunosuppressed rabbits with Encephalitozoon cuniculi . A total of thirty rabbits were divided into five groups: NN (non-immunosuppressed; non-infected), IN (immunosuppressed; non-infected), IPI (immunosuppressed; protected-infected), ITI (immunosuppressed; treated-infected), and II (immunosuppressed; infected) groups. Fenbendazole was administered as a prophylactic for seven successive days before infection with E. cuniculi and as a treatment for four weeks initiated on the 28th day post-challenge (PC). Experimental rabbits were infected with intraperitoneal injection of 2 × 10 5 E. cuniculi spores. Parameters evaluated were body weight, detection of spores in urine, serum antibody assay, hematological, biochemical and histopathological changes. The IPI and ITI groups showed a significant better final bwt than the II group. Spores were detected in urine of all infected rabbits from the 28th day PC until the end of the study. The IPI group showed the least values of antibodies (IgG) compared to the ITI and II groups. Concerning histopathological changes, the intensity of the lesions was marked particularly in the II rabbits and to a lesser extent in the ITI rabbits. Noticeable improvement was found in the IPI rabbits. It could be concluded that fenbendazole was effective to some extent in protection of rabbits against E. cuniculi infection, while when administered as a therapeutic no significant effects were observed.

SERVICE QUALITY DIMENSIONS IN SPECTATOR SPORT: ANANALYSIS OF THE TWENTY-TWENTYCRICKETLEAGUEMATCHES IN SOUTH AFRICA

Directory of Open Access Journals (Sweden)

B. A Mokoena

2017-01-01

Full Text Available Since their inception, twenty-twenty (T20 cricket league matches have gainedtremendous popularity and areheralded in South Africa with the potential ofincreasingthespectatorsupport base in cricket. The purpose of this studywastoenhance an understanding of service quality by examining theservice qualitydimensions in T20 cricket events in South Africa. A convenience sample of250T20 cricket spectatorsin the Gauteng provinceofSouth Africa participated in asurveyusingastructuredself-administered questionnaire. The factor analysisprocedure resulted in the extraction of six primarydimensions, namely servicepersonnel, game atmosphere, facility access, facility aesthetics, home team qualityand opposing team characteristics. The model was tested using confirmatory factoranalysis, which showed a good-fit of the data to the model.Among the servicequality dimensions, facility access was rated the most important dimension. Thestudy recommends that managers use the suggested dimensional framework tomeasure service quality in T20 cricket. Managers can also use this framework andmeasurement scale as a diagnostic tool to identify strengths and weaknesses in theirservices, thus providing guidance for potential areas of improvement.

Y-configuration double-stent-assisted coiling using two closed-cell stents for wide-neck basilar tip aneurysms.

Science.gov (United States)

Jeon, Pyoung; Kim, Byung Moon; Kim, Dong Joon; Kim, Dong I K; Park, Keun Young

2014-09-01

This study aimed to evaluate clinical and angiographic outcomes of Y-configuration double-stent-assisted (Y-stent) coiling using two closed-cell stents for wide-necked basilar tip aneurysm (BTA). A total of 25 patients underwent Y-stent coiling using two closed-cell stents as a first-time treatment in 18 (3 ruptured) BTAs, retreatment in 2 BTAs and as a third treatment in 5 wide-necked BTAs. Clinical and angiographic outcomes were evaluated retrospectively. Treatment-related complications were three (12.0 %) thromboembolic infarctions due to two acute in-stent thromboses and one embolism. Twenty-two (88 %) patients had favorable outcomes (modified Rankin scale score [mRS], 0-2) during the follow-up period (mean, 30 months; range, 6-54 months). Two patients died: one from initial subarachnoid hemorrhage and the other from intracerebral hemorrhage due to underlying Moyamoya disease. Post-treatment angiograms showed complete occlusion in nine aneurysms, residual neck in 11 aneurysms and residual sac in five aneurysms. Follow-up angiograms were available at least once between 5 to 34 months (mean, 16 months) in 21 patients. Nineteen patients showed improved or stable states (complete occlusion, n = 17; residual neck, n = 2). Major recurrences occurred in two BTAs (9.5 %). Those two major recurrent aneurysms had been large-sized aneurysms at the initial coiling procedure. Both showed not only coil compaction but also progressive growth to giant-sized aneurysms and intra-aneurysmal thrombus formation at the Y-stent coiling as a third-time treatment. Y-stent coiling using two closed-cell stents is a safe and durable treatment option for wide-necked BTA, but may have limited efficacy for large/giant sized and thrombosed aneurysms.

Effects of energy constraints on transportation systems. [Twenty-six papers

Energy Technology Data Exchange (ETDEWEB)

Mittal, R. K. [ed.

1977-12-01

Twenty-six papers are presented on a variety of topics including: energy and transportaton facts and figures; long-range planning under energy constraints; technology assessment of alternative fuels; energy efficiency of intercity passenger and freight movement; energy efficiency of intracity passenger movement; federal role; electrification of railroads; energy impact of the electric car in an urban enviroment; research needs and projects in progress--federal viewpoint; research needs in transportation energy conservation--data needs; and energy intensity of various transportation modes--an overview. A separate abstract was prepared for each of the papers for inclusion in Energy Research Abstracts (ERA) and in Energy Abstracts for Policy Analysis (EAPA).

Twenty-five years of post-Bretton Woods experience: some lessons

Directory of Open Access Journals (Sweden)

H. ASKARI

1999-03-01

Full Text Available In 1971 many academic economists were predicting that the Bretton Woods system of fixed parities would collapse. Some, most notably Milton Friedman, became excited about the possibility of a floating system because the benefits of international capital mobility can only be achieved through the flexibility in the exchange rate. These economists argued that a floating exchange rate system can ensure positive results more than the fixed parities system. Twenty-five years later, however, there is still no consensus on the matter. The author reviews the post-Bretton Woods experience to highlight some policies and approaches that might be helpful for the future.

Closed-Loop Neuroprosthesis for Reach-to-Grasp Assistance: Combining Adaptive Multi-channel Neuromuscular Stimulation with a Multi-joint Arm Exoskeleton.

Science.gov (United States)

Grimm, Florian; Gharabaghi, Alireza

2016-01-01

Stroke patients with severe motor deficits cannot execute task-oriented rehabilitation exercises with their affected upper extremity. Advanced rehabilitation technology may support them in performing such reach-to-grasp movements. The challenge is, however, to provide assistance as needed, while maintaining the participants' commitment during the exercises. In this feasibility study, we introduced a closed-loop neuroprosthesis for reach-to-grasp assistance which combines adaptive multi-channel neuromuscular stimulation with a multi-joint arm exoskeleton. Eighteen severely affected chronic stroke patients were assisted by a gravity-compensating, seven-degree-of-freedom exoskeleton which was attached to the paretic arm for performing reach-to-grasp exercises resembling activities of daily living in a virtual environment. During the exercises, adaptive electrical stimulation was applied to seven different muscles of the upper extremity in a performance-dependent way to enhance the task-oriented movement trajectory. The stimulation intensity was individualized for each targeted muscle and remained subthreshold, i.e., induced no overt support. Closed-loop neuromuscular stimulation could be well integrated into the exoskeleton-based training, and increased the task-related range of motion (p = 0.0004) and movement velocity (p = 0.015), while preserving accuracy. The highest relative stimulation intensity was required to facilitate the grasping function. The facilitated range of motion correlated with the upper extremity Fugl-Meyer Assessment score of the patients (p = 0.028). Combining adaptive multi-channel neuromuscular stimulation with antigravity assistance amplifies the residual motor capabilities of severely affected stroke patients during rehabilitation exercises and may thus provide a customized training environment for patient-tailored support while preserving the participants' engagement.

Closed-Loop Neuroprosthesis for Reach-to-Grasp Assistance: Combining Adaptive Multi-channel Neuromuscular Stimulation with a Multi-joint Arm Exoskeleton

Science.gov (United States)

Grimm, Florian; Gharabaghi, Alireza

2016-01-01

Stroke patients with severe motor deficits cannot execute task-oriented rehabilitation exercises with their affected upper extremity. Advanced rehabilitation technology may support them in performing such reach-to-grasp movements. The challenge is, however, to provide assistance as needed, while maintaining the participants' commitment during the exercises. In this feasibility study, we introduced a closed-loop neuroprosthesis for reach-to-grasp assistance which combines adaptive multi-channel neuromuscular stimulation with a multi-joint arm exoskeleton. Eighteen severely affected chronic stroke patients were assisted by a gravity-compensating, seven-degree-of-freedom exoskeleton which was attached to the paretic arm for performing reach-to-grasp exercises resembling activities of daily living in a virtual environment. During the exercises, adaptive electrical stimulation was applied to seven different muscles of the upper extremity in a performance-dependent way to enhance the task-oriented movement trajectory. The stimulation intensity was individualized for each targeted muscle and remained subthreshold, i.e., induced no overt support. Closed-loop neuromuscular stimulation could be well integrated into the exoskeleton-based training, and increased the task-related range of motion (p = 0.0004) and movement velocity (p = 0.015), while preserving accuracy. The highest relative stimulation intensity was required to facilitate the grasping function. The facilitated range of motion correlated with the upper extremity Fugl-Meyer Assessment score of the patients (p = 0.028). Combining adaptive multi-channel neuromuscular stimulation with antigravity assistance amplifies the residual motor capabilities of severely affected stroke patients during rehabilitation exercises and may thus provide a customized training environment for patient-tailored support while preserving the participants' engagement. PMID:27445658

Semi-closed bilateral partial miotomy of the puborectalis for anismus: a pilot study: Partial miotomy of the puborectalis for anismus.

Science.gov (United States)

Asciore, L; Pescatori, L C; Pescatori, M

2015-12-01

Anismus or non relaxing puborectalis muscle (PRM) may cause obstructed defecation (OD). Reported surgical treatment is partial miotomy, followed by sepsis, bleeding, and incontinence. The aim of the present study was to investigate on the feasibility and outcome of a modified mini-invasive operation. Consecutive patients with anismus and OD not responding to medical therapy, excluding multiparous females, patients with anal incontinence, recto-rectal intussusception, and disordered psychological pattern. Semi-closed bilateral partial division of PRM, pulled down through 1-cm perianal incisions, was performed. Concomitant significant rectal mucosal prolapse and rectocele, when present, were treated. OD was evaluated using a validated score and anal/vaginal ultrasound (US) was performed pre -and postoperatively. A control group of seven patients with normal bowel habit was also investigated. Eight patients (seven females), median age 48 years (range 29-71) were operated. Six also had significant mucosal prolapse and rectocele. All were followed up for a median of 12 months (range 2-40). None of them had postoperative sepsis or bleeding. One had just one occasional episode of mild anal incontinence. Symptoms improved in 6 or 75 % and, OD score decreased from 19.6 ± 1.0 to 9.2 ± 2.0 (mean ± s.e.m.), P = 0.007. No patient had anismus after surgery and PRM relaxation changed from 0 to 5.9 ± 0.8 mm being 6.6 ± 1.5 mm in controls. Semi-closed bilateral partial division of PRM achieves muscle's relaxation on straining in all patients without any significant postoperative complication. Further studies are needed prior to consider it a validated procedure.

Factors influencing efficiency of sliding mechanics to close extraction space: a systematic review.

Science.gov (United States)

Barlow, M; Kula, K

2008-05-01

To review recent literature to determine strength of clinical evidence concerning the influence of various factors on the efficiency (rate of tooth movement) of closing extraction spaces using sliding mechanics. A comprehensive systematic review on prospective clinical trials. An electronic search (1966-2006) of several databases limiting the searches to English and using several keywords was performed. Also a hand search of five key journals specifically searching for prospective clinical trials relevant to orthodontic space closure using sliding mechanics was completed. Outcome Measure - Rate of tooth movement. Ten prospective clinical trials comparing rates of closure under different variables and focusing only on sliding mechanics were selected for review. Of these ten trials on rate of closure, two compared arch wire variables, seven compared material variables used to apply force, and one examined bracket variables. Other articles which were not prospective clinical trials on sliding mechanics, but containing relevant information were examined and included as background information. CONCLUSION - The results of clinical research support laboratory results that nickel-titanium coil springs produce a more consistent force and a faster rate of closure when compared with active ligatures as a method of force delivery to close extraction space along a continuous arch wire; however, elastomeric chain produces similar rates of closure when compared with nickel-titanium springs. Clinical and laboratory research suggest little advantage of 200 g nickel-titanium springs over 150 g springs. More clinical research is needed in this area.

Appraisal of seven critical reading strategies employed by teachers ...

