The Antigerminative Activity of Twenty-Seven Monoterpenes
Directory of Open Access Journals (Sweden)
Laura De Martino
2010-09-01
Full Text Available Monoterpenes, the main constituents of essential oils, are known for their many biological activities. The present work studied the potential biological activity of twenty-seven monoterpenes, including monoterpene hydrocarbons and oxygenated ones, against seed germination and subsequent primary radicle growth of Raphanus sativus L. (radish and Lepidium sativum L. (garden cress, under laboratory conditions. The compounds, belonging to different chemical classes, showed different potency in affecting both parameters evaluated. The assayed compounds demonstrated a good inhibitory activity in a dose-dependent way. In general, radish seed is more sensitive than garden cress and its germination appeares more inhibited by alcohols; at the highest concentration tested, the more active substances were geraniol, borneol, (±-β-citronellol and α-terpineol. Geraniol and carvone inhibited, in a significant way, the germination of garden cress, at the highest concentration tested. Radicle elongation of two test species was inhibited mainly by alcohols and ketones. Carvone inhibited the radicle elongation of both seeds, at almost all concentrations assayed, while 1,8-cineole inhibited their radicle elongation at the lowest concentrations (10−5 M, 10−6 M.
Female and male life tables for seven wild primate species
Bronikowski, Anne M.; Cords, Marina; Alberts, Susan C.; Altmann, Jeanne; Brockman, Diane K.; Fedigan, Linda M.; Pusey, Anne; Stoinski, Tara; Strier, Karen B.; Morris, William F.
2016-01-01
We provide male and female census count data, age-specific survivorship, and female age-specific fertility estimates for populations of seven wild primates that have been continuously monitored for at least 29 years: sifaka (Propithecus verreauxi) in Madagascar; muriqui (Brachyteles hypoxanthus) in Brazil; capuchin (Cebus capucinus) in Costa Rica; baboon (Papio cynocephalus) and blue monkey (Cercopithecus mitis) in Kenya; chimpanzee (Pan troglodytes) in Tanzania; and gorilla (Gorilla beringei) in Rwanda. Using one-year age-class intervals, we computed point estimates of age-specific survival for both sexes. In all species, our survival estimates for the dispersing sex are affected by heavy censoring. We also calculated reproductive value, life expectancy, and mortality hazards for females. We used bootstrapping to place confidence intervals on life-table summary metrics (R0, the net reproductive rate; λ, the population growth rate; and G, the generation time). These data have high potential for reuse; they derive from continuous population monitoring of long-lived organisms and will be invaluable for addressing questions about comparative demography, primate conservation and human evolution. PMID:26928014
Tavares, Inês M; Laan, Ellen T M; Nobre, Pedro J
2017-06-01
Cognitive-affective factors contribute to female sexual dysfunctions, defined as clinically significant difficulties in the ability to respond sexually or to experience sexual pleasure. Automatic thoughts and affect presented during sexual activity are acknowledged as maintenance factors for these difficulties. However, there is a lack of studies on the influence of these cognitive-affective dimensions regarding female orgasm. To assess the role of automatic thoughts and affect during sexual activity in predicting female orgasm occurrence and to investigate the mediator role of these variables in the relation between sexual activity and orgasm occurrence. Nine hundred twenty-six sexually active heterosexual premenopausal women reported on frequency of sexual activities and frequency of orgasm occurrence, cognitive factors, and social desirability. Participants completed the Sexual Modes Questionnaire-Automatic Thoughts Subscale, the Positive and Negative Affect Schedule, and the Socially Desirable Response Set. Multiple linear regressions and mediation analyses were performed, controlling for the effect of covariates such as social desirability, sociodemographic and medical characteristics, and relationship factors. The main outcome measurement was orgasm frequency as predicted and mediated by automatic thoughts and affect experienced during sexual activities. The presence of failure thoughts and lack of erotic thoughts during sexual activity significantly and negatively predicted female orgasm, whereas positive affect experienced during sexual activity significantly and positively predicted female orgasm. Moreover, negative automatic thoughts and positive affect during sexual activity were found to mediate the relation between sexual activity and female orgasm occurrence. These data suggest that the cognitive aspects of sexual involvement are critical to enhancing female orgasm experience and can aid the development of strategies that contemplate the central role
Dantas, Galileu P S; Hamada, Neusa; Mendes, Humberto F
2016-05-30
Twenty two species of Stenochironomus Kieffer are known from Brazil, 19 of which occur in the Amazon region. In order to increase knowledge of the taxonomy of this genus in the Amazon region, collections were carried out in streams located in Presidente Figueiredo, Manaus and Itacoatiara municipalities, Amazonas State. Leaves and wood mined by Stenochironomus larvae were collected and transported to the laboratory where they were kept until adult emergence. Seven new species were found, one of which is described in the immature stages and as adults of both sexes (S. amazonicus sp. n.), one as immatures and adult male (S. liviae sp. n.), four as male and pupa (S. bare sp. n., S. figueiredoensis sp. n., S. gracilis sp. nov. and S. manauara sp. n.) and one only as male (S. suzanae sp. n.). Additionally, the female, pupa and larva of S. impendens Borkent, pupa and larva of S. jubatus Borkent, female and pupa of S. zonarius Borkent and female of S. palliaculeatus Borkent were described.
Portillo, Javier; Del Coso, Juan; Abián-Vicén, Javier
2017-12-01
Portillo, J, Del Coso, J, and Abián-Vicén, J. Effects of caffeine ingestion on skill performance during an international female rugby sevens competition. J Strength Cond Res 31(12): 3351-3357, 2017-The aim of this study was to establish the effects of a caffeine-containing energy drink on skills and technical performance during a match in female elite rugby sevens players. On 2 nonconsecutive days of a friendly tournament, 16 women from the Spanish national rugby sevens team (mean age = 23 ± 2 years) ingested 3 mg of caffeine per kilogram of body mass in the form of an energy drink or the same drink without caffeine (placebo drink). After 60 minutes for caffeine absorption, participants played 3 rugby sevens matches against another national team. Body impacts during the matches were assessed by triaxial accelerometers. The matches were videotaped, and each individual technical action was notated afterward by 2 experienced observers. In comparison with the placebo drink, the ingestion of the caffeinated energy drink increased the rate of body impacts in zone 1 (16.1 ± 4.9 vs. 20.8 ± 9.9 impacts/min, p rugby-specific technical actions during the games. In conclusion, the ingestion of 3 mg·kg of caffeine in the form of an energy drink increased the number of body impacts during a rugby sevens international competition which suggests a higher engagement of the players during the game. However, the caffeine ingestion did not influence the quality of the technical actions performed during the competition.
How packaging designs of cosmetics affect female consumers' purchasing behavior?
Liu, Yinuo
2011-01-01
The topic of the thesis is “How packaging designs of cosmetics affect female consumers’ purchasing behavior?” Its aim is to identify whether female consumers are attracted by packaging designs of cosmetics, and how packaging designs of cosmetics affect different female consumer groups. Research question is: “If packaging of cosmetics affects which cosmetics females prefer when they buy cosmetics? And if so, is this preferences related to age and income?” To answer this question, the author us...
Essien-Wood, Idara R.
Given the lack of literature on Undergraduate African American females in the sciences (UAAFS), this study sought to explicate their experiences at one large, predominantly White, Research I institution in the southwestern United States. In particular, the purpose of this study was to identify factors that affect the academic success and persistence of Black females in the natural and physical sciences. Data was collected via in-depth, semi-structured interviews with 15 Black female science majors. Findings from this study identified several supportive mechanisms for academic success: family, religion, teaching assistants and friends. Also identified were seven barriers to academic success: employment, lack of diversity, cultural dissonance, unwelcoming Research I environment, faculty, advisors, classmates, and lab groups. Further, an analysis of students' responses revealed numerous instances of racial and gender micro-aggressions. Recommendations are provided to address factors identified as affecting student academic success and persistence as well as a culture of micro-aggressive behavior.
Socio-Economic Affects of Floods on Female Teachers in Jampur (Pakistan)
Buzdar, Muhammad Ayub; Ali, Akhtar
2011-01-01
Women are major affected segment of society in any disaster in under developed countries. Floods of 2010, in Pakistan, affected more than 17 million people. Ultimately, it created several social, psychological and financial problems for affected females. The current paper aimed to study the socio-economic affects of floods on female teachers of…
Knowledge of Repetitions Range Affects Force Production in Trained Females
Directory of Open Access Journals (Sweden)
Israel Halperin, Saied J. Aboodarda, Fabien A. Basset, David G. Behm
2014-12-01
Full Text Available Most studies have examined pacing strategies with cyclical activities (running and cycling. It has been demonstrated that males employ different pacing strategies during repeated maximal voluntary contractions (MVCs dependent upon a known endpoint. Since different fatiguing mechanisms have been identified between the genders, it is not known if females use comparable pacing strategies. The purpose of this study was to examine if informing female subjects regarding the number of MVCs to perform would affect force and electromyography (EMG. Twenty well-trained females completed 3 fatiguing protocols in a randomized order. In the control condition participants were informed they would perform twelve MVCs and then actually completed twelve. In the unknown condition they were not told how many MVCs to perform but were stopped after twelve. In the deception condition they were initially informed to perform 6 MVCs, but after the 6th MVC they were asked to perform a few more MVCs and were stopped after twelve. During the first 6 MVCs, forces in the deception condition were greater compared to the unknown (p = 0.021, ES = 0.65, 5% and control (p = 0.022, ES = 0.42, 3% conditions. No differences were found between conditions in the last 6 MVCs. A main effect for repetitions showed force deficits during the first 6 MVCs (p = 0.000, ES = 1.81, 13% and last 6 MVCs (p = 0.05, ES = 0.34, 3%. No differences were found between conditions in biceps and triceps EMG. However, EMG decreased during the first 6 MVCs for biceps (p = 0.001, ES = 1.0, 14% and triceps (p = 0.001, ES = 0.76, 14% across conditions. No differences were found in the last 6 MVCs. The anticipation of performing fewer MVCs led to increased force, whereas no endpoint led to decreased force production.
O'Donnell, Shannon; Tavares, Francisco; McMaster, Daniel; Chambers, Samuel; Driller, Matthew
2018-01-01
The current study aimed to assess the validity and test-retest reliability of a linear position transducer when compared to a force plate through a counter-movement jump in female participants. Twenty-seven female recreational athletes (19 ± 2 years) performed three counter-movement jumps simultaneously using the linear position transducer and…
How Stereotypes Affect Current Collegiate Female Athletes' Athletic Experiences
James, Melissa
2017-01-01
Stereotype discrimination affects female athletes' athletic experiences. Studies have been conducted of former collegiate female athletes' perceptions of the lesbian stereotype found that they were discriminated against because of their sport participation. These limit the recalling of thoughts and experience from the female athletes' playing…
Gender factors affecting female labour input in the Nigerian ...
African Journals Online (AJOL)
Gender factors affecting female labour input in the Nigerian University system. ... which mostly affect women‟s job performance in the Nigerian university system. ... are essential in building a gender-friendly university work environment.
DOES GENDER IMPACT ON FEMALE DOCTORS' EXPERIENCES IN THE TRAINING AND PRACTICE OF SURGERY?
Umoetok, F; van Wyk, J; Madiba, T E
2017-06-01
Surgery has been a male-dominated speciality both in South Africa and abroad. This mixed methodology case study collected data from a purposive sample of female surgical registrars enrolled at one institution in South Africa. A self-administered questionnaire was used to explore whether or not female doctors perceived any benefits of being in a male-dominated specialty. It explored problems encountered due to gender, the participants' perceptions of the influence of gender on their surgical training, practice and challenges. Thirty-two female registrars participated in the study. The respondents were mainly South African (91%) and enrolled in seven surgical specialities. Twenty-seven (84%) respondents were satisfied with their practical training and skills development as surgeons. Twenty-four (75%) respondents had identified a mentor from the department and all respondents indicated that the gender of their mentor did not impact on the quality of their training. Seventeen (53%) respondents perceived having received differential treatment due to their gender and 25 (78.2%) thought that the gender of their mentor did not impact on the quality of the guidance in surgery. Challenges included physical threats to them as females from patients and disrespect, emotional threats and defaming statements from male registrars. Other challenges included time-constraints for family and academic work, poor work life balance and being treated differently due to their gender. Seventeen (53%) respondents would consider teaching in the Department of Surgery. Twenty-five respondents (78%) would recommended the specialty to young female students, as they were convinced that surgery had been the right choice for them. Seventeen respondents (53%) were also open to pursuing teaching posts in the Department of Surgery. Generally, females had positive perceptions of their training in Surgery. They expressed concern about finding a worklife balance. The gender of their mentor did not impact
Social isolation during puberty affects female sexual behavior in mice
Directory of Open Access Journals (Sweden)
Jasmina eKercmar
2014-09-01
Full Text Available Exposure to stress during puberty can lead to long-term behavioral alterations in adult rodents coincident with sex steroid hormone-dependent brain remodeling and reorganization. Social isolation is a stress for social animals like mice, but little is known about the effects of such stress during adolescence on later reproductive behaviors. The present study examined sexual behavior of ovariectomized, estradiol and progesterone primed female mice that were individually housed from 25 days of age until testing at approximately 95 days, or individually housed from day 25 until day 60 (during puberty, followed by housing in social groups. Mice in these isolated groups were compared to females that were group housed throughout the experiment. Receptive sexual behaviors of females and behaviors of stimulus males were recorded. Females housed in social groups displayed greater levels of receptive behaviors in comparison to both socially isolated groups. Namely, social females had higher lordosis quotients and more often displayed stronger lordosis postures in comparison to isolated females. No differences between female groups were observed in stimulus male sexual behavior suggesting that female ’attractiveness’ was not affected by their social isolation. Females housed in social groups had fewer cells containing immunoreactive estrogen receptor (ER α in the anteroventral periventricular nucleus (AVPV and in the ventromedial nucleus of the hypothalamus (VMH than both isolated groups. These results suggest that isolation during adolescence affects female sexual behavior and re-socialization for one month in adulthood is insufficient to rescue lordosis behavior from the effects of social isolation during the pubertal period.
Directory of Open Access Journals (Sweden)
Burcu Gülüm Tekin
2015-07-01
Full Text Available “The Pram” is the only horror story in Roddy Doyle’s collection The Deportees and Other Stories (2007. It is also unique in terms of its approach to Ireland’s multicultural scene in the twenty-first century. Doyle turns the other side of the coin and introduces a migrant caretaker (Alina, who loses her mind due to her employees’ (the O’Reilly family ill-treatment. As a reaction to their scornful attitude, Alina becomes a murderer. Set in the context of twenty-first century Dublin, “The Pram” contains various references to Celtic and Polish mythological female figures (in particular, the Old Hag of Beara and Boginka, which strengthen the thrilling, mythical elements in the plot. This paper aims to examine the characters’ negative attitude towards migrants in Ireland in the light of the racist discourse present in the story. Also, I will focus on the story’s female characters and discuss the handicaps of being a female migrant in Ireland. The parallels between the mythical female figures and the protagonist Alina will be another point to be analyzed. The argument of this paper is that Doyle does not always portray the positive outcomes of a multicultural society. On the contrary, he conveys the perspective of the incoming migrant. “The Pram” stages the obstacles that a female outsider may experience in Ireland and her subsequent transformation as a result of the racism she encounters there.
Farias Zuniga, Amanda M; Côté, Julie N
2017-06-01
The effects of performing a 90-minute computer task with a laptop versus a dual monitor desktop workstation were investigated in healthy young male and female adults. Work-related musculoskeletal disorders are common among computer (especially female) users. Laptops have surpassed desktop computer sales, and working with multiple monitors has also become popular. However, few studies have provided objective evidence on how they affect the musculoskeletal system in both genders. Twenty-seven healthy participants (mean age = 24.6 years; 13 males) completed a 90-minute computer task while using a laptop or dual monitor (DualMon) desktop. Electromyography (EMG) from eight upper body muscles and visual strain were measured throughout the task. Neck proprioception was tested before and after the computer task using a head-repositioning test. EMG amplitude (root mean square [RMS]), variability (coefficients of variation [CV]), and normalized mutual information (NMI) were computed. Visual strain ( p computer workstation designs.
Attentional and affective biases for attractive females emerge early in development.
Rennels, Jennifer Lynn; Verba, Stephanie Ann
2017-01-01
Predominant experience with females early in development results in infants developing an attractive, female-like facial representation that guides children's attention toward and affective preferences for attractive females. When combined with increased interest in the other sex at puberty, these early emerging biases might help explain the robust prosocial and financial biases men exhibit toward attractive women during adulthood.
Factors Affecting the Business Performance of Female Owned Enterprises in TRNC
Hatice Jenkins; Salih Katircioglu
2007-01-01
This study is the first empirical research on the performance of the Turkish Cypriot female entrepreneurs in North Cyprus. The research helps to identify the major factors affecting the performance of Turkish Cypriot female entrepreneurs both positively and negatively. Furthermore, it identifies the main causes of performance variations among the businesses owned by female entrepreneurs. A face to face survey method was utilized to collect primary data from two hundred female entrepreneurs an...
Tavares, Inês M.; Laan, Ellen T. M.; Nobre, Pedro J.
2017-01-01
Cognitive-affective factors contribute to female sexual dysfunctions, defined as clinically significant difficulties in the ability to respond sexually or to experience sexual pleasure. Automatic thoughts and affect presented during sexual activity are acknowledged as maintenance factors for these
Factors affecting sports participation among female students at ...
African Journals Online (AJOL)
The primary aim of this study was to examine factors affecting sport participation among resident and non- resident female students at Tshwane University of Technology (TUT), Pretoria, South Africa. The study targeted all students participating in 12 registered sports but due to the fact that only a limited number of the total ...
Norrie disease and exudative vitreoretinopathy in families with affected female carriers.
Shastry, B S; Hiraoka, M; Trese, D C; Trese, M T
1999-01-01
Norrie disease (ND) is a rare X-linked recessive disorder characterized by congenital blindness, which is often associated with sensorineural hearing loss and mental retardation. X-linked familial exudative vitreoretinopathy (FEVR) is a hereditary disorder characterized by an abnormality of the peripheral retina and is not associated with systemic diseases. X-linked recessive disorders generally do not affect females. Here we show that female carriers can be associated with manifestation of an X-linked disorder. A four-generation family with an affected female, and a history of congenital blindness and hearing loss, was identified through the pro-band. A second family, with a full-term female infant, was evaluated through ophthalmic examinations and found to exhibit ocular features, such as retinal folds, retinal detachment and peripheral exudates. Peripheral blood specimens were collected from several affected and unaffected family members. DNA was extracted and analyzed by single-strand conformation polymorphism (SSCP) following polymerase chain reaction (PCR) amplification of the exons of the Norrie disease gene. The amplified products were sequenced by the dideoxy chain termination method. In an X-linked four-generation family, a novel missense (A118D) mutation in the third exon of the Norrie disease gene, was identified. The mutation was transmitted through three generations and cosegregated with the disease. The affected maternal grandmother and the unaffected mother carried the same mutation in one of their alleles. In an unrelated sporadic family, a heterozygous missense mutation (C96Y) was identified in the third exon of the Norrie disease gene in an affected individual. Analysis of exon-1 and 2 of the Norrie disease gene did not reveal any additional sequence alterations in these families. The mutations were not detected in the unaffected family members and the 116 normal unrelated controls, suggesting that they are likely to be the pathogenic mutations
Group Positive Psychotherapy and Depression of Females Affected by Multiple Sclerosis
Directory of Open Access Journals (Sweden)
Tayebeh Khayatan
2014-12-01
Full Text Available Objectives: Multiple Sclerosis is one of the most important and prevalent central nervous system diseases, causing disorders such as depression among affected patients. Positive psychotherapy is also a new approach that can be effective in reducing the depression of these people. This study aims to investigate the efficiency of group positive psychotherapy for decreasing the depression among females affected by Multiple Sclerosis. Methods: A samples of 30 females affected by Multiple Sclerosis with mild to moderate depression were participated, and were divided into two groups, intervention and control. Both groups completed Beck Depression Inventory II (BDI-II at the beginning, he intervention group received six sessions of positive psychotherapy. After the intervention both group completed the questionnaire again. Data was analyzed by descriptive and inferential statistical methods. Results: The result demonstrated that, the decline of depression was more in the intervention group than the control group. Moreover in the intervention group than control group, there was obtained significant reduction in both sub-scales of Beck Depression Inventory II. Discussion: Results of this study indicated that group positive psychotherapy is effective in reducing the depression of females affected by Multiple Sclerosis. This treatment can be widely used in the caring centers for treatment of people affected by Multiple Sclerosis and this can be justified because of its low cost and good efficiency.
Umoetok, F; Van Wyk, J M; Madiba, T E
2017-09-01
Surgery has been identified as a male-dominated specialty in South Africa and abroad. This study explored how female registrars perceived the impact of gender on their training and practice of surgery. A self-administered questionnaire was used to explore whether females perceived any benefits to training in a male-dominated specialty, their choice of mentors and the challenges that they encountered during surgical training. Thirty-two female registrars participated in the study. The respondents were mainly South African (91%) and enrolled in seven surgical specialties. Twenty-seven (84%) respondents were satisfied with their training and skills development. Twenty-four (75%) respondents had a mentor from the department. Seventeen (53%) respondents perceived having received differential treatment due to their gender and 25 (78.2%) thought that the gender of their mentor did not impact on the quality of the guidance received in surgery. Challenges included physical threats to female respondents from patients and disrespect, emotional threats and defaming statements from male registrars. Additional challenges included time-constraints for family and academic work, poor work-life balance and being treated differently due to their gender. Seventeen (53%) respondents would consider teaching in the Department of Surgery. Generally, females had positive perceptions of their training in Surgery. They expressed concern about finding and maintaining a work-life balance. The gender of their mentor did not impact on the quality of the training but 'bullying' from male peers and selected supervisors occurred. Respondents will continue to recommend the specialty as a satisfying career to young female students.
Khan, Arif O; Aldahmesh, Mohammed A; Mohamed, Jawahir Y; Alkuraya, Fowzan S
2012-06-01
To correlate clinical examination with underlying genotype in asymptomatic females who are potential carriers of X-linked developmental cataract (Nance-Horan syndrome). An ophthalmologist blind to the pedigree performed comprehensive ophthalmic examination for 16 available family members (two affected and six asymptomatic females, five affected and three asymptomatic males). Facial features were also noted. Venous blood was collected for sequencing of the gene NHS. All seven affected family members had congenital or infantile cataract and facial dysmorphism (long face, bulbous nose, abnormal dentition). The six asymptomatic females ranged in age from 4-35 years old. Four had posterior Y-suture centered lens opacities; these four also exhibited the facial dysmorphism of the seven affected family members. The fifth asymptomatic girl had scattered fine punctate lens opacities (not centered on the Y-suture) while the sixth had clear lenses, and neither exhibited the facial dysmorphism. A novel NHS mutation (p.Lys744AsnfsX15 [c.2232delG]) was found in the seven patients with congenital or infantile cataract. This mutation was also present in the four asymptomatic girls with Y-centered lens opacities but not in the other two asymptomatic girls or in the three asymptomatic males (who had clear lenses). Lens opacities centered around the posterior Y-suture in the context of certain facial features were sensitive and specific clinical signs of carrier status for NHS mutation in asymptomatic females. Lens opacities that did not have this characteristic morphology in a suspected female carrier were not a carrier sign, even in the context of her affected family members.
Directory of Open Access Journals (Sweden)
Carlos Mello Moyano
2013-10-01
Full Text Available Despite the importance of personal values and self-concept to understand consumers’ motivation and its influence over an individual’s action system, few studies have analyzed their relationship with consumer behavior in emerging countries. As a means of expression, consumers use brands and products in order to communicate their self-concept and personal values to their reference group. This study seeks to shed light on the causality relationship among personal values, self-concept´s affective security dimension and female consumer behavior in retail environments in an emerging country, namely Brazil. To test the study’s hypotheses, confirmatory factor analysis and structural equation modeling were employed. The research sample consisted of 204 women who live in Brazil. The results reveal a significant relationship between personal values and women’s self-concept, especially on its affective security dimension. Self-concept also had significant influence on female consumers’ behavior. Seven of the eight hypotheses tested found support. Managerial implications of the findings are also discussed.
Directory of Open Access Journals (Sweden)
Salvatore Francesco Carbone
2014-01-01
Full Text Available Objectives. To assess the diagnostic performance of diffusion-weighted MR imaging (DWI in patients affected by prostatic fossa (PF relapse after radical prostatectomy (RP for prostatic carcinoma (PC. Methods. Twenty-seven patients showing a nodular lesion in the PF at T2-weighted MR imaging after RP, with diagnosis of PC relapse established by biopsy or PSA determinations, were investigated by DWI. Two readers evaluated the DWI results in consensus and the apparent diffusion coefficient (ADC of the nodules, separately; a mean value was obtained (ADCm. Results. Relapses did not significantly differ in size in respect of postsurgical benign nodules. The DWI qualitative evaluation showed sensitivity, specificity, accuracy, ppv, and npv values, respectively, of 83.3%, 88.9%, 85.2%, 93.7%, and 72.7% (100%, 87.5%, 95.6%, 93.7%, and 100%, for nodules >6 mm. The intraclass correlation coefficient (ICC for ADC evaluation between the two readers was 0.852 (95% CI 0.661–0.935; P=0.0001. The ADCm values for relapses and benign nodules were, respectively, 0.98±0.21×10−3 mm2/sec and 1.24±0.32×10−3 mm2/sec (P=0.006. Sensitivity, specificity, accuracy, ppv and npv of ADCm were, respectively, 77.8%, 88.9%, 81.8%, 93.3%, and 66.7% (93.3%, 87.5%, 85.4%, 93.3%, and 87.5% for nodules >6 mm. Conclusions. Diffusion-weighted MR imaging is a promising tool in the management of a hyperintense nodule detected by T2-weighted sequences. This might have a relevant importance in contouring radiotherapy treatment volumes.
Blunden, Pamela
2011-01-01
This thesis was submitted for the degree of Doctor of Philosophy and awarded by Brunel University. This thesis is a socio-cultural study of the development of female stand-up comedy in the first decade of the twenty-first century within a multi-racial and multi-cultural Britain. It also engages with the theory and practice of performance and asks the question: ‘In what ways can it be said that female stand-up comics perform the comic side of bodily abjection?’ This question is applied to t...
African Journals Online (AJOL)
User
to arrest customers comprised unfair and discriminatory practices”. ... Even in French feminist theatre of 1870 -1914, Doestoevsky's fiction and Malaysian and ..... called “sex workers”) are compelled to pay tax to the government on their income. .... When a politician sells out his principles, or simply throws them to the wind to.
Transitional Patterns of Adolescent Females in Non-Traditional Career Paths.
Ciccocioppo, Anna-Lisa; Stewin, Leonard L.; Madill, Helen M.; Montgomerie, T. Craig; Tovell, Dorothy R.; Armour, Margaret-Ann; Fitzsimmons, George W.
2002-01-01
Examines the factors that affected the career decision-making of adolescent females and young women in undergraduate science, engineering, and technology programs. Qualitative analysis was used to uncover seven themes: transition from high school, educational influences, family influences, academic issues, coursework management, gender issues, and…
Duggan, Louise Maria
2015-01-01
This article explores the use of qualitative research methods towards our understanding of the issues affecting female undergraduate engineers. As outlined in this article female engineering students face many challenges during their undergraduate studies. Qualitative research methods provide an opportunity to gain a deeper understanding of the…
Male irradiation affects female remating behavior in Anastrepha serpentina (Diptera: Tephritidae).
Landeta-Escamilla, Anais; Hernández, Emilio; Arredondo, José; Díaz-Fleischer, Francisco; Pérez-Staples, Diana
2016-02-01
Female remating in target pest species can affect the efficacy of control methods such as the Sterile Insect Technique (SIT) but very little is known about the postcopulatory mating behavior of these pests. In this study, we investigated the remating behavior of female Anastrepha serpentina (Diptera: Tephritidae), an oligophagous pest of Sapotaceae. First, we tested how long the sexual refractory period of females lasted after an initial mating. Second, we tested the effect of male and female sterility, female ovipositing opportunities and male density on female propensity to remate. Lastly, we tested if the amount of sperm stored by females was correlated to the likelihood of females to remate. We found that receptivity of mass-reared A. serpentina females had a bimodal response, with up to 16% of mass-reared A. serpentina females remating five days after the initial copulation, decreasing to 2% at 10 and 15 days and increasing to 13% after 20 days. Compared to fertile males, sterile males were less likely to mate and less likely to inhibit females from remating. Copula duration of sterile males was shorter compared to fertile males. Remating females were less likely to mate with a sterile male as a second mate. Sterile females were less likely to mate or remate compared to fertile females. Opportunity to oviposit and male density had no effect on female remating probability. Sperm numbers were not correlated with female likelihood to remate. Information on the post-copulatory behavior of mass-reared A. serpentina will aid fruit fly managers in improving the quality of sterile males. We discuss our results in terms of the differences this species presents in female remating behavior compared to other tephritids. Copyright © 2015 Elsevier Ltd. All rights reserved.
Sex therapy for female sexual dysfunction
2013-01-01
Introduction About 45% of women suffer from some form of sexual dysfunction. Despite its high prevalence, there are few studies that have systematically evaluated sex therapy in comparison with other interventions. Objective Review randomized clinical trials that present psychotherapeutic interventions for female sexual dysfunctions. Method Through a search in three databases (Medline, Web of Science and PsycInfo), 1419 references were found. After an analysis of the abstracts, twenty-seven articles met the inclusion criteria and composed this review. Results Sex therapy, as proposed by Masters and Johnson and Heiman and LoPiccolo, is still the most commonly used form of therapy for sexual dysfunctions; although it has shown results, the results do not consistently support that this is the best alternative in the treatment of sexual dysfunctions. Conclusion There is a lack of systematic study of many female sexual dysfunctions. Orgasmic disorder and sexual pain (vaginismus and dyspaurenia) are the most extensively studied disorders and those in which sex therapy seems to have better outcomes. PMID:24066697
DEFF Research Database (Denmark)
Prescott, Lotte; Eidemak, Inge; Harrison, Adrian Paul
2014-01-01
PURPOSE: This study aimed to compare sexual dysfunction in Danish female predialysis patients with chronic kidney disease (CKD) stage 4-5 with age-matched healthy women in Denmark. METHODS: Twenty-seven adult female predialysis patients (CKD stage 4-5 ~ creatinine clearance ≤ 30 ml/min) without.......1, respectively, p = 0.180). CONCLUSION: Sexual dysfunction was found to be more than two times as frequent in Danish female predialysis patients with CKD stage 4-5 compared to age- and gender-matched healthy controls, and this result emphasizes the need for attention towards sexual function in the treatment...... diagnosed depression and 54 randomly assigned healthy female controls completed the questionnaires Female Sexual Function Index, Female Sexual Distress Scale, and the Major Depression Inventory. RESULTS: Predialysis patients reported lower Female Sexual Function Index scores compared to the controls (14...
Global Feminism from Page to Stage: Teaching "Half the Sky" and "Seven"
Capo, Beth Widmaier
2012-01-01
The documentary play "Seven" is the collaboration of seven female playwrights with seven women activists connected in 2006 by the Vital Voices Global Partnership, a nonprofit nongovernmental organization supporting the development of female leaders (Vital). The stated mission of Vital Voices is to "identify, invest in and bring…
Social context-induced song variation affects female behavior and gene expression.
Directory of Open Access Journals (Sweden)
Sarah C Woolley
2008-03-01
caudomedial mesopallium (CMM was most affected by whether a song was directed or undirected, whereas the caudomedial nidopallium (NCM was most affected by whether a song was familiar or unfamiliar. Together these data demonstrate that females detect and prefer the features of directed song and suggest that high-level auditory areas including the CMM are involved in this social perception.
JENKINS, Hatice; KATIRCIOĞLU, Salih
2007-01-01
This study is the first empirical research on the performance of the Turkish Cypriot female entrepreneurs in North Cyprus. The research helps to identify the major factors affecting the performance of Turkish Cypriot female entrepreneurs both positively and negatively. Furthermore, it identifies the main causes of performance variations among the businesses owned by female entrepreneurs. A face to face survey method was utilized to collect primary data from two hundred female entrepreneurs an...
Iranian Female Language Learners' Listening Strategy Preferences in Multimedia Environment
Directory of Open Access Journals (Sweden)
Shabnam Talebi Eskandari
2016-11-01
Full Text Available Listening skill has been recently paid great attention comparing with the other three language skills since having communication is the first and most essential need. Language learners have been using the three different listening strategies (Cognitive, Meta-cognitive, and Socio-affective to improve their listening skills in multimedia environments in particular. The main focus of this study is to determine the most preferable listening strategies employed in improving listening skills in multimedia environment by female Iranian English language learners. To achieve the goals, thirty female English language learners – twenty to twenty five - out of sixty were selected. In order to collect data IELTS test as pre-test and post-test questionnaire and interview were used. The result indicated that these language learners mainly employed meta-cognitive strategies the most in the multimedia environment. Thus, it is implied that the findings would be beneficial to the classroom practice, guide learners and lecturers as well as syllabus planners and material designers
Iron Deficiency In Frequent And First Time Female Blood Donors ...
African Journals Online (AJOL)
Aim of the study: This study was conducted to evaluate the frequency of iron deficiency and relevant factors in frequent and first time female blood donors at Casablanca blood transfusion centre, Morocco. Methods: Between November 2005 and April 2006, twenty-one female first time and twenty-one frequent female blood ...
Sahin, Alpaslan; Gulacar, Ozcan; Stuessy, Carol
2015-12-01
Social cognitive theory guided the design of a survey to investigate high school students' perceptions of factors affecting their career contemplations and beliefs regarding the influence of their participation in the international Science Olympiad on their subject interests and twenty-first century skills. In addition, gender differences in students' choice of competition category were studied. Mixed methods analysis of survey returns from 172 Olympiad participants from 31 countries showed that students' career aspirations were affected most by their teachers, personal interests, and parents, respectively. Students also indicated that they believed that their participation in the Olympiad reinforced their plan to choose a science, technology, engineering, and mathematics (STEM) major at college and assisted them in developing and improving their twenty-first century skills. Furthermore, female students' responses indicated that their project choices were less likely to be in the engineering category and more likely to be in the environment or energy categories. Findings are discussed in the light of increasing the awareness of the role and importance of Science Olympiads in STEM career choice and finding ways to attract more female students into engineering careers.
Sexually transmitted bacteria affect female cloacal assemblages in a wild bird
White, Joël; Mirleau, Pascal; Danchin, Etienne; Mulard, Hervé; Hatch, Scott A.; Heeb, Phillipp; Wagner, Richard H.
2010-01-01
Sexual transmission is an important mode of disease propagation, yet its mechanisms remain largely unknown in wild populations. Birds comprise an important model for studying sexually transmitted microbes because their cloaca provides a potential for both gastrointestinal pathogens and endosymbionts to become incorporated into ejaculates. We experimentally demonstrate in a wild population of kittiwakes (Rissa tridactyla) that bacteria are transmitted during copulation and affect the composition and diversity of female bacterial communities. We used an anti-insemination device attached to males in combination with a molecular technique (automated ribosomal intergenic spacer analysis) that describes bacterial communities. After inseminations were experimentally blocked, the cloacal communities of mates became increasingly dissimilar. Moreover, female cloacal diversity decreased and the extinction of mate-shared bacteria increased, indicating that female cloacal assemblages revert to their pre-copulatory state and that the cloaca comprises a resilient microbial ecosystem.
Clarke, Anthea C; Anson, Judith M; Pyne, David B
2017-04-01
To inform recruitment, selection, training and testing of male and female rugby sevens players game running movement patterns and physical characteristics were quantified across junior, senior, and elite playing levels. Anthropometric and physical testing (40 m sprint, vertical jump, Yo-Yo IR1) occurred prior to players' national championships or international tournaments (n = 110 players), while game movements were obtained via GPS (n = 499 game files). The game movements of male players were similar across playing levels except for number of impacts >10 g which were 2 to 4-fold higher in elite (25.0 ± 11.2 impacts · game - 1 ; mean ± SD), than junior (6.3 ± 3.5) and senior (11.8 ± 6.6) players. In men, there were fewer substantial correlations between on- and off-field measures which may reflect similar physical attributes across playing levels, and that other (strength, technical or tactical) factors may better differentiate these players. In females, elite players had more favourable on- and off-field performance measures than juniors and seniors, with moderate to strong correlations between on- and off-field variables. Female players should benefit from additional fitness training, while male players need to balance fitness with other technical and tactical factors.
The impact of indigenous culture on female leadership in Pakistan
Directory of Open Access Journals (Sweden)
Shafta Manzoor
2015-12-01
Full Text Available Digging into the experiences of thirty working women, this study examined the barriers imposed by indigenous culture of Pakistan impose on these women. The study followed a qualitative research approach with phenomenological theoretical framework. Fifteen females were interviewed from urban areas and fifteen from rural areas to draw a holistic picture of indigenous culture of Pakistan and its effect on career progress of females. From the data collected, seven categories were initially developed through open coding, followed by three clusters through axial coding and lastly the study created a theoretical framework through selective coding. Findings of the study indicated that indigenous culture strongly affects the career success of working women in Pakistan. The study concluded that indigenous culture of Pakistan puts taboos on females in the form of family behavior, expectations, and the structurally enforced inferior status of females which affects their leadership skills negatively and restricts their career growth. The study concluded that indigenous culture affects career progress of females in negative way and although efforts have been done to give women equal rights in Pakistan, these efforts will become more meaningful if general perception of society about women and their role starts to change which will require awareness programs and cooperation from academic institutions and policy makers.
Karaoğlu, Pakize; Polat, Ayşe İpek; Yiş, Uluç; Hız, Semra
2015-01-01
Brain injuries occurring at a particular time may cause damages in well-defined regions of brain. Perinatal hypoxic ischemic encephalopathy and hypoglycemia are some of the most common types of brain injuries. Neonatal hypoglycemia can cause abnormal myelination in parietal and occipital lobes resulting in parieto-occipital encephalomalacia. There is a small number of studies about clinical and electroencephalographic (EEG) features of children with parieto-occipital encephalomalacia. They might have important neurologic sequelae such as cortical visual loss, seizures, and psychomotor retardation. We aimed to evaluate the causes of parieto-occipital encephalomalacia and evaluate the clinical and electrophysiological features of children with parieto-occipital encephalomalacia. We evaluated clinical features and EEGs of 27 children with parieto-occipital encephalomalacia. Descriptive statistics were used. Hospitalization during the neonatal period was the most common cause (88.9%) of parieto-occipital brain injury. Eleven patients (40.7%) had a history of neonatal hypoglycemia. Twenty-three patients (85.2%) had epilepsy and nine of the epileptic patients (39%) had refractory seizures. Most of the patients had bilateral (50%) epileptic discharges originating from temporal, parietal, and occipital lobes (56.2%). However, some patients had frontal sharp waves and some had continuous spike and wave discharges during sleep. Visual abnormalities were evident in 15 (55.6%) patients. Twenty-two (81.5%) had psychomotor retardation. Fine motor skills, social contact and language development were impaired more than gross motor skills. In our study, most of the patients with parieto-occipital encephalomalacia had an eventful perinatal history. Epilepsy, psychomotor retardation, and visual problems were common neurologic complications.
Neurodevelopmental and neurobehavioral characteristics in males and females with CDKL5 duplications.