African Journals Online (AJOL)

Appraisal of seven critical reading strategies employed by teachers in Ogun State senior secondary schools to teach reading comprehension. ... as a result of the teachers' ability to engage the students in skilful and well- framed questions.

Increasing precipitation volatility in twenty-first-century California

Science.gov (United States)

Swain, Daniel L.; Langenbrunner, Baird; Neelin, J. David; Hall, Alex

2018-05-01

Mediterranean climate regimes are particularly susceptible to rapid shifts between drought and flood—of which, California's rapid transition from record multi-year dryness between 2012 and 2016 to extreme wetness during the 2016-2017 winter provides a dramatic example. Projected future changes in such dry-to-wet events, however, remain inadequately quantified, which we investigate here using the Community Earth System Model Large Ensemble of climate model simulations. Anthropogenic forcing is found to yield large twenty-first-century increases in the frequency of wet extremes, including a more than threefold increase in sub-seasonal events comparable to California's `Great Flood of 1862'. Smaller but statistically robust increases in dry extremes are also apparent. As a consequence, a 25% to 100% increase in extreme dry-to-wet precipitation events is projected, despite only modest changes in mean precipitation. Such hydrological cycle intensification would seriously challenge California's existing water storage, conveyance and flood control infrastructure.

Accelerators for the twenty-first century - a review

International Nuclear Information System (INIS)

Wilson, E.J.N.

1990-01-01

Modern synchrotrons and storage rings are based upon the electrical technology of the 1900s boosted by the microwave radar techniques of World War II. This method of acceleration now seems to be approaching its practical limit. It is high time that we seek a new physical acceleration mechanism to provide the higher energies and luminosities needed to continue particle physics beyond the machines now on the stocks. Twenty years is a short time in which to invent, develop, and construct such a device. Without it, high-energy physics may well come to an end. Particle physicists and astrophysicists are invited to join accelerator specialists in the hunt for this new principle. This report analyses the present limitations of colliders and explores some of the directions in which one might look to find a new principle. Chapters cover proton colliders, electron-positron colliders, linear colliders, and two-beam accelerators; transverse fields, wake-field and beat-wave accelerators, ferroelectric crystals, and acceleration in astrophysics. (orig.)

Changes to injury profile (and recommended cricket injury definitions based on the increased frequency of Twenty20 cricket matches

Directory of Open Access Journals (Sweden)

John Orchard

2010-05-01

Full Text Available John Orchard1, Trefor James2, Alex Kountouris2, Marc Portus21School of Public Health, University of Sydney, Sydney, Australia; 2Cricket Australia, Melbourne, AustraliaAbstract: This study analyzes injuries occurring prospectively in Australian men’s cricket at the state and national levels over 11 seasons (concluding in season 2008–09. In the last four of these seasons, there was more cricket played, with most of the growth being a new form of the game – Twenty20 cricket. Since the introduction of a regular Twenty20 program, injury incidence rates in each form of cricket have been fairly steady. Because of the short match duration, Twenty20 cricket exhibits a high match injury incidence, expressed as injuries per 10,000 hours of play. Expressed as injuries per days of play, Twenty20 cricket injury rates compare more favorably to other forms of cricket. Domestic level Twenty20 cricket resulted in 145 injuries per 1000 days of play (compared to 219 injuries per 1000 days of domestic one day cricket, and 112 injuries per 1000 days of play in first class domestic cricket. It is therefore recommended that match injury incidence measures be expressed in units of injuries per 1000 days of play. Given the high numbers of injuries which are of gradual onset, seasonal injury incidence rates (which typically range from 15–20 injuries per team per defined ‘season’ are probably a superior incidence measure. Thigh and hamstring strains have become clearly the most common injury in the past two years (greater than four injuries per team per season, perhaps associated with the increased amount of Twenty20 cricket. Injury prevalence rates have risen in conjunction with an increase in the density of the cricket calendar. Annual injury prevalence rates (average proportion of players missing through injury have exceeded 10% in the last three years, with the injury prevalence rates for fast bowlers exceeding 18%. As the amount of scheduled cricket is

Search for open-quote open-quote polarized close-quote close-quote instantons in the vacuum

International Nuclear Information System (INIS)

Kuchiev, M.Y.

1996-01-01

The new phase of a gauge theory in which the instantons are open-quote open-quote polarized,close-quote close-quote i.e., have the preferred orientation, is discussed. A class of gauge theories with the specific condensates of the scalar fields is considered. In these models there exists an interaction between instantons resulting from one-fermion loop corrections. The interaction makes the identical orientation of instantons the most probable, permitting one to expect the system to undergo a phase transition into the state with polarized instantons. The existence of this phase is confirmed in the mean-field approximation in which there is a first-order phase transition separating the open-quote open-quote polarized phase close-quote close-quote from the usual nonpolarized one. The considered phase can be important for the description of gravity in the framework of the gauge field theory. copyright 1996 The American Physical Society

Complication rate in unprotected carotid artery stenting with closed-cell stents

International Nuclear Information System (INIS)

Tietke, Marc W.K.; Kerby, Tina; Alfke, Karsten; Riedel, Christian; Rohr, Axel; Jensen, Ulf; Jansen, Olaf; Zimmermann, Phillip; Stingele, Robert

2010-01-01

The discussion on the use of protection devices (PDs) in carotid artery stenting (CAS) is gaining an increasing role in lowering the periprocedural complication rates. While many reviews and reports with retrospective data analysis do promote the use of PDs the most recent multi-centre trials are showing advantages for unprotected CAS combined with closed-cell stent designs. We retrospectively analysed 358 unprotected CAS procedures performed from January 2003 to June 2009 in our clinic. Male/female ratio was 2.68/1. The average age was 69.3 years. Seventy-three percent (261/358) showed initial neurological symptoms. All patients were treated on a standardised interventional protocol. A closed and small-sized cell designed stent was implanted in most cases (85.2%). One hundred seventy-one (47.8%) were controlled by Doppler ultrasonography usually at first in a 3-month and later in 6-month intervals. The peri-interventional and 30-day mortality/stroke rate was 4.19% (15/358). These events included three deaths, five hyperperfusion syndromes (comprising one death by a secondary fatal intracranial haemorrhage), one subarachnoid haemorrhage and seven ischaemic strokes. Only 20% (3/15) of all complications occurred directly peri-interventional. The overall peri-interventional complication rate was 0.8% (3/358). Most complications occurred in initial symptomatic patients (5.36%). The in-stent restenosis rate for more than 70% was 7% (12/171) detected at an average of 9.8 month. Our clinical outcome demonstrates that unprotected CAS with small cell designed stents results in a very low procedural complication rate, which makes the use of a protection device dispensable. (orig.)

The Analysis of Fourth Adventure of Seven-Adventures of Iranian National Epic based on Myth

Directory of Open Access Journals (Sweden)

GH Ebrahimi

2012-08-01

Full Text Available The seven-adventures of Rostam, in particular, and other Iranian seven-adventures such as Esfandyar seven-adventures or Gorshasp pseudo-seven-adventures are a kind of eternity search, a kind of battle with selfhood that aims to facilitate the problems, the difficulties of evolution way and human ascent. By discussing and analyzing Iranian seven-adventures, this research aims to study the fourth adventure of all the seven-adventures, which is, at the surface, the battle between man (hero, champion and woman but, in essence, it is the battle between fire and water. Fire is the son of Ahura Mazda and water is its enemy. Water, which was at one time the symbol of holiness and purity of Ahura, became a satanic element during Sassanid era and following the dominance of Zorvani thoughts on religious system of that time. By analyzing Rostam, Esfandyar, Gorshasp, Heracles fourth adventure and looking at Zal and Roodabe stories, Khajavi Kermani’s Sam-Nameh, Nezemi’s Khosro and Shirin and Mahmoud Dolatabadi’s Kalidar, we try to prove this hypothesis.

Writing a Book from Your Dissertation: Seven Stages

Science.gov (United States)

Pane, Debra M.

2016-01-01

The purpose of this Writer's Forum is to share seven stages for writing a book from your dissertation: relinquishing control of your dissertation; selecting and working with your publisher; defining and writing for your audience; revising and drafting your dissertation into a book; securing and using feedback; including front matter, back matter,…

The power features of Masseter muscle activity in tension-type and migraine without aura headache during open-close clench cycles

Directory of Open Access Journals (Sweden)

Behrouz Alizadeh Savareh

2017-07-01

Full Text Available Introduction Different types of headaches and TMJ click influence the masseter muscle activity. The aim of this study was to assess the trend of energy level of the electromyography (EMG activity of the masseter muscle during open-close clench cycles in migraine without aura (MOA and tension-type headache (TTH with or without TMJ click. Methods Twenty-five women with MOA and twenty four women with TTH participated in the study. They matched with 25 healthy subjects, in terms of class of occlusion and prevalence of temporomandibular joint (TMJ with click. The EMG of both masseter muscles were recorded during open-close clench cycles at a rate of 80 cycles per minute for 15 seconds. The mouth opening was restricted to two centimeters by mandibular motion frame. Signal processing steps have been done on the EMG as: noise removing, smoothing, feature extraction, and statistical analyzing. The six statistical parameters of energy computed were mean, Variance, Skewness, Kurtosis, and first and second half energy over all signal energy. Results A three-way ANOVA indicated that during all the cycles, the mean of energy was more and there was a delay in showing the peak of energy in the masseter of the left side with clicked TMJ in MOA group compared to the two other groups, while this pattern occurred inversely in the side with no-clicked TMJ (P < 0.009. The variation of energy was significantly less in MOA group compared to the two other groups in the no-clicked TMJ (P < 0.003. However, the proportion of the first or second part of signal energy to all energy showed that TTH group had less energy in the first part and more energy in the second part in comparison to the two other groups (P < 0.05. Conclusion The study showed different changes in the energy distribution of masseter muscle activity during cycles in MOA and TTH. MOA, in contrast to TTH, had lateralization effect on EMG and interacted with TMJ click.

Driving safety after brain damage: follow-up of twenty-two patients with matched controls.

Science.gov (United States)

Katz, R T; Golden, R S; Butter, J; Tepper, D; Rothke, S; Holmes, J; Sahgal, V

1990-02-01

Driving after brain damage is a vital issue, considering the large number of patients who suffer from cerebrovascular and traumatic encephalopathy. The ability to operate a motor vehicle is an integral part of independence for most adults and so should be preserved whenever possible. The physician may estimate a patient's ability to drive safely based on his own examination, the evaluation of a neuropsychologist, and a comprehensive driving evaluation--testing, driving simulation, behind-the-wheel observation--with a driving specialist. This study sought to evaluate the ability of brain-damaged individuals to operate a motor vehicle safely at follow-up. These patients had been evaluated (by a physician, a neuropsychologist, and a driving specialist) and were judged able to operate a motor vehicle safely after their cognitive insult. Twenty-two brain-damaged patients who were evaluated at our institution were successfully followed up to five years (mean interval of 2.67 years). Patients were interviewed by telephone. Their driving safely was compared with a control group consisting of a close friend or spouse of each patient. Statistical analysis revealed no difference between patient and control groups in the type of driving, the incidence of speeding tickets, near accidents, and accidents, and the cost of vehicle damage when accidents occurred. The patient group was further divided into those who had, and those who had not experienced driving difficulties so that initial neuropsychologic testing could be compared. No significant differences were noted in any aspect of the neuropsychologic test battery. We conclude that selected brain-damaged patients who have passed a comprehensive driving assessment as outlined were as fit to drive as were their normal matched controls.(ABSTRACT TRUNCATED AT 250 WORDS)

Identification and differentiation of the twenty six bluetongue virus serotypes by RT-PCR amplification of the serotype-specific genome segment 2.

Directory of Open Access Journals (Sweden)

Narender S Maan

Full Text Available Bluetongue (BT is an arthropod-borne viral disease, which primarily affects ruminants in tropical and temperate regions of the world. Twenty six bluetongue virus (BTV serotypes have been recognised worldwide, including nine from Europe and fifteen in the United States. Identification of BTV serotype is important for vaccination programmes and for BTV epidemiology studies. Traditional typing methods (virus isolation and serum or virus neutralisation tests (SNT or VNT are slow (taking weeks, depend on availability of reference virus-strains or antisera and can be inconclusive. Nucleotide sequence analyses and phylogenetic comparisons of genome segment 2 (Seg-2 encoding BTV outer-capsid protein VP2 (the primary determinant of virus serotype were completed for reference strains of BTV-1 to 26, as well as multiple additional isolates from different geographic and temporal origins. The resulting Seg-2 database has been used to develop rapid (within 24 h and reliable RT-PCR-based typing assays for each BTV type. Multiple primer-pairs (at least three designed for each serotype were widely tested, providing an initial identification of serotype by amplification of a cDNA product of the expected size. Serotype was confirmed by sequencing of the cDNA amplicons and phylogenetic comparisons to previously characterised reference strains. The results from RT-PCR and sequencing were in perfect agreement with VNT for reference strains of all 26 BTV serotypes, as well as the field isolates tested. The serotype-specific primers showed no cross-amplification with reference strains of the remaining 25 serotypes, or multiple other isolates of the more closely related heterologous BTV types. The primers and RT-PCR assays developed in this study provide a rapid, sensitive and reliable method for the identification and differentiation of the twenty-six BTV serotypes, and will be updated periodically to maintain their relevance to current BTV distribution and

Twenty years after the Chernobyl accident

International Nuclear Information System (INIS)

2006-01-01

Full text: The April 1986 accident at the Chernobyl nuclear power plant remains a painful memory in the lives of the hundreds of thousands of people who were most affected by the accident. In addition to the emergency rescue workers who died, thousands of children contracted thyroid cancer, and thousands of other individuals will eventually die of other cancers caused by the release of radiation. Vast areas of cropland, forests, rivers and urban centres were contaminated by environmental fallout. Hundreds of thousands of people were evacuated from these affected areas - forced to leave behind their homes, possessions, and livelihoods - and resettled elsewhere, in a traumatic outcome that has had long-lasting psychological and social impacts. The commemoration of the Chernobyl tragedy is taking place in many forums this month - in Minsk, in Kiev and in other locations. At the IAEA, it might be said that we have been responding to the accident and its consequences for twenty years, in a number of ways: first, through a variety of programmes designed to help mitigate the environmental and health consequences of the accident; second, by analyzing the lessons of what went wrong to allow such an accident to occur at all; and third, by working to prevent any such accident from occurring in the future. Building a strong and effective global nuclear safety regime is a central objective of our work. This requires effective international cooperation. The explosions that destroyed the Unit 4 reactor core, and discharged its contents in a cloud of radionuclides, made painfully clear that the safety risks associated with nuclear and radiological activities extend beyond national borders. International cooperation on nuclear safety matters - sharing information, setting clear safety standards, assisting with safety upgrades, and reviewing operational performance - has therefore become a hallmark of IAEA activity, particularly at a time when we are witnessing an expansion of

Close-In Substellar Companions and the Formation of sdB-Type Close Binary Stars

Directory of Open Access Journals (Sweden)

L. Y. Zhu

2015-02-01

Full Text Available The sdB-type close binaries are believed to have experienced a common-envelope phase and may evolve into cataclysmic binaries (CVs. About 10% of all known sdB binaries are eclipsing binaries consisting of very hot subdwarf primaries and low-mass companions with short orbital periods. The eclipse profiles of these systems are very narrow and deep, which benefits the determination of high precise eclipsing times and makes the detection of small and close-in tertiary bodies possible. Since 2006 we have monitored some sdB-type eclipsing binaries to search for the close-in substellar companions by analyzing the light travel time effect. Here some progresses of the program are reviewed and the formation of sdB-type binary is discussed.

Observing the Progressive Decoherence of the open-quote open-quote Meter close-quote close-quote in a Quantum Measurement

International Nuclear Information System (INIS)

Brune, M.; Hagley, E.; Dreyer, J.; Maitre, X.; Maali, A.; Wunderlich, C.; Raimond, J.M.; Haroche, S.

1996-01-01

A mesoscopic superposition of quantum states involving radiation fields with classically distinct phases was created and its progressive decoherence observed. The experiment involved Rydberg atoms interacting one at a time with a few photon coherent fields trapped in a high Q microwave cavity. The mesoscopic superposition was the equivalent of an open-quote open-quote atom+measuringapparatus close-quote close-quote system in which the open-quote open-quote meter close-quote close-quote was pointing simultaneously towards two different directions emdash a open-quote open-quote Schroedinger cat.close-quote close-quote The decoherence phenomenon transforming this superposition into a statistical mixture was observed while it unfolded, providing a direct insight into a process at the heart of quantum measurement. copyright 1996 The American Physical Society

Validation Study of the Revised Seven Components Inventory

Science.gov (United States)

Brown, Jennifer L.; da Silva, Stephanie; Newberry, Jennifer

2018-01-01

One out of every three students who begin an academic school year does not return for a second year, which has remained unchanged for the past 50 years. The Seven Principles for Good Practice in Undergraduate Education could improve the classroom learning environment, which could lead to increased student satisfaction and retention. More empirical…

Advertising and the Seven Sins of Memory

DEFF Research Database (Denmark)

Percy, Larry

2004-01-01

A positive intention may be formed as a result of exposure to an advertisement, but if a memory malfunction interferes with that intention, the advertising will be ineffective.This paper considers the implications for advertisers of Daniel Schacter’s ‘seven sins of memory’: transcience, absent......-mindedness, blocking, misattribution, suggestibility, bias and persistence. Each of the ‘sins’ is explained in detail and advice provided for advertisers on how to avoid these pitfalls....

Open-closed homotopy algebra in mathematical physics

International Nuclear Information System (INIS)

Kajiura, Hiroshige; Stasheff, Jim

2006-01-01

In this paper we discuss various aspects of open-closed homotopy algebras (OCHAs) presented in our previous paper, inspired by Zwiebach's open-closed string field theory, but that first paper concentrated on the mathematical aspects. Here we show how an OCHA is obtained by extracting the tree part of Zwiebach's quantum open-closed string field theory. We clarify the explicit relation of an OCHA with Kontsevich's deformation quantization and with the B-models of homological mirror symmetry. An explicit form of the minimal model for an OCHA is given as well as its relation to the perturbative expansion of open-closed string field theory. We show that our open-closed homotopy algebra gives us a general scheme for deformation of open string structures (A ∞ algebras) by closed strings (L ∞ algebras)

MICROBIAL DEGRADATION OF SEVEN AMIDES BY SUSPENDED BACTERIAL POPULATIONS

Science.gov (United States)

Microbial transformation rate constants were determined for seven amides in natural pond water. A second-order mathematical rate expression served as the model for describing the microbial transformation. Also investigated was the relationship between the infrared spectra and the...

Prospects for strong interaction physics at ISABELLE. [Seven papers

Energy Technology Data Exchange (ETDEWEB)

Sidhu, D P; Trueman, T L

1977-01-01

Seven papers are presented resulting from a conference intended to stimulate thinking about how ISABELLE could be used for studying strong interactions. A separate abstract was prepared for each paper for inclusion in DOE Energy Research Abstracts (ERA). (PMA)

Catholic school governance in the twenty-first century: continuity, incongruity and challenge

OpenAIRE

Storr, Christopher John

2007-01-01

This study has two main aspects: first, it reports the results of a survey of ninety nine governors working in Roman Catholic primary and secondary schools situated in four English Catholic dioceses, and publishes hitherto unknown information about them; and, second, it examines how, in seeking to maintain a distinctive educational ethos, these governors are responding both to the legislative changes of the last twenty years, and to changes in English social and cultural attitudes. It shows h...

Seven words you can never say at HHS

Directory of Open Access Journals (Sweden)

Robbins RA

2017-12-01

Full Text Available No abstract available. Article truncated at 150 words. The recent announcement of the seven words you can never say at Health & Human Services (HHS reminded me of the late George Carlin’s routine, “Seven Words You Can Never Say on Television” (1. Policy analysts at the Centers for Disease Control (CDC in Atlanta were told of the list of forbidden words at a meeting last Thursday, December 14, with senior CDC officials who oversee the budget, according to an analyst who took part in the 90-minute briefing (2. The forbidden words are "vulnerable," "entitlement," "diversity," "transgender," "fetus," "evidence-based" and "science-based." In some instances, the analysts were given alternative phrases. Instead of “science-based” or “evidence-based,” the suggested phrase is “CDC bases its recommendations on science in consideration with community standards and wishes,” the person said. In other cases, no replacement words were immediately offered. This is the latest attempt by government departments to distort fact. As an example, the …

Cost-Analysis of Seven Nosocomial Outbreaks in an Academic Hospital.

Science.gov (United States)

Dik, Jan-Willem H; Dinkelacker, Ariane G; Vemer, Pepijn; Lo-Ten-Foe, Jerome R; Lokate, Mariëtte; Sinha, Bhanu; Friedrich, Alex W; Postma, Maarten J

2016-01-01

Nosocomial outbreaks, especially with (multi-)resistant microorganisms, are a major problem for health care institutions. They can cause morbidity and mortality for patients and controlling these costs substantial amounts of funds and resources. However, how much is unclear. This study sets out to provide a comparable overview of the costs of multiple outbreaks in a single academic hospital in the Netherlands. Based on interviews with the involved staff, multiple databases and stored records from the Infection Prevention Division all actions undertaken, extra staff employment, use of resources, bed-occupancy rates, and other miscellaneous cost drivers during different outbreaks were scored and quantified into Euros. This led to total costs per outbreak and an estimated average cost per positive patient per outbreak day. Seven outbreaks that occurred between 2012 and 2014 in the hospital were evaluated. Total costs for the hospital ranged between €10,778 and €356,754. Costs per positive patient per outbreak day, ranged between €10 and €1,369 (95% CI: €49-€1,042), with a mean of €546 and a median of €519. Majority of the costs (50%) were made because of closed beds. This analysis is the first to give a comparable overview of various outbreaks, caused by different microorganisms, in the same hospital and all analyzed with the same method. It shows a large variation within the average costs due to different factors (e.g. closure of wards, type of ward). All outbreaks however cost considerable amounts of efforts and money (up to €356,754), including missed revenue and control measures.

Cost-Analysis of Seven Nosocomial Outbreaks in an Academic Hospital.

Directory of Open Access Journals (Sweden)

Jan-Willem H Dik

Full Text Available Nosocomial outbreaks, especially with (multi-resistant microorganisms, are a major problem for health care institutions. They can cause morbidity and mortality for patients and controlling these costs substantial amounts of funds and resources. However, how much is unclear. This study sets out to provide a comparable overview of the costs of multiple outbreaks in a single academic hospital in the Netherlands.Based on interviews with the involved staff, multiple databases and stored records from the Infection Prevention Division all actions undertaken, extra staff employment, use of resources, bed-occupancy rates, and other miscellaneous cost drivers during different outbreaks were scored and quantified into Euros. This led to total costs per outbreak and an estimated average cost per positive patient per outbreak day.Seven outbreaks that occurred between 2012 and 2014 in the hospital were evaluated. Total costs for the hospital ranged between €10,778 and €356,754. Costs per positive patient per outbreak day, ranged between €10 and €1,369 (95% CI: €49-€1,042, with a mean of €546 and a median of €519. Majority of the costs (50% were made because of closed beds.This analysis is the first to give a comparable overview of various outbreaks, caused by different microorganisms, in the same hospital and all analyzed with the same method. It shows a large variation within the average costs due to different factors (e.g. closure of wards, type of ward. All outbreaks however cost considerable amounts of efforts and money (up to €356,754, including missed revenue and control measures.

Deaf leaders’ strategies for working with signed language interpreters: An examination across seven countries.

NARCIS (Netherlands)

Haug, T.; Bontempo, K.; Leeson, L.; Napier, J.; Nicodemus, B.; Van den Bogaerde, B.; Vermeerbergen, M.

In this paper, we report interview data from 14 Deaf leaders across seven countries (Australia, Belgium, Ireland, the Netherlands, Switzerland, the United Kingdom, and the United States) regarding their perspectives on signed language interpreters. Using a semistructured survey questionnaire, seven

Gene : CBRC-GGOR-01-1364 [SEVENS

Lifescience Database Archive (English)

Full Text Available bradykinin receptor B1 [Homo sapiens] sp|P46663|BKRB1_HUMAN RecName: Full=B1 bradykinin receptor; AltName: ...Full=BK-1 receptor; Short=B1R emb|CAB45650.1| bradykinin B1 receptor [Homo sapiens] dbj|BAC06112.1| seven tr...ansmembrane helix receptor [Homo sapiens] gb|AAH34705.1| Bradykinin receptor B1 [Homo sapi...ens] gb|AAP32296.1| bradykinin receptor B1 [Homo sapiens] gb|EAW81632.1| bradykinin receptor B1 [Homo sapi...1 [synthetic construct] dbj|BAF84659.1| unnamed protein product [Homo sapiens] 1e

The seven S's for successful management.