Szafranski, Przemyslaw; Golla, Sailaja; Jin, Weihong; Fang, Ping; Hixson, Patricia; Matalon, Reuben; Kinney, Daniel; Bock, Hans-Georg; Craigen, William; Smith, Janice L; Bi, Weimin; Patel, Ankita; Wai Cheung, Sau; Bacino, Carlos A; Stankiewicz, Paweł
2015-07-01
Point mutations and genomic deletions of the CDKL5 (STK9) gene on chromosome Xp22 have been reported in patients with severe neurodevelopmental abnormalities, including Rett-like disorders. To date, only larger-sized (8-21 Mb) duplications harboring CDKL5 have been described. We report seven females and four males from seven unrelated families with CDKL5 duplications 540-935 kb in size. Three families of different ethnicities had identical 667kb duplications containing only the shorter CDKL5 isoform. Four affected boys, 8-14 years of age, and three affected girls, 6-8 years of age, manifested autistic behavior, developmental delay, language impairment, and hyperactivity. Of note, two boys and one girl had macrocephaly. Two carrier mothers of the affected boys reported a history of problems with learning and mathematics while at school. None of the patients had epilepsy. Similarly to CDKL5 mutations and deletions, the X-inactivation pattern in all six studied females was random. We hypothesize that the increased dosage of CDKL5 might have affected interactions of this kinase with its substrates, leading to perturbation of synaptic plasticity and learning, and resulting in autistic behavior, developmental and speech delay, hyperactivity, and macrocephaly.
The effect of a 1550 nm fractional erbium-glass laser in female pattern hair loss.
Lee, G-Y; Lee, S-J; Kim, W-S
2011-12-01
Female pattern hair loss (FPHL) is the most common cause of hair loss in women, and its prevalence increases with advancing age. Affected women may experience psychological distress and social withdrawal. A variety of laser and light sources have been tried for treatment of hair loss, and some success has been reported. The purpose of this study was to determine the efficacy and safety of a 1550 nm fractional erbium-glass laser in treatment of female pattern hair loss. Twenty eight ethnic South Korean patients with varying degrees of FPHL were enrolled in the study. Patients received ten treatments with a 1550 nm fractional Er:Glass Laser (Mosaic, Lutronic Co., Ltd, Seoul, South Korea) at 2-weeks intervals using the same parameters (5-10 mm tip, 6 mJ pulse energy, 800 spot/cm(2) density, static mode). Phototrichogram and global photographs were taken at baseline and at the end of laser treatment, and analysed for changes in hair density and hair shaft diameter. Global photographs underwent blinded review by three independent dermatologists using a 7-point scale. Patients also answered questionnaires assessing hair growth throughout the study. All adverse effects were reported during the study. Twenty seven patients completed a 5-month schedule of laser treatment. One patient was excluded during treatment due to occurrence of alopecia areata. At the initial visit, mean hair density was 100 ± 14/cm(2) , and mean hair thickness was 58 ± 12 μm. After 5 months of laser treatment, hair density showed a marked increase to 157 ± 28/cm(2) (P laser treatment; however, these resolved within 2 h. A 1550 nm fractional erbium-glass laser irradiation may be an effective and safe treatment option for women with female pattern hair loss. © 2011 The Authors. Journal of the European Academy of Dermatology and Venereology © 2011 European Academy of Dermatology and Venereology.
A different female partner does not affect the success of second vasectomy reversal.
Kim, Soo Woong; Ku, Ja Hyeon; Park, Kwanjin; Son, Hwancheol; Paick, Jae-Seung
2005-01-01
The aim of the study was to determine whether the pregnancy rate with the same female partner or younger partners was higher compared with different or older partners after undergoing repeated vasectomy reversal. A total of 44 patients were enrolled in the present study. The cause of reversal in patients with the same partner was the desire to have more children in 14 cases, the loss of a child in 7 cases, and the desire for a son in 7 cases. Patients were asked about pregnancy and childbirth during follow-up visits and by telephone or mail. Following microsurgical vasectomy reversal, patency was observed in 38 men (86.4%). Twenty-five of the couples (56.8%) achieved pregnancy without any artificial conception technique. We did not observe a significant difference in the pregnancy rate (57.1% vs 56.3%, P=.954) between patients with the same or a different female partner. In the multivariate model used, partner age was the only independent predictor for pregnancy. Patients with a partner less than 35 years old had a 4.1-fold greater chance (odds ratio, 4.13; 95% confidence interval, 1.06-16.10; P=.041) of pregnancy than those with a partner 35 years old or older. The area under the receiver operating characteristics curve for partner age was 73.0% (95% confidence interval 56.8-89.2, P=.011). Our findings suggest that repeat microsurgical vasectomy reversal still remains a reasonable choice for patients with different female partners. However, it should be considered that the likelihood of achieving pregnancy after repeat vasectomy reversal may decrease with advancing age of the female partner.
Maguire, Sarah E; Schmidt, Marc F; White, David J
2013-01-01
Social experiences can organize physiological, neural, and reproductive function, but there are few experimental preparations that allow one to study the effect individuals have in structuring their social environment. We examined the connections between mechanisms underlying individual behavior and social dynamics in flocks of brown-headed cowbirds (Molothrus ater). We conducted targeted inactivations of the neural song control system in female subjects. Playback tests revealed that the lesions affected females' song preferences: lesioned females were no longer selective for high quality conspecific song. Instead, they reacted to all cowbird songs vigorously. When lesioned females were introduced into mixed-sex captive flocks, they were less likely to form strong pair-bonds, and they no longer showed preferences for dominant males. This in turn created a cascade of effects through the groups. Social network analyses showed that the introduction of the lesioned females created instabilities in the social structure: males in the groups changed their dominance status and their courtship patterns, and even the competitive behavior of other female group-mates was affected. These results reveal that inactivation of the song control system in female cowbirds not only affects individual behavior, but also exerts widespread effects on the stability of the entire social system.
Does foraging behaviour affect female mate preferences and pair formation in captive zebra finches?
Directory of Open Access Journals (Sweden)
Neeltje J Boogert
Full Text Available BACKGROUND: Successful foraging is essential for survival and reproductive success. In many bird species, foraging is a learned behaviour. To cope with environmental change and survive periods in which regular foods are scarce, the ability to solve novel foraging problems by learning new foraging techniques can be crucial. Although females have been shown to prefer more efficient foragers, the effect of males' foraging techniques on female mate choice has never been studied. We tested whether females would prefer males showing the same learned foraging technique as they had been exposed to as juveniles, or whether females would prefer males that showed a complementary foraging technique. METHODOLOGY/PRINCIPAL FINDINGS: We first trained juvenile male and female zebra finches (Taeniopygia guttata to obtain a significant proportion of their food by one of two foraging techniques. We then tested whether females showed a preference for males with the same or the alternative technique. We found that neither a male's foraging technique nor his foraging performance affected the time females spent in his proximity in the mate-choice apparatus. We then released flocks of these finches into an aviary to investigate whether assortative pairing would be facilitated by birds taught the same technique exploiting the same habitat. Zebra finches trained as juveniles in a specific foraging technique maintained their foraging specialisation in the aviary as adults. However, pair formation and nest location were random with regard to foraging technique. CONCLUSIONS/SIGNIFICANCE: Our findings show that zebra finches can be successfully trained to be foraging specialists. However, the robust negative results of the conditions tested here suggest that learned foraging specializations do not affect mate choice or pair formation in our experimental context.
Carcinoma of female urethra. Manitoba experience: 1958-1987
International Nuclear Information System (INIS)
Hahn, P.; Krepart, G.; Malaker, K.
1991-01-01
Fourteen female patients with primary urethral carcinoma were treated at the Manitoba Cancer Foundation in the last twenty-nine years. The relationship of natural history to the stage, location, and therapeutic modality has been reviewed. A higher stage and length of urethral involvement affected prognosis negatively, whereas lower stage had a positive prognostic effect and location of tumor had no prognostic influence. Two patients with Stage C, who failed to received inguinal node radiotherapy, died of disease recurring in the inguinal area. Patients who received inguinal radiation (3 patients Stages B, C, and D1) had no regional recurrence. It is suggested that, for all female urethral carcinoma, bilateral ilioinguinal nodes be included in the radiation field. For radical treatment, iridium 192 insertion in combination with external beam treatment is recommended
DEFF Research Database (Denmark)
Johansson, Hanna Katarina Lilith; Hansen, J. S.; Elfving, B.
2017-01-01
response and inflammation in experimental animals, which may affect female reproduction. This proof-of-principle study therefore aimed to investigate if lung exposure by intratracheal instillation of the MWCNT NM-400 would affect the estrous cycle and reproductive function in female mice.Results: Estrous...... of irregular cycling after exposure. Our data indicates that MWCNT exposure may interfere with events leading to ovulation....
Chen, Bo-Jian; Liu, Kai; Zhou, Lin-Jun; Gomes-Silva, Guilherme; Sommer-Trembo, Carolin; Plath, Martin
2018-01-01
Consistent individual differences in behavioral tendencies (animal personality) can affect individual mate choice decisions. We asked whether personality traits affect male and female mate choice decisions similarly and whether potential personality effects are consistent across different mate choice situations. Using western mosquitofish (Gambusia affinis) as our study organism, we characterized focal individuals (males and females) twice for boldness, activity, and sociability/shoaling and found high and significant behavioral repeatability. Additionally, each focal individual was tested in two different dichotomous mate choice tests in which it could choose between computer-animated stimulus fish of the opposite sex that differed in body size and activity levels, respectively. Personality had different effects on female and male mate choice: females that were larger than average showed stronger preferences for large-bodied males with increasing levels of boldness/activity (i.e., towards more proactive personality types). Males that were larger than average and had higher shoaling tendencies showed stronger preferences for actively swimming females. Size-dependent effects of personality on the strength of preferences for distinct phenotypes of potential mating partners may reflect effects of age/experience (especially in females) and social dominance (especially in males). Previous studies found evidence for assortative mate choice based on personality types or hypothesized the existence of behavioral syndromes of individuals' choosiness across mate choice criteria, possibly including other personality traits. Our present study exemplifies that far more complex patterns of personality-dependent mate choice can emerge in natural systems.
Adewale, Osonuga Odusoga; Oduyemi, Osonuga Ifabunmi; Ayokunle, Osonuga
2014-01-01
Objective To determine the effect of graded doses of aqueous leaf extracts of Momordica charantia on fertility hormones of female albino rats. Methods Twenty adult, healthy, female Wistar rats were divided into four groups: low dose (LD), moderate dose (MD) and high dose (HD) groups which received 12.5 g, 25.0 g, 50.0 g of the leaf extract respectively and control group that was given with water ad libatum. Result Estrogen levels reduced by 6.40 nmol/L, 10.80 nmol/L and 28.00 nmol/L in the LD, MD and HD groups respectively while plasma progesterone of rats in the LD, MD and HD groups reduced by 24.20 nmol/L, 40.8 nmol/L and 59.20 nmol/L respectively. Conclusion Our study has shown that the antifertility effect of Momordica charantia is achieved in a dose dependent manner. Hence, cautious use of such medication should be advocated especially when managing couples for infertility. PMID:25183143
Soleman, Remi S; Staphorsius, A.S.; Cohen-Kettenis, Peggy T; Lambalk, Cornelis B; Veltman, Dick J; van Trotsenburg, M.A.A.; Hompes, Peter G A; Drent, M L; de Ronde, W P; Kreukels, Baudewijntje P C
Although the prevailing opinion is that emotional processes are influenced by sex hormones, the literature is still inconclusive. The aim of the current study was to examine the effects of gonadal suppression on brain activity during affective picture processing. Twenty-one female-to-male (FtM)
Does Ramadan Fasting Adversely Affect Cognitive Function in Young Females?
Directory of Open Access Journals (Sweden)
Mahboubeh Ghayour Najafabadi
2015-01-01
Full Text Available We examined the effects of Ramadan fasting on cognitive function in 17 female athletes. Data were obtained from participants of two fasting (n=9 and nonfasting (n=8 groups at three periods of the study (before Ramadan, at the third week in Ramadan, and after Ramadan. Digit span test (DST and Stroop color test were employed to assess short-term memory and inhibition/cognitive flexibility at each time point. There were no significant changes for DST and Stroop task 1 in both groups, whereas Stroop task 2 and task 3 showed significant improvements in Ramadan condition (p<0.05. Interference indices did not change significantly across the study except in post-Ramadan period of fasting group (p<0.05. Group × week interaction was significant only for error numbers (p<0.05. Athletes in nonfasting showed a significant decrease in number of errors in Ramadan compared to baseline (p<0.05. The results suggest that Ramadan fasting may not adversely affect cognitive function in female athletes.
Female brain size affects the assessment of male attractiveness during mate choice.
Corral-López, Alberto; Bloch, Natasha I; Kotrschal, Alexander; van der Bijl, Wouter; Buechel, Severine D; Mank, Judith E; Kolm, Niclas
2017-03-01
Mate choice decisions are central in sexual selection theory aimed to understand how sexual traits evolve and their role in evolutionary diversification. We test the hypothesis that brain size and cognitive ability are important for accurate assessment of partner quality and that variation in brain size and cognitive ability underlies variation in mate choice. We compared sexual preference in guppy female lines selected for divergence in relative brain size, which we have previously shown to have substantial differences in cognitive ability. In a dichotomous choice test, large-brained and wild-type females showed strong preference for males with color traits that predict attractiveness in this species. In contrast, small-brained females showed no preference for males with these traits. In-depth analysis of optomotor response to color cues and gene expression of key opsins in the eye revealed that the observed differences were not due to differences in visual perception of color, indicating that differences in the ability to process indicators of attractiveness are responsible. We thus provide the first experimental support that individual variation in brain size affects mate choice decisions and conclude that differences in cognitive ability may be an important underlying mechanism behind variation in female mate choice.
Regasa, Guta; Taha, Mukerem
2015-01-01
The objectives of the study were to assess the current status of the academic performance of females in grade seven and eight and to study how perception of parents affect the academic performance of female students in Kutto Sorfella Primary School, Sodo Zuria Woreda, SNNPR, Ethiopia. To achieve the objectives of this research both qualitative and…
International Nuclear Information System (INIS)
Sallam, H.A.; Hazaa, M.A.; Abd El-Rahman, H.A.; Hussein, M.A.
2000-01-01
Factors influencing sex pheromone production in the cotton leaf worm female moth with emphasis on gamma radiation were investigated. To determine the effect of age on sex pheromone production, ether extracts of the female abdominal tips were prepared from virgin females of various ages in a concentration of 0.01 FE/mu L. Each female extract was tested against 1-2 days-old males. The obtained results indicated that virgin females could secrete sex pheromone early at the beginning of their life. The pheromone production increased rapidly to reach its maximum on the second day. To study the effect of daytime on sex pheromone production, the ether extracts of 1-2 days old virgin female abdominal tips were prepared at 3 hour-intervals, throughout the photo phase and scotophase in a concentration of 0.01 FE/mu L. The obtained results indicated that pheromone production showed a minimum concentration at mid-day during the photo phase. It then increased to a moderate concentration from 7:0 p.m. to 10:0 p.m. and reached its maximum titer at almost mid-night. The obtained data on the effect of gamma irradiation indicated that irradiation of 3 and 6-day-old female pupae with doses of 60 and 120 Gy, respectively caused a reduction of 28.1 and 27.3 % in male response, respectively, to female sex pheromone extracts. When full-grown female pupae were irradiated with 200 and 350 Gy, a reduction of 15.6 and 75% in male response, respectively, was reached. Thus, an irradiation dose of 350 Gy applied to full-grown female pupae could severely affect pheromone production of the emerging female moths
DEFF Research Database (Denmark)
Randers, Morten Bredsgaard; Andersen, Lars Juel; Ørntoft, Christina Øyangen
2013-01-01
Abstract This study examined the intermittent exercise performance and cardiovascular health profile in elite female football players in comparison to untrained young women, as well as a subgroup subjected to football training 2x1 h · week(-1) for 16 weeks. Twenty-seven Danish national team players...... weeks of football training with 26 and 46% increases in TAPSE and E/A ratio, respectively, reaching levels comparable to ET. In summary, elite female football players have a superior cardiovascular health profile and intermittent exercise performance compared to untrained controls, but short...... (elite trained, ET) and 28 untrained women (UT) underwent dual-energy X-ray absorptiometry-scanning (DXA), comprehensive transthoracic echocardiography, treadmill and Yo-Yo Intermittent Endurance level 2 (IE2) testing. Eight women in UT were also tested after the football training period. Maximal oxygen...
2009-01-01
For the past two weeks, Bram Conjaerts, a Belgian filmmaker, has been touring the CERN sites and surrounding countryside conducting research for his new documentary. The film will follow the entire 27 Km length of the LHC ring, but unlike most documentaries about the LHC, it will take place mostly above ground! Bram Conjaerts during his visit to CERN.While working towards his film degree in 2008, Bram Conjaerts won an award at the International Documentary Festival for his documentary "Henri and the Islands", an anthropological documentary about the smallest village in Belgium. In an unlikely change of subject matter he decided to use the prize money to make a film about the LHC. "With the money granted by the Flemish government, I wanted to create a documentary about something adventurous and something that I did not know about, " explains Conjaerts. "I started doing research about the LHC and CERN and I came across the fantasy of...
Energy and protein requirements of weaned male and female Saanen goats.
Figueiredo, F O M; Leite, R F; St-Pierre, N R; Resende, K T; Almeida, A K; Souza, A P; Teixeira, I A M A
2017-10-01
The objective of this research was to estimate the energy and protein requirements for maintenance and growth in male (castrated and intact) and female Saanen goat kids between 15 and 30 kg BW. To determine the net energy requirements for maintenance (NE m ) and the net protein requirements for maintenance (NP m ), 75 goats (25 castrated and 26 intact males and 24 females) were used. Twenty-one goats (seven castrated and eight intact males and six females) were randomly assigned for slaughter to estimate the initial empty body composition. The 54 remaining animals (18 castrated and 18 intact males and 18 females) were randomly assigned in a split-plot design using a 3 × 3 factorial arrangement with three sexes and three levels of intake (ad libitum and restricted feed to 75% or 50% of the ad libitum intake). Within each sex, six blocks (three goats per block) were formed and one goat was randomly assigned to each level of intake. The 75% and the 50% of ad libitum rationing were determined daily, based on the DMI of the animal fed ad libitum on the previous day. All animals within block were slaughtered when the animal fed ad libitum reached 30 kg BW. The net energy requirements for gain (NE g ) and the net protein requirements for gain (NP g ) were obtained using 58 animals (20 castrated and 20 intact males and 18 females). The animals were fed ad libitum and slaughtered at targeted BW (15, 23 or 30 kg). Sex did not affect NE g and NP m (277.8 kJ/kg 0.75 BW day and 2.98 g CP/kg 0.75 BW day respectively), as well as NP g (180.9 ± 6.48 g/kg EBW gain) in Saanen goat kids. However, castrated males and females had similar NE g (varied from 12.6 ± 0.424 to 17.9 ± 1.38 MJ/kg EBW gain), greater than intact males (varied from 9.74 ± 0.420 to 10.7 ± 0.984 MJ/kg EBW gain), as the BW increased from 15 to 30 kg. Journal of Animal Physiology and Animal Nutrition © 2016 Blackwell Verlag GmbH.
Dominance rank causally affects personality and glucocorticoid regulation in female rhesus macaques
Kohn, Jordan N.; Snyder-Mackler, Noah; Barreiro, Luis B.; Johnson, Zachary P.; Tung, Jenny; Wilson, Mark E.
2017-01-01
Low social status is frequently associated with heightened exposure to social stressors and altered glucocorticoid regulation by the hypothalamic-pituitary-adrenal (HPA) axis. Additionally, personality differences can affect how individuals behave in response to social conditions, and thus may aggravate or protect against the effects of low status on HPA function. Disentangling the relative importance of personality from the effects of the social environment on the HPA axis has been challenging, since social status can predict aspects of behavior, and both can remain stable across the lifespan. To do so here, we studied an animal model of social status and social behavior, the rhesus macaque (Macaca mulatta). We performed two sequential experimental manipulations of dominance rank (i.e., social status) in 45 adult females, allowing us to characterize personality and glucocorticoid regulation (based on sensitivity to the exogenous glucocorticoid dexamethasone) in each individual while she occupied two different dominance ranks. We identified two behavioral characteristics, termed ‘social approachability’ and ‘boldness,’ which were highly social status-dependent. Social approachability and a third dimension, anxiousness, were also associated with cortisol dynamics in low status females, suggesting that behavioral tendencies may sensitize individuals to the effects of low status on HPA axis function. Finally, we found that improvements in dominance rank increased dexamethasone-induced acute cortisol suppression and glucocorticoid negative feedback. Our findings indicate that social status causally affects both behavioral tendencies and glucocorticoid regulation, and that some behavioral tendencies also independently affect cortisol levels, beyond the effects of rank. Together, they highlight the importance of considering personality and social status together when investigating their effects on HPA axis function. PMID:27639059
Sun, Chen; Adhikari, Koushik; Koppel, Kadri
2015-01-01
The objective of this study was to determine what factors female consumers valued more when they buy nail polish. Ninety-eight female consumers participated in a nail polish consumer study at the Sensory Analysis Center, Kansas State University. A questionnaire containing a check-all-that-apply (CATA) question, behavior questions and demographic questions was presented to each consumer. In the CATA question, the factors that may affect consumers’ decision to buy a nail polish were asked, incl...
Holm-Denoma, Jill; Smith, April; Waesche, Matthew
2014-09-01
The purpose of this study was to examine the effects of including female athletes' weights in athletic event programs on female spectators' body image, eating disorder symptoms, self-esteem, and affective state and to investigate whether the magnitude of the athletes' reported weights had differential effects on female spectators (i.e., do female spectators who view heavier athletes respond differently than those who view less heavy athletes?). We used an experimental design to examine hypotheses derived from competing theories to determine whether exposure to female athletes of varying weight would adversely or beneficially impact female undergraduates (N = 152) who served as athletic event spectators. Analyses indicated that in this simulated study, female spectators' body image, eating disorder symptoms, self-esteem, and affective states were not impacted by the presence or by the magnitude of female athletes' weights in athletic event programs. The results imply that including athletes' weights in game-day programs at women's athletic events does not affect female spectators on an individual level.
Female teachers' math anxiety affects girls' math achievement.
Beilock, Sian L; Gunderson, Elizabeth A; Ramirez, Gerardo; Levine, Susan C
2010-02-02
People's fear and anxiety about doing math--over and above actual math ability--can be an impediment to their math achievement. We show that when the math-anxious individuals are female elementary school teachers, their math anxiety carries negative consequences for the math achievement of their female students. Early elementary school teachers in the United States are almost exclusively female (>90%), and we provide evidence that these female teachers' anxieties relate to girls' math achievement via girls' beliefs about who is good at math. First- and second-grade female teachers completed measures of math anxiety. The math achievement of the students in these teachers' classrooms was also assessed. There was no relation between a teacher's math anxiety and her students' math achievement at the beginning of the school year. By the school year's end, however, the more anxious teachers were about math, the more likely girls (but not boys) were to endorse the commonly held stereotype that "boys are good at math, and girls are good at reading" and the lower these girls' math achievement. Indeed, by the end of the school year, girls who endorsed this stereotype had significantly worse math achievement than girls who did not and than boys overall. In early elementary school, where the teachers are almost all female, teachers' math anxiety carries consequences for girls' math achievement by influencing girls' beliefs about who is good at math.
Reproductive hormones disorders of Sudanese females using immunoradiometric assay (IRMA)
International Nuclear Information System (INIS)
Ali, N. I.; Almahi, W. A. A.; Abdalla, O. M.; Bafarag, S. M. I.; Abdelgadir, O. M.; Eltayeb, M. A. H.; Hassan, A. M. E.; Hassan, A. M. E.
2004-12-01
In this study fertility hormones were measured for 587 infertile Sudanese female referred from gynecological clinics. The ages of these female ranges from 16-50 years divided into seven groups. Eighty seven percent of them are in the age range between 21 and 40 year which correlate with the female's fertile period and 5.6% of them under 20 years. Sensitive (IRMA) method was used for measuring the hormone concentration. The objective of this study was to found out the percentage of hormonal disorders and its relation to the age in infertile Sudanese females. The age group (21-25) was the most affected group by the Poly Cystic Ovary Syndrome (PCOS) and represented 5.1% of the total number of patients. The least group was the age group (41-45) with a percentage of 0.4. The LH and the FSH in the age group of (31-35) was found to be higher than the other groups and represented 11.4% and 7.8% from the total number of patients respectively. The least percent of high level of LH and FSH was found to be in the most fertile age group (15-20) and it was 1.7% and 1.0% from the total number of studied patient, respectively. Those who were in the age range (26-30) with hyperprolactinaemia represented 10.4% of patients, while those with age rang (46-50) with hyperprolactinaemia represented the lowest percentage (1.2%). The percentage of patients having high LH and high FSH was 44.5% and 29.1% respectively, while the hyperprolactinaemia among the infertile Sudanese female was found to 38.2%.(Author)
Do (Female) Founders Influence (Female) Joiners to Become Founders too?
DEFF Research Database (Denmark)
Rocha, Vera; Van Praag, Mirjam
-founder (gender) homophily affects the likelihood of female and male joiners to become founders themselves. We find a relatively large and robust positive effect among female joiners that can be attributed to the role modeling function of female founders. Female entrepreneurs hiring personnel may thus have...
Evaluation of radiotherapy and chemotherapy treatment in patients of oral squamous cell carcinoma
International Nuclear Information System (INIS)
Sannomiya, Eduardo Kazuo; Medici Filho, Edmundo; Moraes, Luiz Cesar de; Castilho, Julio Cezar de Melo; Furukawa, Souhei
2003-01-01
We evaluated the effectiveness of radiotherapy combined with chemotherapy in patients with oral squamous cell carcinoma. Therefore, 1042 cases where reviewed in School Dentistry - Osaka Univ. Seven hundred and fifteen were male and three hundred and twenty-seven were female. Ora cancer was affected more male than female patients, with mean age of 582 years old. The tongue was the most common anatomic localization of oral cancer. In tongue, the use of external radiotherapy y combined with brachytherapy and brachytherapy isolated presented better results than chemotherapy combined with external radiotherapy. In buccal mucosa, there was not differences in the treatment's results using external radiotherapy and combined chemotherapy and external radiotherapy. In tongue's floor and upper and jaw gingiva the combined treatment with chemotherapy and external radiotherapy presented better results than isolated external radiotherapy. (author)
Reproductive Hormones Disorders Of Sudanese Infertile Females Using Immunoradiometric assay (IRMA)
International Nuclear Information System (INIS)
Ali, N. I.; Almahi, W. A. A.; Abdalla, O. M.; Bafarag, S. M. I.; Abdelgadir, O. M.; Eltayeb, M. A. H.; Hassan, A. M. E.; Hassan, A. M. E.
2004-01-01
In this study fertility hormones were measured for 587 infertile Sudanese female referred from gynecological clinics. The ages of these female ranges from 16 - 50 years divided into seven groups. Eighty seven percent of them are in the age range between 21 and 40 year which correlate with the female's fertile period and 5.6% of them under 20 years. Sensitive (IRMA) method was used for measuring the hormone concentration. The objective of this study was to found out the percentage of hormonal disorders and its relation to the age in infertile Sudanese females. The age group (21 - 25) was the most affected group by the Poly-Cystic Ovary Syndrome (PCOS) and represented 5.1% of the total number of patients. The least group was the age group (41- 45) with a percentage of 0.4. The LH and the FSH in the age group of (31- 35) was found to be higher than the other groups and represented 11.4% and 7.8% from the total number of patients respectively. The least percent of high level of LH and FSH was found to be in the most fertile age group (15 - 20) and it was 1.7% and 1.0% from the total number of studied patient, respectively. Those who were in the age range (26 - 30) with hyperprolactinemia represented 10.4% of patients, while those with age range (46 - 50) with hyperprolactinemia represented the lowest percentage (1.2%). The percentage of patients having high LH and high FSH was 44.5% and 29.1% respectively , while the hyperprolactinemia among the infertile Sudanese female was found to 38.2%. (Authors)
Biancalana, V.; Scheidecker, S.; Miguet, M.; Laquerriere, A.; Romero, N.B.; Stojkovic, T.; Neto, O. Abath; Mercier, S.; Voermans, N.C.; Tanner, L.; Rogers, C.; Ollagnon-Roman, E.; Roper, H.; Boutte, C.; Ben-Shachar, S.; Lornage, X.; Vasli, N.; Schaefer, E.; Laforet, P.; Pouget, J.; Moerman, A.; Pasquier, L.; Marcorelle, P.; Magot, A.; Kusters, B.; Streichenberger, N.; Tranchant, C.; Dondaine, N.; Schneider, R.; Gasnier, C.; Calmels, N.; Kremer, V.; Nguyen, K. Van; Perrier, J.; Kamsteeg, E.J.; Carlier, P.; Carlier, R.Y.; Thompson, J.; Boland, A.; Deleuze, J.F.; Fardeau, M.; Zanoteli, E.; Eymard, B.; Laporte, J.
2017-01-01
X-linked myotubular myopathy (XLMTM), a severe congenital myopathy, is caused by mutations in the MTM1 gene located on the X chromosome. A majority of affected males die in the early postnatal period, whereas female carriers are believed to be usually asymptomatic. Nevertheless, several affected
Directory of Open Access Journals (Sweden)
Chen Sun
2015-06-01
Full Text Available The objective of this study was to determine what factors female consumers valued more when they buy nail polish. Ninety-eight female consumers participated in a nail polish consumer study at the Sensory Analysis Center, Kansas State University. A questionnaire containing a check-all-that-apply (CATA question, behavior questions and demographic questions was presented to each consumer. In the CATA question, the factors that may affect consumers’ decision to buy a nail polish were asked, including both sensory and non-sensory factors. The frequency in percent for the factors was calculated. Sensory appeal, price and convenience of usage were the top factors that affected consumers’ buying decisions. Consumers valued sensory appeal and convenience of usage; this suggested that a nail polish company’s product development and advertising departments may want to focus on these two areas, primarily. The information presented in this study could help a nail polish company understand more about consumer segmentation and advertising strategy.
International Nuclear Information System (INIS)
Rudmann, S.V.
1986-01-01
Circulating blood platelets serve an important role in the physiological process of hemostasis. Physical exercise has been documented to result in alterations in many hemostatic parameters including platelet size, number and function. Most published research data support the hypotheses that both hemostasis and fibrinolysis become activated as a consequence of various levels of physical exercise. The purpose of this study was to determine the effect of twenty minutes aerobic exercise on platelet activation in vivo. Platelet activation in vivo is associated with the release of platelet granular contents. Platelet alpha granules contain two platelet specific proteins: platelet factor 4 (PF4) and beta-thromboglobulin (BTG). Elevated plasma levels of these proteins are a specific marker of in vivo platelet activation. Subjects were moderately trained female volunteers between the ages of 22 and 40 years. Subjects were exercised or twenty minutes on a bicycle ergometer at workloads that represented 65 to 75% of their functional capacity. Blood specimens were drawn within five minutes of exercise. Plasma samples from exercise and control subjects were assayed for PF4 and BTG using a sensitive competitive-binding radioimmunoassay procedure. The mean plasma levels of both proteins were significantly greater in the exercising subjects when compared with the non-exercising controls. Data from this study support the following research hypotheses: BTG plasma levels will be significantly higher in exercising subjects than in non-exercising controls, and PF4 plasma levels will be significantly higher in exercising subjects than in non-exercising controls
Coelho, Roberta R; de Souza Júnior, José Dijair Antonino; Firmino, Alexandre A P; de Macedo, Leonardo L P; Fonseca, Fernando C A; Terra, Walter R; Engler, Gilbert; de Almeida Engler, Janice; da Silva, Maria Cristina M; Grossi-de-Sa, Maria Fatima
2016-09-01
Vitellogenin (Vg), a yolk protein precursor, is the primary egg nutrient source involved in insect reproduction and embryo development. The Cotton Boll weevil (CBW) Anthonomus grandis Boheman, the most important cotton pest in Americas, accumulates large amounts of Vg during reproduction. However, the precise role of this protein during embryo development in this insect remains unknown. Herein, we investigated the effects of vitellogenin (AgraVg) knockdown on the egg-laying and egg viability in A. grandis females, and also characterized morphologically the unviable eggs. AgraVg transcripts were found during all developmental stages of A. grandis, with highest abundance in females. Silencing of AgraVg culminated in a significant reduction in transcript amount, around 90%. Despite this transcriptional reduction, egg-laying was not affected in dsRNA-treated females but almost 100% of the eggs lost their viability. Eggs from dsRNA-treated females showed aberrant embryos phenotype suggesting interference at different stages of embryonic development. Unlike for other insects, the AgraVg knockdown did not affect the egg-laying ability of A. grandis, but hampered A. grandis reproduction by perturbing embryo development. We concluded that the Vg protein is essential for A. grandis reproduction and a good candidate to bio-engineer the resistance against this devastating cotton pest.
Goodwin, Laura; Fairclough, Stephen H; Poole, Helen M
2013-06-01
Kolk et al.'s model of symptom perception underlines the effects of trait negative affect, selective attention and external stressors. The current study tested this model in 263 males and 498 females from an occupational sample. Trait negative affect was associated with symptom reporting in females only, and selective attention and psychological job demands were associated with symptom reporting in both genders. Health anxiety was associated with symptom reporting in males only. Future studies might consider the inclusion of selective attention, which was more strongly associated with symptom reporting than negative affect. Psychological job demands appear to influence symptom reporting in both males and females.
Akhtari-Zavare, Mehrnoosh; Lattif, Latiffah A; Juni, Muhamad Hanafiah; Md Said, Salmiah; Ismail, Irmi Zarina
2015-12-01
Breast cancer is the most common cancer among women worldwide, including Malaysia. In developing countries, predictors affecting breast self-examination (BSE) practice are different. This cross-sectional study was conducted to determine the prevalence of BSE practice and the predictors affecting BSE practice among undergraduate female students in Klang Valley, Malaysia. A cross-sectional study was conducted among 820 female undergraduate students to assess the BSE performance and related determinants of BSE practice in Klang Valley, Malaysia. Data were collected via a self-administered structured questionnaire that was developed for this study. The mean age of the respondents was 21.7 ± 1.2 years old. Most of them were single (96.8%), Malay (91.9%) and 19.6% of the participants performed BSE regularly. Multivariate logistic regression modeling revealed that BSE performance was more likely among women who have checked their breast with a doctor (odds ratio = 2.04, P = 0.00), and women who have personal history of breast disease (odds ratio = 4.43, P = 0.03). The findings showed a low BSE practice rate among young Malaysian women. Hence, the community's breast health awareness is needed to improve breast cancer prevention among young Malaysian women. © 2015 Japan Society of Obstetrics and Gynecology.
Directory of Open Access Journals (Sweden)
Qingkui Jiang
2015-06-01
Full Text Available The objective of this study was to determine whether nutrient digestibility and reproductive performance of pregnant mink (Neovison vison were affected by different dietary protein levels. One hundred and twenty female mink were randomly assigned to four groups, receiving diets of fresh material with different protein levels. The dietary protein levels, expressed as percentage of dry matter (DM, were 32, 36, 40 and 44% respectively. These values corresponded to average 320, 360, 400 and 440 g protein/kg DM, respectively. Results were as follows. All of crude protein digestibility, nitrogen (N intake, N retention increased along with dietary protein level increasing. Low protein level (32% significantly reduced the above indicators (P < 0.05. DM digestibility and ether extract digestibility were not affected by dietary protein level. Results of mated females, barren females, kids per litter, live born kids per mated female, birth survival rate, and birth weight showed that mink achieved optimal reproductive performance when dietary protein level was 36%. In conclusion, dietary protein was anticipated to significantly influence some nutrients' utilization. Adopting the appropriate dietary protein level allow better reproduction performance. The most preferable reproductive performance was achieved when diet contained 275.5 g digestible protein per kg DM for female mink in gestation.
The twenty-five maiden ladies' tomb and predicaments of the feminist movement in Taiwan
Lee, Anru; Tang, Wen-hui Anna
2010-01-01
“The Twenty-five Maiden Ladies’ Tomb” is the collective burial site of the female workers who died in a ferry accident on their way to work in 1973. The fact that of the more than 70 passengers on board all 25 who died were unmarried young women, and the taboo in Taiwanese culture that shuns unmarried female ghosts, made the Tomb a fearsome place. Feminists in Gaoxiong (高雄) had for some years wanted the city government to change the tomb’s public image....
Directory of Open Access Journals (Sweden)
P. Santhoshkumar
2016-09-01
Full Text Available Twenty seven road killed specimens of Plectrurus perrotetii were recorded in Emerald and its surrounding areas in the Nilgiris. Among the road kills, fourteen of them were females, seven were males and six are juveniles. Among the road kill female specimens of this species, it was observed that seven were gravid with fully developed young. Three to six developing young ones were observed
Coria-Avila, Genaro Alfonso; Paredes-Ramos, Pedro; Galán, Ricardo; Herrera-Covarrubias, Deissy; López-Meraz, Maria-Leonor
2014-05-01
Female sexual behavior is sensitive to stress and diseases. Some studies have shown that status epilepticus (SE) can affect sexual proceptivity and receptivity in female rats and also increases reject responses towards males. However, epidemiologic studies indicate that SE is more frequent in young individuals. Herein, we assessed the effects of SE in infant females on their sexual behavior during adulthood. Thirteen-day-old (P13) rat pups received intraperitoneal injections of lithium chloride (3 mEq/kg). Twenty hours later, at P14, SE was induced by subcutaneous injection of pilocarpine hydrochloride (100 mg/kg s.c.). Control animals were given an equal volume of saline subcutaneously. The animals were weaned at P21 and, later in adulthood, were ovariectomized and hormone-primed with estradiol+progesterone, and their sexual behavior assessed during 4 separate trials of 30 min each with a stud male. Our results indicate that proceptive behaviors (solicitations and hops and darts) were impaired during the first trial, but no alterations were observed for receptivity and attractivity. By trial 3, all SE females displayed normal proceptivity. These results indicate that SE in infancy readily affects proceptivity in a reversible manner. We discuss the role of sexual experience in recovery. Copyright © 2014 Elsevier Inc. All rights reserved.
Swartjes F; ECO
2003-01-01
Twenty scenarios, differing with respect to land use, soil type and contaminant, formed the basis for calculating human exposure from soil contaminants with the use of models contributed by seven European countries (one model per country). Here, the human exposures to children and children
Early twenty-first-century droughts during the warmest climate
Directory of Open Access Journals (Sweden)
Felix Kogan
2016-01-01
Full Text Available The first 13 years of the twenty-first century have begun with a series of widespread, long and intensive droughts around the world. Extreme and severe-to-extreme intensity droughts covered 2%–6% and 7%–16% of the world land, respectively, affecting environment, economies and humans. These droughts reduced agricultural production, leading to food shortages, human health deterioration, poverty, regional disturbances, population migration and death. This feature article is a travelogue of the twenty-first-century global and regional droughts during the warmest years of the past 100 years. These droughts were identified and monitored with the National Oceanic and Atmospheric Administration operational space technology, called vegetation health (VH, which has the longest period of observation and provides good data quality. The VH method was used for assessment of vegetation condition or health, including drought early detection and monitoring. The VH method is based on operational satellites data estimating both land surface greenness (NDVI and thermal conditions. The twenty-first-century droughts in the USA, Russia, Australia and Horn of Africa were intensive, long, covered large areas and caused huge losses in agricultural production, which affected food security and led to food riots in some countries. This research also investigates drought dynamics presenting no definite conclusion about drought intensification or/and expansion during the time of the warmest globe.
DEFF Research Database (Denmark)
Vinberg, Maj; Miskowiak, Kamilla; Kessing, Lars Vedel
2013-01-01
This study aims to investigate whether: familial history of affective disorder, subclinical depressive symptoms and life events (LEs) are predictive of a later development of mood disorder (onset). In a high-risk study, 234 healthy monozygotic and dizygotic twins with and without a co-twin history...... of affective disorder (high and low risk twins, respectively) were identified through nationwide registers and assessed from 2002 to 2005. Participants were followed longitudinally at 6-months intervals for up to nine years and finally reassessed with a personal interview to obtain information on whether...... they had an onset. During the follow-up period (mean time 7.0 years), 36 participants (15.4%) developed onset. Onset was significantly associated with risk status (Hazard ratio (HR) = 1.38, 95% CI 1.08-1.76), female sex, HR = 2.70, 95% CI 1.19-6.97, age HR = 0.97, 95% CI 0.93-0.99), and also with baseline...
Maruoka, Takashi; Kodomari, Ikuko; Yamauchi, Rena; Wada, Etsuko; Wada, Keiji
2009-04-17
The maternal environment is thought to be important for fetal brain development. However, the effects of maternal environment are not fully understood. Here, we investigated whether enrichment of the maternal environment can influence prenatal brain development and postnatal behaviors in mice. An enriched environment is a housing condition with several objects such as a running wheel, tube and ladder, which are thought to increase sensory, cognitive and motor stimulation in rodents compared with standard housing conditions. First, we measured the number of BrdU-positive cells in the hippocampal dentate gyrus of fetuses from pregnant dams housed in an enriched environment. Our results revealed that maternal enrichment influences cell proliferation in the hippocampus of female, but not male, fetuses. Second, we used the open-field test to investigate postnatal behaviors in the offspring of dams housed in the enriched environment during pregnancy. We found that maternal enrichment significantly affects the locomotor activity and time spent in the center of the open-field in female, but not male, offspring. These results indicate that maternal enrichment influences prenatal brain development and postnatal behaviors in female offspring.
International Nuclear Information System (INIS)
Bal, Chandrasekhar; Kumar, Ajay; Tripathi, Madhavi; Chandrashekar, Narayana; Phom, Hentok; Murali, Nadig R.; Chandra, Prem; Pant, Gauri S.
2005-01-01
Background: We tried to evaluate the female fertility and genetic risk to the offspring from the exposure to high-dose 131 I by assessing the pregnancy outcomes and health status of the children of female patients with differentiated thyroid cancer who had received therapeutic doses of 131 I. Materials and Methods: From 1967 to 2002, a total of 1,282 women had been treated with 131 I. Of these patients, 692 (54%) were in the reproductive age group (18-45 years). Forty women had a total of 50 pregnancies after high-dose 131 I. Age at presentation ranged from 16 to 36 years (mean, 23 ± 4 years). Histopathology was papillary thyroid cancer in 32 cases and follicular thyroid cancer in 8 cases. Results: Single high-dose therapy was given in 30 cases, 2 doses were given in 7 cases, 3 doses were given in 2 cases, and four doses were given in 1 case in which lung metastases had occurred. In 37 patients (92%), disease was successfully ablated before pregnancy. Ovarian absorbed-radiation dose calculated by the MIRD method ranged from 3.5 to 60 cGy (mean, 12 ± 11 cGy). The interval between 131 I therapy and pregnancy varied from 7 to 120 months (37.4 ± 28.2 months). Three spontaneous abortions occurred in 2 women. Forty-seven babies (20 females and 27 males) were born. Forty-four babies were healthy with normal birth weight and normal developmental milestones. Twenty women delivered their first baby after 131 I therapy. The youngest child in our series is 11 months of age, and the oldest is 8.5 years of age. Conclusions: Female fertility is not affected by high-dose radioiodine treatment, and the therapy does not appear to be associated with any genetic risks to the offspring
Energy Technology Data Exchange (ETDEWEB)
Sannomiya, Eduardo Kazuo [Universidade de Santo Amaro (UNISA), SP (Brazil). Faculdade de Odontologia. Dept. de Diagnostico e Cirurgia; Medici Filho, Edmundo; Moraes, Luiz Cesar de; Castilho, Julio Cezar de Melo [UNESP, Sao Jose dos Campos, SP (Brazil). Faculdade de Odontologia. Dept. de Cirurgia, Periodontia e Radiologia; Furukawa, Souhei [Osaka Univ. (Japan). Faculdade de Odontologia. Dept. de Radiologia e Radioterapia Buco-Maxilo-Facial
2003-12-01
We evaluated the effectiveness of radiotherapy combined with chemotherapy in patients with oral squamous cell carcinoma. Therefore, 1042 cases where reviewed in School Dentistry - Osaka Univ. Seven hundred and fifteen were male and three hundred and twenty-seven were female. Ora cancer was affected more male than female patients, with mean age of 582 years old. The tongue was the most common anatomic localization of oral cancer. In tongue, the use of external radiotherapy y combined with brachytherapy and brachytherapy isolated presented better results than chemotherapy combined with external radiotherapy. In buccal mucosa, there was not differences in the treatment's results using external radiotherapy and combined chemotherapy and external radiotherapy. In tongue's floor and upper and jaw gingiva the combined treatment with chemotherapy and external radiotherapy presented better results than isolated external radiotherapy. (author)
Early exposure to a low dose of bisphenol A affects socio-sexual behavior of juvenile female rats.
Porrini, Stefania; Belloni, Virginia; Della Seta, Daniele; Farabollini, Francesca; Giannelli, Giuletta; Dessì-Fulgheri, Francesco
2005-04-15
Play behavior is affected by alteration of the hormonal environment during development. In fact, congenital adrenal hyperplasia or early administration of diethylstilbestrol are able to modify female play behavior in mammals. In this research, play behavior of female rats was used to explore the effects of perinatal exposure to low, environmentally relevant dose of bisphenol A (BPA), a xenoestrogen widely diffused in the environment. We used 18 females born to mothers exposed to 40 microg/kg/day BPA during pregnancy and lactation, and 18 control females. The subjects were observed in a heterosexual social situation from 35 to 55 days of age. Six main behaviors were identified by principal component analysis (PCA): exploration, defensive behavior to males, play behavior with males, play behavior with females, low-intensity mating behavior, social grooming. Early administration of BPA was responsible for a significant increase of exploration (including social investigation) (pbehavior, but is able however to defeminize some aspects of female behavior. This result is compatible with the estrogenic properties of BPA, and suggests caution in the use of a chemical that, in the range of human exposure, is able to influence the development of the brain during a critical period, resulting in long-term effects on behavior.
Pramono, A.; Noriko, N.; Komara, S. B.
2017-04-01
Hypertension is more common in eldery female that triggered by diet and lifestyle changes. Bananas were not only useful for the food, but also for hypertension therapy and preserving life. Administration of bananas decreased blood pressure in hypertensive patients. This study aims to identify of factors that influenced by the administration of banana (Musa paradisiaca) on elderly female hypertensive patient. Twenty of eldery female patient were divided into 2 respondents group: control (11 patients) and treatment (9 patients). The treatment groups received banana twice a day during 2 weeks, but the control group didn’t. Here, we showed the administration of banana significantly decreased blood pressure on elderly female hypertensive patient (p = 0.00) in both systole and diastole. There was a significant decrease in sodium levels (p = 0.037) in the blood, but potassium levels remained the same. Erythrocyte sedimentation level (p = 0.136) and trombocyte count (p = 0.176) in treatment group, were not affected by banana administration. Taken together, banana administration on elderly female hypertensive patient decreased the blood pressure significantly, greatly affected by the natrium dischargement from the blood. Thus, our findings contribute to preliminary comprehension of banana effect on hypertension reduction.
Zhou, Shiyi; Da, Shu; Guo, Heng; Zhang, Xichao
2018-01-01
After the implementation of the universal two-child policy in 2016, more and more working women have found themselves caught in the dilemma of whether to raise a baby or be promoted, which exacerbates work–family conflicts among Chinese women. Few studies have examined the mediating effect of negative affect. The present study combined the conservation of resources model and affective events theory to examine the sequential mediating effect of negative affect and perceived stress in the relationship between work–family conflict and mental health. A valid sample of 351 full-time Chinese female employees was recruited in this study, and participants voluntarily answered online questionnaires. Pearson correlation analysis, structural equation modeling, and multiple mediation analysis were used to examine the relationships between work–family conflict, negative affect, perceived stress, and mental health in full-time female employees. We found that women’s perceptions of both work-to-family conflict and family-to-work conflict were significant negatively related to mental health. Additionally, the results showed that negative affect and perceived stress were negatively correlated with mental health. The 95% confidence intervals indicated the sequential mediating effect of negative affect and stress in the relationship between work–family conflict and mental health was significant, which supported the hypothesized sequential mediation model. The findings suggest that work–family conflicts affected the level of self-reported mental health, and this relationship functioned through the two sequential mediators of negative affect and perceived stress. PMID:29719522
Zhou, Shiyi; Da, Shu; Guo, Heng; Zhang, Xichao
2018-01-01
After the implementation of the universal two-child policy in 2016, more and more working women have found themselves caught in the dilemma of whether to raise a baby or be promoted, which exacerbates work-family conflicts among Chinese women. Few studies have examined the mediating effect of negative affect. The present study combined the conservation of resources model and affective events theory to examine the sequential mediating effect of negative affect and perceived stress in the relationship between work-family conflict and mental health. A valid sample of 351 full-time Chinese female employees was recruited in this study, and participants voluntarily answered online questionnaires. Pearson correlation analysis, structural equation modeling, and multiple mediation analysis were used to examine the relationships between work-family conflict, negative affect, perceived stress, and mental health in full-time female employees. We found that women's perceptions of both work-to-family conflict and family-to-work conflict were significant negatively related to mental health. Additionally, the results showed that negative affect and perceived stress were negatively correlated with mental health. The 95% confidence intervals indicated the sequential mediating effect of negative affect and stress in the relationship between work-family conflict and mental health was significant, which supported the hypothesized sequential mediation model. The findings suggest that work-family conflicts affected the level of self-reported mental health, and this relationship functioned through the two sequential mediators of negative affect and perceived stress.
Directory of Open Access Journals (Sweden)
Shiyi Zhou
2018-04-01
Full Text Available After the implementation of the universal two-child policy in 2016, more and more working women have found themselves caught in the dilemma of whether to raise a baby or be promoted, which exacerbates work–family conflicts among Chinese women. Few studies have examined the mediating effect of negative affect. The present study combined the conservation of resources model and affective events theory to examine the sequential mediating effect of negative affect and perceived stress in the relationship between work–family conflict and mental health. A valid sample of 351 full-time Chinese female employees was recruited in this study, and participants voluntarily answered online questionnaires. Pearson correlation analysis, structural equation modeling, and multiple mediation analysis were used to examine the relationships between work–family conflict, negative affect, perceived stress, and mental health in full-time female employees. We found that women’s perceptions of both work-to-family conflict and family-to-work conflict were significant negatively related to mental health. Additionally, the results showed that negative affect and perceived stress were negatively correlated with mental health. The 95% confidence intervals indicated the sequential mediating effect of negative affect and stress in the relationship between work–family conflict and mental health was significant, which supported the hypothesized sequential mediation model. The findings suggest that work–family conflicts affected the level of self-reported mental health, and this relationship functioned through the two sequential mediators of negative affect and perceived stress.
Imbornoni, Lauren; Price, Elinora T; Andrews, Jennifer; Meaney, F John; Ciafaloni, Emma; Cunniff, Christopher
2014-11-01
Manifestations of Duchenne and Becker muscular dystrophy (DBMD) are present in up to 40% of heterozygous females, but there are few reports of females who exhibit skeletal muscle symptoms in childhood. From the Muscular Dystrophy Surveillance Tracking and Research Network, a multi-site population-based surveillance network for dystrophinopathy, nine symptomatic female heterozygotes with onset of symptoms prior to age 9 years were identified. The median age at diagnosis was 8.3 years, and the median interval from first symptoms to diagnosis was 1.35 years. Of the nine female heterozygotes, four had a positive family history, seven had intellectual disability and five had at least one mental health disorder. Mental health concerns included attention deficit hyperactivity disorder (ADHD), autism spectrum features, bipolar disorder, and depression. The frequency of intellectual and mental health problems in this group is higher than previously reported for affected males and for symptomatic females. These findings may have implications for diagnosis of early manifesting heterozygotes and for their health supervision. © 2014 Wiley Periodicals, Inc.
New Korean Record of Twenty Eight Species of the Family Ichneumonidae (Hymenoptera
Directory of Open Access Journals (Sweden)
Choi, Jin-Kyung
2014-04-01
Full Text Available We report twenty eight ichneumonid species new to Korea. These species belong to seven subfamilies. Among them five subfamilies, Diacritinae Townes, 1965, Microleptinae Townes, 1958, Orthocentrinae F$\\ddot{o} $ 수식 이미지rster, 1869, Orthopelmatinae Schmiedeknecht, 1910, Phrudinae Townes and Townes, 1949, are newly introduced to Korean fauna. All specimens are based on the insect collection of animal systematic laboratory at the Yeungnam University Gyeongsan Campus. Photographs of habitus of newly recorded subfamilies, diagnosis of 28 species and host information are provided.
Nike Twins Seven Seven: Nigerian Batik Artist.
LaDuke, Betty
1987-01-01
Chronicles the personal and professional life of Nike Twins Seven Seven (born 1951), a Nigerian batik artist, and her husband, Twins Seven Seven, a musician-artist, both of whom have received international acclaim. (BJV)
Stafleu, A.; Graaf, de C.; Staveren, van W.A.; Burema, J.
2001-01-01
Fishbein and Ajzen's theory of reasoned action was used as a framework to study beliefs and attitudes towards twenty foods that contribute to fat intake in a Netherlands smaple population. Subjects between 18 and 75 years of age (n = 419, response rate 23€filled out a self-administered
Directory of Open Access Journals (Sweden)
Baohu Ji
2015-08-01
Research in context: Due to lack of biological markers, diagnosis and treatment of psychiatric disorders are subjective. There is utmost urgency to identify biomarkers for clinics, research, and drug development. We found that XIST and KDM5C gene expression may be used as a biological marker for diagnosis of major affective disorders in a significantly large subset of female patients from the general population. Our studies show that over-expression of XIST and some X-linked escapee genes may be a common mechanism for development of psychiatric disorders between the patients with rare genetic diseases (XXY or XXX and the general population of female psychiatric patients.
RT-PCR for detection of all seven genotypes of Lyssavirus genus.
Vázquez-Morón, S; Avellón, A; Echevarría, J E
2006-08-01
The Lyssavirus genus includes seven species or genotypes named 1-7. Rabies genotypes correlate with geographical distribution and specific hosts. Co-circulation of different lyssaviruses, imported cases, and the presence of unknown viruses, such as Aravan, Khujand, Irkut and West Caucasian Bat Virus, make it necessary to use generic methods able to detect all lyssaviruses. Primer sequences were chosen from conserved regions in all genotypes in order to optimise a generic RT-PCR. Serial dilutions of 12 RNA extracts from all seven Lyssavirus genotypes were examined to compare the sensitivity of the RT-PCR standardised in this study with a published RT-PCR optimised for EBLV1 detection and capable of amplifying RNA from all seven lyssaviruses. All seven genotypes were detected by both RT-PCRs, however, the sensitivity was higher with the new version of the test. Twenty samples submitted for rabies diagnosis were tested by the new RT-PCR. Eight out of 20 samples from six dogs, one horse and one bat were found positive, in agreement with immunofluorescence results. Seven samples from terrestrial mammals were genotype 1 and one from a bat was genotype 5. In conclusion, this method can be used to complement immunofluorescence for the diagnosis of rabies, enabling the detection of unexpected lyssaviruses during rabies surveillance.
An Empirical Comparison of Seven Iterative and Evolutionary Function Optimization Heuristics
Baluja, Shumeet
1995-01-01
This report is a repository of the results obtained from a large scale empirical comparison of seven iterative and evolution-based optimization heuristics. Twenty-seven static optimization problems, spanning six sets of problem classes which are commonly explored in genetic algorithm literature, are examined. The problem sets include job-shop scheduling, traveling salesman, knapsack, binpacking, neural network weight optimization, and standard numerical optimization. The search spaces in these problems range from 2368 to 22040. The results indicate that using genetic algorithms for the optimization of static functions does not yield a benefit, in terms of the final answer obtained, over simpler optimization heuristics. Descriptions of the algorithms tested and the encodings of the problems are described in detail for reproducibility.
International Nuclear Information System (INIS)
Carrijo da Silva Dias, D.; Leandro Bonifácio, R.; Augusto da Silva Alfenas, R.
2015-01-01
Female professional contributions in nuclear science and technology are no longer a novelty. Names such as Marie Curie, Chen Shiung Wu and Rosalyn Yalow are evidence of the incessant, worldwide efforts of women to take part in fields largely reserved for men. Although society has witnessed high level female achievements as early as in the 1800s, female scientists and technicians still face a long journey ahead in empowering themselves into full and equal participation in these areas. Today, the Laboratory of Poços de Caldas of the Brazilian Commission for Nuclear Energy (CNEN/LAPOC) experiences a process of women empowerment at all levels of the institution. At the Technical Section, two of the seven research departments are headed by female researchers who play essential roles in the institution’s quest for excellence. Today, their work include coordination of a major environmental research project involving most researchers at LAPOC, successful participations on international intercomparisons of radiometric analysis and development of new methodologies in nuclear field applications. At the administrative level, female collaborators lead the Administration Section, improving several aspects of internal management, promoting further interaction at the workplace and strengthening cooperation among all departments. Regarding the capacitation level, the Commission has a long tradition of welcoming students and junior researchers through institutional programmes of training and collaboration in several projects. Today CNEN/LAPOC works with twenty scholarship grantees — half of which are women. Not only the Laboratory has reached equality in participation, but unarguably the female participants have demonstrated the most remarkable achievements among the group, attested by their continuous academic pursuit through Master’s and Doctoral degrees, full collaboration in scientific publishing and attendance in training programmes at international level. The purpose
Hallonsten, Sofia
2016-01-01
Is it possible to cover an issue as a journalist to the extent that you are practically a human rights activist, and still contribute to its continuation by unconsciously upholding the values causing the issue? This study asks the question if journalists help or hinder the elimination of female genital mutilation (FGM), and puts forth the thesis that journalists as a collective in fact are affecting the development more negatively through their attitudes than positively through their actions....
Toscano, Sharyl E
2007-09-20
This paper describes the nature and characteristics of the dating relationships of adolescent females, including any of their experiences of abuse. A grounded theory approach was used with 22 theoretically sampled female adolescents ages 15-18. Several important themes emerged: Seven stages of dating consistently described the relationships of female adolescents. A circle consisting of two interacting same sex peer groups provided structure for each teen as they navigated the dating course. The circle was the central factor affecting a female adolescent's potential for risk or harm in dating relationships. Teens defined abuse as an act where the intention is to hurt. Having once succumbed to sexual pressure, teens felt unable to refuse sex in subsequent situations. An awareness of both the stages of dating and the dynamics of the circle will assist health care providers to plan and implement interventions in the female adolescent population. Study findings on factors and influences that support non-abusive versus abusive relationship might help identify female teens at risk and/or support interventions aimed at preventing dating violence.
Lean in and Lift up: Female Superintendents Share Their Career Path Choices
Kelsey, Cheryl; Allen, Kathy; Coke, Kelly; Ballard, Glenda
2014-01-01
The purpose of the research was to inform professional practice pertaining to the preparation of female administrators as future school superintendents. Twenty female superintendents in Texas were interviewed using a qualitative research approach. Strategies, career experiences and perception of barriers were identified using open-ended questions.…
Directory of Open Access Journals (Sweden)
Lang, Delia
2011-07-01
Full Text Available Objectives: African-American women are affected by disproportionately high rates of violence and sexually transmitted infections (STI/human immunodeficiency virus (HIV infection. It is imperative to address the intersection of these two urgent public health issues, particularly as these affect African-American adolescent girls. This study assessed the prevalence of rape victimization (RV among a sample of African-American adolescent females and examined the extent to which participants with a history of RV engage in STI/HIV associated risk behaviors over a 12-month time period.Methods: Three hundred sixty-seven African-American adolescent females ages 15-21, seeking sexual health services at three local teenager-oriented community health agencies in an urban area of the Southeastern United States, participated in this study. Participants were asked to complete an audio computer-assisted self-interview (ACASI at baseline, six- and 12-month follow-up. We assessed sociodemographics, history of RV and sexual practices. At baseline, participants indicating they had experienced forced sex were classified as having a history of RV.Results: Twenty-five percent of participants reported a history of RV at baseline. At six- and 12-months, victims of RV had significantly lower proportions of condom-protected sex (p=.008, higher frequency of sex while intoxicated (p=.005, more inconsistent condom use (p=.008, less condom use at last sex (p=.017, and more sex partners (p=.0001 than non-RV victims. Over the 12-month follow-up period, of those who did not report RV at baseline, 9.5% reported that they too had experienced RV at some point during the 12-month time frame.Conclusion: African-American adolescent females who experience RV are engaging in more risky sexual behaviors over time than non-RV girls, thereby placing themselves at higher risk for contracting STIs. In light of the results from this unique longitudinal study, we discuss considerations for
Gobinath, Aarthi R; Workman, Joanna L; Chow, Carmen; Lieblich, Stephanie E; Galea, Liisa A M
2016-02-01
Postpartum depression (PPD) affects approximately 15% of mothers, disrupts maternal care, and can represent a form of early life adversity for the developing offspring. Intriguingly, male and female offspring are differentially vulnerable to the effects of PPD. Antidepressants, such as fluoxetine, are commonly prescribed for treating PPD. However, fluoxetine can reach offspring via breast milk, raising serious concerns regarding the long-term consequences of infant exposure to fluoxetine. The goal of this study was to examine the long-term effects of maternal postpartum corticosterone (CORT, a model of postpartum stress/depression) and concurrent maternal postpartum fluoxetine on behavioral, endocrine, and neural measures in adult male and female offspring. Female Sprague-Dawley dams were treated daily with either CORT or oil and fluoxetine or saline from postnatal days 2-23, and offspring were weaned and left undisturbed until adulthood. Here we show that maternal postpartum fluoxetine increased anxiety-like behavior and impaired hypothalamic-pituitary-adrenal (HPA) axis negative feedback in adult male, but not female, offspring. Furthermore, maternal postpartum fluoxetine increased the density of immature neurons (doublecortin-expressing) in the hippocampus of adult male offspring but decreased the density of immature neurons in adult female offspring. Maternal postpartum CORT blunted HPA axis negative feedback in males and tended to increase density of immature neurons in males but decreased it in females. These results indicate that maternal postpartum CORT and fluoxetine can have long-lasting effects on anxiety-like behavior, HPA axis negative feedback, and adult hippocampal neurogenesis and that adult male and female offspring are differentially affected by these maternal manipulations. Copyright © 2015 Elsevier Ltd. All rights reserved.
Male and Female Secondary School EFL Teachers' Code ...
African Journals Online (AJOL)
This study explored male and female secondary school EFL teachers' attitudes, reasons and beliefs about the functions of code-switching to L1 (Amharic) in their classes. The participants of the study were all the available (38 male and 19 female) English language teachers in seven secondary schools in Bahir Dar City and ...
Directory of Open Access Journals (Sweden)
Kirsty Mhairi Ross
2016-11-01
Full Text Available Touch screen storybooks turn reading into an interactive multimedia experience, with hotspot-activated animations, sound effects, and games. Positive and negative effects of reading multimedia stories have been reported, but the underlying mechanisms which explain how children’s learning is affected remain uncertain. The present study examined the effect of storybook format (touch screen and print on story comprehension, and considered how level of touch screen interactivity (high and low and shared reading behaviors (cognitive and emotional scaffolding, emotional engagement might contribute to comprehension. Seven-year-olds (n = 22 were observed reading one touch screen storybook and one print storybook with their mothers. Story comprehension was inferior for the touch screen storybooks compared to the print versions. Touch screen interactivity had no significant effect on comprehension but did affect shared reading behaviors. The mother-child dyads spent less time talking about the story in the highly interactive touch screen condition, despite longer shared reading sessions because of touch screen interactions. Positive emotional engagement was greater for children and mothers in the highly interactive touch screen condition, due to additional positive emotions expressed during touch screen interactions. Negative emotional engagement was greater for children when reading and talking about the story in the highly interactive condition, and some mothers demonstrated negative emotional engagement with the touch screen activities. The less interactive touch screen storybook had little effect on shared reading behaviors, but mothers controlling behaviors were more frequent. Storybook format had no effect on the frequency of mothers’ cognitive scaffolding behaviors (comprehension questions, word help. Relationships between comprehension and shared reading behaviors were examined for each storybook, and length of the shared reading session and
Banya, Santonino K.
Chemistry is a human endeavor that relies on basic human qualities like creativity, insights, reasoning, and skills. It depends on habits of the mind: skepticism, tolerance of ambiguity, openness to new ideas, intellectual honesty, curiosity, and communication. Young female students begin studying chemistry curiosity; however, when unconvinced, they become skeptical. Researches focused on gender studies have indicated that attitudes toward science education differ between males and females. A declining interest in chemistry and the under representation of females in the chemical science was found (Jacobs, 2000). This study investigated whether self-confidence toward chemistry, the influence of role models, and knowledge about the usefulness of chemistry were affecting the attitudes toward chemistry, of 183 high school young females across the United States. The young female students surveyed, had studied chemistry for at least one year prior to participating in the study during the fall semester of 2003. The schools were randomly selected represented diverse economic backgrounds and geographical locations. Data were obtained using Chemistry Attitude Influencing Factors (CAIF) instrument and from interviews with a focus group of three young female students about the effect of self-confidence toward chemistry, the influence of role models, and knowledge about the usefulness of chemistry on their decision to study chemistry. The CAIF instrument consisted of a 12-items self-confidence questionnaire (ConfiS), 12-items each of the influence of role models (RoMoS) and knowledge about usefulness of chemistry (US) questionnaire. ConfiS was adopted (with permission) from CAEQ (Coll & Dalgety, 2001), and both RoMoS and US were modified from TOSRA (Fraser, 1978), public domain document. The three young female students interviewed, gave detailed responses about their opinions regarding self-confidence toward chemistry, the influence of role models, and knowledge about the
Directory of Open Access Journals (Sweden)
Lyes eDerouiche
2015-12-01
Full Text Available During development, environmental estrogens are able to induce an estrogen mimetic action that may interfere with endocrine and neuroendocrine systems. The present study investigated the effects on the reproductive function in female mice following developmental exposure to pharmaceutical ethinylestradiol (EE2, the most widespread and potent synthetic steroid present in aquatic environments. EE2 was administrated in drinking water at environmentally relevant (ENVIR or pharmacological (PHARMACO doses (0.1 and 1 µg/kg (body weight/day respectively, from embryonic day 10 until postnatal day 40. Our results show that both groups of EE2-exposed females had advanced vaginal opening and shorter estrus cycles, but a normal fertility rate compared to CONTROL females. The hypothalamic population of GnRH neurons was affected by EE2 exposure with a significant increase in the number of perikarya in the preoptic area of the PHARMACO group and a modification in their distribution in the ENVIR group, both associated with a marked decrease in GnRH fibers immunoreactivity in the median eminence. In EE2-exposed females, behavioral tests highlighted a disturbed maternal behavior, a higher lordosis response, a lack of discrimination between gonad-intact and castrated males in sexually experienced females, and an increased anxiety-related behavior. Altogether, these results put emphasis on the high sensitivity of sexually dimorphic behaviors and neuroendocrine circuits to disruptive effects of EDCs.
Regulatory focus affects physician risk tolerance.
Veazie, Peter J; McIntosh, Scott; Chapman, Benjamin P; Dolan, James G
2014-01-01
Risk tolerance is a source of variation in physician decision-making. This variation, if independent of clinical concerns, can result in mistaken utilization of health services. To address such problems, it will be helpful to identify nonclinical factors of risk tolerance, particularly those amendable to intervention-regulatory focus theory suggests such a factor. This study tested whether regulatory focus affects risk tolerance among primary care physicians. Twenty-seven primary care physicians were assigned to promotion-focused or prevention-focused manipulations and compared on the Risk Taking Attitudes in Medical Decision Making scale using a randomization test. Results provide evidence that physicians assigned to the promotion-focus manipulation adopted an attitude of greater risk tolerance than the physicians assigned to the prevention-focused manipulation (p = 0.01). The Cohen's d statistic was conventionally large at 0.92. Results imply that situational regulatory focus in primary care physicians affects risk tolerance and may thereby be a nonclinical source of practice variation. Results also provide marginal evidence that chronic regulatory focus is associated with risk tolerance (p = 0.05), but the mechanism remains unclear. Research and intervention targeting physician risk tolerance may benefit by considering situational regulatory focus as an explanatory factor.
Exploring the effect of sexual empowerment on sexual decision making in female adolescents.
Hsu, Hsiu-Yueh; Lien, Yu-Fen; Lou, Jiunn-Horng; Chen, Sheng-Hwang; Wang, Ruey-Hsia
2010-03-01
Traditional health education may not provide adequate sexual information to female adolescents. Sexual health education for female adolescents broadens opportunities for nurses to help female adolescents adopt appropriate sexual attitudes and make appropriate decisions. The purpose of this study was to understand the effect of sexual empowerment on sexual decision making in female adolescents. Twenty-nine female students with steady boyfriends were invited to participate in a sexual empowerment course. Course activities specifically related to sexual empowerment were audio-tape-recorded. Dialogue content was analyzed, and content provided by each study participant was reconfirmed in face-to-face interviews to understand the entire empowerment process in terms of how such may affect responses and to assess the possibility of correctly reinterpreting findings during the member check process. This study also took into consideration degrees of reliability and rigorousness. The four themes found to underlie participant perceptions of their sexual empowerment to make sex-related decisions were as follows: (a) proactively seeking sexual knowledge, (b) reexamining relationships with boyfriends, (c) the right to say "no" and to engage in self-protection, and (d) the need to change sexual attitudes and behaviors. Using the peer group intervention in sexual empowerment may positively impact sexual health decision making in adolescent girls. Nursing professionals may consider peer group intervention as a sexual empowering method in healthcare.
Mazerolle, Stephanie M; Eason, Christianne M; Ferraro, Elizabeth M; Goodman, Ashley
2015-02-01
Female athletic trainers (ATs) tend to depart the profession of athletic training after the age of 30. Factors influencing departure are theoretical. Professional demands, particularly at the collegiate level, have also been at the forefront of anecdotal discussion on departure factors. To understand the career and family intentions of female ATs employed in the collegiate setting. Qualitative study. National Collegiate Athletic Association Division I. Twenty-seven female ATs (single = 14, married with no children = 6, married with children = 7) employed in the National Collegiate Athletic Association Division I setting. All female ATs responded to a series of open-ended questions via reflective journaling. Data were analyzed via a general inductive approach. Trustworthiness was established by peer review, member interpretive review, and multiple-analyst triangulation. Our participants indicated a strong desire to focus on family or to start a family as part of their personal aspirations. Professionally, many female ATs were unsure of their longevity within the Division I collegiate setting or even the profession itself, with 2 main themes emerging as factors influencing decisions to depart: family planning persistence and family planning departure. Six female ATs planned to depart the profession entirely because of conflicts with motherhood and the role of the AT. Only 3 female ATs indicated a professional goal of persisting at the Division I setting regardless of their family or marital status, citing their ability to maintain work-life balance because of support networks. The remaining 17 female ATs planned to make a setting change to balance the roles of motherhood and AT because the Division I setting was not conducive to parenting. Our results substantiate those of previous researchers, which indicate the Division I setting can be problematic for female ATs and stimulate departure from the setting and even the profession.
Mazerolle, Stephanie M.; Eason, Christianne M.; Ferraro, Elizabeth M.; Goodman, Ashley
2015-01-01
Context: Female athletic trainers (ATs) tend to depart the profession of athletic training after the age of 30. Factors influencing departure are theoretical. Professional demands, particularly at the collegiate level, have also been at the forefront of anecdotal discussion on departure factors. Objective: To understand the career and family intentions of female ATs employed in the collegiate setting. Design: Qualitative study. Setting: National Collegiate Athletic Association Division I. Patients or Other Participants: Twenty-seven female ATs (single = 14, married with no children = 6, married with children = 7) employed in the National Collegiate Athletic Association Division I setting. Data Collection and Analysis: All female ATs responded to a series of open-ended questions via reflective journaling. Data were analyzed via a general inductive approach. Trustworthiness was established by peer review, member interpretive review, and multiple-analyst triangulation. Results: Our participants indicated a strong desire to focus on family or to start a family as part of their personal aspirations. Professionally, many female ATs were unsure of their longevity within the Division I collegiate setting or even the profession itself, with 2 main themes emerging as factors influencing decisions to depart: family planning persistence and family planning departure. Six female ATs planned to depart the profession entirely because of conflicts with motherhood and the role of the AT. Only 3 female ATs indicated a professional goal of persisting at the Division I setting regardless of their family or marital status, citing their ability to maintain work-life balance because of support networks. The remaining 17 female ATs planned to make a setting change to balance the roles of motherhood and AT because the Division I setting was not conducive to parenting. Conclusions: Our results substantiate those of previous researchers, which indicate the Division I setting can be
Reijgwart, Marsinah Lusanne; Vinke, C.M.; Hendriksen, C.F.M.; Van Der Meer, Miriam; Schoemaker, N.J.; van Zeeland, Y.R.A.
Knowledge of species-specific motivation and preferences for enrichment options is necessary to put in place an appropriate enrichment plan. This knowledge is currently lacking for ferrets. Therefore, seven female ferrets were consecutively housed in a seven-chamber closed economy consumer demand
DePesa, Natasha S; Cassisi, Jeffrey E
2017-09-01
Disgust has recently been implicated in the development and maintenance of female sexual dysfunction, yet most empirical studies have been conducted with a sexually healthy sample. The current study contributes to the literature by expanding the application of a disgust model of sexual functioning to a clinically relevant sample of women with low sexual desire/arousal and accompanying sexual distress. Young women (mean age = 19.12 years) with psychometrically defined sexual dysfunction (i.e., female sexual interest/arousal disorder [FSIAD] group) and a healthy control group were compared in their affective (i.e., facial electromyography [EMG] and self-report) and autonomic (i.e., heart rate and electrodermal activity) responses to disgusting, erotic, positive, and neutral images. Significant differences were predicted in responses to erotic images only. Specifically, it was hypothesized that the FSIAD group would display affective and autonomic responses consistent with a disgust response, while responses from the control group would align with a general appetitive response. Results largely supported study hypotheses. The FSIAD group displayed significantly greater negative facial affect, reported more subjective disgust, and recorded greater heart rate deceleration than the control group in response to erotic stimuli. Greater subjective disgust response corresponded with more sexual avoidance behavior. Planned follow-up analyses explored correlates of subjective disgust responses.
Hassanien, Intisar T E; Grötzner, Manuela; Meyering-Vos, Martina; Hoffmann, Klaus H
2014-07-01
In the polyandric moth, Spodopterafrugiperda, juvenile hormone (JH) is transferred from the male accessory reproductive glands (AG) to the female bursa copulatrix (BC) during copulation (see Hassanien et al., 2014). Here we used the RNA interference technique to study the role of allatoregulating neuropeptides in controlling the synthesis and transfer of JH during mating. Knockdown of S. frugiperda allatostatin C (Spofr-AS type C) in freshly emerged males leads to an accumulation of JH in the AG beyond that in the control and mating results in a higher transport of JH I and JH II into the female BC. Knockdown of S. frugiperda allatotropin 2 (Spofr-AT2) significantly reduces the amount of JH in the AG as well as its transfer into the female BC during copulation. Knockdown of S. frugiperda allatostatin A (Spofr-AS type A) and S. frugiperda allatotropin (Spofr-AT; Hassanien et al., 2014) only slightly affects the accumulation of JH in the AG and its transfer from the male to the female. We conclude that Spofr-AS type C and Spofr-AT2 act as true allatostatin and true allatotropin, respectively, on the synthesis of JH I and JH II in the male AG. Moreover, both peptides seem to control the synthesis of JH III in the corpora allata of adult males and its release into the hemolymph. Copyright © 2014 Elsevier Ltd. All rights reserved.
Energetics and sugar-feeding of field-collected anopheline females.
Holliday-Hanson, M L; Yuval, B; Washino, R K
1997-06-01
We studied the relationship between nutritional reserves and blood-feeding and sugar-feeding of Anopheles freeborni (Diptera: Culicidae) females in the field. In particular we determined whether (1) females feed on nectar before maturing eggs and initiating host-seeking and (2) the energy reserves of host-seeking females differ from those of non-fed resting females. Twenty-three percent of host-seeking females and 94 percent of gravid females were positive for nectar sugars (containing > 20 micrograms of fructose) versus 55 percent of empty (no blood or eggs) females collected in the morning and 36 percent of empty females collected in the evening. In addition, gravid females contained significantly more calories of nectar than empty, blood-fed, or partially blood-fed females collected in the morning. When the energy reserves of host-seeking and resting females were compared, no differences were found in lipid, trehalose, or glycogen. However, empty females collected in the evening contained more glycogen than empty females collected in the morning. We conclude that gravid females frequently feed on nectar and that fructose is metabolized into glycogen during the day.
Roles of Female and Male Genotype in Post-Mating Responses in Drosophila melanogaster.
Delbare, Sofie Y N; Chow, Clement Y; Wolfner, Mariana F; Clark, Andrew G
2017-10-30
Mating induces a multitude of changes in female behavior, physiology, and gene expression. Interactions between female and male genotype lead to variation in post-mating phenotypes and reproductive success. So far, few female molecules responsible for these interactions have been identified. Here, we used Drosophila melanogaster from 5 geographically dispersed populations to investigate such female × male genotypic interactions at the female transcriptomic and phenotypic levels. Females from each line were singly-mated to males from the same 5 lines, for a total of 25 combinations. Reproductive output and refractoriness to re-mating were assayed in females from the 25 mating combinations. Female × male genotypic interactions resulted in significant differences in these post-mating phenotypes. To assess whether female × male genotypic interactions affect the female post-mating transcriptome, next-generation RNA sequencing was performed on virgin and mated females at 5 to 6 h post-mating. Seventy-seven genes showed strong variation in mating-induced expression changes in a female × male genotype-dependent manner. These genes were enriched for immune response and odorant-binding functions, and for expression exclusively in the head. Strikingly, variation in post-mating transcript levels of a gene encoding a spermathecal endopeptidase was correlated with short-term egg production. The transcriptional variation found in specific functional classes of genes might be a read-out of female × male compatibility at a molecular level. Understanding the roles these genes play in the female post-mating response will be crucial to better understand the evolution of post-mating responses and related conflicts between the sexes. © The American Genetic Association 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
International Nuclear Information System (INIS)
Hall, D.A.; Yoder, I.
1984-01-01
Infertility, defined as 1 year of unprotected intercourse without conception, is becoming of increasingly important medical concern. Fertility in both the male and the female is at its peak in the twenties. Many couples today have postponed marriage and/or childbearing into their 30s until careers are established, but at that point fertility may be diminished. The current epidemic of venereal disease has been associated with an increasing incidence of tubal scarring. In addition, the use of intrauterine devices (IUDs) and birth control pills for contraception have let to later problems with pelvic inflammatory disease (PID) and ovulation disturbances. The problem of infertility intensifies as the number of babies available for adoption decreases. Therefore, it is estimated that approximately 10-20% of couples will eventually seek medical attention for an infertility-related problem. Fortunately, marked improvements in the results of tubal surgery are concurrently occurring secondary to refinements in microsurgical techniques, and many medical alternatives to induce ovulation are being developed. The male factor causes infertility in 30-40 % of couples, and the female factor is responsible in approximately 50% of couples. No cause is found in 10-20% of couples. This chapter discusses the role of coordinated imaging in the diagnosis and therapy of infertility in the female
Practice Patterns and Job Satisfaction of Mohs Surgeons.