Science.gov (United States)

Davidhizar, R

1995-03-01

Becoming a successful manager in a health care agency is, for most new managers, an awesome goal. Successful management is more than knowledge of leadership roles and management functions that can be learned in school or educational workshops. Successful management involves effective use of both the manager's affective and cognitive domains. Mentoring and apprenticeship with a successful nurse leader is for many novice managers a highly valuable way to learn management skills since this allows for techniques with a successful nurse manager to be visualized and then modeled. "Seven S's" that provide a framework for managerial success are discussed.

78 FR 31627 - Twenty-Second Meeting: RTCA Special Committee 224, Airport Security Access Control Systems

Science.gov (United States)

2013-05-24

..., Management Analyst, NextGen, Business Operations Group, Federal Aviation Administration. [FR Doc. 2013-12460... Welcome, Introductions & Administrative Remarks Review and Approve Summary of the Twenty-first Meeting... Next Meeting Any Other Business Adjourn Attendance is open to the interested public but limited to...

76 FR 21741 - Twenty-First Century Communications and Video Programming Accessibility Act; Announcement of Town...

Science.gov (United States)

2011-04-18

... equipment distribution program for people who are deaf-blind. In addition, the law will fill accessibility... Programming Accessibility Act; Announcement of Town Hall Meeting AGENCY: Federal Communications Commission... The Twenty-First Century Communications and Video Programming Accessibility Act (the Act or CVAA...

Strong coupling in F-theory and geometrically non-Higgsable seven-branes

Directory of Open Access Journals (Sweden)

James Halverson

2017-06-01

Full Text Available Geometrically non-Higgsable seven-branes carry gauge sectors that cannot be broken by complex structure deformation, and there is growing evidence that such configurations are typical in F-theory. We study strongly coupled physics associated with these branes. Axiodilaton profiles are computed using Ramanujan's theories of elliptic functions to alternative bases, showing explicitly that the string coupling is O(1 in the vicinity of the brane; that it sources nilpotent SL(2,Z monodromy and therefore the associated brane charges are modular; and that essentially all F-theory compactifications have regions with order one string coupling. It is shown that non-perturbative SU(3 and SU(2 seven-branes are related to weakly coupled counterparts with D7-branes via deformation-induced Hanany–Witten moves on (p,q string junctions that turn them into fundamental open strings; only the former may exist for generic complex structure. D3-brane near these and the Kodaira type II seven-branes probe Argyres–Douglas theories. The BPS states of slightly deformed theories are shown to be dyonic string junctions.

A seven harmonic actively compensated Langmuir probe for the GEC Cell

Science.gov (United States)

Goodyear, A.; Nolle, L.; Hopgood, A. A.; Picton, P. D.; Braithwaite, N.

2001-10-01

The uncertainty of Langmuir probe measurements in capacitively coupled discharges depends to a great extent on how well harmonic components in the plasma potential are accounted for. The extent to which individual harmonics distort a probe characteristic has been determined across power and pressure parameter-space in the GEC cell. Langmuir probe current-voltage measurements are distorted by RF components across the probe sheath. A seven harmonic waveform was applied to the probe tip to actively match that generated by the plasma. In some circumstances harmonics above the 3rd contributed RF components of the order of the electron temperature in magnitude. Measurement of the EEDF was found to be particularly sensitive to these components. Optimization of the applied waveform (seven amplitudes and seven phases) was achieved using artificially intelligent control. This is advantageous given the large number of (possibly interacting) parameters and permits tracking of changes in plasma conditions. An algorithm utilizing simulated annealing determines the optimum waveform in a far shorter time than a skilled human operator can.

New Apprenticeships in Ireland

OpenAIRE

Deegan, Mark

2017-01-01

Short Abstract: There are twenty-seven statutory Apprenticeships in Ireland. The Department of Education and Skills has a strategy to develop over a hundred new Apprenticeships. This paper addresses the steps being taken to develop these programmes and to encourage stakeholders to engage with Apprenticeship as a mode of education. Full Abstract: There are twenty-seven statutory Apprenticeships in Ireland. The Department of Education and Skills has a strategy to develop over a hundred...

Hosotani model in closed string theory

International Nuclear Information System (INIS)

Shiraishi, Kiyoshi.

1988-11-01

Hosotani mechanism in the closed string theory with current algebra symmetry is described by the (old covariant) operator method. We compare the gauge symmetry breaking mechanism in a string theory which has SU(2) symmetry with the one in an equivalent compactified closed string theory. We also investigate the difference between Hosotani mechanism and Higgs mechanism in closed string theories by calculation of a fourpoint amplitude of 'Higgs' bosons at tree level. (author)

Comparison of accuracy and safety of the SEVEN and the Navigator continuous glucose monitoring systems.

Science.gov (United States)

Garg, Satish K; Smith, James; Beatson, Christie; Lopez-Baca, Benita; Voelmle, Mary; Gottlieb, Peter A

2009-02-01

This study evaluated the accuracy and safety of two continuous glucose monitoring (CGM) systems, the SEVEN (DexCom, San Diego, CA) and the Navigator (Abbott Diabetes Care, Alameda, CA), with the YSI laboratory measurements of blood glucose (blood glucose meter manufactured by YSI, Yellow Springs, OH), when worn concurrently in adults with type 1 diabetes. Fourteen subjects with type 1 diabetes, 33 +/- 6 (mean +/- SD) years old, were enrolled in this study. All subjects wore both sensors concurrently over three consecutive 5-day CGM sessions (15-day wear). On Days 5, 10, and 15, subjects participated in an 8-h in-clinic session where measurements from the CGM systems were collected and compared with YSI measurements every 15 min. At the end of Day 5 and 10 in-clinic sessions, the sensors were removed, and new sensors were inserted for the following CGM session despite the SEVEN system's recommended use for up to 7 days. The mean absolute relative difference (ARD) for the two CGM devices versus YSI was not different: 16.8% and 16.1% for SEVEN and Navigator, respectively (P = 0.38). In the hypoglycemic region (YSI value blood glucose (SMBG) values. Thirteen additional Navigator replacement devices were issued compared to two for the SEVEN. A total of three versus 14 skin reactions were reported with the SEVEN and Navigator insertion area, respectively. Glucose measurements with the SEVEN and Navigator were found to be similar compared with YSI and SMBG measurements, with the exception of the hypoglycemic range where the SEVEN performed better. However, the Navigator caused more skin area reactions.

Closing the loop.

Science.gov (United States)

Dassau, E; Atlas, E; Phillip, M

2010-02-01

The dream of closing the loop is actually the dream of creating an artificial pancreas and freeing the patients from being involved with the care of their own diabetes. Insulin-dependent diabetes (type 1) is a chronic incurable disease which requires constant therapy without the possibility of any 'holidays' or insulin-free days. It means that patients have to inject insulin every day of their life, several times per day, and in order to do it safely they also have to measure their blood glucose levels several times per day. Patients need to plan their meals, their physical activities and their insulin regime - there is only very small room for spontaneous activities. This is why the desire for an artificial pancreas is so strong despite the fact that it will not cure the diabetic patients. Attempts to develop a closed-loop system started in the 1960s but never got to a clinical practical stage of development. In recent years the availability of continuous glucose sensors revived those efforts and stimulated the clinician and researchers to believe that closing the loop might be possible nowadays. Many papers have been published over the years describing several different ideas on how to close the loop. Most of the suggested systems have a sensing arm that measures the blood glucose repeatedly or continuously, an insulin delivery arm that injects insulin upon command and a computer that makes the decisions of when and how much insulin to deliver. The differences between the various published systems in the literature are mainly in their control algorithms. However, there are also differences related to the method and site of glucose measurement and insulin delivery. SC glucose measurements and insulin delivery are the most studied option but other combinations of insulin measurements and glucose delivery including intravascular and intraperitoneal (IP) are explored. We tried to select recent publications that we believe had influenced and inspired people interested

Seven channel gated charge to time converter

Energy Technology Data Exchange (ETDEWEB)

Stubbs, R J; Waddoup, W D [Durham Univ. (UK)

1977-11-01

By using a hybrid integrated circuit seven independent gated charge to time converters have been constructed in a single width NIM module. Gate widths from < approximately 10 ns to approximately 300 ns are possible with a resolution of 0.25 pC, linearity is better than +-1 pC over 2.5 decades of input signal height. Together with a multichannel scaling system described in the following paper one has a very powerful multichannel gated ADC system.

27 CFR 70.485 - Closing agreements.

Science.gov (United States)

2010-04-01

... Relating to Alcohol, Tobacco, Firearms, and Explosives Administrative Remedies § 70.485 Closing agreements... disadvantage through consummation of such an agreement. (b) Scope of closing agreement—(1) In general. A...

Outcomes of treatment of nine cases of recalcitrant severe hidradenitis suppurativa with carbon dioxide laser.

Science.gov (United States)

Madan, V; Hindle, E; Hussain, W; August, P J

2008-12-01

Hidradenitis suppurativa (HS) is a chronic and often a recalcitrant inflammatory skin condition. To present the results of carbon dioxide (CO2) laser treatment of recalcitrant HS in nine patients who had failed to improve on medical and other surgical treatments. HS lesions consisting of abscesses, sinuses and granulation tissue were completely excised using the cutting mode of a CO2 laser, leaving only healthy residual subcutaneous fat. The wounds were closed by primary intention where possible and left to granulate otherwise. Outcomes were determined by clinical review and questionnaire. Twenty-seven sites were treated in 19 sessions on nine patients. Seven procedures were performed under general anaesthesia and 12 under local. All patients rated their postoperative discomfort as less or equal to their preoperative state. Seven of the nine patients had complete remission for 12 months or longer after their last laser treatment and ceased all medications. High levels of patient satisfaction were reported with CO2 laser treatment. The main complication was axillary scar contracture in two patients but this was insufficient to limit limb movement. CO2 laser treatment should be considered as a treatment option in recalcitrant HS, where multiple medical treatments have been ineffective.

A rule of seven in Watson-Crick base-pairing of mismatched sequences.

Science.gov (United States)

Cisse, Ibrahim I; Kim, Hajin; Ha, Taekjip

2012-05-13

Sequence recognition through base-pairing is essential for DNA repair and gene regulation, but the basic rules governing this process remain elusive. In particular, the kinetics of annealing between two imperfectly matched strands is not well characterized, despite its potential importance in nucleic acid-based biotechnologies and gene silencing. Here we use single-molecule fluorescence to visualize the multiple annealing and melting reactions of two untethered strands inside a porous vesicle, allowing us to precisely quantify the annealing and melting rates. The data as a function of mismatch position suggest that seven contiguous base pairs are needed for rapid annealing of DNA and RNA. This phenomenological rule of seven may underlie the requirement for seven nucleotides of complementarity to seed gene silencing by small noncoding RNA and may help guide performance improvement in DNA- and RNA-based bio- and nanotechnologies, in which off-target effects can be detrimental.

Inflation in a closed universe

Science.gov (United States)

Ratra, Bharat

2017-11-01

To derive a power spectrum for energy density inhomogeneities in a closed universe, we study a spatially-closed inflation-modified hot big bang model whose evolutionary history is divided into three epochs: an early slowly-rolling scalar field inflation epoch and the usual radiation and nonrelativistic matter epochs. (For our purposes it is not necessary to consider a final dark energy dominated epoch.) We derive general solutions of the relativistic linear perturbation equations in each epoch. The constants of integration in the inflation epoch solutions are determined from de Sitter invariant quantum-mechanical initial conditions in the Lorentzian section of the inflating closed de Sitter space derived from Hawking's prescription that the quantum state of the universe only include field configurations that are regular on the Euclidean (de Sitter) sphere section. The constants of integration in the radiation and matter epoch solutions are determined from joining conditions derived by requiring that the linear perturbation equations remain nonsingular at the transitions between epochs. The matter epoch power spectrum of gauge-invariant energy density inhomogeneities is not a power law, and depends on spatial wave number in the way expected for a generalization to the closed model of the standard flat-space scale-invariant power spectrum. The power spectrum we derive appears to differ from a number of other closed inflation model power spectra derived assuming different (presumably non de Sitter invariant) initial conditions.

Molecular characterisation of the early response in pigs to experimental infection with Actinobacillus pleuropneumoniae using cDNA microarrays

DEFF Research Database (Denmark)

Hedegaard, Jakob; Skovgaard, Kerstin; Mortensen, Shila

2007-01-01

Background: The bacterium Actinobacillus pleuropneumoniae is responsible for porcine pleuropneumonia, a widespread, highly contagious and often fatal respiratory disease of pigs. The general porcine innate immune response after A. pleuropneumoniae infection is still not clarified. The objective...... lymph node tissue were hybridised to an expanded version of the porcine microarray with 26879 unique PCR products. Results: A total of 357 genes differed significantly in expression between infected and non-infected lung tissue, 713 genes differed in expression in liver tissue from infected versus non-infected...... animals and 130 genes differed in expression in tracheobronchial lymph node tissue from infected versus non-infected animals. Among these genes, several have previously been described to be part of a general host response to infections encoding immune response related proteins. In inflamed lung tissue...