Kohli, Nita; Golda, Nicholas
2018-01-01
There is a paucity of data on Mohs surgery workforce patterns. To identify if gender differences exist in practice patterns of Mohs surgeons, factors that influence these differences, and factors influencing job satisfaction among Mohs surgeons. An electronic survey was distributed to dermatology organizations targeting members of the American College of Mohs Surgery (ACMS), from October 2015 to April 2016. Two hundred twenty-seven ACMS members responded; 37% were women. Twenty-five percent of women and 19% of men work part time. Thirty-seven percent of women practice in academia versus 22% of men. Forty-three percent of women and 23% of men identified children as a factor affecting their ability to work full time. Gender comparisons for current job satisfaction show 57% of men and 35% of women being very satisfied. Supervision/feedback/recognition adds to satisfaction at a higher rate for women (53%) than for men (29%). For both genders combined, work content, patient base, and autonomy had the highest average job satisfaction ratings. Gender differences exist in practice patterns and job satisfaction of Mohs surgeons. This study demonstrates factors that could influence job satisfaction among female Mohs surgeons-knowledge that is important to individuals who lead, mentor, or supervise female Mohs surgeons.
Factors Affecting Drug Abuse in Adolescent Females in Rural Communities
Renes, Susan L.; Strange, Anthony T.
2009-01-01
This article explores factors influencing adolescent female substance use in rural communities. Self-reported data gathered from females 12 to 15 years of age in two northwestern communities in the United States showed an association among gender identity, peer and parental relationships, and substance use. Aggressive masculinity had the strongest…
Eason, Christianne M.; Mazerolle, Stephanie M.; Goodman, Ashley
2014-01-01
Context: One of the greatest catalysts for turnover among female athletic trainers (ATs) is motherhood, especially if employed at the National Collegiate Athletic Association Division I level. The medical education literature regularly identifies the importance of role models in professional character formation. However, few researchers have examined the responsibility of mentorship and professional role models as it relates to female ATs' perceptions of motherhood and retention. Objective: To evaluate perceptions of motherhood and retention in relation to mentorship and role models among female ATs currently employed in the collegiate setting. Design: Qualitative study. Setting: Female athletic trainers working in National Collegiate Athletic Association Division I. Patients or Other Participants: Twenty-seven female ATs employed in the National Collegiate Athletic Association Division I setting volunteered. Average age of the participants was 35 ± 9 years. All were full-time ATs with an average of 11 ± 8 years of clinical experience. Data Collection and Analysis: Participants responded to questions by journaling their thoughts and experiences. Multiple-analyst triangulation and peer review were included as steps to establish data credibility. Results: Male and female role models and mentors can positively or negatively influence the career and work–life balance perceptions of female ATs working in the Division I setting. Female ATs have a desire to see more women in the profession handle the demands of motherhood and the demands of their clinical setting. Women who have had female mentors are more positive about the prospect of balancing the rigors of motherhood and job demands. Conclusions: Role models and mentors are valuable resources for promoting perseverance in the profession in the highly demanding clinical settings. As more female ATs remain in the profession who are able to maintain work–life balance and are available to serve as role models, the
Eason, Christianne M; Mazerolle, Stephanie M; Goodman, Ashley
2014-01-01
One of the greatest catalysts for turnover among female athletic trainers (ATs) is motherhood, especially if employed at the National Collegiate Athletic Association Division I level. The medical education literature regularly identifies the importance of role models in professional character formation. However, few researchers have examined the responsibility of mentorship and professional role models as it relates to female ATs' perceptions of motherhood and retention. To evaluate perceptions of motherhood and retention in relation to mentorship and role models among female ATs currently employed in the collegiate setting. Qualitative study. Female athletic trainers working in National Collegiate Athletic Association Division I. Twenty-seven female ATs employed in the National Collegiate Athletic Association Division I setting volunteered. Average age of the participants was 35 ± 9 years. All were full-time ATs with an average of 11 ± 8 years of clinical experience. Participants responded to questions by journaling their thoughts and experiences. Multiple-analyst triangulation and peer review were included as steps to establish data credibility. Male and female role models and mentors can positively or negatively influence the career and work-life balance perceptions of female ATs working in the Division I setting. Female ATs have a desire to see more women in the profession handle the demands of motherhood and the demands of their clinical setting. Women who have had female mentors are more positive about the prospect of balancing the rigors of motherhood and job demands. Role models and mentors are valuable resources for promoting perseverance in the profession in the highly demanding clinical settings. As more female ATs remain in the profession who are able to maintain work-life balance and are available to serve as role models, the attitudes of other women may start to change.
How Culture Affects Female Inequality across Countries: An Empirical Study
Cheung, Hoi Yan; Chan, Alex W. H.
2007-01-01
Many studies have commented that culture has an influence on gender inequality. However, few studies have provided data that could be used to investigate how culture actually influences female inequality. One of the aims of this study is to investigate whether Hofstede's cultural dimensions have an impact on female inequality in education in terms…
Factors Affecting Female Lecturer Retention in Private Higher Institution in Perak
Juliana Abu Bakar; Zam Zuriyati Mohamad; S.A. Sharmeela-Banu
2015-01-01
The contribution of female lecturer in education profession is undeniable and their satisfaction is crucial to retain them in this field. This research was conducted with the aim to investigate the factors that influence the female lecturer satisfaction in private higher education institution in Perak, Malaysia. Subsequently it intends to examine the effect of female lecturer satisfaction on their job retention. Perceived Organization Support Theory and Theory of Organizational Equilibrium ha...
Directory of Open Access Journals (Sweden)
Toscano Sharyl E
2007-09-01
Full Text Available Abstract Background This paper describes the nature and characteristics of the dating relationships of adolescent females, including any of their experiences of abuse. Methods A grounded theory approach was used with 22 theoretically sampled female adolescents ages 15–18. Results Several important themes emerged: Seven stages of dating consistently described the relationships of female adolescents. A circle consisting of two interacting same sex peer groups provided structure for each teen as they navigated the dating course. The circle was the central factor affecting a female adolescent's potential for risk or harm in dating relationships. Teens defined abuse as an act where the intention is to hurt. Having once succumbed to sexual pressure, teens felt unable to refuse sex in subsequent situations. Conclusion An awareness of both the stages of dating and the dynamics of the circle will assist health care providers to plan and implement interventions in the female adolescent population. Study findings on factors and influences that support non-abusive versus abusive relationship might help identify female teens at risk and/or support interventions aimed at preventing dating violence.
Male sexual harassment alters female social behaviour towards other females.
Darden, Safi K; Watts, Lauren
2012-04-23
Male harassment of females to gain mating opportunities is a consequence of an evolutionary conflict of interest between the sexes over reproduction and is common among sexually reproducing species. Male Trinidadian guppies Poecilia reticulata spend a large proportion of their time harassing females for copulations and their presence in female social groups has been shown to disrupt female-female social networks and the propensity for females to develop social recognition based on familiarity. In this study, we investigate the behavioural mechanisms that may lead to this disruption of female sociality. Using two experiments, we test the hypothesis that male presence will directly affect social behaviours expressed by females towards other females in the population. In experiment one, we tested for an effect of male presence on female shoaling behaviour and found that, in the presence of a free-swimming male guppy, females spent shorter amounts of time with other females than when in the presence of a free-swimming female guppy. In experiment two, we tested for an effect of male presence on the incidence of aggressive behaviour among female guppies. When males were present in a shoal, females exhibited increased levels of overall aggression towards other females compared with female only shoals. Our work provides direct evidence that the presence of sexually harassing males alters female-female social behaviour, an effect that we expect will be recurrent across taxonomic groups.
Identification and characterization of twenty-seven short ...
Indian Academy of Sciences (India)
They have been successfully applied to resolve phylo- genetic relationships among various groups at different tax- onomic ranks (Nikaido et al. 2003; Chen et al. .... nizable flanking direct repeats (DRs) that are diagnostic of amplification via RNA intermediates during retrotransposi- tion (Weiner et al. 1986; Deininger 1989) ...
Mlenga, Francis Howard
The purpose of the study was to determine factors affecting elementary female student teachers' choice of science as a major at college level in Zimbabwe. The study was conducted at one of the Primary School Teachers' Colleges in Zimbabwe. A sample of two hundred and thirty-eight female student teachers was used in the study. Of these one hundred and forty-two were non-science majors who had been randomly selected, forty-one were science majors and forty-five were math majors. Both science and math majors were a convenient sample because the total enrollment of the two groups was small. All the subjects completed a survey questionnaire that had sixty-eight items. Ten students from the non-science majors were selected for individual interviews and the same was done for the science majors. A further eighteen were selected from the non-science majors and divided into three groups of six each for focus group interviews. The same was done for the science majors. The interviews were audio taped and transcribed. Data from the survey questionnaires were analyzed using Binary Logistic Regression which predicted factors that affected students' choice of science as a major. The transcribed interview data were analyzed used using domain, taxonomic and componential analyses. Results of the study indicated that elementary female students' choice of science as a major at college level is affected by students' attitudes toward science, teacher behavior, out-of-school experiences, role models, gender stereotyping, parental influence, peer influence, in-school experiences, and societal expectations, namely cultural and social expectations.
Women's sexual and emotional responses to male- and female-produced erotica
Laan, E.; Everaerd, W.; van Bellen, G.; Hanewald, G.
1994-01-01
Whether erotic films made by women are more arousing for women than erotic films made by men was studied. Forty-seven subjects were exposed to both a woman-made, female-initiated, and female centered, erotic film excerpt. Photoplethysmographic vaginal pulse amplitude was recorded continuously.
Pawluski, Jodi L.; van Donkelaar, Eva; Abrams, Zipporah; Steinbusch, Harry W. M.; Charlier, Thierry D.
2014-01-01
Selective serotonin reuptake inhibitor medications are one of the most common treatments for mood disorders. In humans, these medications are taken orally, usually once per day. Unfortunately, administration of antidepressant medications in rodent models is often through injection, oral gavage, or minipump implant, all relatively stressful procedures. The aim of the present study was to investigate how administration of the commonly used SSRI, fluoxetine, via a wafer cookie, compares to fluoxetine administration using an osmotic minipump, with regards to serum drug levels and hippocampal plasticity. For this experiment, adult female Sprague-Dawley rats were divided over the two administration methods: (1) cookie and (2) osmotic minipump and three fluoxetine treatment doses: 0, 5, or 10 mg/kg/day. Results show that a fluoxetine dose of 5 mg/kg/day, but not 10 mg/kg/day, results in comparable serum levels of fluoxetine and its active metabolite norfluoxetine between the two administration methods. Furthermore, minipump administration of fluoxetine resulted in higher levels of cell proliferation in the granule cell layer (GCL) at a 5 mg dose compared to a 10 mg dose. Synaptophysin expression in the GCL, but not CA3, was significantly lower after fluoxetine treatment, regardless of administration method. These data suggest that the administration method and dose of fluoxetine can differentially affect hippocampal plasticity in the adult female rat. PMID:24757568
Directory of Open Access Journals (Sweden)
Jodi L. Pawluski
2014-01-01
Full Text Available Selective serotonin reuptake inhibitor medications are one of the most common treatments for mood disorders. In humans, these medications are taken orally, usually once per day. Unfortunately, administration of antidepressant medications in rodent models is often through injection, oral gavage, or minipump implant, all relatively stressful procedures. The aim of the present study was to investigate how administration of the commonly used SSRI, fluoxetine, via a wafer cookie, compares to fluoxetine administration using an osmotic minipump, with regards to serum drug levels and hippocampal plasticity. For this experiment, adult female Sprague-Dawley rats were divided over the two administration methods: (1 cookie and (2 osmotic minipump and three fluoxetine treatment doses: 0, 5, or 10 mg/kg/day. Results show that a fluoxetine dose of 5 mg/kg/day, but not 10 mg/kg/day, results in comparable serum levels of fluoxetine and its active metabolite norfluoxetine between the two administration methods. Furthermore, minipump administration of fluoxetine resulted in higher levels of cell proliferation in the granule cell layer (GCL at a 5 mg dose compared to a 10 mg dose. Synaptophysin expression in the GCL, but not CA3, was significantly lower after fluoxetine treatment, regardless of administration method. These data suggest that the administration method and dose of fluoxetine can differentially affect hippocampal plasticity in the adult female rat.
Congenital adrenal hyperplasia: as viewed by parents of affected children in India--a pilot study.
Bhakhri, Bhanu Kiran; Jain, Vandana
2011-01-01
A spectrum of myths and misconceptions about congenital adrenal hyperplasia (CAH) is prevalent among the parents of affected children in India. The perceptions of parents may affect several aspects of these children's management, and to explore these perceptions we carried out a cross-sectional questionnaire-based descriptive study during May 2010. Twenty-eight individuals (17 males and 11 females), parents of 22 affected children aged parents of misconceptions about CAH. These misconceptions were resulting in potentially harmful practices, and in addition there was immense societal pressure on the families as a result of ignorance and myths about the disorder. There is a need for regular CAH education and interaction programs to provide an acceptable platform for the parents and patients, where their concerns can be expressed and shared and their requirements addressed appropriately by a multidisciplinary team.
Cryotherapy does not affect peroneal reaction following sudden inversion.
Berg, Christine L; Hart, Joseph M; Palmieri-Smith, Riann; Cross, Kevin M; Ingersoll, Christopher D
2007-11-01
If ankle joint cryotherapy impairs the ability of the ankle musculature to counteract potentially injurious forces, the ankle is left vulnerable to injury. To compare peroneal reaction to sudden inversion following ankle joint cryotherapy. Repeated measures design with independent variables, treatment (cryotherapy and control), and time (baseline, immediately post treatment, 15 minutes post treatment, and 30 minutes post treatment). University research laboratory. Twenty-seven healthy volunteers. An ice bag was secured to the lateral ankle joint for 20 minutes. The onset and average root mean square amplitude of EMG activity in the peroneal muscles was calculated following the release of a trap door mechanism causing inversion. There was no statistically significant change from baseline for peroneal reaction time or average peroneal muscle activity at any post treatment time. Cryotherapy does not affect peroneal muscle reaction following sudden inversion perturbation.
Liu, Han; Chen, Qian; Lei, Lei; Zhou, Wei; Huang, Lisu; Zhang, Jun; Chen, Dan
2018-04-01
Evidence has shown that leukocyte telomere length (LTL) at birth is related to the susceptibility to various diseases in later life and the setting of newborn LTL is influenced by the intrauterine environment. Perfluoroalkyl and polyfluoroalkyl substances (PFASs), as a kind of persistent organic pollutants, are commonly used in commercial and domestic applications and are capable of crossing the maternal-fetal barrier during pregnancy. We hypothesized that intrauterine exposure to PFASs may affect fetal LTL by increasing oxidative stress. To verify this hypothesis, LTL, concentrations of PFASs and reactive oxygen species (ROS) were measured in umbilical cord blood of 581 newborns from a prospective cohort. Our results showed that there were interactions between PFOS/PFDA and sex on LTL and ROS. The LTL was significantly shorter (0.926 ± 0.053 vs 0.945 ± 0.054, P = .023 for PFOS; 0.919 ± 0.063 vs 0.940 ± 0.059, P = .011 for PFDA) and the ROS levels were extremely higher (252.9 ± 60.5 [M] vs 233.5 ± 53.6 [M], P = .031 for PFOS; 255.2 ± 62.9 [M] vs 232.9 ± 58.3 [M], P = .011 for PFDA) in the female newborns whose PFOS or PFDA concentrations fell in the upmost quartile compared with those in the lowest quartile after adjusting for potential confounders. ROS levels were inversely associated with LTL in female newborns (β = -1.42 × 10 -4 , P = .022). 13% of the effect of PFOS on female LTL was mediated through ROS approximately by the mediation analyses. However, in male newborns, no relationships among PFASs, ROS and LTL were observed. Our findings suggest a "programming" role of PFASs on fetal telomere biology system in females in intrauterine stage. Copyright © 2018 Elsevier Ltd. All rights reserved.
Player and Game Characteristics and Head Impacts in Female Youth Ice Hockey Players.
Reed, Nick; Taha, Tim; Greenwald, Richard; Keightley, Michelle
2017-08-01
Despite the growing popularity of ice hockey among female youth and interest in the biomechanics of head impacts in sport, the head impacts sustained by this population have yet to be characterized. To describe the number of, biomechanical characteristics of, and exposure to head impacts of female youth ice hockey players during competition and to investigate the influences of player and game characteristics on head impacts. Cohort study. Twenty-seven female youth ice hockey players (mean age = 12.5 ± 0.52 years) wore instrumented ice hockey helmets during 66 ice hockey games over a 3-year period. Data specific to player, game, and biomechanical head impact characteristics were recorded. A multiple regression analysis identified factors most associated with head impacts of greater frequency and severity. A total of 436 total head impacts were sustained during 6924 minutes of active ice hockey participation (0.9 ± 0.6 impacts per player per game; range, 0-2.1). A higher body mass index (BMI) significantly predicted a higher number of head impacts sustained per game (P = .008). Linear acceleration of head impacts was greater in older players and those who played the forward position, had a greater BMI, and spent more time on the ice (P = .008), whereas greater rotational acceleration was present in older players who had a greater BMI and played the forward position (P = .008). During tournament games, increased ice time predicted increased severity of head impacts (P = .03). This study reveals for the first time that head impacts are occurring in female youth ice hockey players, albeit at a lower rate and severity than in male youth ice hockey players, despite the lack of intentional body checking.
Latka, Mary H.; Kapadia, Farzana; Fortin, Princess
2008-01-01
Data on adolescents' views regarding the female condom are limited. We conducted seven single-gender focus groups with 47 New York City boys and girls aged 15-20 years (72% African American; 43% ever on public assistance; 72% sexually active; 25% had either been pregnant or fathered a pregnancy). Conceptual mapping was performed by participants to…
Moon, Seung-Jin; Kim, Yong Tae; Lee, Tchun Yong; Moon, Hongsang; Kim, Mi Jung; Kim, Shin Ah; Choi, Bo Youl
2011-03-01
An overactive bladder (OAB) affects a person's quality of life. Patients who suffer from OAB run to the toilet frequently to prevent incontinence, and this behavior increases their risk of falling and fear of falling. This study evaluated the influence of OAB on falls and concern about falling in females aged 40 and over living in urban and rural communities. We conducted a population-based cohort study using King's Health Questionnaire (KHQ), the Korean version of Falls Efficacy Scale-International (KFES-I) and a questionnaire regarding falls, in females aged 40 and over in Guri city and Yangpyeong county. The data from 514 responders were analyzed. The definition of OAB was 'moderately' or 'a lot' of urgency, or urge incontinence in KHQ. Falls was defined as experience of falls in the last year. High fear of falling was defined as a score of 24 or over in KFES-I. The factors were analyzed by the exact chi-square test and Student's t-test. The multivariate logistic regression model was adopted in order to examine the effects of OAB on falls and concern about falling. Of the 514 responders, 98 fitted the criterion of OAB. Eighty-nine (17.3%) of the responders had experienced falls in the last year: twenty-seven (27.5%) in the group with OAB and 62 (14.9%) in the group without OAB. There was a significant association between falls and OAB (odds ratio [OR], 1.76; 95% confidence interval [CI], 1.00 to 3.08; P=0.0485), and between high fear of falling and OAB (OR, 2.72; 95% CI, 1.42 to 5.20; P=0.0024). Urgency and symptoms of urge incontinence increase the risk of falls in women aged 40 or older in the community. Early diagnosis and proper treatment may prevent falls and improve quality of life in OAB patients.
Directory of Open Access Journals (Sweden)
William J. Cottam
2016-01-01
Full Text Available Functional magnetic resonance imaging studies (fMRI have transformed our understanding of central processing of evoked pain but the typically used block and event-related designs are not best suited to the study of ongoing pain. Here we used arterial spin labelling (ASL for cerebral blood flow mapping to characterise the neural correlates of perceived intensity of osteoarthritis (OA pain and its interrelation with negative affect. Twenty-six patients with painful knee OA and twenty-seven healthy controls underwent pain phenotyping and ASL MRI at 3T. Intensity of OA pain correlated positively with blood flow in the anterior mid-cingulate cortex (aMCC, subgenual cingulate cortex (sgACC, bilateral hippocampi, bilateral amygdala, left central operculum, mid-insula, putamen and the brainstem. Additional control for trait anxiety scores reduced the pain-CBF association to the aMCC, whilst pain catastrophizing scores only explained some of the limbic correlations. In conclusion, we found that neural correlates of reported intensity of ongoing chronic pain intensity mapped to limbic-affective circuits, and that the association pattern apart from aMCC was explained by trait anxiety thus highlighting the importance of aversiveness in the experience of clinical pain.
Randers, Morten Bredsgaard; Andersen, Lars Juel; Orntoft, Christina; Bendiksen, Mads; Johansen, Lars; Horton, Joshua; Hansen, Peter Riis; Krustrup, Peter
2013-01-01
This study examined the intermittent exercise performance and cardiovascular health profile in elite female football players in comparison to untrained young women, as well as a subgroup subjected to football training 2x1 h · week(-1) for 16 weeks. Twenty-seven Danish national team players (elite trained, ET) and 28 untrained women (UT) underwent dual-energy X-ray absorptiometry-scanning (DXA), comprehensive transthoracic echocardiography, treadmill and Yo-Yo Intermittent Endurance level 2 (IE2) testing. Eight women in UT were also tested after the football training period. Maximal oxygen uptake rate (VO2max), peak ventilation and peak lactate were 40, 18 and 51% higher (Pfootball elevated VO2max and Yo-Yo IE2 performance by 16 and 40%, respectively, and lowered fat mass by 6%. Cardiac function was markedly improved by 16 weeks of football training with 26 and 46% increases in TAPSE and E/A ratio, respectively, reaching levels comparable to ET. In summary, elite female football players have a superior cardiovascular health profile and intermittent exercise performance compared to untrained controls, but short-term football training can markedly improve the cardiovascular health status.
Identification of seven loci affecting mean telomere length and their association with disease
Codd, V.; Nelson, C.P.; Albrecht, E.; Mangino, M.; Deelen, J.; Buxton, J.L.; Hottenga, J.J.; Fischer, K.; Esko, T.; Surakka, I.; Broer, L.; Nyholt, DR; Mateo Leach, I.; Salo, P.; Hägg, S.; Matthews, M.K.; Palmen, J.; Norata, G.D.; O'Reilly, P.F.; Saleheen, D.; Amin, N.; Balmforth, A.J.; Beekman, M.; de Boer, R.A.; Böhringer, S.; Braund, P.S.; Burton, P.R.; de Craen, A.J.; Denniff, M.; Dong, Y.; Douroudis, K.; Dubinina, E.; Eriksson, J.G.; Garlaschelli, K.; Guo, D.; Hartikainen, A.L.; Henders, A.K.; Houwing-Duistermaat, J.J.; Kananen, L.; Karssen, L.C.; Kettunen, J.; Klopp, N.; Lagou, V.; van Leeuwen, E.; Madden, P.A.; Mägi, R.; Magnusson, P.K.E.; Männistö, S.; McCarthy, M.I.; Medland, S.E.; Mihailov, E.; Montgomery, G.W.; Oostra, B.A.; Palotie, A.; Peters, A.; Pollard, H.; Pouta, A.; Prokopenko, I.; Ripatti, S.; Salomaa, V.; Suchiman, H.E.D.; Valdes, A.M.; Verweij, N.; Viñuela, A.; Wang, X.; Wichmann, H. E.; Widen, E.; Willemsen, G.; Wright, M.J.; Xia, K.; Xiao, X.; van Veldhuisen, D.J.; Catapano, A.L.; Tobin, M.D.; Hall, A.S.; Blakemore, A.I.F.; van Gilst, W.H.; Zhu, H.; Erdmann, J.; Reilly, M.P.; Kathiresan, S.; Schunkert, H.; Talmud, P.J.; Pedersen, N.L.; Perola, M.; Ouwehand, W.; Kaprio, J.; Martin, N.G.; van Duijn, C.M.; Hovatta, I.; Gieger, C.; Metspalu, A.; Boomsma, D.I.; Järvelin, M.R.; Slagboom, P.E.; Thompson, J.R.; Spector, T.D.; van der Harst, P.; Samani, N.J.
2013-01-01
Interindividual variation in mean leukocyte telomere length (LTL) is associated with cancer and several age-associated diseases. We report here a genome-wide meta-analysis of 37,684 individuals with replication of selected variants in an additional 10,739 individuals. We identified seven loci,
Identification of seven loci affecting mean telomere length and their association with disease
Codd, Veryan; Nelson, Christopher P.; Albrecht, Eva; Mangino, Massimo; Deelen, Joris; Buxton, Jessica L.; Hottenga, Jouke Jan; Fischer, Krista; Esko, Tonu; Surakka, Ida; Broer, Linda; Nyholt, Dale R.; Mateo Leach, Irene; Salo, Perttu; Hagg, Sara; Matthews, Mary K.; Palmen, Jutta; Norata, Giuseppe D.; O'Reilly, Paul F.; Saleheen, Danish; Amin, Najaf; Balmforth, Anthony J.; Beekman, Marian; de Boer, Rudolf A.; Bohringer, Stefan; Braund, Peter S.; Burton, Paul R.; de Craen, Anton J. M.; Denniff, Matthew; Dong, Yanbin; Douroudis, Konstantinos; Dubinina, Elena; Eriksson, Johan G.; Garlaschelli, Katia; Guo, Dehuang; Hartikainen, Anna-Liisa; Henders, Anjali K.; Houwing-Duistermaat, Jeanine J.; Kananen, Laura; Karssen, Lennart C.; Kettunen, Johannes; Klopp, Norman; Lagou, Vasiliki; van Leeuwen, Elisabeth M.; Madden, Pamela A.; Maegi, Reedik; Verweij, Niek; van Veldhuisen, Dirk J.; van Gilst, Wiek H.; van der Harst, Pim
Interindividual variation in mean leukocyte telomere length (LTL) is associated with cancer and several age-associated diseases. We report here a genome-wide meta-analysis of 37,684 individuals with replication of selected variants in an additional 10,739 individuals. We identified seven loci,
Svec, Lace A.; Wade, Juli
2008-01-01
Female zebra finches display a preference for songs of males raised with tutors compared to those from males without tutors. To determine howthis behavioral preference may bemediated by auditory perception sites, the social behavior network, and the dopamine reward system, and whether responses of these regions are affected by estradiol, females were treated with hormone or blank implants.An auditory choice test was conducted followed by exposure to tutored or untutored song or silence to exa...
DEFF Research Database (Denmark)
Myburgh, Corrie; Hartvigsen, Jan; Aagaard, Per
2012-01-01
. METHODS: Seventy-seven female office workers (25-46yrs) with and without neck/shoulder pain were observed with respect to self-reported pain (NRS-101), pressure-pain threshold (PPT), maximum voluntary contraction (Fmax) and rate of force development (RFD) at baseline (pre-intervention), immediately post...... or intervention (p=0.001). CONCLUSIONS: In selected female neck/shoulder pain sufferers, maximum voluntary contraction and rapid force generation of the upper Trapezius was not influenced by clinically relevant self-reported pain or the presence of diagnostically relevant MFTrPs. Dry needling, deep or superficial......, did not affect measured functional outcomes over the 48-hour observation period. DOMS affected participants uniformly irrespective of pain, MFTrP status or intervention type and therefore is like to act as a modifier.Trial registrationClinical Trials.gov- NCT01710735Significance and Innovations...
Dilemmas in counselling females with the fragile X syndrome
B.B.A. de Vries (Bert); H.M. van den Boer-van den Berg; M.F. Niermeijer (Martinus); A. Tibben (Arend)
1999-01-01
textabstractThe dilemmas in counselling a mildly retarded female with the fragile X syndrome and her retarded partner are presented. The fragile X syndrome is an X linked mental retardation disorder that affects males and, often less severely, females. Affected females
Directory of Open Access Journals (Sweden)
D. BURTINI
2015-10-01
Full Text Available Female Emigration. From Rural Romania to the Adriatic Coast: Women on Their Journey between Opportunity and Social Vulnerability. “The Italian Syndrome”. The twenty-first century can be called the “age of migration”, in fact since the de-colonization and markedly since the eighties migration affects the entire planet, qualifying as a global phenomenon. Comparing it with it in the past today prevails new elements and in fact, in addition to a geographical change of the phenomenon, it has turned its composition, showing a growing feminization.
Relative Age Affects Marathon Performance in Male and Female Athletes
Connick, Mark J.; Beckman, Emma M.; Tweedy, Sean M.
2015-01-01
Marathon runners are ranked in 5-year age groups. However the extent to which 5-year groupings facilitates equitable competition has not been evaluated. The aim of this study was to evaluate the effect of relative age in male and female marathon running. Marathon finishing times for the top ten male (aged 20-69 years) and female athletes (aged 20-64 years) were obtained from the 2013 New York and Chicago marathons. Intra-class and inter-class validity were evaluated by comparing performances ...
Oxytocin differentially affects sucrose taking and seeking in male and female rats.
Zhou, Luyi; Ghee, Shannon M; See, Ronald E; Reichel, Carmela M
2015-04-15
Oxytocin has a modulatory role in natural and drug reward processes. While the role of oxytocin in pair bonding and reproduction has been extensively studied, sex differences in conditioned and unconditioned behavioral responses to oxytocin treatment have not been fully characterized. Here, we determined whether male and female rats would show similar dose response curves in response to acute oxytocin on measures of locomotor activity, sucrose seeking, and sucrose intake. Male and freely cycling female rats received vehicle or oxytocin (0.1, 0.3, 1, 3mg/kg, IP) injections before behavioral tests designed to assess general motor activity, as well as sucrose self-administration and seeking. Lower doses of oxytocin decreased motor activity in a novel environment in females relative to males. Likewise, lower doses of oxytocin in females decreased responding for sucrose during maintenance of sucrose self-administration and reinstatement to sucrose-conditioned cues. However, sucrose seeking in response to a sucrose prime was only decreased by the highest oxytocin dose in both sexes. In general, oxytocin had similar effects in both sexes. However, females were more sensitive to lower doses of oxytocin than males. These findings are consistent with the notion that oxytocin regulates many of the same behaviors in males and females, but that the effects are typically more profound in females. Therapeutic use of oxytocin should include sex as a factor in determining dose regimens. Copyright © 2015 Elsevier B.V. All rights reserved.
Ramos, D; Bueno, J L O; Bigand, E
2011-02-01
The combined influence of tempo and mode on emotional responses to music was studied by crossing 7 changes in mode with 3 changes in tempo. Twenty-four musicians aged 19 to 25 years (12 males and 12 females) and 24 nonmusicians aged 17 to 25 years (12 males and 12 females) were required to perform two tasks: 1) listening to different musical excerpts, and 2) associating an emotion to them such as happiness, serenity, fear, anger, or sadness. ANOVA showed that increasing the tempo strongly affected the arousal (F(2,116) = 268.62, mean square error (MSE) = 0.6676, P effects were found between tempo and mode (F (1,58) = 115.6, MSE = 0.6428, P effects. This finding demonstrates that small changes in the pitch structures of modes modulate the emotions associated with the pieces, confirming the cognitive foundation of emotional responses to music.
Aktaş, Demet
2015-08-01
The purpose of this study was to investigate the prevalence and the affecting factors of dysmenorrhea and its effects on overall comfort among female university students. This was a cross-sectional study. The research was carried out between October and November 2013 at a university in Ankara. This study was conducted with 200 female students. The data were analyzed using frequencies, means, SD, χ(2) tests, independent t tests and analysis of variance. Data were collected using an interview questionnaire, the visual analog scale (VAS) and the General Comfort Questionnaire. The mean age of students in this study group was 20.85 ± 2.15 years. The prevalence of dysmenorrhea in the students was 84%. The mean severity of pain was 5.78 ± 2.45 on the VAS. The present study found that 45.8% of female students experienced moderate menstrual pain and the most common co-occurring symptoms were irritability (34.6%) and fatigue (21.5%). One-fourth of the students with dysmenorrhea consulted the advice of a physician and the most commonly used methods for pain were analgesics (69%), heat application (56.5%), and rest (71.4%). Family history of dysmenorrhea, education about menstruation, and frequency of menstrual cycle were identified as important factors in the development of dysmenorrhea (p dysmenorrhea (2.57 ± 0.25) was lower than that of students without the condition (2.65 ± 0.23). Also, use of the methods for management of dysmenorrhea was found to increase students' general comfort levels. Therefore, it is important for nurses to educate and advise adolescents and young women about dysmenorrhea. Copyright © 2015 American Society for Pain Management Nursing. Published by Elsevier Inc. All rights reserved.
Factors Affecting the Unemployment (Rate) of Female Art Graduates in Iran
Hedayat, Mina; Kahn, Sabzali Musa; Hanafi, Jaffri
2013-01-01
The aim of this study is to explore the relationship between the opportunities of female artist graduates in Tehran Province and the current employment market. Mixed method was employed in this study. The population of the current study consisted of 240 female artist graduates selected using a systematic random sampling method from both public and…
Female genital mutilation in Britain.
Black, J A; Debelle, G D
1995-06-17
The practice of female genital mutilation predates the founding of both Christianity and Islam. Though largely confined among Muslims, the operation is also practiced in some Christian communities in Africa such that female genital mutilation takes place in various forms in more than twenty African countries, Oman, Yemen, the United Arab Emirates, and by some Muslims in Malaysia and Indonesia. In recent decades, ethnic groups which practice female genital mutilation have immigrated to Britain. The main groups are from Eritrea, Ethiopia, Somalia, and Yemen. In their own countries, an estimated 80% of women have had the operation. Female genital mutilation has been illegal in Britain since 1985, but it is practiced illegally or children are sent abroad to undergo the operation typically at age 7-9 years. It is a form of child abuse which poses special problems. The authors review the history of female genital mutilation and describe its medical complications. Assuming that the size of the population in Britain of ethnic groups which practice or favor female genital mutilation remains more or less unchanged, adaptation and acculturation will probably cause the practice to die out within a few generations. Meanwhile, there is much to be done. A conspiracy of silence exists in medical circles as well as widespread ignorance. Moreover, none of a number of well-known obstetric and pediatric textbooks mentions female genital mutilation, while the National Society for the Prevention of Cruelty to Children has neither information nor instructional material. It is high time that the problem was more widely and openly discussed.
Prevalence of congenital color vision defects in Saudi females of Arab origin.
Alabdelmoneam, Mussaed
2011-09-01
Inherited color vision deficiencies (CVD) vary in prevalence by population and by sex. The most common CVD is X chromosome-linked anomalous trichromacy. Prevalence varies significantly by sex and race. The frequency of color vision defects in Saudi females has not been studied previously. This study surveyed the prevalence of congenital color vision defects in Saudi females of Arab origin. Seven thousand four hundred sixty-seven female subjects (N = 7,467) from the Kingdom of Saudi Arabia were screened using both Ishihara pseudoisochromatic plates and the Farnsworth Dichotomous test (D-15). CVD subjects were tested further with the Farnsworth-Munsell 100 Hue test. Of 7,467 female subjects tested, 26 subjects were found to have defective color vision, for a prevalence of 0.35%. Sixteen subjects had a deutan defect, and 10 had a protan defect. Arab females have significantly lower prevalence of CVD when compared with published data from females of other races. Analysis of the 5 regions of Saudi Arabia showed no significant difference between the regions. Prevalence of CVD among Saudi females of Arab origin is 0.35% and is among the lowest of all published data. Copyright © 2011 American Optometric Association. Published by Elsevier Inc. All rights reserved.
Teachers Perceptions of Female Student Aggression at an All-Girls School
Winter, Clare; McKenzie, Karen
2017-01-01
There has been limited research into how teachers view and respond to relational aggression in girls. The existing research is largely quantitative and questionnaire based and has indicated that gender stereotypes may influence teachers’ perceptions of female aggression. The present study adopted a qualitative approach, using semi-structured interviews to explore how seven teachers (six females and one male) working in a single sex (all girls) school, experienced and perceived female student ...
DEFF Research Database (Denmark)
Höglund, Johanna Karolina; Guldbrandtsen, B; Su, G
2009-01-01
Data from the joint Nordic breeding value prediction for Danish and Swedish Holstein grandsire families were used to locate quantitative trait loci (QTL) for female fertility traits in Danish and Swedish Holstein cattle. Up to 36 Holstein grandsires with over 2,000 sons were genotyped for 416 mic...... for QTL segregating on Bos taurus chromosome (BTA)1, BTA7, BTA10, and BTA26. On each of these chromosomes, several QTL were detected affecting more than one of the fertility traits investigated in this study. Evidence for segregation of additional QTL on BTA2, BTA9, and BTA24 was found...
Directory of Open Access Journals (Sweden)
Luiz Carlos Vieira Júnior
2011-11-01
Full Text Available The ingestive behavior and performance of female lambs grazing on Marandu pasture submitted to different stocking rates during the rainy and transition season were evaluated. The experimental area with 4,500 m² was divided into 45 paddocks of 100 m². Twenty-seven Santa Ines female lambs (purebred with 4 months age and 22 kg of initial body weight were distributed in a completely randomized design, with nine replicates. Lambs were divided into 9 groups with the same initial weight and submitted to three stocking rates: 2, 3 and 4 lambs/paddock, which corresponded to 40, 60 and 80 lambs/ha, respectively. Each group of animals had a module of five paddocks, managed on intermittent grazing system, with 7 days of occupation and 28 d of rest. Increase on time grazing and reduction on time ruminating and resting were observed as stocking rates increased. There was 14% raise in time grazing and 41% decline on time resting by lambs subjected to the highest stocking rate compared with those in the lower stocking rate. The number of animals/ha promoted linear effect on average daily gain, which was higher for animals in the lowest stocking rate of 90 g/d. For gain per area, the best result was obtained with 60 animals/ha featuring an average value of 426 kg/ha.