A and B Theories of Closed Time

Directory of Open Access Journals (Sweden)

Phill Dowe

Full Text Available ABSTRACT Closed time is possible in several senses of ‘possible’. One might like to know, therefore, whether closed time is possible in the sense that it is compatible with standard metaphysical theories of time. In this paper I am concerned with whether closed time is compatible with A and/or B theories of time. A common enough view amongst philosophers is that B theories do but A theories do not allow closed time. However, I show that prima-facie neither approach allows closed time, but that with a little work standard versions of both approaches do. This shows that there’s no special problem with the notion of eternal return.

76 FR 76449 - Post Office Closing

Science.gov (United States)

2011-12-07

... the closing of the Spring Dale, West Virginia post office has been filed. It identifies preliminary... Postal Service's determination to close the Spring Dale post office in Spring Dale, West Virginia. The...

Study of the chain termination in the polymerization of seven-membered carbonate cyclic

International Nuclear Information System (INIS)

Carpentier, Jean-Francois; Casagrande Junior, Osvaldo de; Gil, Marcelo Priebe

2011-01-01

Methyl substituted seven-membered ring carbonate (7CC), namely 4-methyl-1,3-dioxepan-2-one (α-Me7CC) have been synthesized in good yield (up to 50%) upon cyclization of the corresponding α-diols issued from green renewable acid. ( I mmortal ) Ring-opening polymerization (iROP) of this monomer has been carried out using various catalysts combined with an alcohol acting as a co-initiator and a chain transfer agent. The Lewis acid Al(OTf) 3 or the organometallic complexes [(BDI iPr )Zn(N(SiMe 3 ) 2 )] ((BDI iPr ) = 2-((2,6-diisopropylphenyl)amido)-4-((2,6- diisopropylphenyl)-imino)-2-pentene] and [(ONOO tBu )Y(N(SiHMe 2 ) 2 )(THF)] (ONOO tBu = amino-alkoxy-bis( phenolate)) successfully afforded the corresponding poly(α-Me7CC) with quite good control and activities. Detailed microstructural analysis of the poly(a-Me7CC) using 1 H and 13 C NMR and MALDI-TOF-MS techniques revealed the higher regioselectivity -with preferential ring-opening at the most hindered oxygen-acyl O-C(O)O bond, i.e. close to the α-Me substituent- of the zinc-based system followed by the yttrium as compared to the lack of selectivity of the aluminum one, in the ROP of α-Me7CC. (author)

Rethinking schizophrenia in the context of the person and their circumstances: seven reasons

Directory of Open Access Journals (Sweden)

Marino Pérez-Álvarez

2016-11-01

Full Text Available We know a great deal about schizophrenia, but the current state of the art is one of uncertainty. Researchers are confused, and patients feel misunderstood. This situation has been identified as due largely to the fact that the dominant neurobiological perspective leaves out the person. The aim of the present article is to review and integrate a series of clinical, phenomenological, historical, cultural, epidemiological, developmental, epigenetic and therapeutic phenomena in support of a suggestion that schizophrenia is above all a disorder of the person rather than of the brain. Specifically, we review seven phenomena, beginning with the conception of schizophrenia as a particular disorder of the self. We continue by looking at its recent origin, as a modern phenomenon, its juvenile onset, related to the formation of the self, the better prognosis in developing countries compared to developed countries, and the high incidence of the disorder among migrants. In the context of these phenomena of a marked socio-cultural nature, we consider the so-called genetic myth, according to which schizophrenia would have a genetic origin. On reviewing the current genetic emphasis in the light of epigenetics, it emerges that the environment and behaviour recover their prominent role in the vicissitudes of development. The seventh reason, which closes the circle of the argument, concerns the role of interpersonal chemistry in recovery of the sense of self.

Ultrastructural myocardial changes in seven cats with spontaneous hypertrophic cardiomyopathy

DEFF Research Database (Denmark)

Christiansen, Liselotte Bruun; Prats Gavalda, Clara; Hyttel, Poul

2015-01-01

OBJECTIVES: Hypertrophic cardiomyopathy (HCM) is the most common heart disease in cats and shares clinical and pathological characteristics with human HCM. Little is known about the pathogenic mechanisms underlying development of spontaneous feline HCM. ANIMALS: The study population consisted...... of seven cats diagnosed with HCM and eight age-matched cats with no evidence of cardiac disease. METHODS: Fresh myocardial biopsies taken from the middle of the left ventricular posterior free wall were obtained and examined with transmission electron microscopy. RESULTS: Electron microscopic examination...... showed ultrastructural aberrations of the myocardial cytoarchitecture and of the interstitium in the seven cats with HCM. In the most severely affected cats the myofibrils were disorganized and subsarcolemmal mitochondria were depleted. In control cats, contraction band artifacts were commonly seen...

Arduino Mega 2560 Microcontroller Built 3-Phase Seven Level Inverter

Directory of Open Access Journals (Sweden)

PAVANKUMAR Shriram Mehtre

2017-10-01

Full Text Available n this paper, the implementation of 3-phase seven level cascaded H-bridge inverter is discussed with Arduino microcontroller and harmonic analysis is performed using Fourier series. The multilevel inverters (MLI give several benefits as reduced switching voltage stresses and the capability to operate in higher level voltage applications. A new and simple architecture Arduino Mega 2560 microcontroller is employed to produce the control signals for the seven level cascaded H-bridge MLI switches. The computer simulation is carried out in PSIM environment and prototype experimental model is developed with TLP 250 driver ICs and power MOSFET switches to validate the simulation results. The THDs present in different voltage level inverters are mathematically analysed using Fourier series.

Cine MR imaging of internal derangements of the knee

International Nuclear Information System (INIS)

Niitsu, M.; Anno, I.; Ishikawa, N.; Akisada, M.; Fukubayashi, T.

1990-01-01

This paper assesses internal derangements of the knee joint by a new method of cine MR imaging. Cine MR imaging, involving cine acquisition of kinematic sagittal images during knee movement, was used to evaluate 51 symptomatic patients and 19 healthy subjects. Cine MR images of cruciate ligament fears showed disappearance of low-intensity bundles during knee movement, periodic appearance of joint fluid in the area of the ligament, and irregular tibial movement. Cine MR images of meniscal tears showed independent movement of meniscal fragments and periodic tear opening and closing. Twenty-seven of the 28 anterior cruciate ligament (ACL) tears confirmed arthroscopically were correctly identified with cine MR imaging, with a sensitivity of 96% and a specificity of 92%

Twenty years of JHEP

International Nuclear Information System (INIS)

Amati, Daniele; Bonora, Loriano

2017-01-01

On July 1st of twenty years ago we launched the first issue of JHEP. It was a real challenge to try the adventure of a scientific journal thought and managed by scientists, independent of private or institutional publishers. The idea was that physicists who were performing the work, writing the papers, and refereeing those of their peers, could also edit them in an electronic format. Thus, at a limited cost which could be handled by academic or scientific institutions, giving open access to the published information, and avoiding the heavy burden at that time placed on our libraries. In order to avoid the failure that - as we well remember was predicted to us by publishing companies and institutions, we needed the active support of the scientific community. A support in collaborating to the scrutiny of papers and scientific policies but, mainly, in sending to us their good papers. We contacted in that sense several of our most active and renowned colleagues, restricting of course to our high energy physics field. We received many enthusiastic responses as can be specifically seen from the papers that appear in the first issues of the journal, as well as the respected names listed in the advisory and in the editorial boards featuring in the opening page of the first issue of JHEP attached to this letter. We were optimists, but perhaps not as much as to foresee the success of the journal, which, in his first 20 years, turned out to be one of the most (if not the most) prestigious one in our field. Success for which --- as first project chairman and executive editor - we must essentially thank the scientific community who supported JHEP by considering it ''their journal'', as was our intention from the start. In this occasion we would like to recall the important contribution of Marco Fabbrichesi who designed the software on which the journal is based, and the technical personnel who implemented it and made it work. It is our pleasure to mention

Thirty-seven transcription factor genes differentially respond to a ...

Indian Academy of Sciences (India)

Plant transcription factors and insect defence si. Thirty-seven transcription factor genes differentially respond to a harpin protein and affect resistance to the green peach aphid in Arabidopsis. HUNLIN. PIN. RUOXUE LIŲ, BEIBEI LÜ, XIAOMENG WANG, CHUNLING ZHANG, SHUPING ZHANG, JUN QIAN, LEI CHEN,.

Movies to the Rescue: Keeping the Cold War Relevant for Twenty-First-Century Students

Science.gov (United States)

Gokcek, Gigi; Howard, Alison

2013-01-01

What are the challenges of teaching Cold War politics to the twenty-first-century student? How might the millennial generation be educated about the political science theories and concepts associated with this period in history? A college student today, who grew up in the post-Cold War era with the Internet, Facebook, Twitter, smart phones,…

Design Principles for Closed Loop Supply Chains

NARCIS (Netherlands)

H.R. Krikke (Harold); C.P. Pappis (Costas); G.T. Tsoulfas; J.M. Bloemhof-Ruwaard (Jacqueline)

2001-01-01

textabstractIn this paper we study design principles for closed loop supply chains. Closed loop supply chains aim at closing material flows thereby limiting emission and residual waste, but also providing customer service at low cost. We study 'traditional' and 'new' design principles known in the

Analysis of vertical marginal discrepancy in feldspathic porcelain crowns manufactured with different CAD/CAM systems: Closed and open.

Science.gov (United States)

Kricheldorf, Fabio; Bueno, Cleuber Rodrigo de Souza; Amaral, Wilson da Silva; Junior, Joel Ferreira Santiago; Filho, Hugo Nary

2018-01-01

The objective of this study is to compare the marginal adaptation of feldspathic porcelain crowns using two computer-aided design/computer-aided manufacturing systems, one of them is open and the other is closed. Twenty identical titanium abutments were divided into two groups: open system (OS), where ceramic crowns were created using varied equipment and software, and closed system (CS), where ceramic crowns were created using the CEREC system. Through optical microscopy analysis, we assess the marginal adaptation of the prosthetic interfaces. The data were subjected to the distribution of normality and variance. The t -test was used for the analysis of the comparison factor between the groups, and the one-way ANOVA was used to compare the variance of crown analysis regions within the group. A significance level of 5% was considered for the analyses. There was a significant difference between the systems ( P = 0.007), with the CS group having the higher mean (23.75 μm ± 3.05) of marginal discrepancy when compared to the open group (17.94 μm ± 4.77). Furthermore, there were no differences in marginal discrepancy between the different points between the groups ( P ≥ 0.05). The studied groups presented results within the requirements set out in the literature. However, the OS used presented better results in marginal adaptation.

IGF-1R and Leptin Expression Profile and the Effects of Metformin Treatment on Metabolic and Endocrine Parameters in PCOS Mice

Directory of Open Access Journals (Sweden)

Luis Eduardo Prado Correia

2017-01-01

Full Text Available We aim to assess the effects of metformin treatment on metabolic and endocrine parameters and genes expression related to the insulin-responsive pathway in polycystic ovary syndrome (PCOS. This study comprises twenty-eight obese mice divided into three metformin-treated groups for seven and twenty days and eight nonobese and nontreated ones. We found a significant decrease in glycemia after metformin treatment at days seven and twenty. However, we did not observe differences in body weight measurement. Histologically, after twenty days we observed follicular development with regression of androgenic effects. Levels of IGF-1R protein expression were low after twenty days of treatment, but LEP proteins showed an overexpression in the ovarian stroma. We assessed the IGF-1R and LEP mRNAs levels; data showed a significant overexpression of LEP after seven days of treatment, while the IGF-1R was downregulated. Metformin therapy seems to exert a beneficial effect on histological and anovulatory features, reducing follicular number and pyknosis formation, possibly involved in the reversion of androgenic stimulus. Expression of IGF-1 and LEPR indicates a relevant role in androgenic features reversion present in PCOS, hormonal equilibrium, body weight regulation, and glucose metabolism, therefore, under phenotype obesity and infertility regulation in this model.

Achievements in the past twenty years and perspective outlook of crop space breeding in China

International Nuclear Information System (INIS)

Liu Luxiang; Guo Huijun; Zhao Linshu; Gu Jiayu; Zhao Shirong

2007-01-01

Space breeding is a novel effective approach to crop mutational improvement, which was firstly founded by the chinese scientists in 1987. A national collaborative research network has been established and significant achievements have been made during the past twenty years. More than forty new mutant varieties derived from space mutagenesis in rice, wheat, cotton, sweet pepper, tomato, sesame and alfalfa have been developed, officially released and put into production. A series of useful rare mutant germplasms which might make a great breakthrough in crop grain yield and/or quality improvement have been obtained. Technique innovations in space breeding and ground simulation of space environmental factors have been made good progresses. Intellective property right protection and industrialization of space mutation techniques and mutant varieties, exploration of the mechanism of space mutation induction have also been stably advanced. In this paper, the main achievements of crop space breeding in the past twenty years had been reviewed. The perspective development strategies of space breeding were also discussed. (authors)

Initial Career and Work Meanings in Seven European Countries.

Science.gov (United States)

Claes, Rita; Quintanilla, S. Antonio R.

1994-01-01

Explores initial careers of two target groups of young adults in seven European countries. Career patterns were constructed through cluster analysis on data gathered via self-report. Six career patterns were identified. Offers suggestions for further research and implications for career counseling, career education, and organizational career…

Seven new species of helminths for reptiles from Armenia.

Science.gov (United States)

Nelli, Sargsyan; Felix, Danielyan; Marine, Arakelyan

2014-09-01

Helminthic infections of reptiles habiting in the territory of Armenia are examined. Seven species of helminths new for reptiles from Armenia are registered: Parapharyngodon skrjabini, Oswaldocruzia goezei, Neoxysomatium sp., Telorchis assula, Nematotaenia tarentolae, Mesocestoides lineatus and Spirometra erinacei europea. Descriptions and pictures of them are given.

Archaeomagnetic dating of seven archaeological fireplaces in the Netherlands

NARCIS (Netherlands)

Hoof, A.A.M. van; Langereis, C.G.; Joosten, I.; Thijssen, J.R.A.M.; Nijhof, E.; Groenendijk, H.A.; Eynde, G.R.M. van den

1997-01-01

The palaeomagnetic directions of seven Dutch fireplaces are compared with the archaeological age estimates which range from the first to the 17th century AD. A comparison with the British master curve of secular variation for archaeomagnetic dating results in a refinement of the archaeological age

Global Aphasia As A Predictor Of Mortality In The Acute Phase Of A First Stroke [afasia Global Prediz Mortalidade Na Fase Aguda De Um Primeiro Acidente Vascular Cerebral Isquêmico

OpenAIRE

de Oliveira F.F.; Damasceno B.P.

2011-01-01

OBJECTIVE: To establish whether vascular aphasic syndromes can predict stroke outcomes. METHOD: Thirty-seven adults were evaluated for speech and language within 72 hours after a single first-ever ischemic brain lesion, in blind association to CT and/or MR. RESULTS: Speech or language disabilities were found in seven (87.5%) of the eight deceased patients and twenty-six (89.7%) of the twenty-nine survivors. Global aphasia was identified in eleven patients, all with left hemisphere lesions (ni...

Ecological restoration should be redefined for the twenty-first century.

Science.gov (United States)

Martin, David M

2017-09-24

Forty years ago, ecological restoration was conceptualized through a natural science lens. Today, ecological restoration has evolved into a social and scientific concept. The duality of ecological restoration is acknowledged in guidance documents on the subject but is not apparent in its definition. Current definitions reflect our views about what ecological restoration does but not why we do it. This viewpoint does not give appropriate credit to contributions from social sciences, nor does it provide compelling goals for people with different motivating rationales to engage in or support restoration. In this study, I give a concise history of the conceptualization and definition of ecological restoration, and I propose an alternative definition and corresponding viewpoint on restoration goal-setting to meet twenty-first century scientific and public inquiry.

On integrable c < 1 open-closed string theory

International Nuclear Information System (INIS)

Johnson, C.V.

1994-01-01

The integrable structure of open-closed string theories in the (p, q) conformal minimal model backgrounds is presented. The relation between the τ-function of the closed string theory and that of the open-closed string theory is uncovered. The resulting description of the open-closed string theory is shown to fit very naturally into the framework of the sl(q, C) KdV hierarchies. In particular, the twisted bosons which underlie and organise the structure of the closed string theory play a similar role here and may be employed to derive loop equations and correlation function recursion relations for the open-closed strings in a simple way. (orig.)

7 CFR 1927.54 - Requirements for closing agents.

Science.gov (United States)

2010-01-01

... closing agent and close agency real estate loans, provide necessary title clearance, and perform such... PROGRAM REGULATIONS TITLE CLEARANCE AND LOAN CLOSING Real Estate Title Clearance and Loan Closing § 1927... practice law in the state where the real estate security is located and who complies with the bonding and...

40 CFR 73.38 - Closing of accounts.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Closing of accounts. 73.38 Section 73...) SULFUR DIOXIDE ALLOWANCE SYSTEM Allowance Tracking System § 73.38 Closing of accounts. (a) General... close the general account by submitting an allowance transfer, pursuant to § 73.50 and § 73.52...

Synthesis of Carbon Nano tubes: A Revolution in Material Science for the Twenty-First Century

International Nuclear Information System (INIS)

Allaf, Abd. W.

2003-01-01

The aim of this work is to explain the preparation procedures of single walled carbon nano tubes using arc discharge technique. The optimum conditions of carbon nano tubes synthesis are given. It should be pointed out that this sort of materials would be the twenty-first century materials

Affective and cognitive determinants of intention to consume twenty foods that contribute to fat intake

NARCIS (Netherlands)

Stafleu, A.; Graaf, de C.; Staveren, van W.A.; Burema, J.

2001-01-01

Fishbein and Ajzen's theory of reasoned action was used as a framework to study beliefs and attitudes towards twenty foods that contribute to fat intake in a Netherlands smaple population. Subjects between 18 and 75 years of age (n = 419, response rate 23€filled out a self-administered

Molecular-state close-coupling theory including continuum states. I. Derivation of close-coupled equations

International Nuclear Information System (INIS)

Thorson, W.R.; Bandarage, G.

1988-01-01

We formulate a close-coupling theory of slow ion-atom collisions based on molecular (adiabatic) electronic states, and including the electronic continuum. The continuum is represented by packet states spanning it locally and constructed explicitly from exact continuum states. Particular attention is given to two fundamental questions: (1) Unbound electrons can escape from the local region spanned by the packet states. We derive close-coupled integral equations correctly including the escape effects; the ''propagator'' generated by these integral equations does not conserve probability within the close-coupled basis. Previous molecular-state formulations including the continuum give no account of escape effects. (2) Nonadiabatic couplings of adiabatic continuum states with the same energy are singular, reflecting the fact that an adiabatic description of continuum behavior is not valid outside a local region. We treat these singularities explicitly and show that an accurate representation of nonadiabatic couplings within the local region spanned by a set of packet states is well behaved. Hence an adiabatic basis-set description can be used to describe close coupling to the continuum in a local ''interaction region,'' provided the effects of escape are included. In principle, the formulation developed here can be extended to a large class of model problems involving many-electron systems and including models for Penning ionization and collisional detachment processes

The covered distance for twenty five years of the Manche waste storage 1969 - 1994

International Nuclear Information System (INIS)

Gourden, J.M.

2001-01-01

The twenty five years of the Manche plant,are narrated with the difficulties of the beginning, the problems coming from leaks or runoff that have led to improvement in the knowledge of radioactive waste behaviour and the solutions that have been brought. It is from the building of the plant until the radioactive waste management that is related in this book. (N.C.)

Studies on the preparative isolation and stability of seven main anthocyanins from Yan 73 grape.

Science.gov (United States)

Tang, Ke; Li, Yang; Han, Yehui; Han, Fuliang; Li, Jiming; Nie, Yao; Xu, Yan

2014-09-01

[corrected] Seven anthocyanin monomers of Yan 73 grape were separated using preparative HPLC and identified by UPLC-ESI-MS/MS. The stabilities of the seven isolated anthocyanins to light, temperature and pH were also investigated. Seven anthocyanin monomers were successfully isolated with an Xbridge Prep C18 column on a preparative scale. The pigments delphinidin-3-O-glucoside, malvidin-3-O-acetylglucoside and malvidin-3-O-coumarylglucoside were yielded in a one-step separation by preparative HPLC, with purities up to 99.9%, 91.7% and 95.5%, respectively. The pigments cyanidin-3-O-glucoside, petunidin-3-O-glucoside, peonidin-3-O-glucoside, and malvidin-3-O-glucoside were further purified with another elution method and their purities were all improved up to 99.9%. Monomeric anthocyanin degradation fitted a first-order reaction model. The seven isolated anthocyanins were significantly more stable in the dark than under light. High temperature was also unfavourable for the stability of anthocyanins. The anthocyanins were more stable at lower pH than at higher pH. In addition, among these anthocyanins, delphinidin-3-O-glucoside, malvidin-3-O-acetylglucoside and malvidin-3-O-coumarylglucoside were more susceptible to light, heat, and pH than the others. A simple and clean isolation method of seven anthocyanin monomers from Yan 73 grape was established. The stabilities of the seven anthocyanin monomers to light, temperature and pH were different, but the trends in changes were similar. © 2014 Society of Chemical Industry.

Evaluation of static and dynamic balance in athletes with anterior cruciate ligament injury – A controlled study

Directory of Open Access Journals (Sweden)

Tiago Lazzaretti Fernandes

Full Text Available OBJECTIVES: Anterior cruciate ligament injury leads to adaptive responses to maintain postural control. However, there is no consensus regarding whether leg dominance also affects postural control in athletes with anterior cruciate ligament injury. The purpose of this study was to evaluate dynamic and static postural control among athletes with and without anterior cruciate ligament injury to the dominant leg. METHODS: Twenty-eight athletes, twenty-one males and seven females aged 15-45 years, were allocated to one of two groups: the anterior cruciate ligament injury group (26±3 years or the control group without anterior cruciate ligament injury (25±6.5 years. All subjects performed one legged stance tests under eyes open and eyes closed conditions and squat and kick movement tests using a postural control protocol (AccuSwayPlus force platform, Massachusetts. The center of pressure displacement and speed were measured by the force platform. In addition, the distance traveled on the single-leg hop test was assessed as an objective measure of function. RESULTS: Significantly greater mediolateral sway was found under the eyes closed condition (p=0.04 and during squat movement (p=0.01 in the anterior cruciate ligament injury group than in the control group. Analysis of the single-leg hop test results showed no difference between the groups (p=0.73. CONCLUSION: Athletes with anterior cruciate ligament injury had greater mediolateral displacement of the center of pressure toward the dominant leg under the eyes closed condition and during squat movement compared to control athletes.

Development of the Respiratory Index of Severity in Children (RISC score among young children with respiratory infections in South Africa.

Directory of Open Access Journals (Sweden)

Carrie Reed

Full Text Available OBJECTIVE: Pneumonia is a leading cause of death in children worldwide. A simple clinical score predicting the probability of death in a young child with lower respiratory tract infection (LRTI could aid clinicians in case management and provide a standardized severity measure during epidemiologic studies. METHODS: We analyzed 4,148 LRTI hospitalizations in children <24 months enrolled in a pneumococcal conjugate vaccine trial in South Africa from 1998-2001, to develop the Respiratory Index of Severity in Children (RISC. Using clinical data at admission, a multivariable logistic regression model for mortality was developed and statistically evaluated using bootstrap resampling techniques. Points were assigned to risk factors based on their coefficients in the multivariable model. A child's RISC score is the sum of points for each risk factor present. Separate models were developed for HIV-infected and non-infected children. RESULTS: Significant risk factors for HIV-infected and non-infected children included low oxygen saturation, chest indrawing, wheezing, and refusal to feed. The models also included age and HIV clinical classification (for HIV-infected children or weight-for-age (for non-infected children. RISC scores ranged up to 7 points for HIV-infected or 6 points for non-infected children and correlated with probability of death (0-47%, HIV-infected; 0-14%, non-infected. Final models showed good discrimination (area under the ROC curve and calibration (goodness-of-fit. CONCLUSION: The RISC score incorporates a simple set of risk factors that accurately discriminate between young children based on their risk of death from LRTI, and may provide an objective means to quantify severity based on the risk of mortality.

Leadership for Twenty-First-Century Schools and Student Achievement: Lessons Learned from Three Exemplary Cases

Science.gov (United States)

Schrum, Lynne; Levin, Barbara B.