Erickson, A; Fisher, M; Furukawa-Stoffer, T; Ambagala, A; Hodko, D; Pasick, J; King, D P; Nfon, C; Ortega Polo, R; Lung, O
2018-04-01
Microarray technology can be useful for pathogen detection as it allows simultaneous interrogation of the presence or absence of a large number of genetic signatures. However, most microarray assays are labour-intensive and time-consuming to perform. This study describes the development and initial evaluation of a multiplex reverse transcription (RT)-PCR and novel accompanying automated electronic microarray assay for simultaneous detection and differentiation of seven important viruses that affect swine (foot-and-mouth disease virus [FMDV], swine vesicular disease virus [SVDV], vesicular exanthema of swine virus [VESV], African swine fever virus [ASFV], classical swine fever virus [CSFV], porcine respiratory and reproductive syndrome virus [PRRSV] and porcine circovirus type 2 [PCV2]). The novel electronic microarray assay utilizes a single, user-friendly instrument that integrates and automates capture probe printing, hybridization, washing and reporting on a disposable electronic microarray cartridge with 400 features. This assay accurately detected and identified a total of 68 isolates of the seven targeted virus species including 23 samples of FMDV, representing all seven serotypes, and 10 CSFV strains, representing all three genotypes. The assay successfully detected viruses in clinical samples from the field, experimentally infected animals (as early as 1 day post-infection (dpi) for FMDV and SVDV, 4 dpi for ASFV, 5 dpi for CSFV), as well as in biological material that were spiked with target viruses. The limit of detection was 10 copies/μl for ASFV, PCV2 and PRRSV, 100 copies/μl for SVDV, CSFV, VESV and 1,000 copies/μl for FMDV. The electronic microarray component had reduced analytical sensitivity for several of the target viruses when compared with the multiplex RT-PCR. The integration of capture probe printing allows custom onsite array printing as needed, while electrophoretically driven hybridization generates results faster than conventional
Directory of Open Access Journals (Sweden)
Swarup Mitra
2016-11-01
Full Text Available There is currently a lack of understanding how surgical menopause can influence obsessions, compulsions and associated affective and cognitive functions in female OCD patients. Early menopause in women due to surgical removal of ovaries not only causes dramatic hormonal changes, but also may induce affective and cognitive disorders. Here, we tested if surgical removal of ovaries (ovariectomy, OVX, which mimics surgical menopause in humans, would result in exacerbation of compulsive, affective and cognitive behaviors in mice strains that exhibit a spontaneous compulsive-like phenotype. Female mice from compulsive-like BIG, non-compulsive SMALL and randomly-bred Control strains were subjected to OVX or sham-surgery. After seven days animals were tested for nest building and marble burying to measure compulsive-like behavior. The elevated plus maze and open field tests measured anxiety-like behaviors, while memory was assessed by the novel object recognition. Acute OVX resulted in exacerbation of compulsive-like and anxiety-like behaviors in compulsive-like BIG mice. No significant effects of OVX were observed for the non-compulsive SMALL and Control strains. Object recognition memory was impaired in compulsive-like BIG female mice compared to the Control mice, without an effect of OVX on the BIG mice. We also tested whether 17 β-estradiol (E2 or progesterone (P4 could reverse the effects of OVX. E2, but not P4, attenuated the compulsive-like behaviors in compulsive-like BIG OVX female mice. The actions of the sex steroids on anxiety-like behaviors in OVX females were strain and behavioral test dependent. Altogether, our results indicate that already existing compulsions can be worsened during acute ovarian deprivation concomitant with exacerbation of affective behaviors and responses to hormonal intervention in OVX female mice can be influenced by genetic background.
Setchell, Joanna M; Smith, Tessa; Wickings, E Jean; Knapp, Leslie A
2008-11-01
Subordinate female cercopithecine primates often experience decreased reproductive success in comparison with high-ranking females, with a later age at sexual maturity and first reproduction and/or longer interbirth intervals. One explanation that has traditionally been advanced to explain this is high levels of chronic social stress in subordinates, resulting from agonistic and aggressive interactions and leading to higher basal levels of glucocorticoids. We assessed the relationships among fecal cortisol levels and reproductive condition, dominance rank, degree of social support, and fertility in female mandrills (Mandrillus sphinx) living in a semi-free-ranging colony in Franceville, Gabon. Lower-ranking females in this colony have a reproductive disadvantage relative to higher-ranking females, and we were interested in determining whether this relationship between dominance rank and reproductive success is mediated through stress hormones. We analyzed 340 fecal samples from 19 females, collected over a 14-month period. We found that pregnant females experienced higher fecal cortisol levels than cycling or lactating females. This is similar to results for other primate species and is likely owing to increased metabolic demands and interactions between the hypothalamus-pituitary-adrenal axis, estrogen, and placental production of corticotrophin releasing hormones during pregnancy. There was no influence of dominance rank on fecal cortisol levels, suggesting that subordinate females do not suffer chronic stress. This may be because female mandrills have a stable social hierarchy, with low levels of aggression and high social support. However, we found no relationship between matriline size, as a measure of social support, and fecal cortisol levels. Subordinates may be able to avoid aggression from dominants in the large enclosure or may react only transiently to specific aggressive events, rather than continuously expecting them. Finally, we found no relationship
International Nuclear Information System (INIS)
Han Lin; Zhao Fengling; Wang Xi'ai; Wang Ping; Jiang Feng; Lu Yumin
2012-01-01
Objective: To investigate the chromosomal aberrations in seven medical staffs suspected with exposure to ionizing radiation and to speculate its possible causation. Methods: The hospital staffs, including 6 females and 1 male,worked in a clinical laboratory where a CT room was located downstairs. The thickness of precast slab between these two rooms was 6 cm. Peripheral blood lymphocytes of seven staffs were examined for conventional chromosomal aberrations. Results: The frequencies of dicentrics in the peripheral lymphocytes of 4 females were from 0.40% to 1.60% that was significantly higher than the spontaneous frequency of dicentrics (0.03%, χ 2 =36.79, P<0.05). The translocation was observed in the lymphocytes from all subjects with frequencies from 0.33% to 1.20%, obviously higher than its spontaneous frequency of 0.01% (χ 2 =42.90, P<0.05). Conclusion: These staffs suffer from ionizing radiation. (authors)
Substrate texture affects female cricket walking response to male calling song
Sarmiento-Ponce, E. J.; Sutcliffe, M. P. F.; Hedwig, B.
2018-03-01
Field crickets are extensively used as a model organism to study female phonotactic walking behaviour, i.e. their attraction to the male calling song. Laboratory-based phonotaxis experiments generally rely on arena or trackball-based settings; however, no attention has been paid to the effect of substrate texture on the response. Here, we tested phonotaxis in female Gryllus bimaculatus, walking on trackballs machined from methyl-methacrylate foam with different cell sizes. Surface height variations of the trackballs, due to the cellular composition of the material, were measured with profilometry and characterized as smooth, medium or rough, with roughness amplitudes of 7.3, 16 and 180 µm. Female phonotaxis was best on a rough and medium trackball surface, a smooth surface resulted in a significant lower phonotactic response. Claws of the cricket foot were crucial for effective walking. Females insert their claws into the surface pores to allow mechanical interlocking with the substrate texture and a high degree of attachment, which cannot be established on smooth surfaces. These findings provide insight to the biomechanical basis of insect walking and may inform behavioural studies that the surface texture on which walking insects are tested is crucial for the resulting behavioural response.
Directory of Open Access Journals (Sweden)
Paul A. Ayayee
2018-05-01
Full Text Available Insect gut microbiota contribute significantly to host nutritional ecology. Disrupting insect gut microbial assemblages impacts nutrient provisioning functions, and can potentially affect host standard metabolic rate (SMR, a measure of host energy balance. In this study, we evaluated the effect of disrupting gut microbial assemblages on the SMR of female Periplaneta americana cockroaches fed dog food (DF, high protein/carbohydrate (p/c ratio, and cellulose-amended dog food (CADF, 30% dog food, 70% cellulose, low p/c ratio diets, supplemented with none, low, or high antibiotic doses. Bacterial loads decreased significantly between diet types (P = 0.04 and across antibiotic doses (P = 0.04. There was a significant diet type x antibiotic dose interaction on SMR of females on both diets (P = 0.05 by the end of the seven-day experimental period. In CADF-fed females, SMR decreased linearly with decreasing bacterial load. However, SMR of DF-fed females on the low dose was significantly higher than those in the control and high dose groups. This is interpreted as a diet-dependent response by low dose DF-fed females to the loss of nutritional services provided by gut bacteria. Severe reductions in bacterial load at high doses reduced SMR of females on both diet types. This study provides insights into the potential role of gut bacteria as modulators of host energy expenditure under varying dietary conditions.
Outlook: The Next Twenty Years
Energy Technology Data Exchange (ETDEWEB)
Murayama, Hitoshi
2003-12-07
I present an outlook for the next twenty years in particle physics. I start with the big questions in our field, broken down into four categories: horizontal, vertical, heaven, and hell. Then I discuss how we attack the bigquestions in each category during the next twenty years. I argue for a synergy between many different approaches taken in our field.
Pair housing differentially affects motivation to self-administer cocaine in male and female rats.
Westenbroek, Christel; Perry, Adam N; Becker, Jill B
2013-09-01
Female rats exhibit greater intake and motivation to self-administer cocaine. In females but not males, isolation by itself is a stressor, which could lead to increased drug intake. Therefore, we hypothesized that social housing would buffer against stress and reduce the motivation to self-administer cocaine primarily in females. Male and female Sprague-Dawley rats were housed individually or in same-sex pairs. The individually housed rats and one of each pair were allowed to self-administer (SA) a low dose of cocaine (0.2 mg/kg/inf) on a fixed ratio (FR1) schedule for one week. Motivation for cocaine SA was measured for an additional 2 weeks on a progressive ratio schedule. Isolated females had greater cocaine-intake on the FR1 schedule and greater motivation to take cocaine than males. Pair-housing in females, but not males, attenuated the motivation to take cocaine. Isolated females, but not males, showed escalation of their motivation to take cocaine, which was attenuated by pair housing of females. Concluding, the motivation to take cocaine escalates in females but not males, and pair-housing of females attenuates this escalation. Copyright © 2013 Elsevier B.V. All rights reserved.
Neurogenesis and Helplessness are Mediated by Controllability in Males but not in Females
Shors, Tracey J.; Mathew, Jason; Sisti, Helene M.; Edgecomb, Carol; Beckoff, Steven; Dalla, Christina
2009-01-01
Background Numerous studies have implicated neurogenesis in the hippocampus in animal models of depression, especially those related to controllability and learned helplessness. Here, we tested the hypothesis that uncontrollable, but not controllable stress would reduce cell proliferation in the hippocampus of male and female rats, and would relate to the expression of helplessness behavior. Methods To manipulate controllability, groups of male and female rats were trained in one session (acute stress) or over seven sessions (repeated stress) to escape a footshock, while yoked controls could not escape, but were exposed to the same amount of stress. Cell proliferation was assessed with immunohistochemistry of BrdU and immunofluorescence of BrdU and NeuN. Separate groups were exposed to either controllable or uncontrollable stress and their ability to learn to escape during training on a more difficult task was used as a behavioral measure of helplessness. Results Acute stress reduced cell proliferation in males, but did not affect proliferation in the female hippocampus. When animals were given the opportunity to learn to control the stress over days, males produced more cells than the yoked males without control. Repeated training with controllable stress did not influence proliferation in females. Under all conditions, males were more likely than females to express helplessness behavior, even males that were not previously stressed. Conclusions The modulation of neurogenesis by controllability was evident in males but not in females, as was the expression of helplessness behavior, despite the fact that men are less likely than women to experience depression. PMID:17306770
Hormonal contraceptive use lowers female intrasexual competition in pair-bonded women
Cobey, Kelly D.; Klipping, Christine; Buunk, Abraham P.
The purpose of this study was to test the influence of hormonal contraceptive use on levels of female intrasexual competition. Twenty-eight women completed a scale for intrasexual competition on three occasions: when using hormonal contraceptives and when regularly cycling at a fertile and a
Vascular affection in relation to oxidative DNA damage in metabolic syndrome.
Abd El Aziz, Rokayaa; Fawzy, Mary Wadie; Khalil, Noha; Abdel Atty, Sahar; Sabra, Zainab
2018-02-01
Obesity has become an important issue affecting both males and females. Obesity is now regarded as an independent risk factor for atherosclerosis-related diseases. Metabolic syndrome is associated with increased risk for development of cardiovascular disease. Urinary 8-oxo-7,8-dihydro-2'-deoxyguanosine concentration has been used to express oxidation status. Twenty-seven obese patients with metabolic syndrome, 25 obese patients without metabolic syndrome and 31 healthy subjects were included in our study. They were subjected to full history and clinical examination; fasting blood sugar (FBS), 2 hour post prandial blood sugar (2HPP), lipid profile, urinary 8-oxo-7,8-dihydro-2'-deoxyguanosine and carotid duplex, A/B index and tibial diameters were all assessed. There was a statistically significant difference ( p = 0.027) in diameter of the right anterior tibial artery among the studied groups, with decreased diameter of the right anterior tibial artery in obese patients with metabolic syndrome compared to those without metabolic syndrome; the ankle brachial index revealed a lower index in obese patients with metabolic syndrome compared to those without metabolic syndrome. There was a statistically insignificant difference ( p = 0.668) in the 8-oxodG in the studied groups. In obese patients with metabolic syndrome there was a positive correlation between 8-oxodG and total cholesterol and LDL. Urinary 8-oxodG is correlated to total cholesterol and LDL in obese patients with metabolic syndrome; signifying its role in the mechanism of dyslipidemia in those patients. Our study highlights the importance of anterior tibial artery diameter measurement and ankle brachial index as an early marker of atherosclerosis, and how it may be an earlier marker than carotid intima-media thickness.
Aggio, D; Wallace, K; Boreham, N; Shankar, A; Steptoe, A; Hamer, M
2017-01-01
ABSTRACT Objective The aim of the study was to determine whether objectively measured daily physical activity and posture of sitting, standing, and sit-to-stand transitions are associated with daily assessments of affect. Methods Participants (N = 51, 49% female) wore ActivPal accelerometers for 24 h/d for seven consecutive days. Time spent sitting, standing, and being physically active and sit-to-stand transitions were derived for each day. Participants also completed a mood inventory each e...
Aggio, D.; Wallace, K.; Boreham, N.; Shankar, A.; Steptoe, A.; Hamer, M.
2017-01-01
OBJECTIVE: The aim of the study was to determine whether objectively measured daily physical activity and posture of sitting, standing, and sit-to-stand transitions are associated with daily assessments of affect. METHODS: Participants (N = 51, 49% female) wore ActivPal accelerometers for 24 h/d for seven consecutive days. Time spent sitting, standing, and being physically active and sit-to-stand transitions were derived for each day. Participants also completed a mood inventory each evening....
Directory of Open Access Journals (Sweden)
Alia Almoajel
2017-10-01
Full Text Available Aims To determine whether there is an effect of healthy behaviours (diet, physical activity, sleep pattern and coping with stress strategies on academic performance among King Saud University (KSU female students who study in different academic fields. Methods A self-administered questionnaire was distributed among 14342 female students aged from 18-25 from different colleges fields, these colleges are Medical Colleges, Sciences Colleges and Humanities Colleges. We distributed the questionnaires through the students’ official emails and only 310 students who completed them. Results The study results show, there was a very weak, positive monotonic correlation between GPA and family income (rs=0.105, n=310, p>0.001 while, there was a very weak, negative monotonic correlation between GPA and the number of family members, marital status, and with whom they live (p<0.001. Regarding the health behaviours; Physical activity seems to be related to academic performance among students of sciences colleges (X2 =174.34, and p<0.001 while, sleep pattern and stress are related to academic performance for medical students, (X2 =297.470, X2 =120.7 respectively and p<0.001. Conclusion The medical students are the most affected group by the health behaviours where sleep pattern and cope with stress are found to be the most health behaviours affecting their academic performance.
Social change and traditional gender roles in Lagos State, Nigeria ...
African Journals Online (AJOL)
Social change and traditional gender roles in Lagos State, Nigeria. ... twenty seven respondents consisted of 135 Females (59.5%) and 92 Males (40.5%) participated in the survey. The study adopted descriptive method of research design.
Chiang, Ching-Cheng; Hsu, Chih-Chia; Chiang, Jinn-Yen; Chang, Weng-Cheng; Tsai, Jong-Chang
2016-12-01
[Purpose] The purpose of this study was to compare the internal and external rotation of the dominant and nondominant shoulders of adolescent female tennis players. The correlation between the shoulder rotation range of motion and the player's ranking was also analyzed. [Subjects and Methods] Twenty-one female junior tennis players who were 13 to 18 years old participated in this study. A standard goniometer was used to measure the internal and external rotation of both glenohumeral joints. The difference in internal and external rotation was calculated as the glenohumeral rotation deficit. The year-end ranking of each player was obtained from the Chinese Taipei Tennis Association. [Results] The internal rotation of the dominant shoulder was significantly smaller than that of the nondominant shoulder. Moreover, player ranking was significantly and negatively correlated with the internal rotation range of motion of both shoulders. On the other hand, the correlations of the internal and external rotation ranges of motion with the age, height, and weight were not significant. [Conclusion] The flexibility of the glenohumeral internal rotation is smaller in the dominant shoulder than of the nondominant shoulder in these junior female tennis players. Flexibility of the glenohumeral internal rotation may be a factor affecting performance in junior female tennis players.
International Nuclear Information System (INIS)
Fesenko, S V; Alexakhin, R M; Balonov, M I; Bogdevich, I M; Howard, B J; Kashparov, V A; Sanzharova, N I; Panov, A V; Voigt, G; Zhuchenka, Yu M
2006-01-01
The accident at the Chernobyl NPP (nuclear power plant) was the most serious ever to have occurred in the history of nuclear energy. The consumption of contaminated foodstuffs in affected areas was a significant source of irradiation for the population. A wide range of different countermeasures have been used to reduce exposure of people and to mitigate the consequences of the Chernobyl accident for agriculture in affected regions in Belarus, Russia and Ukraine. This paper for the first time summarises key data on countermeasure application over twenty years for all three countries and describes key lessons learnt from this experience. (review)
Myxoma of the Jaw Bones: Analysis of 27 Cases | Ajike | Nigerian ...
African Journals Online (AJOL)
Twenty-seven patients with histologically confirmed cases of odontogenic myxoma of the jaws were managed in a 10-year period. They represent 8.5% of all odontogenic tumours seen during the period. There was a female preponderance with the female to male ratio of 2.4:1. The age range was 11-70 years with majority ...
Twenty Practices of an Entrepreneurial University
DEFF Research Database (Denmark)
Gjerding, Allan Næs; Wilderom, Celeste P.M.; Cameron, Shona P.B.
2006-01-01
studies twenty organisational practices against which a University's entrepreneurship can be measured. These twenty practices or factors in effect formed the basis for an entrepreneurship audit. During a series of interviews, the extent to which the universities are seen as entrepreneurial...
Osemwota, Osamuede; Uhlemann, John; Rubin, Adam
2017-08-01
Twenty-nail transverse melanonychia from hydroxyurea is a rare phenomenon, only reported four times previously. Here we describe a 51-year-old female who presented with 20-nail transverse melanonychia 3 months after initiating hydroxyurea therapy. Transverse melanonychia is a benign process but can cause patients significant distress, and thus is an entity with which dermatologists should recognize. We then review the cutaneous manifestations, differential diagnosis, and clinical considerations when evaluating patients with transverse melanonychia from hydroxyurea or other causes. J Drugs Dermatol. 2017;16(8):814-815..
Endocrine autoimmune diseases and female infertility.
Sen, Aritro; Kushnir, Vitaly A; Barad, David H; Gleicher, Norbert
2014-01-01
An increasing body of evidence suggests that immune-mediated processes affect female reproductive success at multiple levels. Crosstalk between endocrine and immune systems regulates a large number of biological processes that affect target tissues, and this crosstalk involves gene expression, cytokine and/or lymphokine release and hormone action. In addition, endocrine-immune interactions have a major role in the implantation process of the fetal (paternally derived) semi-allograft, which requires a reprogramming process of the maternal immune system from rejection to temporary tolerance for the length of gestation. Usually, the female immune system is supportive of all of these processes and, therefore, facilitates reproductive success. Abnormalities of the female immune system, including autoimmunity, potentially interfere at multiple levels. The relevance of the immune system to female infertility is increasingly recognized by investigators, but clinically is often not adequately considered and is, therefore, underestimated. This Review summarizes the effect of individual autoimmune endocrine diseases on female fertility, and points towards selected developments expected in the near future.
Wang, Dan; De Vito, Giuseppe; Ditroilo, Massimiliano; Fong, Daniel T P; Delahunt, Eamonn
2015-06-01
The objective of this study was to investigate the gender-specific differences in peak torque (PT), muscle stiffness (MS) and musculoarticular stiffness (MAS) of the knee joints in a young active population. Twenty-two male and twenty-two female recreational athletes participated. PT of the knee joint extensor musculature was assessed on an isokinetic dynamometer, MS of the vastus lateralis (VL) muscle was measured in both relaxed and contracted conditions, and knee joint MAS was quantified using the free oscillation technique. Significant gender differences were observed for all dependent variables. Females demonstrated less normalized PT (mean difference (MD)=0.4Nm/kg, p=0.005, η(2)=0.17), relaxed MS (MD=94.2N/m, pjoint injury incidence and prevalence in females when compared to males. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Abdulrahman O. Musaiger
2012-01-01
Full Text Available Objective. The aim of this study was to find out the prevalence of overweight and obesity among adolescents in seven Arab countries using similar reference standard. Methods. A school-based cross-sectional study was carried out in seven cities in Arab countries, namely, Algeria, Jordan, Kuwait, Libya, Palestine, Syria, and United Arab Emirates. A multistage stratified random sampling technique was used. The total sample included was 4698 adolescents aged from 15 to 18 years (2240 males, 2458 females. The International Obesity Task Force (IOTF reference standard was used to classify the adolescents as nonobese, overweight, and obese. Results. Among males, overweight was highest among Kuwaiti adolescents (25.6%, followed by Jordanian (21.6%, and Syrian (19.7% adolescents. Among females, the highest prevalence of overweight was reported in Libyan adolescents (26.6%, followed by Kuwaiti (20.8%, and Syrian (19.7% adolescents. As for obesity, Kuwaiti adolescents showed the highest prevalence of obesity for both males (34.8% and females (20.6%. Conclusion. There is an urgent need to establish a plan of action to combat obesity in schoolchildren in these countries.
Factors Affecting The Levels Of Job Satisfaction Of Female ...
African Journals Online (AJOL)
This meant that more studies on the job attitude of library administrators should be undertaken to lessen this common dissatisfaction among female librarians. The study revealed the need for a new approach to librarianship in Nigeria by considering the human side of the profession as well as its technical side. Samaru ...
Directory of Open Access Journals (Sweden)
Peter J Winsauer
2015-07-01
Full Text Available The effects of hormone status and age on the development of tolerance to D9-THC were assessed in sham-operated (intact or ovariectomized (OVX female rats that received either intraperitoneal saline or 5.6 mg/kg of D9-THC daily from postnatal day (PD 75 to 180 (early adulthood onward or PD 35 to 140 (adolescence onward. During this time, the 4 groups for each age (i.e., intact/saline, intact/THC, OVX/saline, and OVX/THC were trained in a learning and performance procedure and dose-effect curves were established for D9-THC (0.56-56 mg/kg and the cannabinoid type-1 receptor (CB1R antagonist rimonabant (0.32-10 mg/kg. Despite the persistence of small rate-decreasing and error-increasing effects in intact and OVX females from both ages during chronic D9-THC, all of the D9-THC groups developed tolerance. However, the magnitude of tolerance, as well as the effect of hormone status, varied with the age at which chronic D9-THC was initiated. There was no evidence of dependence in any of the groups. Hippocampal protein expression of CB1R, AHA1 (a co-chaperone of CB1R and HSP90β (a molecular chaperone modulated by AHA-1 was affected more by OVX than chronic D9-THC; striatal protein expression was not consistently affected by either manipulation. Hippocampal BDNF expression varied with age, hormone status, and chronic treatment. Thus, hormonal status differentially affects the development of tolerance to the disruptive effects of delta-9-tetrahydrocannabinol (D9-THC on learning and performance behavior in adolescent, but not adult, female rats. These factors and their interactions also differentially affect cannabinoid signaling proteins in the hippocampus and striatum, and ultimately, neural plasticity.
Aging differentially affects male and female neural stem cell neurogenic properties
Directory of Open Access Journals (Sweden)
Jay Waldron
2010-09-01
Full Text Available Jay Waldron1, Althea McCourty1, Laurent Lecanu1,21The Research Institute of the McGill University Health Centre, Montreal, Canada; 2Department of Medicine, McGill University, Montreal, Quebec, CanadaPurpose: Neural stem cell transplantation as a brain repair strategy is a very promising technology. However, despite many attempts, the clinical success remains very deceiving. Despite clear evidence that sexual dimorphism rules many aspects of human biology, the occurrence of a sex difference in neural stem cell biology is largely understudied. Herein, we propose to determine whether gender is a dimension that drives the fate of neural stem cells through aging. Should it occur, we believe that neural stem cell sexual dimorphism and its variation during aging should be taken into account to refine clinical approaches of brain repair strategies.Methods: Neural stem cells were isolated from the subventricular zone of three- and 20-month-old male and female Long-Evans rats. Expression of the estrogen receptors, ERα and ERβ, progesterone receptor, androgen receptor, and glucocorticoid receptor was analyzed and quantified by Western blotting on undifferentiated neural stem cells. A second set of neural stem cells was treated with retinoic acid to trigger differentiation, and the expression of neuronal, astroglial, and oligodendroglial markers was determined using Western blotting.Conclusion: We provided in vitro evidence that the fate of neural stem cells is affected by sex and aging. Indeed, young male neural stem cells mainly expressed markers of neuronal and oligodendroglial fate, whereas young female neural stem cells underwent differentiation towards an astroglial phenotype. Aging resulted in a lessened capacity to express neuron and astrocyte markers. Undifferentiated neural stem cells displayed sexual dimorphism in the expression of steroid receptors, in particular ERα and ERβ, and the expression level of several steroid receptors increased
Thirty-seven transcription factor genes differentially respond to a ...
Indian Academy of Sciences (India)
Plant transcription factors and insect defence si. Thirty-seven transcription factor genes differentially respond to a harpin protein and affect resistance to the green peach aphid in Arabidopsis. HUNLIN. PIN. RUOXUE LIŲ, BEIBEI LÜ, XIAOMENG WANG, CHUNLING ZHANG, SHUPING ZHANG, JUN QIAN, LEI CHEN,.
Wu, Meng-Shan Sharon; Chaney, Isabella; Chen, Cheng-Hao Steven; Nguyen, Bang; Melewar, T. C.
2015-01-01
Purpose - Against the background of increasing consumption of luxury fashion brands by young female consumers in Asian countries, this paper offers insights into the consumption motives and purchasing behaviour of that market segment in Taiwan.\\ud \\ud Design/methodology/approach - Analysis of data collected using face-to-face semi-structured interviews with twenty-three 18-32 year-old fashion-conscious females was completed and new empirical insights are offered.\\ud \\ud Findings - The study f...
La Rosa, Raffica J; Conner, Jeffrey K
2017-01-01
Central questions in plant reproductive ecology are whether the functions of floral traits in hermaphrodites create conflict between sexes that could slow evolution, and whether individual floral traits function in pollinator attraction, efficiency, or both. We studied how floral traits affect pollinator visitation and efficiency, and how they affect male and female function and female fitness within and across three Asclepias species that differ in floral morphology. Using separate multiple regressions, we regressed pollen removal, deposition, and fruit number onto six floral traits. We also used path analyses integrating these variables with pollinator visitation data for two of the species to further explore floral function and its effects on fruit production. Most traits affected male pollination success only, and these effects often differed between species. The exception was increased slit length, which increased pollinia insertion in two of the species. There were no interspecific differences in the effects of the traits on female pollination success. All traits except horn reach affected pollination efficiency in at least one species, and horn reach and two hood dimensions were the only traits to affect pollinator attraction, but in just one species. Traits tended to function in only one sex, and more traits affected function through pollinator efficiency than through attraction. There was no significant link between female pollination success and female fitness in any of the three species; this pattern is consistent with fruit production not being limited by pollen deposition. © 2017 Botanical Society of America.
Percutaneous gastrostomy -a report of twenty-seven cases-
International Nuclear Information System (INIS)
Kim, Tae Ho; Lee, Ho Suk; Kim, Yong Joo; Kim, Tae Hun; Suh, Kyung Jin; Kang, Duk Sik
1991-01-01
Nutritional support by gastrostomy feeding is an important treatment adjunct when major swallowing difficulty or debilitating diseases is present. This technique for percutaneous placement of a gastric feeding tube now provides many patients with a simple, safe, and well-tolerated alternative to surgical feeding gastrostomy. We experienced 27 cases of percutaneous gastrostomy from January 1989 to February 1991 at Kyungpook National University Hospital. The underlying diseases of the patients were esophageal cancer (11), pyriform sinus cancer (4), laryngeal cancer (3), tongue cancer (2), lye stricture (1), lung cancer (1), chordoma (1), lethal midline granuloma (1), malignant lymphoma (1), maxillary cancer (1), and tonsil cancer (1). Selding method was used in all cases. In five patients it was difficult to insert the nasogastric tube for air insufflation, and one patient had subtotal gastrectomy with gastrojejunostomy, but gastrostomy was performed in all cases. The general condition improved in all patients. We experienced one case of mild peritonitis, but no other significant complications were observed. Gastrostomy tubes were patient in all patients during their survival period, except two patients who experienced obstruction 2 and 6 months after the procedure. Percutaneous gastrostomy can be used safely and effectively in such patients who have pharyngoesophageal or CNS lesions precluding oral intake
Inbreeding affects sexual signalling in males but not females of Tenebrio molitor.
Pölkki, Mari; Krams, Indrikis; Kangassalo, Katariina; Rantala, Markus J
2012-06-23
In many species of animals, individuals advertise their quality with sexual signals to obtain mates. Chemical signals such as volatile pheromones are species specific, and their primary purpose is to influence mate choice by carrying information about the phenotypic and genetic quality of the sender. The deleterious effects of consanguineous mating on individual quality are generally known, whereas the effect of inbreeding on sexual signalling is poorly understood. Here, we tested whether inbreeding reduces the attractiveness of sexual signalling in the mealworm beetle, Tenebrio molitor, by testing the preferences for odours of inbred and outbred (control) individuals of the opposite sex. Females were more attracted to the odours produced by outbred males than the odours produced by inbred males, suggesting that inbreeding reduces the attractiveness of male sexual signalling. However, we did not find any difference between the attractiveness of inbred and outbred female odours, which may indicate that the quality of females is either irrelevant for T. molitor males or quality is not revealed through female odours.
Directory of Open Access Journals (Sweden)
D. Ramos
2011-02-01
Full Text Available The combined influence of tempo and mode on emotional responses to music was studied by crossing 7 changes in mode with 3 changes in tempo. Twenty-four musicians aged 19 to 25 years (12 males and 12 females and 24 nonmusicians aged 17 to 25 years (12 males and 12 females were required to perform two tasks: 1 listening to different musical excerpts, and 2 associating an emotion to them such as happiness, serenity, fear, anger, or sadness. ANOVA showed that increasing the tempo strongly affected the arousal (F(2,116 = 268.62, mean square error (MSE = 0.6676, P < 0.001 and, to a lesser extent, the valence of emotional responses (F(6,348 = 8.71, MSE = 0.6196, P < 0.001. Changes in modes modulated the affective valence of the perceived emotions (F(6,348 = 4.24, MSE = 0.6764, P < 0.001. Some interactive effects were found between tempo and mode (F (1,58 = 115.6, MSE = 0.6428, P < 0.001, but, in most cases, the two parameters had additive effects. This finding demonstrates that small changes in the pitch structures of modes modulate the emotions associated with the pieces, confirming the cognitive foundation of emotional responses to music.
Anti-mycobacterial recall responses differentiate female patients ...
African Journals Online (AJOL)
Preferred Customer
patients with genital tuberculosis from patients with other gynecological ... Lakew2. Abstract. Background: Female Genital Tuberculosis (FGTB) is one form of extra pulmonary tuberculosis affecting the female ..... major secretion product of.
Strategies of Female Members of Parliament in Developing Empathy Values to Gain Constituent Support
Ridhahani
2017-01-01
This qualitative research aims to describe the strategies applied by female parliamentary candidates to develop empathy values to gain constituent support in the legislative general election in 2014. Research subjects comprise 12 female members of parliament from seven regencies/cities in South Kalimantan who were chosen from different…
Health of Europeans twenty years after the fall of Berlin wall.
Ginter, E; Simko, V
2010-01-01
The failure of central planning in the totalitarian systems of the USSR and its satellites adversely affected not only the economy and social relations but also the population health. While in the countries with established democracy (DEM) the general health and the life expectancy (LE) steadily improved, in countries declaring socialism (SOC) the LE was stagnant and in the USSR even decreased. Dramatic changes in Russia after the demise of Soviet Union resulted in an extraordinary destabilization of LE that reached a minimum in 1994. Remarkably, even twenty years after the breakdown of the Iron Curtain there persists a gap in the general health between the DEM and the SOC regions of Europe. Within the territory of the former Soviet influence there are additional differences in LE: Central Europe is much better off than Russia and its neighbours. Main cause of relatively high mortality in the post totalitarian Europe is the cardiovascular disease (CVD). Among females about 80% difference in LE between DEM and SOC countries is related to premature CVD mortality. In SOC males compared to DEM, about 50% of the higher mortality is caused by CVD, 20% is related to external factors (trauma, suicide) and 10% is oncologic disorders. The main suggested cause of such excess mortality, besides a low socioeconomic level and limited funding for health care, is an improper life style: alcoholism, smoking and inadequate intake of protective nutrients. Alcoholism, especially binge drinking is a prominent factor in Russia, Belarus, Ukraine and in the Baltic Republics (Fig. 6, Tab. 4, Ref. 20).
Women on board: female board membership as a form of elite democratization
Heemskerk, E.M.; Fennema, M.
2014-01-01
Corporate elites have been all-male bastions until the twenty-first century. The recent inclusion of women in the corporate elite needs explanation because it is an abrupt change in recruitment practices. We consider female presence in corporate boards as a sign of the democratization of elite
Shukla, Shantanu; Pareek, Vidhi; Gadagkar, Raghavendra
2014-07-01
In many primitively eusocial wasp species new nests are founded either by a single female or by a small group of females. In the single foundress nests, the lone female develops her ovaries, lays eggs as well as tends her brood. In multiple foundress nests social interactions, especially dominance-subordinate interactions, result in only one 'dominant' female developing her ovaries and laying eggs. Ovaries of the remaining 'subordinate' cofoundresses remain suppressed and these individuals function as workers and tend the dominant's brood. Using the tropical, primitively eusocial polistine wasp Ropalidia marginata and by comparing wasps held in isolation and those kept as pairs in the laboratory, we demonstrate that social interactions affect ovarian development of dominant and subordinate wasps among the pairs in opposite directions, suppressing the ovaries of the subordinate member of the pair below that of solitary wasps and boosting the ovaries of dominant member of the pair above that of solitary females. In addition to being of physiological interest, such mirror image effects of aggression on the ovaries of the aggressors and their victims, suggest yet another mechanism by which subordinates can enhance their indirect fitness and facilitate the evolution of worker behavior by kin selection. Copyright © 2014 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Fesenko, S V [International Atomic Energy Agency, 1400 Vienna (Austria); Alexakhin, R M [Russian Institute of Agricultural Radiology and Agroecology, 249020 Obninsk (Russian Federation); Balonov, M I [International Atomic Energy Agency, 1400 Vienna (Austria); Bogdevich, I M [Research Institute for Soil Science and Agrochemistry, Minsk (Belarus); Howard, B J [Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Avenue, Bailrigg, Lancaster LAI 4AP (United Kingdom); Kashparov, V A [Ukrainian Institute of Agricultural Radiology (UIAR), Mashinostroiteley Street 7, Chabany, Kiev Region 08162 (Ukraine); Sanzharova, N I [Russian Institute of Agricultural Radiology and Agroecology, 249020 Obninsk (Russian Federation); Panov, A V [Russian Institute of Agricultural Radiology and Agroecology, 249020 Obninsk (Russian Federation); Voigt, G [International Atomic Energy Agency, 1400 Vienna (Austria); Zhuchenka, Yu M [Research Institute of Radiology, 246000 Gomel (Belarus)
2006-12-15
The accident at the Chernobyl NPP (nuclear power plant) was the most serious ever to have occurred in the history of nuclear energy. The consumption of contaminated foodstuffs in affected areas was a significant source of irradiation for the population. A wide range of different countermeasures have been used to reduce exposure of people and to mitigate the consequences of the Chernobyl accident for agriculture in affected regions in Belarus, Russia and Ukraine. This paper for the first time summarises key data on countermeasure application over twenty years for all three countries and describes key lessons learnt from this experience. (review)
Developmental programming by androgen affects the circadian timing system in female mice.
Mereness, Amanda L; Murphy, Zachary C; Sellix, Michael T
2015-04-01
Circadian clocks play essential roles in the timing of events in the mammalian hypothalamo-pituitary-ovarian (HPO) axis. The molecular oscillator driving these rhythms has been localized to tissues of the HPO axis. It has been suggested that synchrony among these oscillators is a feature of normal reproductive function. The impact of fertility disorders on clock function and the role of the clock in the etiology of endocrine pathology remain unknown. Polycystic ovarian syndrome (PCOS) is a particularly devastating fertility disorder, affecting 5%-10% of women at childbearing age with features including a polycystic ovary, anovulation, and elevated serum androgen. Approximately 40% of these women have metabolic syndrome, marked by hyperinsulinemia, dyslipidemia, and insulin resistance. It has been suggested that developmental exposure to excess androgen contributes to the etiology of fertility disorders, including PCOS. To better define the role of the timing system in these disorders, we determined the effects of androgen-dependent developmental programming on clock gene expression in tissues of the metabolic and HPO axes. Female PERIOD2::luciferase (PER2::LUC) mice were exposed to androgen (dihydrotestosterone [DHT]) in utero (Days 16-18 of gestation) or for 9-10 wk (DHT pellet) beginning at weaning (pubertal androgen excess [PAE]). As expected, both groups of androgen-treated mice had disrupted estrous cycles. Analysis of PER2::LUC expression in tissue explants revealed that excess androgen produced circadian misalignment via tissue-dependent effects on phase distribution. In vitro treatment with DHT differentially affected the period of PER2::LUC expression in tissue explants and granulosa cells, indicating that androgen has direct and tissue-specific effects on clock gene expression that may account for the effects of developmental programming on the timing system. © 2015 by the Society for the Study of Reproduction, Inc.
Capital in the Twenty-First Century
DEFF Research Database (Denmark)
Hansen, Per H.
2014-01-01
Review essay on: Capital in the Twenty-First Century. By Thomas Piketty . Translated by Arthur Goldhammer . Cambridge, Mass.: The Belknap Press of Harvard University Press, 2014. viii + 685 pp......Review essay on: Capital in the Twenty-First Century. By Thomas Piketty . Translated by Arthur Goldhammer . Cambridge, Mass.: The Belknap Press of Harvard University Press, 2014. viii + 685 pp...
Radio-transmitters do not affect seasonal productivity of female Golden-winged Warblers
Streby, Henry M.; Peterson, Sean M.; Gesmundo, Callie; Johnson, Michael K.; Fish, Alexander C.; Lehman, Justin A.; Andersen, David E.
2013-01-01
Investigating the potential effects of handling and marking techniques on study animals is important for correct interpretation of research results and to effect progress in data-collection methods. Few investigators have compared the reproductive output of radio-tagged and non-radio-tagged songbirds, and no one to date has examined the possible effect of radio-tagging adult songbirds on the survival of their fledglings. In 2011 and 2012, we compared several parameters of reproductive output of two groups of female Golden-winged Warblers (Vermivora chrysoptera) breeding in Minnesota, including 45 females with radio-transmitters and 73 females we did not capture, handle, or mark. We found no difference between groups in clutch sizes, hatching success, brood sizes, length of incubation and nestling stages, fledging success, number of fledglings, or survival of fledglings to independence. Thus, radio-tags had no measurable impact on the productivity of female Golden-winged Warblers. Our results build upon previous studies where investigators have reported no effects of radio-tagging on the breeding parameters of songbirds by also demonstrating no effect of radio-tagging through the post-fledging period and, therefore, the entire breeding season.
Wellness of Minority Female Counselor Educators
Shillingford, M. Ann; Trice-Black, Shannon; Butler, S. Kent
2013-01-01
Minority female counselor educators are faced with numerous challenges. This qualitative study revealed that for female minority counselor educators, these challenges continue to negatively affect their professional and personal experiences. It is through operational wellness practices and optimal balance and functioning that minority female…
Directory of Open Access Journals (Sweden)
Christel Depienne
2009-02-01
Full Text Available Dravet syndrome (DS is a genetically determined epileptic encephalopathy mainly caused by de novo mutations in the SCN1A gene. Since 2003, we have performed molecular analyses in a large series of patients with DS, 27% of whom were negative for mutations or rearrangements in SCN1A. In order to identify new genes responsible for the disorder in the SCN1A-negative patients, 41 probands were screened for micro-rearrangements with Illumina high-density SNP microarrays. A hemizygous deletion on chromosome Xq22.1, encompassing the PCDH19 gene, was found in one male patient. To confirm that PCDH19 is responsible for a Dravet-like syndrome, we sequenced its coding region in 73 additional SCN1A-negative patients. Nine different point mutations (four missense and five truncating mutations were identified in 11 unrelated female patients. In addition, we demonstrated that the fibroblasts of our male patient were mosaic for the PCDH19 deletion. Patients with PCDH19 and SCN1A mutations had very similar clinical features including the association of early febrile and afebrile seizures, seizures occurring in clusters, developmental and language delays, behavioural disturbances, and cognitive regression. There were, however, slight but constant differences in the evolution of the patients, including fewer polymorphic seizures (in particular rare myoclonic jerks and atypical absences in those with PCDH19 mutations. These results suggest that PCDH19 plays a major role in epileptic encephalopathies, with a clinical spectrum overlapping that of DS. This disorder mainly affects females. The identification of an affected mosaic male strongly supports the hypothesis that cellular interference is the pathogenic mechanism.
Evolutionary Influences on Attribution and Affect
Directory of Open Access Journals (Sweden)
Jennie Brown
2017-12-01
Full Text Available Evolutionary theory was applied to Reeder and Brewer's schematic theory and Trafimow's affect theory to extend this area of research with five new predictions involving affect and ability attributions, comparing morality and ability attributions, gender differences, and reaction times for affect and attribution ratings. The design included a 2 (Trait Dimension Type: HR, PR × 2 (Behavior Type: morality, ability × 2 (Valence: positive, negative × 2 (Replication: original, replication × 2 (Sex: female or male actor × 2 (Gender: female or male participant × 2 (Order: attribution portion first, affect portion first mixed design. All factors were within participants except the order and participant gender. Participants were presented with 32 different scenarios in which an actor engaged in a concrete behavior after which they made attributions and rated their affect in response to the behavior. Reaction times were measured during attribution and affect ratings. In general, the findings from the experiment supported the new predictions. Affect was related to attributions for both morality and ability related behaviors. Morality related behaviors received more extreme attribution and affect ratings than ability related behaviors. Female actors received stronger attribution and affect ratings for diagnostic morality behaviors compared to male actors. Male and female actors received similar attribution and affect ratings for diagnostic ability behaviors. Diagnostic behaviors were associated with lower reaction times than non-diagnostic behaviors. These findings demonstrate the utility of evolutionary theory in creating new hypotheses and empirical findings in the domain of attribution.
The Twenty-five Maiden Ladies’ Tomb and Predicaments of the Feminist Movement in Taiwan
Directory of Open Access Journals (Sweden)
Anru Lee
2010-01-01
Full Text Available “The Twenty-five Maiden Ladies’ Tomb” is the collective burial site of the female workers who died in a ferry accident on their way to work in 1973. The fact that of the more than 70 passengers on board all 25 who died were unmarried young women, and the taboo in Taiwanese culture that shuns unmarried female ghosts, made the Tomb a fearsome place. Feminists in Gaoxiong (高雄 had for some years wanted the city government to change the tomb’s public image. Their calls were not answered until the Gaoxiong mayor’s office finally allocated money to clean up the gravesite and, as part of the city’s plans to develop urban tourism, to remake it into the tourist-friendly “Memorial Park for Women Labourers”. Consequently, even though the tomb renovation seemed to indicate a triumph of the feminist endeavour, it was more a result of the Gaoxiong city government’s efforts towards culture-led urban revitalization.
Abnormal neuroendocrine response to clomipramine in hereditary affective psychosis.
Cordes, Joachim; Larisch, Rolf; Henning, Uwe; Thünker, Johanna; Werner, Christian; Orozco, Guillermo; Mayoral, Fermín; Rivas, Fabio; Auburger, Georg; Tosch, Marco; Rietschel, Marcella; Gaebel, Wolfgang; Müller, Hans-Wilhelm; Klimke, Ansgar
2009-01-01
Blunting of prolactin response after serotonergic stimulation during a major depressive episode has been described by several investigators. In this study, the neuroendocrine responses to clomipramine were assessed in remitted patients suffering from hereditary depression. Twenty remitted patients from 11 large families with multigenerational, multiple cases of major affective disorder (bipolar disorder n=15, recurrent depression n=5, according DSM-IV) and 12 healthy relatives were investigated. After intravenous application of 12.5 mg of the serotonin re-uptake inhibitor clomipramine, serum prolactin and cortisol levels were analysed. Patients and comparison group did not differ significantly with respect to age, baseline prolactin and cortisol concentrations. A gender effect was found in an exploratory analysis for prolactin but not for cortisol and therefore the data for prolactin were analysed separately. After clomipramine infusion, the increase of cortisol was significantly lower in patients than in the comparison group (P=.046). For prolactin, this effect could be found in the male (P=.012) as well as in the female (P=.007) subsample. These results suggest that blunted prolactin and cortisol responses to serotonergic stimulation are characteristic for remitted depressive patients with previous episodes of major affective disorders. (c) 2009 Wiley-Liss, Inc.
Identification of transcription-factor genes expressed in the Arabidopsis female gametophyte
Directory of Open Access Journals (Sweden)
Kang Il-Ho
2010-06-01
Full Text Available Abstract Background In flowering plants, the female gametophyte is typically a seven-celled structure with four cell types: the egg cell, the central cell, the synergid cells, and the antipodal cells. These cells perform essential functions required for double fertilization and early seed development. Differentiation of these distinct cell types likely involves coordinated changes in gene expression regulated by transcription factors. Therefore, understanding female gametophyte cell differentiation and function will require dissection of the gene regulatory networks operating in each of the cell types. These efforts have been hampered because few transcription factor genes expressed in the female gametophyte have been identified. To identify such genes, we undertook a large-scale differential expression screen followed by promoter-fusion analysis to detect transcription-factor genes transcribed in the Arabidopsis female gametophyte. Results Using quantitative reverse-transcriptase PCR, we analyzed 1,482 Arabidopsis transcription-factor genes and identified 26 genes exhibiting reduced mRNA levels in determinate infertile 1 mutant ovaries, which lack female gametophytes, relative to ovaries containing female gametophytes. Spatial patterns of gene transcription within the mature female gametophyte were identified for 17 transcription-factor genes using promoter-fusion analysis. Of these, ten genes were predominantly expressed in a single cell type of the female gametophyte including the egg cell, central cell and the antipodal cells whereas the remaining seven genes were expressed in two or more cell types. After fertilization, 12 genes were transcriptionally active in the developing embryo and/or endosperm. Conclusions We have shown that our quantitative reverse-transcriptase PCR differential-expression screen is sufficiently sensitive to detect transcription-factor genes transcribed in the female gametophyte. Most of the genes identified in this
Reversal Surgery in Regretful Male-to-Female Transsexuals After Sex Reassignment Surgery.
Djordjevic, Miroslav L; Bizic, Marta R; Duisin, Dragana; Bouman, Mark-Bram; Buncamper, Marlon
2016-06-01
Sex reassignment surgery (SRS) has proved an effective intervention for patients with gender identity disorder. However, misdiagnosed patients sometimes regret their decision and request reversal surgery. This review is based on our experience with seven patients who regretted their decision to undergo male-to-female SRS. To analyze retrospectively seven patients who underwent reversal surgery after regretting their decision to undergo male-to-female SRS elsewhere. From November 2010 through November 2014, seven men 33 to 53 years old with previous male-to-female SRS underwent reversal phalloplasty. Preoperatively, they were examined by three independent psychiatrists. Surgery included three steps: removal of female genitalia with scrotoplasty and urethral lengthening, total phalloplasty with microvascular transfer of a musculocutaneous latissimus dorsi flap, and neophallus urethroplasty with penile prosthesis implantation. Self-reported esthetic and psychosexual status after reversion surgery and International Index of Erectile Function scores for sexual health after phalloplasty and penile prosthesis implantation. Follow-up was 13 to 61 months (mean = 31 months). Good postoperative results were achieved in all patients. In four patients, all surgical steps were completed; two patients are currently waiting for penile implants; and one patient decided against the penile prosthesis. Complications were related to urethral lengthening: two fistulas and one stricture were observed. All complications were repaired by minor revision. According to patients' self-reports, all patients were pleased with the esthetic appearance of their genitalia and with their significantly improved psychological status. Reversal surgery in regretful male-to-female transsexuals after SRS represents a complex, multistage procedure with satisfactory outcomes. Further insight into the characteristics of persons who regret their decision postoperatively would facilitate better future
Taskin, Cengiz
2016-01-01
The aim of this study was examination of academic achievement of early adolescents with visual impairments. Eighty eight children from Turkey, (age = 12.30 ± 1.22 years; height = 144.10 ± 5.51 cm; weight = 41.45 ± 4.68 kg) for twenty female athletes, (age = 12.30 ± 1.79; height = 151.04 ± 7.49 cm; weight = 48.18 ± 7.63 kg) for twenty seven male…
Park, Hyunchul; Kim, Eunjin; Kim, Jeongeun; Ro, Youngsuck; Ko, Jooyeon
2015-01-01
Background High-intensity focused ultrasound (HIFU) treatment has recently emerged in response to the increasing demand for noninvasive procedures for skin lifting and tightening. Objective This study was aimed at evaluating the clinical efficacy of and patient satisfaction with HIFU treatment for wrinkles and laxity in seven different areas of the face in Asian skin. Methods Twenty Korean patients with facial wrinkle and laxity were analyzed after a single session of HIFU treatment. Two inde...
Pazzinatto, Marcella Ferraz; de Oliveira Silva, Danilo; Barton, Christian; Rathleff, Michael Skovdal; Briani, Ronaldo Valdir; de Azevedo, Fábio Mícolis
2016-10-01
Compare pressure pain thresholds (PPTs) at the knee and a site remote to the knee in female adults with patellofemoral pain (PFP) to pain-free controls before and after a patellofemoral joint (PFJ) loading protocol designed to aggravate symptoms. Cross-sectional study SETTING: Participants were recruited via advertisements in fitness centers, public places for physical activity and universities. Thirty-eight females with patellofemoral pain, and 33 female pain-free controls. All participant performed a novel PFJ loading protocol involving stair negotiation with an extra load equivalent 35% of body mass. PPTs and current knee pain (measured on a visual analogue scale) was assessed before and after the loading protocol. PPTs were measured at four sites around the knee and one remote site on the upper contralateral limb. Females with PFP demonstrated significantly lower PPTs locally and remote to the knee, both before and after the PFJ loading protocol when compared to control group. Following the loading protocol, PPTs at knee were significantly reduced by 0.54 kgf (95%CI = 0.33; 0.74) for quadriceps tendon, 0.38 kgf (95%CI = 0.14; 0.63) for medial patella, and 0.44 kgf (95%CI = 0.18; 0.69) for lateral patella. No significant change in PPT remote to the knee was observed - 0.10 kgf (95%CI = -0.04; 0.24). Female adults with PFP have local and widespread hyperalgesia compared to pain free controls. A novel loading protocol designed to aggravate symptoms, lowers the PPTs locally at the knee but has no effect on PPT on the upper contralateral limb. This suggests widespread hyperalgesia is not affected by acute symptom aggravation. © 2016 American Academy of Pain Medicine. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Musaitif, Linda M.
Purpose. The purpose of this study was to determine the degree to which undergraduate full-time and adjunct faculty members in the health and science programs at community colleges in Southern California utilize the seven principles of good practice as measured by the Faculty Inventory of the Seven Principles for Good Practice in Undergraduate Education. A second purpose was to compare degree of utilization for gender and class size. Methodology. This is a quantitative study wherein there exists a systematic and mathematical assessment of data gathered through the use of a Likert scale survey to process and determine the mathematical model of the use of the principles by the target population of both full-time and adjunct faculty of health/science programs of community colleges in Southern California. Findings. Examination of the data revealed that both full-time and adjunct faculty members of Southern California community colleges perceive themselves a high degree of utilization of the seven principles of good practice. There was no statistically significant data to suggest a discrepancy between full-time and adjunct professors' perceptions among the utilization of the seven principles. Overall, male faculty members perceived themselves as utilizing the principles to a greater degree than female faculty. Data suggest that faculty with class size 60 or larger showed to utilize the seven principles more frequently than the professors with smaller class sizes. Conclusions. Full-time and adjunct professors of the health and sciences in Southern California community colleges perceive themselves as utilizing the seven principles of good practice to a high degree. Recommendations. This study suggests many recommendations for future research, including the degree to which negative economic factors such as budget cuts and demands affect the utilization of the seven principles. Also recommended is a study comparing students' perceptions of faculty's utilization of the seven
Jobs and kids: Female employment and fertility in China
Fang, Hai; Eggleston, Karen N.; Rizzo, John A.; Zeckhauser, Richard J.
2013-01-01
Data on 2,355 married women from the 2006 China Health and Nutrition Survey are used to study how female employment affects fertility in China. China has deep concerns with both population size and female employment, so the relationship between the two should be better understood. Causality flows in both directions. A conceptual model shows how employment prospects affect fertility. Then a well-validated instrumental variable isolates this effect. Female employment reduces a married woman’s...
D'hooghe, M. B.; D'Hooghe, T.; De Keyser, J.
2013-01-01
Multiple sclerosis (MS), a chronic inflammatory demyelinating and degenerative disease of the central nervous system, is a frequent cause of neurological disability in young adults. Female predominance has increased over the last decades. Although female gender carries a higher risk of developing
Hazari, Zahra; Potvin, Geoff; Lock, Robynne M.; Lung, Florin; Sonnert, Gerhard; Sadler, Philip M.
2013-12-01
There are many hypotheses regarding factors that may encourage female students to pursue careers in the physical sciences. Using multivariate matching methods on national data drawn from the Persistence Research in Science and Engineering (PRiSE) project (n=7505), we test the following five commonly held beliefs regarding what factors might impact females’ physical science career interest: (i) having a single-sex physics class, (ii) having a female physics teacher, (iii) having female scientist guest speakers in physics class, (iv) discussing the work of female scientists in physics class, and (v) discussing the underrepresentation of women in physics class. The effect of these experiences on physical science career interest is compared for female students who are matched on several factors, including prior science interests, prior mathematics interests, grades in science, grades in mathematics, and years of enrollment in high school physics. No significant effects are found for single-sex classes, female teachers, female scientist guest speakers, and discussing the work of female scientists. However, discussions about women’s underrepresentation have a significant positive effect.
Span, Sherry A; Vidal, Lourdes A
2003-04-01
62 Caucasian, 61 Hispanic, and 44 Asian female undergraduates completed the Index of Homophobia by Hudson and Ricketts, seven items from the Attitudes Toward Lesbians and Gay Men Scale by Herek, and three questions on Affectional Orientation toward homosexuals from D'Augelli and Rose. Overall, familiarity with homosexuals as measured by self-reported number of homosexual friends correlated negatively with scores on the homophobia measures, but there were no significant differences among the groups' reported number of homosexual friends. Asian students scored significantly higher on the homophobia measures than Caucasian students. Both Asian and Hispanic students endorsed the statement significantly more often than Caucasian students that the university would be better if only heterosexuals attended. No significant differences in scores were found regarding attitudes toward lesbians versus gay men.
Twenty-one year old female with an iris tumor: a case report
International Nuclear Information System (INIS)
Zettinig, G.; Kurtaran, A.; Dudczak, R.; Maca, S.; Barisani, T.; Horvat, R.
2002-01-01
Full text: A 21-year-old female with multiple granulomas an the right iris with concomitant therapy refractive panuveitis was referred to the Department of Ophthalmology to exclude an ocular malignancy. The patient had a history of minimal change glomerulonephritis and cutaneous granulomas at the age of six years that were successfully treated with cyclophosphamide. Her visual acuity initially already reduced to 30 % decreased rapidly to 'counting fingers'. A clinical work-up including chest x-ray, spiral computed tomography of the lungs and a detailed serological examination including angiotensin converting enzyme showed no evidence of infection or neoplasia. Planar scintigraphy 24 hours after administration of 185 MBq Gallium-67 citrate demonstrated an intense tracer accumulation in both lacrimal glands. Salivary gland uptake was normal and there was only a faint accumulation in the mediastinum interpreted as normal. A biopsy of the right iris revealed a granulomatous non caseating inflammation diagnosed as sarcoidosis. A systemic combination treatment with prednisolone and methotrexate for 4 months could not control the inflammation. After therapy was changed to cyclosporine the inflammation decreased and visual acuity decreased to 60 %. Neither a 'lambda sign' (characteristic uptake of Ga-67 in intrathoracic lymph nodes resembling the Greek letter lambda) nor a typical 'panda sign' (bilateral salivary and lacrimal gland uptake of Ga-67) commonly present in sarcoidosis were seen in our patient. This case demonstrates that in individual patients with sarcoidosis, lacrimal gland uptake of Ga-67 may be the only significant noninvasive finding. (author)
Andrade, Marilia Dos Santos; Fleury, Anna Maria; de Lira, Claudio Andre Barbosia; Dubas, Joao Paulo; da Silva, Antonio Carlos
2010-05-01
The purpose of this study was to establish the isokinetic profile of shoulder rotator muscles strength in female handball players. Twenty-seven handball players performed concentric and eccentric strength tests of both dominant and non-dominant upper limbs on an isokinetic dynamometer. Internal and external rotator muscles peak torque was assessed at 1.05, 3.14, and 5.23 rad . s(-1) in concentric mode and at 3.14 and 5.23 rad . s(-1) in eccentric mode. Concentric balance ratio and functional ratio were obtained. Bi-lateral deficiency was compared. Concentric strength for internal and external rotation was significantly greater for the dominant than for the non-dominant limb for all speeds (P muscles were stronger in the dominant than the non-dominant limb (P stronger than the non-dominant side, balance concentric ratios remained the same, with only the functional strength ratio different at 5.23 rad . s(-1). Our results suggest that concentric strength exercises be used for internal and external rotators on the non-dominant side, and functional exercise that improves eccentric rotation strength for prevention programmes.
Lejbak, Lisa; Vrbancic, Mirna; Crossley, Margaret
2009-01-01
This study extends Duff and Hampson's [Duff, S., & Hampson, E. (2001). A sex difference on a novel spatial working memory task in humans. "Brain and Cognition, 47," 470-493] finding of a sex-related difference in favor of females for an object location memory task. Twenty female and 20 male undergraduate students performed both manual and…
Chaturvedi, Arvind K; Craft, Kristi J; Cardona, Patrick S; Rogers, Paul B; Canfield, Dennis V
2009-05-01
During toxicological evaluations of samples from fatally injured pilots involved in civil aviation accidents, a high degree of quality control/quality assurance (QC/QA) is maintained. Under this philosophy, the Federal Aviation Administration (FAA) started a forensic toxicology proficiency-testing (PT) program in July 1991. In continuation of the first seven years of the PT findings reported earlier, PT findings of the next seven years are summarized herein. Twenty-eight survey samples (12 urine, 9 blood, and 7 tissue homogenate) with/without alcohols/volatiles, drugs, and/or putrefactive amine(s) were submitted to an average of 31 laboratories, of which an average of 25 participants returned their results. Analytes in survey samples were correctly identified and quantitated by a large number of participants, but some false positives of concern were reported. It is anticipated that the FAA's PT program will continue to serve the forensic toxicology community through this important part of the QC/QA for laboratory accreditations.
Electricity consumption and economic growth in seven South American countries
International Nuclear Information System (INIS)
Yoo, Seung-Hoon; Kwak, So-Yoon
2010-01-01
This paper attempts to investigate the causal relationship between electricity consumption and economic growth among seven South American countries, namely Argentina, Brazil, Chile, Columbia, Ecuador, Peru, and Venezuela using widely accepted time-series techniques for the period 1975-2006. The results indicate that the causal nexus between electricity consumption and economic growth varies across countries. There is a unidirectional, short-run causality from electricity consumption to real GDP for Argentina, Brazil, Chile, Columbia, and Ecuador. This means that an increase in electricity consumption directly affects economic growth in those countries. In Venezuela, there is a bidirectional causality between electricity consumption and economic growth. This implies that an increase in electricity consumption directly affects economic growth and that economic growth also stimulates further electricity consumption in that country. However, no causal relationships exist in Peru. The documented evidence from seven South American countries can provide useful information for each government with regard to energy and growth policy.
Energy Technology Data Exchange (ETDEWEB)
Kim, Ok-Hwa [Ajou University Hospital, Department of Radiology, Suwon (Korea); Cho, Tae-Joon [Seoul National University Children' s Hospital, Department of Orthopaedic Surgery, Seoul (Korea); Song, Hae-Ryong [Korea University Guro Hospital, Department of Othopaedic Surgery, Seoul (Korea); Chung, Chin Youb [Seoul National University Bundang Hospital, Department of Orthopaedic Surgery, Gyeonggi (Korea); Miyagawa, Shin-Ichiro [National Hospital Organization Kure Medical center, Department of Pediatrics, Hiroshima (Japan); Nishimura, Gen [Kiyose Children' s Hospital, Department of Radiology, Tokyo (Japan); Superti-Furga, Andrea [University of Freiburg, Departement of Pediatrics, Freiburg (Germany); Unger, Sheila [Institute of Human Genetics, University of Freiburg, Freiburg (Germany)
2009-08-15
This study presents seven cases of a rare but distinctive form of spondyloepimetaphyseal dysplasia with joint laxity-leptodactylic or Hall type to emphasize the characteristic clinical and radiological findings. A multiinstitutional retrospective review was performed on seven patients. The patient population consisted of one family with an affected mother and two siblings and four unrelated patients; there were one adult, aged 40 years, and six children, ranging in age from 3 to 12 years. The gender ratio of females to males was 5 to 2. We reviewed the clinical data and skeletal surveys and focused on radiographs of the pelvis, knees, hands, and spine. The outstanding clinical features were short stature, midface hypoplasia, and multiple dislocations and/or ligamentous laxity of the large joints, particularly at the knees with a genu valgum or varum deformity. Of seven patients, six patients showed normal intellect but one patient had mild mental retardation. The main radiological features included small, irregular epiphyses, metaphyseal irregularity with vertical striations that was a constant finding at the knees, constricted femoral necks, delayed ossification of the carpal bones, and slender metacarpals. Progressive thoracolumbar scoliosis was evident with aging; however, the vertebral bodies appeared normal in height or mild platyspondyly was noted. In view of the orthopedic management of multiple joint dislocations and ligamentous laxity of the large joints, awareness of this disease entity and diagnostic precision solely based on radiological findings is of importance, particularly as the disorder is currently more common than initially reported. (orig.)
International Nuclear Information System (INIS)
Kim, Ok-Hwa; Cho, Tae-Joon; Song, Hae-Ryong; Chung, Chin Youb; Miyagawa, Shin-Ichiro; Nishimura, Gen; Superti-Furga, Andrea; Unger, Sheila
2009-01-01
This study presents seven cases of a rare but distinctive form of spondyloepimetaphyseal dysplasia with joint laxity-leptodactylic or Hall type to emphasize the characteristic clinical and radiological findings. A multiinstitutional retrospective review was performed on seven patients. The patient population consisted of one family with an affected mother and two siblings and four unrelated patients; there were one adult, aged 40 years, and six children, ranging in age from 3 to 12 years. The gender ratio of females to males was 5 to 2. We reviewed the clinical data and skeletal surveys and focused on radiographs of the pelvis, knees, hands, and spine. The outstanding clinical features were short stature, midface hypoplasia, and multiple dislocations and/or ligamentous laxity of the large joints, particularly at the knees with a genu valgum or varum deformity. Of seven patients, six patients showed normal intellect but one patient had mild mental retardation. The main radiological features included small, irregular epiphyses, metaphyseal irregularity with vertical striations that was a constant finding at the knees, constricted femoral necks, delayed ossification of the carpal bones, and slender metacarpals. Progressive thoracolumbar scoliosis was evident with aging; however, the vertebral bodies appeared normal in height or mild platyspondyly was noted. In view of the orthopedic management of multiple joint dislocations and ligamentous laxity of the large joints, awareness of this disease entity and diagnostic precision solely based on radiological findings is of importance, particularly as the disorder is currently more common than initially reported. (orig.)
Hall, Stacey L.; Forrester, Scott; Borsz, Melissa
2008-01-01
This constructivist case study examined undergraduate student leadership development. Twenty-one student leaders, 13 females and 8 males, in a campus recreational sports department were interviewed using a semi-structured interview protocol. Seven broad themes: organizing, planning, and delegating; balancing academic, personal and professional…
The Turn to Precarity in Twenty-First Century Fiction
Directory of Open Access Journals (Sweden)
Morrison Jago
2014-01-01
Full Text Available Recent years have seen several attempts by writers and critics to understand the changed sensibility in post-9/11 fiction through a variety of new -isms. This essay explores this cultural shift in a different way, finding a ‘turn to precarity’ in twenty-first century fiction characterised by a renewal of interest in the flow and foreclosure of affect, the resurgence of questions about vulnerability and our relationships to the other, and a heightened awareness of the social dynamics of seeing. The essay draws these tendencies together via the work of Judith Butler in Frames of War, in an analysis of Trezza Azzopardi’s quasi-biographical study of precarious life, Remember Me.
Twenty-four-hour ambulatory blood pressure monitoring in very elderly patients
Cappelleri, Claudia; Janoschka, Alin; Berli, Reto; Kohler, Sibylle; Braun-Dullaeus, Ruediger C.; Heuss, Ludwig T.; Wolfrum, Mathias
2017-01-01
Abstract Elevated blood pressure (BP) is frequently diagnosed in very elderly hospitalized patients. Accurate diagnosis of hypertension is challenging in the hospital environment, due to the “white coat effect,” and both overtreatment and undertreatment can adversely affect clinical outcome. Twenty-four-hour ambulatory blood pressure monitoring (ABPM) has the potential to avoid the “white coat effect” and accurately guide the management of hypertension. However, effects of the hospital environment on ABPM are unknown in the very elderly. We set out to enroll 45 patients, age ≥70 years, with elevated conventional BP during hospitalization in this observational study. It was prespecified by protocol to assess initially the difference between 24-hour BP during hospital-admission and home follow-up. Subsequent analysis should investigate the change in anxiety (Hospital Anxiety and Depression Scale-A [HADS-A]) after discharge, the correlation with change in 24-hour BP after discharge, and the prevalence of orthostatic hypertension. Thirty-one patients were included in the final analysis (age 83.5 ± 4.4 years; 71% female). Twenty-four-hour BP decreased significantly after hospital discharge (systolic from 133.5 ± 15.6 to 126.2 ± 14.4 mm Hg [millimeter of mercury], P = .008; diastolic from 71.0 ± 9.0 to 68.3 ± 8.6 mm Hg, P = .046). Anxiety level (HADS-A) decreased significantly after discharge, from 7.5 (interquartile range [IQR]: 4.0–13.8) to 5.0 (IQR: 4.0–8.0, P = .012). The change in anxiety was a predictor of change in systolic BP after discharge (F[1,20] = 5.9, P = .025). Sixty-one percent of the patients had significant orthostatic hypotension during hospital stay. In conclusion, 24-hour BP in very elderly patients is lower in the home environment than during hospitalization. This phenomenon seems to be directly linked to a lower anxiety-level at home. Reassessing hypertension at home may decrease the
Healing incisional surgical wounds using Rose Hip oil in rats
Lainy Carollyne da Costa Cavalcante; Thyago Cezar Prado Pessôa; Rubens Fernando Gonçalves Ribeiro Júnior; Edson Yuzur Yasojima; Rosa Helena de Figueiredo Chaves Soares; Marcus Vinicius Henriques Brito; Eduardo Henrique Herbster Gouveia; Lucas Nascimento Galvão; Suzana Rodrigues Ramos; Adan Kristian Almeida Carneiro; Yuri Aarão Amaral Serruya; Mateus Malta de Moraes
2017-01-01
Purpose: To evaluate incisional surgical wound healing in rats by using Rose Hip (Rosa rubiginosa L.) oil. Methods: Twenty-one days after the oophorectomy procedure, twenty-seven female, adult, Wistar rats were distributed into three groups: Control group (wound treatment with distilled water); Collagenase group (treatment with collagenase ointment); and Rose Hip group (wound treatment with Rose Hip oil). Each group was distributed according to the date of euthanasia: 7, 14 and 21 days. ...
Characterizing Male–Female Interactions Using Natural Genetic Variation in Drosophila melanogaster
Reinhart, Michael; Carney, Tara; Clark, Andrew G.
2015-01-01
Drosophila melanogaster females commonly mate with multiple males establishing the opportunity for pre- and postcopulatory sexual selection. Traits impacting sexual selection can be affected by a complex interplay of the genotypes of the competing males, the genotype of the female, and compatibilities between the males and females. We scored males from 96 2nd and 94 3rd chromosome substitution lines for traits affecting reproductive success when mated with females from 3 different genetic backgrounds. The traits included male-induced female refractoriness, male remating ability, the proportion of offspring sired under competitive conditions and male-induced female fecundity. We observed significant effects of male line, female genetic background, and strong male by female interactions. Some males appeared to be “generalists” and performed consistently across the different females; other males appeared to be “specialists” and performed very well with a particular female and poorly with others. “Specialist” males did not, however, prefer to court those females with whom they had the highest reproductive fitness. Using 143 polymorphisms in male reproductive genes, we mapped several genes that had consistent effects across the different females including a derived, high fitness allele in Acp26Aa that may be the target of adaptive evolution. We also identified a polymorphism upstream of PebII that may interact with the female genetic background to affect male-induced refractoriness to remating. These results suggest that natural variation in PebII might contribute to the observed male–female interactions. PMID:25425680
Positive erotic picture stimuli for emotion research in heterosexual females.
Jacob, Gitta Anne; Arntz, Arnoud; Domes, Gregor; Reiss, Neele; Siep, Nicolette
2011-12-30
In most experimental studies, emotional pictures are widely used as stimulus material. However, there is still a lack of standardization of picture stimuli displaying erotic relationships, despite the association between a number of psychological problems and severe impairments and problems in intimate relationships. The aim of the study was to test a set of erotic stimuli, with the potential to be used in experimental studies, with heterosexual female subjects. Twenty International Affective Picture System (IAPS) pictures and an additional 100 pictures showing romantic but not explicitly sexual scenes and/or attractive single males were selected. All pictures were rated with respect to valence, arousal, and dominance by 41 heterosexual women and compared to pictures with negative, positive, and neutral emotional valence. Erotic IAPS pictures and our additional erotic pictures did not differ in any of the evaluation dimensions. Analyses of variance (ANOVAs) for valence, arousal, and dominance comparing different picture valence categories showed strong effects for category. However, valence was not significantly different between erotic and positive pictures, while arousal and control were not significantly different between positive and neutral pictures. The pictures of our new set are as positive for heterosexual women as highly positive IAPS pictures, but higher in arousal and dominance. The picture set can be used in experimental psychiatric studies requiring high numbers of stimuli per category. Limitations are the restriction of stimuli application to heterosexual females only and to self-report data. Copyright © 2011 Elsevier Ltd. All rights reserved.
Kenntner-Mabiala, Ramona; Gorges, Susanne; Alpers, Georg W; Lehmann, Andreas C; Pauli, Paul
2007-04-01
The present study investigated affective and physiological responses to changes of tempo and mode in classical music and their effects on heat pain perception. Thirty-eight healthy non-musicians (17 female) listened to sequences of 24 music stimuli which were variations of 4 pieces of classical music. Tempo (46, 60, and 95 beats/min) and mode (major and minor) were manipulated digitally, all other musical elements were held constant. Participants rated valence, arousal, happiness and sadness of the musical stimuli as well as the intensity and the unpleasantness of heat pain stimuli which were applied during music listening. Heart rate, respiratory rate and end-tidal PCO(2) were recorded. Pain ratings were highest for the fastest tempo. Also, participants' arousal ratings, their respiratory rate and heart rate were accelerated by the fastest tempo. The modulation of pain perception by the tempo of music seems to be mediated by the listener's arousal.
Measurements of light at night (LAN) for a sample of female school teachers
Rea, Mark S.; Brons, Jennifer A.; Figueiro, Mariana G.
2012-01-01
Epidemiological studies have shown an association between rotating shiftwork and breast cancer (BC) risk. Recently, light at night (LAN) measured by satellite photometry and by self-reports of bedroom brightness has been shown to be associated with BC risk, irrespective of shiftwork history. Importance has been placed on these associations because retinal light exposures at night can suppress the hormone melatonin and/or disrupt circadian entrainment to the local 24-h light-dark cycle. The present study examined whether it was valid to use satellite photometry and self-reports of brightness to characterize light, as it might stimulate the circadian system and thereby affect BC incidence. Calibrated photometric measurements were made at the bedroom windows and in the bedrooms of a sample of female school teachers, who worked regular dayshifts and lived in a variety of satellite-measured sky brightness categories. The light levels at both locations were usually very low and were independent of the amount of satellite-measured light. Calibrated photometric measurements were also obtained at the corneas of these female school teachers together with calibrated accelerometer measurements for seven consecutive days and evenings. Based upon these personal light exposure and activity measurements, the female teachers who participated in this study did not have disrupted light-dark cycles like those associated with rotating shiftworkers who do exhibit a higher risk for BC. Rather, this sample of female school teachers had 24-h light-dark and activity-rest patterns very much like those experienced by dayshift nurses examined in an earlier study who are not at an elevated risk of BC. No relationship was found between the amount of satellite-measured light levels and the 24-h light-dark patterns these women experienced. It was concluded from the present study that satellite photometry is unrelated to personal light exposures as they might affect melatonin suppression and
The smell of virgins: mating status of females affects male swimming behaviour in Oithona davisae
DEFF Research Database (Denmark)
Heuschele, Jan; Kiørboe, Thomas
2012-01-01
in the presence of virgin when compared with mated females and that the cue is waterborne. The ability to distinguish between virgin and mated females may reduce male mortality during mate search and the cost related to mating behaviour (precopula) in both sexes. We estimate that at realistic population densities...... the ability of males to distinguish between virgin and mated females saves them several hours per day of dangerous and energetically expensive fast female tracking...
International Nuclear Information System (INIS)
Castro, Beatriz; Sánchez, Pilar; Torres, Jesús M.; Ortega, Esperanza
2015-01-01
Background: Early-life exposure to the endocrine disruptor bisphenol A (BPA) affects brain function and behavior, which might be attributed to its interference with hormonal steroid signaling and/or neurotransmitter systems. Alternatively, the use of structural analogs of BPA, mainly bisphenol F (BPF) and bisphenol S (BPS), has increased recently. However, limited in vivo toxicity data exist. Objectives: We investigated the effects of BPA, BPF and BPS on 5α-reductase (5α-R), a key enzyme involved in neurosteroidogenesis, as well as on dopamine (DA)- and serotonin (5-HT)-related genes, in the prefrontal cortex (PFC) of juvenile female rats. Methods: Gestating Wistar rats were treated with either vehicle or 10 μg/kg/day of BPA, BPF or BPS from gestational day 12 to parturition. Then, female pups were exposed from postnatal day 1 through day 21 (PND21), when they were euthanized and RT-PCR, western blot and quantitative PCR-array experiments were performed. Results: BPA decreased 5α-R2 and 5α-R3 mRNA and protein levels, while both BPF and BPS decreased 5α-R3 mRNA levels in PFC at PND21. Further, BPA, BPF and BPS significantly altered, respectively, the transcription of 25, 56 and 24 genes out of the 84 DA and 5-HT-related genes assayed. Of particular interest was the strong induction by all these bisphenols of Cyp2d4, implicated in corticosteroids synthesis. Conclusions: Our results demonstrate for the first time that BPA, BPF and BPS differentially affect 5α-R and genes related to DA/5-HT systems in the female PFC. In vivo evidence of the potential adverse effects of BPF and BPS in the brain of mammals is provided in this work, raising questions about the safety of these chemicals as substitutes for BPA. - Highlights: • Juvenile prefrontal cortex of female rats exposed to bisphenol A, F or S was analyzed. • We provide the first in vivo data of BPF and BPS effects in mammal brain. • BPA, BPF and BPS differently affected dopamine and serotonin
Energy Technology Data Exchange (ETDEWEB)
Castro, Beatriz; Sánchez, Pilar [Department of Biochemistry and Molecular Biology, Faculty of Medicine, University of Granada, Avda. de Madrid s/n, 18012 Granada (Spain); Torres, Jesús M., E-mail: torrespi@ugr.es [Department of Biochemistry and Molecular Biology, Faculty of Medicine, University of Granada, Avda. de Madrid s/n, 18012 Granada (Spain); Institute of Neurosciences, Faculty of Medicine, University of Granada, Granada (Spain); Ortega, Esperanza, E-mail: esortega@ugr.es [Department of Biochemistry and Molecular Biology, Faculty of Medicine, University of Granada, Avda. de Madrid s/n, 18012 Granada (Spain); Institute of Neurosciences, Faculty of Medicine, University of Granada, Granada (Spain)
2015-10-15
Background: Early-life exposure to the endocrine disruptor bisphenol A (BPA) affects brain function and behavior, which might be attributed to its interference with hormonal steroid signaling and/or neurotransmitter systems. Alternatively, the use of structural analogs of BPA, mainly bisphenol F (BPF) and bisphenol S (BPS), has increased recently. However, limited in vivo toxicity data exist. Objectives: We investigated the effects of BPA, BPF and BPS on 5α-reductase (5α-R), a key enzyme involved in neurosteroidogenesis, as well as on dopamine (DA)- and serotonin (5-HT)-related genes, in the prefrontal cortex (PFC) of juvenile female rats. Methods: Gestating Wistar rats were treated with either vehicle or 10 μg/kg/day of BPA, BPF or BPS from gestational day 12 to parturition. Then, female pups were exposed from postnatal day 1 through day 21 (PND21), when they were euthanized and RT-PCR, western blot and quantitative PCR-array experiments were performed. Results: BPA decreased 5α-R2 and 5α-R3 mRNA and protein levels, while both BPF and BPS decreased 5α-R3 mRNA levels in PFC at PND21. Further, BPA, BPF and BPS significantly altered, respectively, the transcription of 25, 56 and 24 genes out of the 84 DA and 5-HT-related genes assayed. Of particular interest was the strong induction by all these bisphenols of Cyp2d4, implicated in corticosteroids synthesis. Conclusions: Our results demonstrate for the first time that BPA, BPF and BPS differentially affect 5α-R and genes related to DA/5-HT systems in the female PFC. In vivo evidence of the potential adverse effects of BPF and BPS in the brain of mammals is provided in this work, raising questions about the safety of these chemicals as substitutes for BPA. - Highlights: • Juvenile prefrontal cortex of female rats exposed to bisphenol A, F or S was analyzed. • We provide the first in vivo data of BPF and BPS effects in mammal brain. • BPA, BPF and BPS differently affected dopamine and serotonin
Directory of Open Access Journals (Sweden)
M. Shafieinia
2015-01-01
Full Text Available Introduction & Objective: Sedentary women are at risk for problems such as obesity, diabetes, depression and cardiovascular disease. Meanwhile, due to long working hours and excessive travel time from home to work and vice versa the employees have minimal physical activity .The purpose of this study was to investigate the effective psychometric factors on physical activity of female employees, according to the Trans-theoretical Model and theory of planned behavior. Materials & Methods: In this cross-sectional study, 95 female staff of Tehran University was selected through a call. In order to collect data, a questionnaire with acceptable, reliability and validity, including demographic data, and constructs of planned behavior theory as well as Trans-theoretical Model was used. The data was analyzed using SPSS version 21 statisti-cal tests; correlation and stepwise regression were also performed. Results: In this study, 72% of the population was in the inactive stages (pre-contemplation, contemplation and preparation and only 28% of patients had regular physical activity. There was a significant positive correlation between the behavioral intention and attitude scores (P = 0.02, perceived behavioral control (P = 0.000, self-efficacy (P = 0.000 and stage of change (P = 0.000, but subjective norms score (P = 0.605 was irrelevant. Conclusion: The results of this study showed that self-efficacy and perceived behavioral con-trol can affect female employees’ intention and physical activity behaviors. So, the authori-ties should seriously consider these factors in educational planning for this stratum of society, remove barriers for the participation of more employees in sporting activities, and offer fa-cilitators at the community level. (Sci J Hamadan Univ Med Sci 2015; 21(4:350-359
Benschop, R. J.; Brosschot, J. F.; Godaert, G. L.; de Smet, M. B.; Geenen, R.; Olff, M.; Heijnen, C. J.; Ballieux, R. E.