2013-01-01

The purpose of this research was to understand ways exemplary award winning secondary school leaders have transformed their schools for twenty-first-century education and student achievement. This article presents three diverse case studies and identifies ways that each school's leader and leadership team reconfigured its culture and expectations,…

Speaking American: Comparing Supreme Court and Hollywood Racial Interpretation in the Early Twenty-First Century

Science.gov (United States)

Hawkins, Paul Henry

2010-01-01

Apprehending that race is social, not biological, this study examines U.S. racial formation in the early twenty-first century. In particular, Hollywood and Supreme Court texts are analyzed as media for gathering, shaping and transmitting racial ideas. Representing Hollywood, the 2004 film "Crash" is analyzed. Representing the Supreme Court, the…

Teaching and Learning in the Twenty-First Century: What Is an "Institute of Education" for?

Science.gov (United States)

Husbands, Chris

2012-01-01

As we begin the twenty-first century, schools and teachers are subject to enormous pressures for change. The revolution in digital technologies, the pressure to develop consistently high-performing schools systems, and the drive between excellence and equity all combine to raise profound questions about the nature of successful teaching and…

Incidence of infection following internal fixation of open and closed tibia fractures in India (INFINITI): a multi-centre observational cohort study.

Science.gov (United States)

Doshi, Prakash; Gopalan, Hitesh; Sprague, Sheila; Pradhan, Chetan; Kulkarni, Sunil; Bhandari, Mohit

2017-04-14

Trauma is a major public health problem, particularly in India due to the country's rapid urbanization. Tibia fractures are a common and often complicated injury that is at risk of infection following surgical fixation. The primary objectives of this cohort study were to determine the incidence of infection within one year of surgery and to describe the distribution of infections by location and time of diagnosis for tibia fractures in India. We conducted a multi-center, prospective cohort study. Patients who presented with an open or closed tibia fracture treated with internal fixation to one of the participating hospitals in India were invited to participate in the study. Participants attended follow-up visits at 3, 6, and 12 months post-surgery, where they were assessed for infections, fracture healing, and health-related quality of life as measured by the EurQol-5 Dimensions (EQ-5D). Seven hundred eighty-seven participants were included in the study and 768 participants completed the 12 month follow-up. The overall incidence of infection was 2.9% (23 infections). The incidence of infection was 1.6% (10 infections) in closed and 8.0% (13 infections) in open fractures. There were 7 deep and 16 superficial infections, with 5 being early, 7 being delayed, and 11 being late infections. Intra-operative antibiotics were given to 92.1% of participants and post-operative antibiotics were given to 96.8% of participants. Antibiotics were prescribed for an average of 8.3 days for closed fractures and 9.1 days for open fractures. Infected fractures took significantly longer to heal, and participants who had an infection had significantly lower EQ-5D scores. The incidence of infection within this cohort is similar to those seen in developed countries. The duration of prophylactic antibiotic use was longer than standard practice in North America, raising concern for the potential development of antibiotic resistant microbes within Indian orthopaedic settings. Future

Historical Approach to the Role of Women in the Legislation of Iran: A Case Study on the Twenty-First Parliament

Directory of Open Access Journals (Sweden)

Sarah Sheibani

2017-01-01

Full Text Available One hundred and ten years ago, men and women took constitutionalism to achieve justice in Iran. National Council was the result of the Iranian people's struggle for justice, both women and men. Men policies from the beginning of legislation put women as minors and lunatics and bankrupted and banned them from vote. However, the Constitutional Revolution as a turning point and a national revolution played a key role in changing attitudes to women and structural context of their participation provided. In this paper, with the use of descriptive-analytical as well as quantitative methods, we sought to answer the question that what was the position of women in the twenty-first Parliament. The results of this study suggest that when Iranian women were allowed to participate politics, they have achieved to show their ability in politics as we saw examples in the twenty-first Parliament in which women had twenty-two percent participation.

Automatically closing swing gate closure assembly

Science.gov (United States)

Chang, Shih-Chih; Schuck, William J.; Gilmore, Richard F.

1988-01-01

A swing gate closure assembly for nuclear reactor tipoff assembly wherein the swing gate is cammed open by a fuel element or spacer but is reliably closed at a desired closing rate primarily by hydraulic forces in the absence of a fuel charge.

Features of a relativistic space-time with seven isometries

International Nuclear Information System (INIS)

Reboucas, M.J.; Teixeira, A.F.F.

1986-01-01

Previous works on the Reboucas-Tiomno spacetime are extended. It is shown that the RT model is Petrov type 0 and exhibit its conformally flat form. The geodesic equations are fully integrated and corresponding motions are discussed at lenght. Confrontation with other rare solutions possessing seven isometries is made. (Author) [pt

Empowerment Starts Here: Seven Principles to Empowering Urban Youth

Science.gov (United States)

Dye, Angela

2011-01-01

"Empowerment Starts Here" covers an experimental approach to social change within urban communities by way of seven distinct principles for student empowerment. Turning classroom methods into a school model, Preparatory School for Global Leadership was the first to experience student empowerment at a school-wide level. This book provides insight…

Work in Progress: The Seven Rs of Team Building

Science.gov (United States)

Brunelli, Jean; Schneider, Elaine Fogel

2004-01-01

This article argues that supportive teams--including professionals, paraprofessionals, and parents--can teach staff members how to identify and implement best practices in early intervention settings. The authors describe "the seven Rs of team building" distilled from their many years of team building and maintenance: 1) Reading cues; 2) Regular…

Subcutaneous emphysema of the upper extremity following penetrating blackthorn injury to the wrist.

LENUS (Irish Health Repository)

Tiong, W H C

2009-02-01

SUMMARY: Noninfective subcutaneous emphysema of the upper extremity, albeit rare, has to be borne in mind when treating patients with subcutaneous emphysema. The misdiagnosis of this condition as its serious infective counterpart often leads to unnecessary aggressive treatment. Noninfective subcutaneous emphysema often accompanies a patient who has no systemic symptoms of illness. Unfortunately, the distinction is not always easy especially when history of injury suggests involvement of an infective or reactive element. Penetrating blackthorn injury is common, especially in rural communities, and often occurs from farming or gardening activities. Blackthorn penetration can cause numerous tissue reactions once embedded under the skin and they are often contaminated with soil. Here we present, for the first time, a case where penetrating blackthorn injury to the wrist resulted in noninfective subcutaneous emphysema involving the whole upper limb and neck, and its subsequent management.

Accuracy and precision evaluation of seven self-monitoring blood glucose systems.

Science.gov (United States)

Kuo, Chih-Yi; Hsu, Cheng-Teng; Ho, Cheng-Shiao; Su, Ting-En; Wu, Ming-Hsun; Wang, Chau-Jong

2011-05-01

Self-monitoring blood glucose (SMBG) systems play a critical role in management of diabetes. SMBG systems should at least meet the minimal requirement of the World Health Organization's ISO 15197:2003. For tight glycemic control, a tighter accuracy requirement is needed. Seven SMBG systems were evaluated for accuracy and precision: Bionime Rightest(™) GM550 (Bionime Corp., Dali City, Taiwan), Accu-Chek(®) Performa (Roche Diagnostics, Indianapolis, IN), OneTouch(®) Ultra(®)2 (LifeScan Inc., Milpitas, CA), MediSense(®) Optium(™) Xceed (Abbott Diabetes Care Inc., Alameda, CA), Medisafe (TERUMO Corp., Tokyo, Japan), Fora(®) TD4227 (Taidac Technology Corp., Wugu Township, Taiwan), and Ascensia Contour(®) (Bayer HealthCare LLC, Mishawaka, IN). The 107 participants (44 men and 63 women) were between 23 and 91 years old. The analytical results of seven SMBG systems were compared with those of plasma analyzed with the hexokinase method (Olympus AU640, Olympus America Inc., Center Valley, PA). The imprecision of the seven blood glucose meters ranged from 1.1% to 4.7%. Three of the seven blood glucose meters (42.9%) fulfilled the minimum accuracy criteria of ISO 15197:2003. The mean absolute relative error value for each blood glucose meter was calculated and ranged from 6.5% to 12.0%. More than 40% of evaluated SMBG systems meet the minimal accuracy criteria requirement of ISO 15197:2003. However, considering tighter criteria for accuracy of ±15%, only the Bionime Rightest GM550 meets this requirement. Because SMBG systems play a critical role in management of diabetes, manufacturers have to strive to improve accuracy and precision and to ensure the good quality of blood glucose meters and test strips.

Multiple case study in seven European countries regarding culture-sensitive classroom quality assessment

OpenAIRE

Slot, P.L.; Cadima, Joana; Salminen, Jenni; Pastori, Giulia; Lerkkanen, Marja-Kristiina

2016-01-01

This report presents the findings of a multiple case study, conducted in seven European countries to examine common and culturally differing aspects of curriculum, pedagogy, and quality of Early Childhood Education and Care (ECEC) provisions in Europe. This multiple case study involved intensive data collection on structural characteristics, process quality, implemented curricula and pedagogical approaches in four ECEC centers in each of the seven countries that were considered examples of ‘g...

Twenty-second Fungal Genetics Conference - Asilomar, 2003

Energy Technology Data Exchange (ETDEWEB)

Jonathan D. Walton

2003-06-30

The purpose of the Twenty Second Fungal Genetics Conference is to bring together scientists and students who are interested in genetic approaches to studying the biology of filamentous fungi. It is intended to stimulate thinking and discussion in an atmosphere that supports interactions between scientists at different levels and in different disciplines. Topics range from the basic to the applied. Filamentous fungi impact human affairs in many ways. In the environment they are the most important agents of decay and nutrient turnover. They are used extensively in the food industry for the production of food enzymes such as pectinase and food additives such as citric acid. They are used in the production of fermented foods such as alcoholic drinks, bread, cheese, and soy sauce. More than a dozen species of mushrooms are used as foods directly. Many of our most important antibiotics, such as penicillin, cyclosporin, and lovastatin, come from fungi. Fungi also have many negative impacts on human health and economics. Fungi are serious pathogens in immuno-compromised patients. Fungi are the single largest group of plant pathogens and thus a serious limit on crop productivity throughout the world. Many fungi are allergenic, and mold contamination of residences and commercial buildings is now recognized as a serious public health threat. As decomposers, fungi cause extensive damage to just about all natural and synthetic materials.

Nuclear energy into the twenty-first century

International Nuclear Information System (INIS)

Hammond, G.P.

1996-01-01

The historical development of the civil nuclear power generation industry is examined in the light of the need to meet conflicting energy-supply and environmental pressures over recent decades. It is suggested that fission (thermal and fast) reactors will dominate the market up to the period 2010-2030, with fusion being relegated to the latter part of the twenty-first century. A number of issues affecting the use of nuclear electricity generation in Western Europe are considered including its cost, industrial strategy needs, and the public acceptability of nuclear power. The contribution of nuclear power stations to achieving CO2 targets aimed at relieving global warming is discussed in the context of alternative strategies for sustainable development, including renewable energy sources and energy-efficiency measures. Trends in the generation of nuclear electricity from fission reactors are finally considered in terms of the main geopolitical groupings that make up the world in the mid-1990s. Several recent, but somewhat conflicting, forecasts of the role of nuclear power in the fuel mix to about 2020 are reviewed. It is argued that the only major expansion in generating capacity will take place on the Asia-Pacific Rim and not in the developing countries generally. Nevertheless, the global nuclear industry overall will continue to be dominated by a small number of large nuclear electricity generating countries; principally the USA, France and Japan. (UK)

Pharmacokinetic comparison of seven 8-methoxypsoralen brands

DEFF Research Database (Denmark)

Menne, T; Andersen, Klaus Ejner; Larsen, E

1981-01-01

The pharmacokinetics of seven 8-MOP brands were evaluated in 7 volunteers using an incomplete bloc design. After a single oral dose the 8-MOP plasma level was followed for 3 hours. The plasma concentration was measured with a gas chromatographic - mass spectrometric method, using an isotopic...... dilution technique. The different brands could be divided into three groups. Two gave a high maximum concentration, four a medium, and one a low concentration. The large interbrand variation observed in this study can explain the variations in the results of the treatment and the differing numbers...

Morphology of the axial skeleton of seven bat genera (Chiroptera: Phyllostomidae

Directory of Open Access Journals (Sweden)

PABLO J. GAUDIOSO

2017-10-01

Full Text Available ABSTRACT Here we present detailed descriptions and comparisons of the axial skeleton of seven species of bats belonging to five subfamilies of Phyllostomidae of different trophic guilds. The material examined consisted of 34 complete skeletons of seven species. For five of the studied species, previous descriptions have not been conducted, and for the vampires only limited information is available, so that descriptions for these species are here completed. The axial skeleton has characters that allow grouping of the species phylogenetically of the same subfamily and by feeding habits. At the same time, there are characters that associate species from different subfamilies with different types of diet or ways to obtain food.