1994-01-01
This study deals with the effect of chronic stress on physiological responsiveness to an acute psychological stressor in male high school teachers. Chronic stress was operationalized as the self-reported number of everyday problems. Twenty-seven subjects reporting extremely low or high numbers of
Space power technology for the twenty-first century (SPT21)
International Nuclear Information System (INIS)
Borger, W.U.; Massie, L.D.
1988-01-01
During the spring and summer months of 1987, the Aero Propulsion Laboratory of the Air Force Wright Aeronautical Laboratories, Wright-Patterson AFB, Ohio in cooperation with the Air Force Space Technology Center at Kirtland AFB, New Mexico, undertook an initiative to develop a Strategic Plan for Space Power Technology Development. The initiative was called SPT21, Space Power Technology for the Twenty-First Century. The planning process involved the participation of other Government organizations (U.S. Army, Navy, DOE and NASA) along with major aerospace companies and universities. Following an SPT21 kickoff meeting on 28 May 1987, detailed strategic planning was accomplished through seven (7) Space Power Technology Discipline Workshops commencing in June 1987 and concluding in August 1987. Technology Discipline Workshops were conducted in the following areas: (1) Solar Thermal Dynamic Power Systems (2) Solar Photovoltaic Cells and Arrays (3) Thermal Management Technology (4) Energy Storage Technology (5) Nuclear Power Systems Technology (6) Power Conditioning, Distribution and Control and (7) Systems Technology/Advanced Concepts. This technical paper summarizes the planning process and describes the salient findings and conclusions of the workshops
Anatomy of the female reproductive system of Rusa deer ( Rusa ...
African Journals Online (AJOL)
The study aims to present baseline data on the reproductive anatomy of a poorly known tropical deer species, Rusa deer (Rusa timorensis). The anatomy of female reproductive system is described using seven uniparous hinds, aged between four and eight years. The various reproductive structures were studied via ...
Jobs and Kids: Female Employment and Fertility in Rural China
Hai Fang; Karen N. Eggleston; John A. Rizzo; Richard J. Zeckhauser
2010-01-01
Data on 2,355 married women from the 2006 China Health and Nutrition Survey are used to study how female employment affects fertility in China. China has deep concerns with both population size and female employment, so the relationship between the two should be better understood. Causality flows in both directions. A conceptual model shows how employment prospects affect fertility. Then a well-validated instrumental variable isolates this effect. Female employment reduces a married woman's p...
Hussain, Mona A.; Abogresha, Noha M.; Tamany, Dalia A.; Lotfy, Mariam
2016-01-01
Introduction Globally, the prevalence of overweight and obesity is increasing, predisposing females to health hazards including compromised reproductive capacity. Our objective was to investigate the effect of ad libitum, isocalorically and hypocalorically restricted high-fat diet (HFD) feeding on reproductive function in diet-induced obese female rats. Material and methods Twenty female albino Sprague Dawley rats were used; 5 rats were kept on a standard pellet animal diet to serve as a control group (A) and 15 rats were fed a HFD for 9 weeks to induce obesity. The HFD fed animals were equally divided into three groups: an ad libitum HFD group (B), an isocalorically restricted HFD group (C), and a hypocalorically restricted HFD group (D). Estrous cyclicity, hormonal levels, ovarian histopathology and caspase-3 immunoreactivity were evaluated. Results The HFD-fed rats in groups B, C and D had significant irregularity in estrous cyclicity Vs group A (p = 0.001, 0.003 and 0.034 respectively). Groups C and D had significant reduction in serum progesterone level (p = 0.006 and 0.018 Vs A). Isocaloric restriction of HFD feeding significantly increased serum LH. Groups B and C had a significant increase in caspase-3 expression in the ovary (p < 0.001). Conclusions Ad libitum HFD interfered with the normal estrous cycle and enhanced apoptosis of luteal cells in obese female rats. The HFD restriction interfered with the normal estrous cycle and caused functional insufficiency of the corpus luteum in obese female rats. These results suggest that HFD feeding determinately affects female reproductive function independently of caloric intake. PMID:27478474
Mielgo Ayuso, Juan; Zourdos, Michael C; Urdampilleta, Aritz; Calleja González, Julio; Seco, Jesús; Córdova, Alfredo
2017-10-24
Specific macronutrient distribution and training can alter acute and chronic hormone behavior and, subsequently, sport performance. The main aim was to examine relationships between dietary intake and anabolic/catabolic hormone response in elite female volleyball players during a 29-week season. Twenty-two elite female volleyballers (26.4 ± 5.6 years; 178 ± 9 cm; 67.1 ± 7.5 kg) had dietary intake (seven-day dietary recall and food frequency questionnaire), blood concentration of anabolic/catabolic hormones concentration, physical performance, and body composition assessed at four time points: a) T1: baseline/pre-testing; b) T2: eleven weeks after T1; c) T3: ten weeks after T2; and d) T4: eight weeks after T3. Hormones evaluated were: total testosterone (TT), free testosterone (FT) adrenocorticotropic hormone (ACTH), and cortisol (C), along with hormone ratios. Positive correlations were observed between carbohydrate/protein ratio with ΔFT (r = 0.955; p 0.05) in body mass or body mass index at any time point, and the sum of six skinfolds improved (p < 0.05) from T1 (86.5 ± 6.9 mm) to T4 (75.2 ± 5.6 mm) as did muscle mass (T1: 28.9 ± 0.7 kg vsT4: 30.1 ± 0.8 kg). Vertical jump, spike-jump and speed improved (p < 0.05) from T1 to T4. A high carbohydrate/protein ratio was associated with positive changes in anabolism, while high protein and low carbohydrates (CHO) were associated with an attenuated anabolic response.
Green, Michelle; Decourville, Nancy; Sadava, Stanley
2012-01-01
Structural equation modeling was used to test a model in which positive affect, negative affect, perceived stress, and social support were hypothesized to mediate the relationship between forgiveness and mental and physical health. Six hundred and twenty-three undergraduates completed a battery of self-report measures. Results of the analyses indicated that the forgiveness-health relation was mediated by positive affect, negative affect, stress, and the interrelationship between negative affect and stress. There was limited support for social support and the interrelationship between positive affect and social support as mediators. The results suggested that the relationship between forgiveness and health is mediated rather than direct. Implications and directions for future research are discussed.
Directory of Open Access Journals (Sweden)
Castillo Victor
2009-08-01
Full Text Available Abstract Background For the conclusive diagnosis of Cushing's Syndrome, a stimulating ACTH test or a low suppressive Dexamethasone test is used. Reports in other species than the dog indicate that plasma cortisol concentration after ACTH administration is affected by gender. We investigated the effect of gender on the cortisol response to ACTH and Dexamethasone tests in dogs. Methods Seven healthy adult Cocker Spaniels (4 females and 3 males were assigned to a two by two factorial design: 4 dogs (2 females and 2 males received IV Dexamethasone 0.01 mg/kg, while the other 3 dogs received an IV saline solution (control group. Two weeks later the treatments were reversed. After one month, ACTH was given IV (250 μg/animal to 4 dogs (2 female and 2 males while the rest was treated with saline solution (control group. Cortisol concentrations were determined by a direct solid-phase radioimmunoassay and cholesterol and triglycerides by commercial kits. Results and Discussion No effect of treatment was observed in metabolite concentrations, but females presented higher cholesterol concentrations. ACTH-treated dogs showed an increase in cortisol levels in the first hour after sampling until 3 hours post injection. Cortisol concentrations in Dexamethasone-treated dogs decreased one hour post injection and remained low for 3 hours, thereafter cortisol concentrations increased. The increase in cortisol levels from one to two hours post ACTH injection was significantly higher in females than males. In Dexamethasone-treated males cortisol levels decreased one hour post injection up to 3 hours; in females the decrease was more pronounced and prolonged, up to 5 hours post injection. Conclusion We have demonstrated that cortisol response to ACTH and Dexamethasone treatment in dogs differs according to sex.
Andrews, James P.
2012-01-01
This qualitative research study focuses on crisis events affecting university international populations. It explores how seven directors of university international offices at seven different geographical locations in Texas respond to those events. The study findings shed light on the current state of crisis preparedness in higher education from…
Spontaneous Pneumothorax: A retrospective study of twenty-five patients and literature review
International Nuclear Information System (INIS)
Batouk, A.; Jastaniah, S.; Grillo, I.A.; Malatani, T.S.; Al-Saigh, A.H.; Al-Shehri, M.Y.; Softah, A.; Ali, K.A.M.; Teklu, B.
1996-01-01
We present a retrospective study of 25 patients with spontaneous pneumothorax (three recurrent) comprising 16 Saudis (nine males and seven females) and eight non-Saudi's (eight males and one female), seen at the Asir Central Hospital, Abha, over a period of 45 months. Almost one-third of patients (9/25) had no underlying cause discernible by our investigational facilities (chest x-ray, ultrasonography, computed tomographic scan and flexible bronchofiberscopy). Underlying pneumonia (three patients), pulmonary tuberculosis (two patients), lung abscess (one patient) and congenital bullae (one patient) constituted the etiology in another third of the spontaneous pneumothorax patients. Other underlying pulmonary diseases, precipitating spontaneous pneumothorax in the group included pulmonary fibrosis, metastatic mesothelioma and immunosuppression in a medulloblastoma patient undergoing chemotherapy with the development of chickenpox. Closed thoracostomy tube drainage was the only method of treatment in 20 out of 25 patients, with three failures of closed thoracostomy tube drainage needing thoractomy and resection of blebs/bullae. The only complication was empyema in two of the patients. Two patients were successfully treated conservatively with observation alone. (author)
Renk, Kimberly; Donnelly, Reesa; McKinney, Cliff; Baksh, Elizabeth
2007-01-01
Schacter (2001) proposes that there are seven memory malfunctions that occur in everyday life and that affect individuals' ability to recall occurrences in their lives. Given that these sins affect other areas of memory, it is likely that they may affect the ratings that informants provide when they are recalling characteristics of the emotional…
Sensory factors affecting female consumers' acceptability of nail polish.
Sun, C; Koppel, K; Adhikari, K
2015-12-01
The objectives of this study were to determine what sensory factors impact consumers' acceptability of nail polishes, to explore how these sensory factors impact consumers' acceptability of nail polishes, to investigate whether there are any consumer segments according to their overall acceptability on different nail polishes and to scrutinize how the consumer segments are related to the sensory factors. Ninety-eight females participated in a nail polish consumer study at Kansas State University. Eight commercial products belonging to four categories - regular (REG), gel (GEL), flake (FLK) and water-based (WAT) - were evaluated. Each nail polish sample was evaluated twice by each participant in two different tasks - a task devoted to applying and evaluating the product and a task devoted to observing the appearance and evaluating the product. Pearson's correlation analysis, analysis of variance (ANOVA), external preference mapping, cluster analysis and internal preference mapping were applied for data analysis. Participants' scores of overall liking of the nail polishes were similar in the application task and in the observation task. In general, participants liked the REG and GEL product samples more than the FLK and WAT samples. Among all the sensory attributes, appearance attributes were the major factors that affected participants' overall liking. Aroma seemed to be a minor factor to participants' overall liking. Some sensory attributes, such as runny, shininess, opacity, spreadability, smoothness, coverage and wet appearance, were found to drive participants' overall acceptability positively, whereas others such as pinhole, fatty-edges, blister, brushlines, pearl-like, flake-protrusion, glittery and initial-drag impacted participants' overall acceptability negatively. Four clusters of participants were identified according to their overall liking scores from both the application task and the observation task. Participants' acceptability, based on different
The seven S's for successful management.
Davidhizar, R
1995-03-01
Becoming a successful manager in a health care agency is, for most new managers, an awesome goal. Successful management is more than knowledge of leadership roles and management functions that can be learned in school or educational workshops. Successful management involves effective use of both the manager's affective and cognitive domains. Mentoring and apprenticeship with a successful nurse leader is for many novice managers a highly valuable way to learn management skills since this allows for techniques with a successful nurse manager to be visualized and then modeled. "Seven S's" that provide a framework for managerial success are discussed.
Topping, Kecia C.
This dissertation examined factors that affected the science achievement of African American females in suburban middle schools. The research literature informed that African American females are facing the barriers of race, gender, socioeconomic status, and cultural learning style preferences. Nationally used measurements of science achievement such as the Standardized Achievement Test, Tenth edition (SAT-10), National Assessment for Educational Progress, and National Center for Educational Statistics showed that African American females are continuing to falter in the areas of science when compared to other ethnic groups. This study used a transformative sequential explanatory mixed methods design. In the first, quantitative, phase, the relationships among the dependent variables, science subscale SAT-10 NCE scores, yearly averages, and the independent variables, attitude toward science scores obtained from the Modified Fennema-Sherman Attitudes toward Science Scale, socioeconomics, and caregiver status were tested. The participants were 150 African American females in grades 6 through 8 in four suburban middle schools located in the Southeastern United States. The results showed a positive, significant linear relationship between the females' attitude and their science subscale SAT-10 NCE scores and a positive, significant linear relationship between the females' attitudes and their yearly averages in science. The results also confirmed that attitude was a significant predictor of science subscale SAT-10 NCE scores for these females and that attitude and socioeconomics were significant predictors of the females' yearly averages in science. In the second, qualitative, phase, nine females purposefully selected from those who had high and low attitude towards science scores on the scale in the quantitative phase were interviewed. The themes that emerged revealed seven additional factors that impacted the females' science achievement. They were usefulness of science
Female residents experiencing medical errors in general internal medicine: a qualitative study.
Mankaka, Cindy Ottiger; Waeber, Gérard; Gachoud, David
2014-07-10
Doctors, especially doctors-in-training such as residents, make errors. They have to face the consequences even though today's approach to errors emphasizes systemic factors. Doctors' individual characteristics play a role in how medical errors are experienced and dealt with. The role of gender has previously been examined in a few quantitative studies that have yielded conflicting results. In the present study, we sought to qualitatively explore the experience of female residents with respect to medical errors. In particular, we explored the coping mechanisms displayed after an error. This study took place in the internal medicine department of a Swiss university hospital. Within a phenomenological framework, semi-structured interviews were conducted with eight female residents in general internal medicine. All interviews were audiotaped, fully transcribed, and thereafter analyzed. Seven main themes emerged from the interviews: (1) A perception that there is an insufficient culture of safety and error; (2) The perceived main causes of errors, which included fatigue, work overload, inadequate level of competences in relation to assigned tasks, and dysfunctional communication; (3) Negative feelings in response to errors, which included different forms of psychological distress; (4) Variable attitudes of the hierarchy toward residents involved in an error; (5) Talking about the error, as the core coping mechanism; (6) Defensive and constructive attitudes toward one's own errors; and (7) Gender-specific experiences in relation to errors. Such experiences consisted in (a) perceptions that male residents were more confident and therefore less affected by errors than their female counterparts and (b) perceptions that sexist attitudes among male supervisors can occur and worsen an already painful experience. This study offers an in-depth account of how female residents specifically experience and cope with medical errors. Our interviews with female residents convey the
Admon, Roee; Treadway, Michael T; Valeri, Linda; Mehta, Malavika; Douglas, Samuel; Pizzagalli, Diego A
2017-08-16
The development of robust laboratory procedures for acute stress induction over the last decades has greatly advanced our understanding of stress responses in humans and their underlying neurobiological mechanisms. Nevertheless, attempts to uncover linear relationships among endocrine, neural, and affective responses to stress have generally yielded inconsistent results. Here, 79 healthy females completed a well established laboratory procedure of acute stress induction that was modified to prolong its effect. Endocrinological and subjective affect assessments revealed stress-induced increases in cortisol release and negative affect that persisted 65 and 100 min after stress onset, respectively, confirming a relatively prolonged acute stress induction. Applying latent class linear mixed modeling on individuals' patterns of cortisol responses identified three distinct trajectories of cortisol response: the hyper-response ( n = 10), moderate-response ( n = 21), and mild-response ( n = 48) groups. Notably, whereas all three groups exhibited a significant stress-induced increase in cortisol release and negative affect, the hyper-response and mild-response groups both reported more negative affect relative to the moderate-response group. Structural MRI revealed no group differences in hippocampal and amygdala volumes, yet a continuous measure of cortisol response (area under the curve) showed that high and low levels of stress-induced cortisol release were associated with less hippocampal gray matter volume compared with moderate cortisol release. Together, these results suggest that distinct trajectories of cortisol response to prolonged acute stress among healthy females may not be captured by conventional linear analyses; instead, quadratic relations may better describe links between cortisol response to stress and affective responses, as well as hippocampal structural variability. SIGNIFICANCE STATEMENT Despite substantial research, it is unclear whether and how
Generational differences in male sexuality that may affect ...
African Journals Online (AJOL)
Objective: To determine generational differences in male sexuality, which could predispose men's female sexual partners to STDs/HlV. Design: Cross-sectional study. Setting: Harare, Zimbabwe. Subjects: Three hundred and ninety seven male adults aged eighteen years and above. Main outcome measures: Number of ...
Vitamin D Deficiency is Prevalent in Females with Rett Syndrome
Motil, Kathleen J.; Barrish, Judy O.; Lane, Jane; Geerts, Suzanne P.; Annese, Fran; McNair, Lauren; Percy, Alan K.; Skinner, Steven A; Neul, Jeffrey L.; Glaze, Daniel G.
2013-01-01
Objectives To determine the prevalence of vitamin D deficiency and identify the relation between 25-hydroxyvitamin D [25(OH)D] levels and the consumption of dietary sources of vitamin D or exposure to anticonvulsants in females with Rett syndrome (RTT). Study design Retrospective review of the medical records of 284 females with RTT to determine serum 25(OH)D and parathyroid hormone levels, nutritional status, dietary sources of vitamin D, exposure to anticonvulsants, degree of mobility, and MECP2 status. Results Twenty percent of females who were tested (n=157) had 25(OH)D levels Anticonvulsants were used by 57% and 39% ambulated independently. Median 25(OH)D levels were lower in individuals who did not receive multivitamin supplements (panticonvulsants, degree of mobility, and MECP2 status did not influence 25(OH)D levels. Conclusion Vitamin D deficiency is prevalent in females with RTT. The use of multivitamin supplements or commercial formulas is associated with improved vitamin D levels. Attention to vitamin D may enhance bone mineral deposition and reduce the frequency of bone fractures in these individuals. PMID:21637127
Female outlet obstruction constipation: assessment with MR defecography
International Nuclear Information System (INIS)
Li Min; Jiang Tao; Yang Xinqing; Peng Peng; Wang Wenchuan
2010-01-01
Objective: Using MR defecography to assess the morphological and functional anorectal anomalies related to female outlet obstruction constipation, and evaluate the joint disease of' anterior and mid pelvic. Methods: One hundred and seven female patients, aged 20 to 84 years (average, 55 years), were diagnosed as outlet obstruction constipation based on clinical symptoms and signs. They all received MR defecography in our institution. The high compliance homemade balloon was inserted into rectum to simulate stool. Then relevant measurements were obtained during rest, squeezing and straining, respectively. Results: In all the 107 cases, 70 (65.4%) presented rectocele on dynamic MRI; 28 (26.2%) presented anismus; 60 (56.1%) presented cystocele; 59 presented vaginal or cervical prolapse(55.1%); and, 54 (50.5%) presented descending perineum. In 85 females (79.4%) multiple disorders were detected, involving more than one pelvic compartment. Conclusion: MR defecography allowed to accurately evaluate the morphological and functional anorectal anomalies related to female outlet obstruction constipation, and the joint disease of anterior and mid pelvic. (authors)
Female genital mutilation: psychological and reproductive health ...
African Journals Online (AJOL)
The study examined the reproductive health and psychological effects of female genital mutilation, in one traditional area in the Upper East region (i.e. Kayoro Traditional Area) of Ghana. The results of the study revealed that, the practice of FGM actually affects the physical (deforming the female genitalia), psychological (the ...
Skull base surgery of non vestibular schwannomas of the posterior ...
African Journals Online (AJOL)
Results: Twenty one patients with intracranial schwannomas arising from cranial nerves other than the vestibulocochlear were surgically treated in the Neurosurgery department, Alexandria University, in the period between 2003 and 2008. There were 14 males and 7 females and the mean age was 38 years. Seven of our ...
Mehl, N S; Srisuwatanasagul, S; Swangchan-Uthai, T; Sirivaidyapong, S; Khalid, M
2017-01-01
Effect of a GnRH-agonist (deslorelin) was studied on reproductive function and ovarian luteinizing hormone receptor (LHR) and follicle stimulating hormone receptor (FSHR) expression in prepubertal female cats that were either implanted with 4.7-mg deslorelin (implanted: n = 6) or not (controls: n = 18) or ovariohysterectomized at prepubertal age (prepubertal OVH: n = 6). Body weights, fecal estradiol, and sexual behavior of implanted and control cats were monitored for 48 weeks followed by collection of ovaries and uteri. Ovaries and uteri were collected from control cats at follicular, luteal, and inactive stage (n = 6/group) and from prepubertal OVH cats at prepubertal age. Ovaries and uteri were analyzed for anatomical/histological characteristics. Ovaries were also analyzed for LHR and FSHR expression. Statistical analysis showed higher (P ≤ 0.05) body weight in control than implanted cats only during 22nd to 26th weeks of the study. Estrus was observed in control cats only. Deslorelin reduced (P ≤ 0.05) ovarian weight and number of antral follicles but did not affect endometrial thickness and gland diameter. However, myometrial thickness of implanted cats was significantly lower than control cats at follicular and luteal stage. Ovarian LHR mRNA expression was lower (P ≤ 0.05) in implanted cats than control cats at follicular stage. FSHR mRNA and LHR protein expression did not differ among the three groups. FSHR protein expression was lower (P ≤ 0.05) in prepubertal OVH cats and was not affected by deslorelin. In conclusion, deslorelin suppresses reproductive function in prepubertal female cats for at least 48 weeks possibly through a change in the ovarian mRNA expression of LHR. Copyright © 2016 Elsevier Inc. All rights reserved.
[Self esteem, affectivity perception, aims, and risk behaviors among teenagers of both sexes].
Millán, T; Valenzuela, S; Vargas, N A
1995-05-01
A self applied and anonymous enquiry was answered by 948 teenagers (600 female), participating in an integral health education plan and coming from a school located in a low income community of Metropolitan Santiago. Twenty nine percent came from single or foster parent families and 18.4% of parents were separated. Nineteen percent of women and 9.8% of men felt that they were not loved by their parents; 30.5% of women and classified as bad or regular their relationship with their fathers and 22.1% of men similarly classified their relationship with their mothers. Eighteen percent of men and 16.5% of women ignored their parent's educational level. Ten to 24% had a negative self image and 50% were unsure about their study goals. Forty eight percent of men and 25.5% of women had get drunk; 24.1 and 12.8% had smoked marihuana. Half of the sample manifested attraction to dangerous situations; 22% had participated in quarrels and 34% had attacked other people. Twenty three percent of men and 35% of women had considered committing suicide. It is concluded that the lack of affection, a deteriorated self image, difficult parental relationships and orientation toward violence appear as the main problems in this sample of teenagers.
Injuries in Spanish female soccer players
Directory of Open Access Journals (Sweden)
Juan Del Coso
2018-04-01
Full Text Available Background: Epidemiologic research to learn the incidence, type, location, and severity of female soccer injuries and the risk factors for sustaining a sport injury is the first step in developing preventive policies. The aim of this study was to analyze the incidence of injuries in the population of female soccer players in Spain. Methods: The injuries incurred by 25,397 female soccer players were registered by the medical staff of the Spanish Football Federation during 1 season. A standardized medical questionnaire was used to classify the injury according to type, severity, location, and injury mechanism. A total of 2108 injuries was reported with an incidence of 0.083 injuries per player per season. Most injuries were in the lower limbs (74.0%, mainly affecting knee (30.4% and ankle joints (17.9%. Results: The proportion of injuries derived from contact with another player was higher during matches (33.7% than during training (11.4%; p 0.05. Conclusion: Most female soccer injuries were located at the knee and ankle; the injury mechanism determined the playing time lost; and the player's age did not affect injury characteristics. Keywords: Ankle, Epidemiology, Knee, Sport injuries, Women
Comparison of absolute speed of screen-film systems measured in seven institutions
International Nuclear Information System (INIS)
Yoshida, Ken-ichi; Murakami, Yasunori; Asahara, Masaki; Nakamura, Satoru; Honda, Mitsugi; Morishita, Junji; Higashida, Yoshiharu; Otsuka, Akiyoshi; Yoshida, Akira.
1998-01-01
We compared the differences in absolute speed of four screen-film systems in seven institutions. Four different screens (HR-4, Fuji; Lanex Medium, Kodak; Lanex 250, Kodak; and HR-12, Fuji) combined with super HRS-30 (Fuji) film and a beam quality of 80 kV tube voltage with a 20 mm aluminum filter were employed. Absolute speeds of the HR-4, Lanex Medium, Lanex 250, and HR-12 in combination with super HRS-30 were 1.83 mR -1 , 2.72 mR -1 , 2.79 mR -1 , and 5.35 mR -1 (average of seven institutions), respectively. The variation in speed was about ±10% for the seven institutions. Two factors (film processor and densitometer) affecting absolute speed were analyzed. The absolute speed measured in seven institutions varied ±14% depending on the film processor (development conditions) and ±3% depending on the densitometer employed in each institution. (author)
Directory of Open Access Journals (Sweden)
Jie-Yu Chuang
2017-07-01
Full Text Available Compared to female major depressive disorder (MDD, male MDD often receives less attention. However, research is warranted since there are significant sex differences in the clinical presentation of MDD and a higher rate of suicide in depressed men. To the best of our knowledge, this is the first functional magnetic resonance imaging (fMRI study with a large sample addressing putative sex differences in MDD during adolescence, a period when one of the most robust findings in psychiatric epidemiology emerges; that females are twice as likely to suffer from MDD than males. Twenty-four depressed and 10 healthy male adolescents, together with 82 depressed and 24 healthy female adolescents, aged 11–18 years, undertook an affective go/no-go task during fMRI acquisition. In response to sad relative to neutral distractors, significant sex differences (in the supramarginal gyrus and group-by-sex interactions (in the supramarginal gyrus and the posterior cingulate cortex were found. Furthermore, in contrast to the healthy male adolescents, depressed male adolescents showed decreased activation in the cerebellum with a significant group-by-age interaction in connectivity. Future research may consider altered developmental trajectories and the possible implications of sex-specific treatment and prevention strategies for MDD.
Chuang, Jie-Yu; Hagan, Cindy C; Murray, Graham K; Graham, Julia M E; Ooi, Cinly; Tait, Roger; Holt, Rosemary J; Elliott, Rebecca; van Nieuwenhuizen, Adrienne O; Bullmore, Edward T; Lennox, Belinda R; Sahakian, Barbara J; Goodyer, Ian M; Suckling, John
2017-01-01
Compared to female major depressive disorder (MDD), male MDD often receives less attention. However, research is warranted since there are significant sex differences in the clinical presentation of MDD and a higher rate of suicide in depressed men. To the best of our knowledge, this is the first functional magnetic resonance imaging (fMRI) study with a large sample addressing putative sex differences in MDD during adolescence, a period when one of the most robust findings in psychiatric epidemiology emerges; that females are twice as likely to suffer from MDD than males. Twenty-four depressed and 10 healthy male adolescents, together with 82 depressed and 24 healthy female adolescents, aged 11-18 years, undertook an affective go/no-go task during fMRI acquisition. In response to sad relative to neutral distractors, significant sex differences (in the supramarginal gyrus) and group-by-sex interactions (in the supramarginal gyrus and the posterior cingulate cortex) were found. Furthermore, in contrast to the healthy male adolescents, depressed male adolescents showed decreased activation in the cerebellum with a significant group-by-age interaction in connectivity. Future research may consider altered developmental trajectories and the possible implications of sex-specific treatment and prevention strategies for MDD.
Mamta Sharma; Gagandeep Kaur
2015-01-01
Music therapy is increasingly used in sports for enhancing sport performance. It provides a mean of improving mental strength among sportspersons. The purpose of this study is to enhance intrinsic motivation, physical self-efficacy and performance of female football players through music therapy. For this purpose, twenty two female football players, in the age group of 21-26 were screened on the basis of their scores on Sport Motivation Scale and Physical Self-Efficacy Scale. Then, they were ...
Lion, Alexis; Theisen, Daniel; Windal, Thierry; Malisoux, Laurent; Nührenbörger, Christian; Huberty, Robert; Urhausen, Axel; Seil, Romain
2014-01-01
This study aimed to realize a prospective follow-up of the injuries occurring in female and male football players involved in the highest league in the Grand-Duchy of Luxembourg. Data concerning anthropometric characteristics and football activities were gathered in 125 female and 243 male football players via questionnaires at the beginning of the study. Then, a follow-up of moderate to severe injuries (> 15 days of interruption in football practice) was performed throughout the season 2013-2014. Sixteen injuries (injury incidence = 0.7 injuries/1000 h of exposure) were observed in 13 female football players (10.4%). These injuries concerned mainly the knee (n = 7; 43.7%), with capsules and ligaments being the most often concerned tissues (n = 7; 43.7%). In male football players, 41 severe injuries (injury incidence = 0.6 injuries/1000 h of exposure) were observed in 36 players (14.8%). These injuries concerned mainly the thighs (n = 12; 29.3%) and the muscles and tendons were the most often concerned tissues (n = 18; 43.9%). Injuries in football are predominantly located at the lower limbs, particularly the knees in female football players. The predominant muscle and tendon lesions of the thighs occurring in males could reveal that physical preparation is insufficient or inadequate for a number of players. Regarding these results, it is necessary to implement an injury prevention strategy. The "FIFA 11+" programme could be used as the basic method, but should be personalized according to sex. The injury collection methodology could be optimized with the use of an electronic database, such as the Training and Injury Prevention Platform for Sports (TIPPS). Beside the systematic recording of injury data (as well as the training load) by the players or the medical staff, this system allows to share of important information between stakeholders, follow-up the players, provide risk factor warnings and increase the awareness of the injury problem.
Psychosocial and sexual aspects of female circumcision
S. Abdel-Azim
2013-01-01
Sexual behavior is a result of interaction of biology and psychology. Sexual excitement of the female can be triggered by stimulation of erotogenic areas; part of which is the clitoris. Female circumcision is done to minimize sexual desire and to preserve virginity. This procedure can lead to psychological trauma to the child; with anxiety, panic attacks and sense of humiliation. Cultural traditions and social pressures can affect as well the unexcised girl. Female circumcision can reduce fem...
Asic3(-/- female mice with hearing deficit affects social development of pups.
Directory of Open Access Journals (Sweden)
Wei-Li Wu
Full Text Available BACKGROUND: Infant crying is an important cue for mothers to respond adequately. Inappropriate response to infant crying can hinder social development in infants. In rodents, the pup-mother interaction largely depends on pup's calls. Mouse pups emit high frequency to ultrasonic vocalization (2-90 kHz to communicate with their dam for maternal care. However, little is known about how the maternal response to infant crying or pup calls affects social development over the long term. METHODOLOGY/PRINCIPAL FINDINGS: Here we used mice lacking acid-sensing ion channel 3 (Asic3(-/- to create a hearing deficit to probe the effect of caregiver hearing on maternal care and adolescent social development. Female Asic3(-/- mice showed elevated hearing thresholds for low to ultrasonic frequency (4-32 kHz on auditory brain stem response, which thus hindered their response to their pups' wriggling calls and ultrasonic vocalization, as well as their retrieval of pups. In adolescence, pups reared by Asic3(-/- mice showed a social deficit in juvenile social behaviors as compared with those reared by wild-type or heterozygous dams. The social-deficit phenotype in juvenile mice reared by Asic3(-/- mice was associated with the reduced serotonin transmission of the brain. However, Asic3(-/- pups cross-fostered to wild-type dams showed rescued social deficit. CONCLUSIONS/SIGNIFICANCE: Inadequate response to pups' calls as a result of ASIC3-dependent hearing loss confers maternal deficits in caregivers and social development deficits in their young.
Directory of Open Access Journals (Sweden)
Celso Souza
2008-06-01
Full Text Available The purpose of this study was to determine the anthropometric and functional profile of strollers who walk oround Willie Davids Stadium of Maringá town district seven. The sample was constituted by 168 subjects: 97 females of 37.60-year average age and 71 males of 36.08-year average age, who voluntarily came to the walking project of Universidade Estadual de Maringá. The data were collected during 1999. The average stature of males was 171.70cm and of females was 161.29 cm; the average weight of males was 76.27 kg and of females was 61.91 kg. Fat percentage in males was 19.44% and in females was 30.46%; lean weight of 60.79 kg for males and 42.51 kg for females. The IMC was 26.60 for males and 23.79 for females; waist/hip rate for males was 0.91 and for females was 0.77. VO2 max for males was 47.66 ml/kg/min and for females was 39.70 ml/kg/min. The results indicate higher weight and stature values for males than for females, that both males and females present a fat percentage higher than regular and acceptable; that the higher risk concentration in found in the interval of 40 to 49 years of age for females, and for males the interval of 30 to 39 concentrates a high risk and up to 30 years concentrates a very high risk, while VO2 max decreases with aging.
Perspective for Female Medical Physicists
International Nuclear Information System (INIS)
Naqvi, Syed Mansoor; Hasnain, Aziz Fatima
2009-01-01
Due to cultural and religious reasons, Pakistani women can be reluctant to seek medical attention for disorders affecting their genitals or breasts. As a result, in the case of cervical and breast cancers, oncological treatment is often not received until the diseases are in the late stages. Once a cancer is classified and the tumor marked, the role of the medical physicist begins. Medical physicists' responsibilities include treatment planning, supervising treatment through radiation, dosimetry, contouring, training, equipment selection, education, research, and supervising radiotherapy facilities. In brachytherapy, isotopes are placed at the tumor site in the form of wires or seeds. There are very few female medical physicists in Pakistan. This leads to further hesitation on the part of many women to seek treatment. To help female patients obtain needed medical care, female physics students should be encouraged to pursue the emerging field of medical physics. This would provide a new professional opportunity for female physics students and give comfort to female patients.
Kirk, Katherine D; Fedele, David A; Wolfe-Christensen, Cortney; Phillips, Timothy M; Mazur, Tom; Mullins, Larry L; Chernausek, Steven D; Wisniewski, Amy B
2011-12-01
Rearing a child with a chronic illness is stressful and can potentially affect parenting style, which may result in poorer outcomes for children. The purpose of this study was to compare parenting characteristics of female caregivers rearing children with a disorder of sex development (DSD) to female caregivers rearing children with type 1 diabetes mellitus (T1DM). Caregivers of both groups were matched according to age and compared on measures of stress and parenting practices. Both groups demonstrated significant levels of stress and negative parenting practices. Children with T1DM and male children with non-life-threatening DSD were perceived as more vulnerable by their caregivers. Better understanding of parenting experiences of female caregivers rearing children with DSD, particularly male children, will facilitate the development of individualized interventions to ameliorate negative parenting practices and stress, with the long-term goal of improved health outcomes for their children. Copyright © 2011 Elsevier Inc. All rights reserved.
Bajoghli, Hafez; Joshaghani, Narges; Mohammadi, Mohammad Reza; Holsboer-Trachsler, Edith; Brand, Serge
2011-09-01
Experiencing romantic love is important in individual development. Little is known about romantic love among adolescents in non-Western countries. The aim of the present study was therefore to explore romantic love among Iranian female adolescents. Eighty-six females (mean age: 17.97 years) took part in the study; 38 of them (44%) indicated they were experiencing romantic love at the time of survey, and 48 (56%) indicated they were not in love. Participants completed questionnaires related to affective states and physical activity, and a sleep log for seven consecutive nights. Compared to controls, participants in love had higher scores for hypomanic-like states, positive mood, physical activity, but not for better sleep quality or for depressive symptoms. Against expectations, hypomania scores increased with the duration of the romantic relationship, suggesting that culture-related issues might shape the way romantic love may be experienced.
Is infertility a risk factor for female sexual dysfunction? A case-control study.
Millheiser, Leah S; Helmer, Amy E; Quintero, Rodolfo B; Westphal, Lynn M; Milki, Amin A; Lathi, Ruth B
2010-11-01
To determine the impact of infertility on female sexual function. A case-control study. Academic infertility and gynecology practices. One hundred nineteen women with infertility and 99 healthy female controls without infertility between the ages of 18 and 45 years were included in this study. Anonymous survey and Female Sexual Function Index. Female Sexual Function Index scores, frequency of sexual intercourse and masturbation, and sex-life satisfaction. Twenty-five percent of our control group had Female Sexual Function Index scores that put them at risk for sexual dysfunction (masturbation. The patients with infertility retrospectively reported a sex-life satisfaction score that was similar to that of the controls before their diagnosis, whereas their current sex-life satisfaction scores were significantly lower than those of the controls. Women with a diagnosis of infertility were found to be at higher risk for sexual dysfunction on the basis of their Female Sexual Function Index scores compared with women without infertility. The interaction of sexual function and infertility is complex and deserves further study. Copyright © 2010. Published by Elsevier Inc.
Mao, Guo-Feng; Mo, Xiao-Chang; Fouad, Hatem; Abbas, Ghulam; Mo, Jian-Chu
2018-03-01
Utilisation of Anagrus nilaparvatae is a promising and effective method for planthoppers manipulation. Twenty-seven components of remote lemongrass (Cymbopogon distans) oil were identified by GC/MS and nine volatiles were selected for behavioural experiments. In this study, we noted that the remote lemongrass oil was attractive to female A. nilaparvatae at concentrations of 0.1 and 1 mg/L. α-Pinene, β-pinene, eucalyptol, carveol and D-carvone attracted female wasps in the dose-dependent bioassays. Blend 1 (a mixture of eucalyptol, D-carvone, carveol, α-pinene, and β-pinene with ratios of remote lemongrass oil volatiles of 625:80:11:5:3) attracted female wasps at 10 mg/L, while blend 2 (a mixture of the same five volatiles at the same loading ratio) attracted them at 0.1 and 1 mg/L. These results suggested that plant essential oils could be attractants for natural enemies to control pests. The ratios of volatiles in the mixtures affect the attractiveness of the synthetic mixtures.
Fruteau, C.; Lemoine, S.; Hellard, E.; van Damme, E.E.C.; Noe, R.