Twenty years of environmental opposition in the electric sector

International Nuclear Information System (INIS)

Molocchi, Andrea

1997-01-01

This article aims to provide a framework for analysing social opposition In Italy against the construction and management of electric power plants (nuclear and thermoelectric) and big electricity power lines in the past twenty years. First The author provide a history of social environmental opposition in the electric sector. This is followed by a typology of reason for opposition in terms of risk perception, which has been applied to about forty cases of social opposition against electric plants. This study an original experimental methodology which could also yield useful results when applied to other complex social phenomena. In the third phase of the study the author analyse the various roles of the social and institutional actors involved in the opposition, and the obstacles to future consensus building. The most interesting result of the study is the not only social but political nature opposition. This factor necessitates integration of the traditional individual risk perception approach with an approach which analyses political and social action of NGO's

76 FR 67498 - Post Office Closing

Science.gov (United States)

2011-11-01

... POSTAL REGULATORY COMMISSION [Docket No. A2012-17; Order No. 918] Post Office Closing AGENCY: Postal Regulatory Commission. ACTION: Notice. SUMMARY: This document informs the public that an appeal of the closing of the Venice, California post office has been filed. It identifies preliminary steps and...

Comparative evaluation of twenty pilot workload assessment measure using a psychomotor task in a moving base aircraft simulator

Science.gov (United States)

Connor, S. A.; Wierwille, W. W.

1983-01-01

A comparison of the sensitivity and intrusion of twenty pilot workload assessment techniques was conducted using a psychomotor loading task in a three degree of freedom moving base aircraft simulator. The twenty techniques included opinion measures, spare mental capacity measures, physiological measures, eye behavior measures, and primary task performance measures. The primary task was an instrument landing system (ILS) approach and landing. All measures were recorded between the outer marker and the middle marker on the approach. Three levels (low, medium, and high) of psychomotor load were obtained by the combined manipulation of windgust disturbance level and simulated aircraft pitch stability. Six instrument rated pilots participated in four seasons lasting approximately three hours each.

The evolution of magnetic structures due to open-quote open-quote magnetosonic streaming close-quote close-quote

International Nuclear Information System (INIS)

Ryutova, M.P.; Kaisig, M.; Tajima, T.

1996-01-01

The Faraday effect in gasdynamics called acoustic streaming and its accompanying nonlinear phenomena have analogies in plasma magnetohydrodynamics. A natural place where these effects may occur is the solar atmosphere with its strongly inhomogeneous magnetic fields concentrated in random magnetic flux tubes. Unlike acoustic streaming in the usual gasdynamics, nonlinear phenomena consisting in the generation of plasma flows by an oscillating magnetic flux tube, open-quote open-quote magnetosonic streaming close-quote close-quote (Ryutova 1986), is accompanied by a current drive and results in a specific evolution of magnetic structures: depending on the physical parameters of the medium a single magnetic flux tube may be either split into thinner flux tubes or dissolved diffusively into the ambient plasma. The effect of the open-quote open-quote magnetosonic streaming,close-quote close-quote on one hand, is an obvious candidate for the generation of mass flows at magnetic flux tubes sites, and on the other hand, it plays an essential role in the evolution of magnetic structures and ultimately may determine their lifetime. The theory of magnetosonic streaming is general and can be applied to other astrophysical objects that maintain oscillatory motions and contain structured magnetic fields or magnetic domains. We review analytical results and describe the origin of the magnetosonic streaming in magnetic flux tubes due to their interaction with acoustic waves. We study numerically the regime of the open-quote open-quote magnetosonic streaming close-quote close-quote corresponding to splitting of a magnetic flux tube. Our computer simulation supports and extends the analytical result. copyright 1996 The American Astronomical Society

Novel intron markers to study the phylogeny of closely related mammalian species

Directory of Open Access Journals (Sweden)

Castresana Jose

2010-11-01

Full Text Available Abstract Background Multilocus phylogenies can be used to infer the species tree of a group of closely related species. In species trees, the nodes represent the actual separation between species, thus providing essential information about their evolutionary history. In addition, multilocus phylogenies can help in analyses of species delimitation, gene flow and genetic differentiation within species. However, few adequate markers are available for such studies. Results In order to develop nuclear markers that can be useful in multilocus studies of mammals, we analyzed the mammalian genomes of human, chimpanzee, macaque, dog and cow. Rodents were excluded due to their unusual genomic features. Introns were extracted from the mammalian genomes because of their greater genetic variability and ease of amplification from the flanking exons. To an initial set of more than 10,000 one-to-one orthologous introns we applied several filters to select introns that belong to single-copy genes, show neutral evolutionary rates and have an adequate length for their amplification. This analysis led to a final list of 224 intron markers randomly distributed along the genome. To experimentally test their validity, we amplified twelve of these introns in a panel of six mammalian species. The result was that seven of these introns gave rise to a PCR band of the expected size in all species. In addition, we sequenced these bands and analyzed the accumulation of substitutions in these introns in five pairs of closely related species. The results showed that the estimated genetic distances in the five species pairs was quite variable among introns and that this divergence cannot be directly predicted from the overall intron divergence in mammals. Conclusions We have designed a new set of 224 nuclear introns with optimal features for the phylogeny of closely related mammalian species. A large proportion of the introns tested experimentally showed a perfect amplification

Three times twenty by twenty-twenty

International Nuclear Information System (INIS)

Heller, W.

2007-01-01

Under the German presidency, the European Council adopted a program of climate protection and energy policy on March 9, 2007. It contains these 3 objectives: (1) By 2020, greenhouse gas emissions in the EU will be reduced by at least 20 percent from their 1990 level. (2) The share of renewable energies in primary energy consumption in the EU will be raised to 20 percent by 2020. (3) To enhance energy efficiency, energy consumption in the EU is to be reduced by 20 percent relative to the forecasts for 2020. The reason given by the European Council for the ambitious energy efficiency goal is its conviction that, in addition to the considerable increase in renewables, a major improvement in energy efficiency will enhance the security of energy supply, attenuate the forecast rise in energy prices, and diminish greenhouse gas emissions. Nuclear power is mentioned only in passing and as a topic for national decisionmaking, which is absolutely unsatisfactory in the light of what nuclear power currently is, and could go on, contributing to the security of supply, the climate protection, and reasonably priced electricity supply. On the whole, the package of energy and environmental policy measures devised by the European Council may be termed ambitious. (orig.)

Twenty-One Genome Sequences from Pseudomonas Species and 19 Genome Sequences from Diverse Bacteria Isolated from the Rhizosphere and Endosphere of Populus deltoides

Energy Technology Data Exchange (ETDEWEB)

Brown, Steven D [ORNL; Utturkar, Sagar M [ORNL; Klingeman, Dawn Marie [ORNL; Johnson, Courtney M [ORNL; Martin, Stanton [ORNL; Land, Miriam L [ORNL; Lu, Tse-Yuan [ORNL; Schadt, Christopher Warren [ORNL; Doktycz, Mitchel John [ORNL; Pelletier, Dale A [ORNL

2012-01-01

To aid in the investigation of the Populus deltoides microbiome we generated draft genome sequences for twenty one Pseudomonas and twenty one other diverse bacteria isolated from Populus deltoides roots. Genome sequences for isolates similar to Acidovorax, Bradyrhizobium, Brevibacillus, Burkholderia, Caulobacter, Chryseobacterium, Flavobacterium, Herbaspirillum, Novosphingobium, Pantoea, Phyllobacterium, Polaromonas, Rhizobium, Sphingobium and Variovorax were generated.

Preparing Teacher-Students for Twenty-First-Century Learning Practices (PREP 21): A Framework for Enhancing Collaborative Problem-Solving and Strategic Learning Skills

Science.gov (United States)

Häkkinen, Päivi; Järvelä, Sanna; Mäkitalo-Siegl, Kati; Ahonen, Arto; Näykki, Piia; Valtonen, Teemu

2017-01-01

With regard to the growing interest in developing teacher education to match the twenty-first-century skills, while many assumptions have been made, there has been less theoretical elaboration and empirical research on this topic. The aim of this article is to present our pedagogical framework for the twenty-first-century learning practices in…

Closed Paths of Light Trapped in a Closed Fermat Curve

Science.gov (United States)

Dana-Picard, Thierry; Naiman, Aaron

2002-01-01

Geometric constructions have previously been shown that can be interpreted as rays of light trapped either in polygons or in conics, by successive reflections. The same question, trapping light in closed Fermat curves, is addressed here. Numerical methods are used to study the behaviour of the reflection points of a triangle when the degree of the…

Survey of siting practices for selected management projects in seven countries

International Nuclear Information System (INIS)

Hardin, E.; Aahagen, H.

1992-06-01

This paper surveys siting practices for deep geologic disposal in seven countries, and attempts to formulate generalizations which could be useful for the upcoming review of the Swedish plan for siting the SFL repository (R and D 92). Comparison of projects in different countries is done with full appreciation of the technical, legal, and cultural differences. The seven countries were selected for experience with siting in crystalline rock, similarity of siting practices to Sweden, and the availability of published information. Local governments have demonstrated effective veto power in each of the seven countries surveyed, although this power is exercised in different ways. This paper shows how the siting strategy itself affects the ability and the inclination of localities to block the project. It shows by example that public involvement, parallel vs. sequential characterization, schedule for siting activities, and the existence of interim waste storage capability have an impact on the success of siting. The focus of this paper is deep geologic disposal. Shallow land disposal and non-radioactive wastes are not discussed in detail, with three exceptions: LLW disposal siting in the U.S. and Canada, and the SAKAB incinerator projects in Sweden. These provide insight into siting approaches and demonstrate that conclusions regarding deep geologic disposal are supported by other experience. (114 refs.) (au)

Small bowel perforation without tumor recurrence after radiotherapy for cervical carcinoma: report of seven cases.

Science.gov (United States)

Yamashita, Hideomi; Nakagawa, Keiichi; Tago, Masao; Igaki, Hiroshi; Shiraishi, Kenshirou; Nakamura, Naoki; Sasano, Nakashi; Yamakawa, Sen; Ohtomo, Kuni

2006-04-01

We describe the clinical presentation, evaluation, management and outcome of patients experiencing small bowel perforation following radiation therapy for cervical cancer. A database consisting of 95 Japanese women with stage 0-4 A cervix cancer treated between 1991 and 2004 contained seven patients (7.4%) with small bowel perforation. The median age at the time of perforation was 72.5 years (range 62-78). The median time from completion of radiotherapy to perforation was 6 months (range 2-58). Surgery (one small bowel resection and anastomosis with diversion; six small bowel resection and anastomosis) was performed immediately in all seven patients. One of seven patients died of small bowel perforation (i.e. mortality rate was 14%). Bowel adhesion was detected during the operation in only three cases (43%). Signs of peritonitis were absent in six cases (86%). Severe abdominal pain was seen in all seven patients. The perforation site was ileum in all seven cases. In all patients, pathological changes were compatible with postirradiation injury of the gastrointestinal tract. The presenting complaints of patients with bowel perforation following radiotherapy vary, and signs of peritonitis may be absent. Emergency physicians must be alert for these complications in patients who have been treated with radiotherapy.

Seven Common Mistakes Solar Installers Make | Solar Research | NREL

Science.gov (United States)

stay in touch with customer Ted is that your past solar customers are arguably your best marketing , big data project led by NREL to understand why some customers go solar and why so many more don't have identified the seven most common mistakes that may be keeping customers away. 1. Not following up

NCBI nr-aa BLAST: CBRC-TBEL-01-1998 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1998 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-82 95% ...

NCBI nr-aa BLAST: CBRC-PTRO-19-0002 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-19-0002 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-163 93% ...

NCBI nr-aa BLAST: CBRC-PABE-26-0241 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-26-0241 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-120 66% ...

NCBI nr-aa BLAST: CBRC-CFAM-08-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-08-0013 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 3e-93 57% ...

NCBI nr-aa BLAST: CBRC-EEUR-01-0561 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-EEUR-01-0561 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-160 88% ...

NCBI nr-aa BLAST: CBRC-HSAP-21-0002 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-21-0002 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-165 94% ...

NCBI nr-aa BLAST: CBRC-BTAU-01-0320 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-0320 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-159 88% ...

NCBI nr-aa BLAST: CBRC-HSAP-18-0009 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-18-0009 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-154 90% ...

NCBI nr-aa BLAST: CBRC-OANA-01-0544 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OANA-01-0544 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-124 71% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-0496 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-0496 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-148 82% ...