2011-01-01
We tested predictions following from the biological market paradigm using reciprocated grooming sessions among the adult females in a sooty mangabey, Cercocebus atys, group with 35 females (Ivory Coast) and in two groups of vervet monkeys, Chlorocebus aethiops (South Africa) with four and seven
Inaltun, Hüseyin; Ates, Salih
2015-01-01
The purpose of this study is to examine relationships among pre-service science teachers' conceptual knowledge of electric current, motivational beliefs, and self-regulation. One hundred and twenty-seven students (female = 107, male = 20) enrolled in the science education program of a public university in Ankara participated the study. A concept…
Directory of Open Access Journals (Sweden)
Rafael Pazinato
2016-11-01
Full Text Available The acaricidal effect of seven essential oils was examined in vitro against the cattle tick (Rhipicephalus microplus. Engorged female ticks were manually collected in farms of Southern Brazil and placed into petri dishes (n = 10 in order to test the following oils: juniper (Juniperus communis, palmarosa (Cymbopogon martinii, cedar (Cedrus atlantica, lemon grass (Cymbopogon citratus, ginger (Zingiber officinale, geranium (Pelargonium graveolens and bergamot (Citrus aurantium var bergamia at concentrations of 1%, 5%, and 10% each. A control group was used to validate the tests containing Triton X-100 only. Treatment effectiveness was measured considering inhibition of tick oviposition (partial or total, egg’s weight, and hatchability. C. martinii, C. citratus and C. atlantica essential oils showed efficacy higher than 99% at all concentrations tested. In addition, J. communis, Z. officinale, P. graveolens, and C. aurantium var bergamia oils showed efficiency ranging from 73% to 95%, depending on the concentration tested, where higher concentrations showed greater efficacy. It was concluded that essential oils can affect tick reproduction in vitro by inhibiting oviposition and hatchability.
Factors Affecting Choice, Satisfaction, and Success in the Female Self-Employed.
Waddell, Frederick T.
1983-01-01
Compared female business owners, managers, and secretaries to examine predictors of occupational choice, satisfaction, and success in the self-employment of women. Results showed owners rated higher than secretaries in achievement motivation, locus of control, and sex role, while owners and managers were similar except in parental models. (JAC)
The clinical characteristics of twenty-eight idiopathic pulmonary fibrosis cases
International Nuclear Information System (INIS)
Yu Yong; Shi Minhua; Hu Huacheng
2007-01-01
Objective: To summarize the clinical characteristics of idiopathic pulmonary fibrosis (IPF). Methods: The clinical characteristics of twenty-eight cases diagnosed as IPF between 1991 and 2006 were studied retrospectively. Results: Most IPF patients had an insidious onset of progressive dyspnea and non-productive cough. Inspiratory crackles and finger clubbing were also noted in most patients. The most impressive appearance of their radiography was peripheral reticular and nodular opacities, distributed largely at the lung bases. Pulmonary function test showed restrictive impairment and impaired oxygen diffusion. The arterial blood gas analysis revealed type I respiratory failure. One IPF case was complicated with lung cancer. The symptoms of fifteen cases(71.4%) were relieved under the therapy with glucocorticoid. Seven patients died as yet in our group and the middle duration was 24 months. Conclusions: The diagnosis of IPF relies mostly on the clinical characteristics, radiography, pulmonary function test, blood gas analysis and exclusion of other ILD. Atypical cases need lung biopsy to do further the diagnosis. Therapy with glucocorticoid may be effective in some cases. Prognosis in IPF cases complicated with lung cancer is poor. (authors)
Babri, Shirin; Doosti, Mohammad-Hossein; Salari, Ali-Akbar
2014-03-15
A nascent literature suggests that neonatal infection is a risk factor for the development of brain, behavior and hypothalamic-pituitary-adrenal axis which can affect anxiety- and depression-related behaviors in later life. It has been documented that neonatal infection raises the concentrations of tumor necrosis factor-alpha (TNF-α) in neonate rodents and such infections may result in neonatal brain injury, at least in part, through pro-inflammatory cytokines. In addition, previous studies have shown that TNF-α is involved in cellular differentiation, neurogenesis and programmed cell death during the development of the central nervous system. We investigated for the first time whether neonatal exposure to TNF-α can affect body weight, stress-induced corticosterone (COR), anxiety- and depression-related behaviors in adult mice. In the present study, neonatal mice were treated to recombinant mouse TNF-α (0.2, 0.4, 0.7 and 1 μg/kg) or saline on postnatal days 3 and 5, then adult male and female mice were exposed to different behavioral tests. The results indicated that neonatal TNF-α treatment reduced body weight in neonatal period in both sexes. In addition, this study presents findings indicating that high doses of TNF- increase stress-induced COR levels, anxiety- and depression-related behaviors in adult males, but increase levels of anxiety without significantly influencing depression in adult female mice [corrected]. Our findings suggest that TNF-α exposure during neonatal period can alter brain and behavior development in a dose and sex-dependent manner in mice. Copyright © 2014 Elsevier B.V. All rights reserved.
A typology of female sex work in the Metropolitan Region of Santiago, Chile.
Belmar, Julieta; Stuardo, Valeria; Folch, Cinta; Carvajal, Bielka; Clunes, Maria José; Montoliu, Alexandra; Casabona, Jordi
2018-04-01
In Chile, sex work takes place covertly in a variety of venues and locations. Formative research using time-location sampling methods is important in order to understand the nature of this diversity. This study used qualitative methods to develop a typology of female sex work in the Metropolitan Region of Santiago, Chile, using semi-structured interviews, focus groups and ethnographic fieldwork during visits to sex work venues. The study identified seven types of venue, which reflect the context and regulatory framework of the country and the structural vulnerabilities that affect female sex workers in Chile. These venues and locations include: cafés con piernas (coffee with legs); nightclubs, topless bars and cabarets; brothels; hotels; street and highway soliciting; massage parlours; and private residences. Formative research methods were helpful in identifying and characterising the venues and locations in which sex work occurred. Barriers to accessing and mapping specific locations were also identified. Recommendations for addressing these barriers include working with non-governmental organisations to map venues and initiate contact with the populations of interest. A comprehensive typology of sex work in the Metropolitan Region of Santiago, Chile, is an essential element for future time-location sampling and bio-behavioural research in the context of second-generation surveillance for HIV and sexually transmitted infections in Chile.
DEFF Research Database (Denmark)
Barene, S; Krustrup, Peter; Jackman, S R
2014-01-01
This randomized controlled study investigated the effectiveness of soccer and Zumba on fitness and health indicators in female participants recruited from a workplace. One hundred seven hospital employees were cluster-randomized to either a soccer group (SG), Zumba group (ZG), or control group (CG......-term soccer training as well asZumba outside working hours may result in fitness andmodest health benefits among female hospital employees...
Diagnostic radiation of potentially reproductive females
Energy Technology Data Exchange (ETDEWEB)
Abd El-Bagi, M E; Al-Mutairi, M S; Al-Thagafi, M A; Al-Masri, N M; Al-Sasi, O [Department of Radiology and Imaging, Armed Forces Hospital, Riyadh (Saudi Arabia)
2001-03-01
Objectives: To find out how consistent or variable is the understanding and practice of radiation protection procedures for women of childbearing age at a multispecialty tertiary hospital. Setting: Riyadh Military Hospital Study. Design: Non-clustered population survey. Methods: A questionnaire was distributed during grand rounds, mid-day clinics and a radiology conference. Questions included which radiation protection rule does the respondent use for females, whether he or she is familiar with those rules and what is his or her source of reference. Further questions were about the radiation dangers to the fetus. Results: Response was 95 (100%). Fifty-seven (60%) were males and 38 (40%) were females. The majority 50 (53%) were Saudis, 16 (17%) Western and 29 (30%) were other nationals. Sixty-two (65%) followed the old rule '10-day rule'; 17 (18%) followed the new '28-day rule' and 16 (17%) didn't know which rule to follow. None of those who followed the '28-day rule' indicated hospital policy as their reference. Conclusions: The understanding and practice of radiation protection guidelines for females is inconsistent. There is significant unfamiliarity with the radiation protection rules among our hospital practitioners. (author)
Diagnostic radiation of potentially reproductive females
International Nuclear Information System (INIS)
Abd El-Bagi, M.E.; Al-Mutairi, M.S.; Al-Thagafi, M.A.; Al-Masri, N.M.; Al-Sasi, O.
2001-01-01
Objectives: To find out how consistent or variable is the understanding and practice of radiation protection procedures for women of childbearing age at a multispecialty tertiary hospital. Setting: Riyadh Military Hospital Study. Design: Non-clustered population survey. Methods: A questionnaire was distributed during grand rounds, mid-day clinics and a radiology conference. Questions included which radiation protection rule does the respondent use for females, whether he or she is familiar with those rules and what is his or her source of reference. Further questions were about the radiation dangers to the fetus. Results: Response was 95 (100%). Fifty-seven (60%) were males and 38 (40%) were females. The majority 50 (53%) were Saudis, 16 (17%) Western and 29 (30%) were other nationals. Sixty-two (65%) followed the old rule '10-day rule'; 17 (18%) followed the new '28-day rule' and 16 (17%) didn't know which rule to follow. None of those who followed the '28-day rule' indicated hospital policy as their reference. Conclusions: The understanding and practice of radiation protection guidelines for females is inconsistent. There is significant unfamiliarity with the radiation protection rules among our hospital practitioners. (author)
Graded shuttle run performance by playing positions in elite female basketball.
Štrumbelj, Boro; Vučković, Goran; Jakovljević, Saša; Milanović, Zoran; James, Nic; Erčulj, Frane
2015-03-01
A graded shuttle run test was used to assess differences in physiological parameters between playing positions in elite female basketball players. Twenty-four female basketball players (8 guards, 8 forwards, and 8 centers) who played for the senior national teams of Slovenia and Serbia were tested with the 30-15 intermittent fitness test. During the shuttle run, the following physiological parameters were measured: oxygen consumption ((Equation is included in full-text article.)), carbon dioxide production ((Equation is included in full-text article.)), pulmonary ventilation (VE) breath by breath, respiratory quotient, oxygen pulse as the (Equation is included in full-text article.)vs. HR ratio and [LA]. No significant differences were found for any of the measures between the 3 playing positions. Although this finding was surprising, future studies should try to determine whether the tactics used in female basketball determine that the interpositional differences seen in male basketball are not evident.
Rhizobia symbiosis of seven leguminous species growing along Xindian riverbank of Northern Taiwan
Directory of Open Access Journals (Sweden)
Cheng-Tai Huang
2018-01-01
Full Text Available Legume-rhizobia symbioses of seven leguminous species growing along Xindian riverbank of Northern Taiwan were investigated in this study. These legumes form either determinate or indeterminate types of root nodules. The determinate nodules of Alysicarpus vaginalis, Desmodium. triflorum, D. heterophyllum, Sesbania cannabina and the indeterminate nodules of Mimosa pudica harbored bacteroids of morphological uniformity (length of 1-3 μm, while the indeterminate nodules of Crotalaria zanzibarica and Trifolium repens contained bacteroids of highly pleomorphism (size varying from 1 to 5 μm. The enclosed bacteria were isolated from respective nodules, and twenty slow-growing and nine fast-growing rhizobial isolates were recovered. The slow-growing isolates were classified to the genus Bradyrhizobium based on the 16S rRNA sequences, whereas the fast-growing rhizobia comprise four genera, Neorhizobium, Rhizobium, Cupriavidus and Paraburkholderia. Results of stable isotope analyses revealed that the seven leguminous species had similar and consistently negative δ15N values in leaves (mean of -1.2 ‰, whereas the values were positive (varying from 3.7 to 7.3 ‰ in the nodules. These values were significantly higher in the indeterminate nodules than those in the determinate ones. In addition, variations in the values of leaf δ13C (varying from -29 to -34‰ among the seven legumes were measured, indicating their photosynthetic water use efficiencies were different. This is the first field survey to report the rhizobial diversity and the nutrient relationships of sympatric legume in Taiwan.
Endometrial cytology in the female cat (Felis catus) during diestrus
Sánchez Riquelme, Alfonso; Arias Ruiz, Francisco
2017-01-01
The purpose of the study was to describe and quantify cytological findings in the cat’s endometrium (Felis catus). Twenty genital tracts were obtained by ovariohysterectomy. To establish the status of the estrous cycle, vaginal cytology was evaluated and ovarian structures were recorded, resulting that all females were in the luteal phase. According to the presence of corpora lutea and follicles, a classification of the luteal phase was proposed: early diestrus: corpora lutea and follicles of...
Ogle, Richard L; Baer, John S
2003-11-01
Two personalized substance abuse assessment and feedback interventions were tested for effectiveness in engaging female domestic violence shelter residents in substance abuse treatment. One hundred forty-seven residents were assessed for quantity andfrequency of substance use, negative consequences due to use, motivation to change substance use behavior, and psychopathological symptoms related to substance abuse. Assessment identified (33) 22% of participants as heavy substance users. Twenty of the 33 heavy-using residents received one of two personalized substance use feedback interventions:face-to-face feedback or writtenfeedbackplaced in shelter mailboxes. Treatment engagement was defined as attending at least one substance abuse treatment session within 30 days after the intervention. Results showed a significant difference in treatment engagement rates in favor of the face-to-face feedback group (60% vs. 0%). The results provide preliminary data suggesting that substance abuse assessment can be effectively accomplished in the shelter environment and that the face-to-face feedback procedure may be an effective intervention to bridge the service linkage problem between domestic violence services and substance abuse treatment.
Ultrastructural myocardial changes in seven cats with spontaneous hypertrophic cardiomyopathy
DEFF Research Database (Denmark)
Christiansen, Liselotte Bruun; Prats Gavalda, Clara; Hyttel, Poul
2015-01-01
OBJECTIVES: Hypertrophic cardiomyopathy (HCM) is the most common heart disease in cats and shares clinical and pathological characteristics with human HCM. Little is known about the pathogenic mechanisms underlying development of spontaneous feline HCM. ANIMALS: The study population consisted...... of seven cats diagnosed with HCM and eight age-matched cats with no evidence of cardiac disease. METHODS: Fresh myocardial biopsies taken from the middle of the left ventricular posterior free wall were obtained and examined with transmission electron microscopy. RESULTS: Electron microscopic examination...... showed ultrastructural aberrations of the myocardial cytoarchitecture and of the interstitium in the seven cats with HCM. In the most severely affected cats the myofibrils were disorganized and subsarcolemmal mitochondria were depleted. In control cats, contraction band artifacts were commonly seen...
Female urinary incontinence and sexuality
Directory of Open Access Journals (Sweden)
Renato Lains Mota
Full Text Available ABSTRACT Urinary incontinence is a common problem among women and it is estimated that between 15 and 55% of them complain of lower urinary symptoms. The most prevalent form of urinary incontinence is associated with stress, followed by mixed urinary incontinence and urge urinary incontinence. It is a symptom with several effects on quality of life of women mainly in their social, familiar and sexual domains. Female reproductive and urinary systems share anatomical structures, which promotes that urinary problems interfere with sexual function in females. This article is a review of both the concepts of female urinary incontinence and its impact on global and sexual quality of life. Nowadays, it is assumed that urinary incontinence, especially urge urinary incontinence, promotes anxiety and several self-esteem damages in women. The odour and the fear of incontinence during sexual intercourse affect female sexual function and this is related with the unpredictability and the chronicity of incontinence, namely urge urinary incontinence. Female urinary incontinence management involves conservative (pelvic floor muscle training, surgical and pharmacological treatment. Both conservative and surgical treatments have been studied about its benefit in urinary incontinence and also the impact among female sexual function. Unfortunately, there are sparse articles that evaluate the benefits of female sexual function with drug management of incontinence.
Female urinary incontinence and sexuality
Mota, Renato Lains
2017-01-01
ABSTRACT Urinary incontinence is a common problem among women and it is estimated that between 15 and 55% of them complain of lower urinary symptoms. The most prevalent form of urinary incontinence is associated with stress, followed by mixed urinary incontinence and urge urinary incontinence. It is a symptom with several effects on quality of life of women mainly in their social, familiar and sexual domains. Female reproductive and urinary systems share anatomical structures, which promotes that urinary problems interfere with sexual function in females. This article is a review of both the concepts of female urinary incontinence and its impact on global and sexual quality of life. Nowadays, it is assumed that urinary incontinence, especially urge urinary incontinence, promotes anxiety and several self-esteem damages in women. The odour and the fear of incontinence during sexual intercourse affect female sexual function and this is related with the unpredictability and the chronicity of incontinence, namely urge urinary incontinence. Female urinary incontinence management involves conservative (pelvic floor muscle training), surgical and pharmacological treatment. Both conservative and surgical treatments have been studied about its benefit in urinary incontinence and also the impact among female sexual function. Unfortunately, there are sparse articles that evaluate the benefits of female sexual function with drug management of incontinence. PMID:28124522
Schütte, Conny; Kleijn, Prisca W; Dicke, Marcel
2006-01-01
Adult female Phytoseiulus persimilis Athias-Henriot (Acari, Phytoseiidae) of one of our laboratory populations showed a lower degree of attraction to herbivore-induced plant volatiles than other laboratory populations. We hypothesized earlier that this consistent change in foraging behavior is a symptom of a disease, as it is a contagious phenomenon. Here we describe more symptoms by comparing mated females of this population (non-responding (NR) population) with mated females of other populations that are strongly attracted to herbivore-induced plant volatiles (responding populations). The most apparent characteristic of the NR population was the presence of numerous dorso-ventrally flattened females (76% of all females). These females had a normal size after mating but shrank during adulthood. Independent of their age, shrunken females did not reproduce and died a few days after shrinking. In addition to these profound differences in short term performance, females from the NR-population showed behavioral changes, including a lower degree of attraction to herbivore-induced plant volatiles, a higher tendency to leave a prey-patch and a lower predation rate. Moreover, about half of the live females of the NR-population carried birefringent dumbbell-shaped crystals in the legs whereas live females of a responding population carried crystals only in the lumen of the Malpighian tubules and the rectum. The symptom 'crystals in the legs' was correlated with low reproduction. Energy dispersive X-ray diffraction of these crystals revealed that they contain calcium and phosphorus along with carbon and oxygen. Crystals with comparable elemental compositions and the same characteristic concentric layering are well known in insects, where they are thought to play a major role in detoxification of calcium and heavy metals, and in storage of phosphorus. The fraction of predators carrying a white spot in the distal part of the opisthosoma, due to accumulation of excretory
Exploring Genetic and Environmental Effects in Dysphonia: A Twin Study
Simberg, Susanna; Santtila, Pekka; Soveri, Anna; Varjonen, Markus; Sala, Eeva; Sandnabba, N. Kenneth
2009-01-01
Purpose: To explore the existence of genetic effects as well as the interaction between potential genetic effects and a voice-demanding occupation on dysphonia. Method: One thousand seven hundred and twenty-eight Finnish twins (555 male; 1,173 female) born between 1961 and 1989 completed a questionnaire concerning vocal symptoms and occupation.…
Perceived acceptability of female smoking in China.
Sansone, Natalie; Yong, Hua-Hie; Li, Lin; Jiang, Yuan; Fong, Geoffrey T
2015-11-01
Female smoking prevalence in China is very low but may rise with increased tobacco marketing towards women and changing norms. However, little is known about current perceptions of women smoking in China. This study sought to examine smokers' and non-smokers' perceived acceptability of female smoking and how it changed over time in China. Data come from Waves 1 to 3 (2006-2009) of the International Tobacco Control China Survey, a face-to-face cohort survey of approximately 800 adult smokers and 200 non-smokers in each of seven cities in mainland China. At Wave 3 (2009), about 38% of smokers and 9% of non-smokers agreed that female smoking is acceptable with women being almost twice as likely to do so as men (67% vs 36% and 11% vs 6%, respectively). In addition to women, smokers who were younger and had more positive perceptions of smoking in general were more likely to say that female smoking is acceptable. This perception significantly increased from Wave 1 (2006) to Wave 3 (2009), as did the perception that smoking is a sign of sophistication, but other general perceptions of smoking did not significantly change between 2006 and 2009. Norms against female smoking appear to remain strong in China, but female smoking may be becoming more acceptable. It is important to monitor these perceptions to prevent a rise in female smoking prevalence along with an increase in tobacco-related death and disease among women in China. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
Neurogenetics in Child Neurology: Redefining a Discipline in the Twenty-first Century.
Kaufmann, Walter E
2016-12-01
Increasing knowledge on genetic etiology of pediatric neurologic disorders is affecting the practice of the specialty. I reviewed here the history of pediatric neurologic disorder classification and the role of genetics in the process. I also discussed the concept of clinical neurogenetics, with its role in clinical practice, education, and research. Finally, I propose a flexible model for clinical neurogenetics in child neurology in the twenty-first century. In combination with disorder-specific clinical programs, clinical neurogenetics can become a home for complex clinical issues, repository of genetic diagnostic advances, educational resource, and research engine in child neurology.
Shift work--problems and its impact on female nurses in Udaipur, Rajasthan India.
Rathore, H; Shukla, K; Singh, S; Tiwari, G
2012-01-01
Abstract : There is good evidence that shift work has negative effects on workers health, safety and performance. It is quite appropriate that attention is paid to this very important feature of socio-technical systems, which may adversely affect mental and physical health, social life and safety of shift workers. Research into the impact of shift work on professionals has consistently identified a range of negative outcomes in physical, psychological, and social domains (Akerstedt, 1988; Costa, Lievore, Casaletti, Gaffuri, & Folkard, 1989; Kogi, 2005; Paley & Tepas, 1994). Hospitals, the biggest employer in the health care field, employ more night shift workers than any other industry. It can therefore be inferred that in medical domain high percentage of workforce may be affected by problems related to shift work. Thus the present study will provide knowledge base for the problems faced by the female nurses. The present study was undertaken with an objective of getting an insight into the problems faced by female nurses in shift work. . It was found that the female nurses in India worked on roaster pattern of change in shift every seven days. They did not have a say in the change of duties, it could only be done on mutual grounds. Partners of younger group did not much adjust to their shift pattern this created stress among the nurses.The results showed that the female nurses in both the age groups i.e. 30-45 years and 45-60 years faced many problems related to health and well being, fatigue, social and domestic situations. They could not give much time to their children in particular. Travelling in nights was risky for them. Common problem was the insufficient sleep during night shifts. The nurses had to cater to the needs of the family, children in particular along with the adjustments to be made due to shift work. They had to sometimes do the night duties and attend social functions as a part of their duty. Children and husband in some cases did not cooperate
Sex and Gender: How Being Male or Female Can Affect Your Health
... Special Issues Subscribe May 2016 Print this issue Sex and Gender How Being Male or Female Can ... a major impact on your health. While both sexes are similar in many ways, researchers have found ...
Participation of locus coeruleus in breathing control in female rats.
de Carvalho, Débora; Patrone, Luis Gustavo A; Marques, Danuzia A; Vicente, Mariane C; Szawka, Raphael E; Anselmo-Franci, Janete A; Bícego, Kênia C; Gargaglioni, Luciane H
2017-11-01
Several evidences indicate that the locus coeruleus (LC) is involved in central chemoreception responding to CO 2 /pH and displaying a high percentage of chemosensitive neurons (>80%). However, there are no studies about the LC-mediated hypercapnic ventilation performed in females. Therefore, we assessed the role of noradrenergic LC neurons in non-ovariectomized (NOVX), ovariectomized (OVX) and estradiol (E2)-treated ovariectomized (OVX+E2) rats in respiratory response to hypercapnia, using a 6-hydroxydopamine (6-OHDA) - lesion model. A reduction in the number of tyrosine hydroxylase (TH) immunoreactive neurons (51-90% in 3 animals of NOVX group, 20-42% of lesion in 5 animals of NOVX females, 61.3% for OVX and 62.6% for OVX+E2 group) was observed seven days after microinjection of 6-OHDA in the LC. The chemical lesion of the LC resulted in decreased respiratory frequency under normocapnic conditions in OVX and OVX+E2 group. Hypercapnia increased ventilation in all groups as consequence of increases in respiratory frequency (fR) and tidal volume (V T ). Nevertheless, the hypercapnic ventilatory response was significantly decreased in 6-OHDA-NOVX>50% rats compared with SHAM-NOVX group and with females that had 20-42% of LC lesion. In OVX and OVX+E2 lesioned groups, no difference in CO 2 ventilatory response was observed when compared to SHAM-OVX and SHAM-OVX+E2 groups, respectively. Neither basal body temperature (Tb) nor Tb reduction in response to hypercapnia were affected by E2 treatment, ovariectomy or LC lesion. Thus, our data show that LC noradrenergic neurons seem to exert an excitatory role on the hypercapnic ventilatory response in female rats, as evidenced by the results in NOVX animals with LC lesioned more than 50%; however, this modulation is not observed in OVX and OVX+E2 rats. In addition, LC noradrenergic neurons of OVX females seem to provide a tonic excitatory drive to maintain breathing frequency in normocapnia, and this response may not to be
Predictors of Change in Body Image in Female Participants of an Outdoor Education Program
Hovey, Kate; Foland, Jody; Foley, John T.; Kniffin, Mike; Bailey, JoEllen
2016-01-01
Body image is an ever-changing phenomenon that has a profound effect on women's quality of life. Research related to body image is expansive, but few researchers have focused on how outdoor education may influence body image. This study examines predictors of change in body image of female participants of an outdoor education program. Twenty-eight…
Pituitary tumours in adolescence: clinical behaviour and neuroimaging features of seven cases.
Nishio, S; Morioka, T; Suzuki, S; Takeshita, I; Fukui, M; Iwaki, T
2001-05-01
The clinicopathologic features of seven paediatric patients with pituitary adenomas (2 male, 5 female; mean age 14.3 years) were reviewed. There were three non-functioning adenomas, three prolactinomas, and one growth hormone producing adenoma. Five patients presented with visual field deficits, and six patients had endocrine symptoms, which included menstrual irregularities in all female patients, pubertal delay in two females, and growth delay and gigantism in one case each. On neuroimaging studies, five adenomas showed parasellar extension, while the remaining two prolactinomas were intrasellar microadenomas. While two patients with prolactinomas received good results with bromocriptine treatment alone, the remaining five patients underwent either craniotomy or transsphenoidal surgery. Postoperatively, visual disturbances improved markedly in all patients. Two patients also received replacement hormonal therapy. While six patients have been stable for 3.6 years on average, one non-functioning tumour recurred 2 years after the initial transcranial subtotal resection of the tumour. Although there are still many unknowns concerning the biology and optimal treatments for paediatric pituitary adenomas, many of them are assumed to be relatively rapidly growing tumours, while others merely have an earlier tumour genesis than in adults. Copyright 2001 Harcourt Publishers Ltd.
Cavanaugh, Courtenay; Campbell, Jacquelyn; Messing, Jill T
2014-06-01
This study examined the impact of cumulative violence victimization on health care workers' subsequent posttraumatic stress-depression comorbidity. Female nurses and nursing personnel (N = 1,044) answered questions about lifetime violence victimization (e.g., childhood abuse, intimate partner violence, and workplace violence) at baseline and completed the Primary Care Posttraumatic Stress (PTS) Disorder screen and Center for Epidemiologic Studies Depression Scale 6 months later. Seven percent screened positive for comorbid posttraumatic stress-depression at 6-month monitoring. Workers who reported one, two, or three or more types of violence victimization at baseline had 2.41 (p .05), and 6.44 (p violence victimization at baseline. These results suggest the need to provide female nurses and nursing personnel with information about (1) the risk cumulative violence victimization poses for poorer mental health and functioning, and (2) evidence-based trauma informed treatment options outside their place of employment for those affected by violence victimization who develop mental health symptoms. Copyright 2014, SLACK Incorporated.
Perfectionism, Performance, and State Positive Affect and Negative Affect after a Classroom Test
Flett, Gordon L.; Blankstein, Kirk R.; Hewitt, Paul L.
2009-01-01
The current study examined the associations among trait dimensions of perfectionism, test performance, and levels of positive and negative affect after taking a test. A sample of 92 female university students completed the Multidimensional Perfectionism Scale one week prior to an actual class test. Measures of positive affect and negative affect…
Challenges of Female Nurses in Disasters: A Qualitative Study
Directory of Open Access Journals (Sweden)
Negar Pourvakhshoori
2016-10-01
Conclusion: Many factors affect the services delivered by female nurses. The results of this study showed that the specific needs of female nurses, who are the main body of Iranian nurses, could maximize their performance and minimize their psychological and emotional damages.
Personal and practice profile of male and female ophthalmologists in India
Directory of Open Access Journals (Sweden)
Kumar Saurabh
2015-01-01
Full Text Available Background: The aim of this study was to study the practice pattern, personal profile, and work-family balance of male and female ophthalmologists in India. Materials and Methods: This study was conducted through 41 point questionnaire sent to the members of All India Ophthalmological Society dealing with practice profile and personal circumstances of ophthalmologists. Results: Six hundred and twenty-two (8% responses were obtained out of 7723 invitations sent. A total of 452 were male and 170 were female ophthalmologists. Age group of 30-39 years was most common age of respondents (male 155; 35.3%; female 81; 47.6%. Larger number of male ophthalmologists (157; 34.7% worked for more than 9 h a day than female ophthalmologists (41; 24.1% (P = 0.01. Larger number of male ophthalmologists (229; 50.7% earned more than Rs. 1 lakh/month than female ophthalmologists (55; 32.4% (P = 0.00001 More female ophthalmologists (21; 12.4% than males (26; 5.8% said that they faced cultural, ethnic or gender bias at work place (P = 0.002. Forty-four (25.9% female and 54 (12% male ophthalmologists said that they often curtailed their work for family needs (P = 0.0001. Two hundred and fifty-two (55.8% male ophthalmologists and 78 (45.9% female ophthalmologists considered their profession rewarding (P = 0.02. Conclusion: Ophthalmology as a profession was considered rewarding by both male and female ophthalmologists. However, female ophthalmologists were curtailing their work for family needs and earning less than male ophthalmologists. Female ophthalmologists were also subject to gender bias at workplace. These issues need to be tackled to improve the work satisfaction of ophthalmology workforce.
Allen, Ayana Ma-el
2010-01-01
A narrative analysis of the lived experiences of seven undergraduate African American females at Predominately White Institutions (PWIs) is presented in this study. The purpose of the study was to explore the ways the seven women constructed their identity and self-concept in the context of their PWI environment. Other key purposes of the study…
Affective disorders in neurological diseases
DEFF Research Database (Denmark)
Nilsson, F M; Kessing, L V; Sørensen, T M
2003-01-01
OBJECTIVE: To investigate the temporal relationships between a range of neurological diseases and affective disorders. METHOD: Data derived from linkage of the Danish Psychiatric Central Register and the Danish National Hospital Register. Seven cohorts with neurological index diagnoses and two...... of affective disorder was lower than the incidence in the control groups. CONCLUSION: In neurological diseases there seems to be an increased incidence of affective disorders. The elevated incidence was found to be particularly high for dementia and Parkinson's disease (neurodegenerative diseases)....
Park, Yong S; Vo, Leyna P; Tsong, Yuying
2009-01-01
The study examined whether family affection (i.e., affective responsiveness, affectionate communication, and affective orientation) protected against the negative effects of perceived parent-child Asian values gap on the quality of their parent relationships for 259 female and 77 male Asian American college students. Asian values gap was higher for women than men, and inversely related to a perceived healthy parent-child relationship for both genders. Participants rated the relationship with their mothers as more positive and affectionate than with their fathers. Both parents were reported to communicate more supportive affection than verbal and nonverbal affection. Affective responsiveness was identified as a protective factor in the father-son relationship whereas verbal affection protected the mother-daughter relationship. The study also revealed that daughters' affective orientation had beneficial effects on the father-daughter relationship at lower levels of Asian values gap. Clinical implications and directions for future research are discussed.
Predicting the Effects of Comparable Worth Programs on Female Labor Supply.
Nakamura, Alice; Nakamura, Masao
1989-01-01
Surveys theories in labor economics about how the female labor supply is affected by the wage offers that women receive. Summarizes the implications concerning expected effects of comparable worth wage adjustments on female labor supply. Examines empirical evidence pertaining to the theory of female labor supply. (JS)
The female innovation-generation consumer's evaluation
African Journals Online (AJOL)
user
The female innovation-generation consumer's evaluation of traditional and virtual displays in South. African clothing ..... only affect consumer behaviour by adding value to displayed ..... Promotional Management 19(5):652-632. FIORE, A.M. ...
Examining the Factors Affecting Student Dropout
Directory of Open Access Journals (Sweden)
Fethi Ahmet INAN
2006-07-01
Full Text Available This study examined the factors affecting student dropouts in an online certificate program. In this research, a combination of quantitative and qualitative methods was used. Online Course Dropout Survey was developed and used to determine which factors affect student attrition from the program. The dropout survey was sent by e-mail to 98 students who had dropped the program. Twenty-six students returned the survey. The findings show that the most important factor affecting student retention is finding sufficient time to study. Having personal problems and affordability of the program took second and third place.
Estradiol and song affect female zebra finch behavior independent of dopamine in the striatum
Svec, Lace A.; Lookingland, Keith J.; Wade, Juli
2009-01-01
Female songbirds display preferences for certain song characteristics, but the neural and hormonal mechanisms mediating these preferences are not fully clear. The present study sought to further explore the role of estradiol, as well as assess potential roles of dopaminergic systems, on behavioral responses to song. Adult female zebra finches were treated with estradiol and exposed to tutored or untutored song or silence. Behavior was quantified and neurochemistry of the nucleus accumbens and...
Male and Female Adult Population Health Status in China: A Cross-Sectional National Survey
Directory of Open Access Journals (Sweden)
Lu Mingshan
2008-08-01
Full Text Available Abstract Background With rapid economic growth and globalization, lifestyle in China has been changing dramatically. This study aimed to describe the male and female adult Chinese population health status. Methods The Chinese Third National Health Services Survey was conducted in 2003 to collect information about health status and quality of life from randomly selected residents. Of the 193,689 respondents to the survey (response rate 77.8%, 139,831 (69,748 male and 70,083 female respondents who were 18 years of age or older were analyzed. Results Among the respondents, fewer males than females rated their overall wellbeing as being poor or very poor (4.8% versus 6.2%, reported illness in the last 2 weeks (14.1% versus 17.4%, presence of physician diagnosed chronic disease (15.0% versus 17.7% and at least one functional problem in seven items of the quality of life (26.9% versus 32.8%. More males than females were currently smoking (52.4% versus 3.4% and drank alcohol more than three times per week (16.5% versus 1.1%. Physically inactive rate was similar between males and females (85.8% versus 87.0%. Fewer rural respondents reported chronic disease than urban respondents (13.0% versus 19.9% for males and 15.5% versus 22.8% for females. In all seven items of the quality of life measured, rural respondents reported less problems than urban respondents (26.2% versus 28.7% for males and 32.0% versus 34.7% for females. Conclusion Males had better health status than females in terms of self-perceived wellbeing, presence of illness, chronic disease, and quality of life. However, smoking and frequent alcohol drinking was more prevalent among males than that among females. In contrast with the social-economic gradient in health commonly found in the literature, the wealthier urban population in China was not found to be healthier than the rural population in terms of physician diagnosed chronic disease.
Directory of Open Access Journals (Sweden)
Melissa A. McCleary
2014-05-01
Full Text Available This study analyzes how 12 recent (2000-2011 Newbery Medal-winning books represent gender. The study counts how many of the books’ characters represent progressive or traditional gender roles, how many male and female characters represent each character category (protagonist, antagonist, major, and minor, how many strong female characters are accepted or rejected by their peers, how many characters hold stereotypical gender beliefs about themselves or their peers, and how many works contain balanced feminist perspectives. The study finds equitable female representation, but the study also finds a bias toward traditional male stereotypes. The results indicate a general acceptance of strong female characters and a balanced representation of females, regardless of a historical fiction classification. These results suggest that characters in Newbery Medal-winning books represent gender more equally and less stereotypically compared to characters in works of earlier decades.
Identification of female-specific QTLs affecting an emotionality-related behavior in rats.
Ramos, A; Moisan, M P; Chaouloff, F; Mormède, C; Mormède, P
1999-09-01
The influence of genetic factors on psychological traits and disorders has been repeatedly demonstrated; however, the molecular mechanisms underlying such an influence remain largely unknown. Anxiety-related disorders constitute the most common class of mental disorder in humans, with women being diagnosed far more frequently than men. A better understanding of the genetic and gender-related mechanisms mediating anxiety traits should enable the development of more rational methods for preventing and treating anxiety disorders. In this study we have aimed to identify, for the first time, quantitative trait loci (QTL) influencing anxiety/emotionality-related traits in rats. To this end, two strains-Lewis (LEW) and Spontaneously Hypertensive Rats (SHR)-that differ for several behavioral measures of anxiety/emotionality were intercrossed. A QTL analysis of the F2 population revealed suggestive loci for various traits, including behaviors in the elevated plus-maze and blood pressure. In addition, one major QTL explaining 50.4% of the total variance (LOD = 7.22) was identified on chromosome 4 for the locomotion in the central and aversive area of the open field. Two other relevant QTLs have been recently mapped near this chromosomic region in the rat, which also harbors Tac1r, the gene encoding for the substance P receptor. Our major QTL affected females but not males and its effect depended on the type of cross (LEW or SHR grandmothers). The present results reveal a complex genetic basis underlying emotional behaviors and they confirm the existence of interactions between genetic factors and sex for this kind of trait. Further investigation of the loci identified herein may give clues to the pathophysiology of psychiatric disorders such as anxiety-related ones.
Isolation of Borrelia burgdorferi from the blood of seven patients with Lyme disease.
Nadelman, R B; Pavia, C S; Magnarelli, L A; Wormser, G P
1990-01-01
Borrelia burgdorferi, the etiologic agent of Lyme disease, has rarely been successfully cultured from blood. We report on seven patients from Westchester County, New York, with B. burgdorferi bacteremia diagnosed between April 1987 and August 1987. One hundred thirty-two attempts to isolate spirochetes were made on blood specimens obtained from 104 patients. Twenty-two of these specimens were obtained from nine patients who had recently been bitten by Ixodes ticks but who were asymptomatic. Heparinized blood or serum specimens (0.2 to 0.4 mL) were inoculated onto 6 mL of modified Barbour-Stoenner-Kelly medium. Lyme serology was performed by enzyme-linked immunosorbent polyvalent, IgM, and IgG assays, fluorescent immunoassay, and microhemagglutination. Four of the seven patients had erythema migrans, two had facial nerve palsy, and one had a flu-like syndrome without rash. These patients represented 21% (four of 19) of all patients with the characteristic skin lesion who had blood cultures for B. burgdorferi, and 40% (two of five) of all those with facial nerve palsy. Serologic testing was frequently nonreactive; two patients had no detectable antibody on multiple sera by five different assays. All patients improved with antibiotic treatment, and had negative subsequent blood cultures, but five of seven had persistent complaints after completion of therapy. Culturing blood for B. burgdorferi may be useful in confirming the diagnosis of Lyme disease in selected patients. Use of spirochete blood cultures may facilitate a better understanding of the pathogenesis and natural history of Lyme disease.
Is muscle coordination affected by loading condition in ballistic movements?
Giroux, Caroline; Guilhem, Gaël; Couturier, Antoine; Chollet, Didier; Rabita, Giuseppe
2015-02-01
This study aimed to investigate the effect of loading on lower limb muscle coordination involved during ballistic squat jumps. Twenty athletes performed ballistic squat jumps on a force platform. Vertical force, velocity, power and electromyographic (EMG) activity of lower limb muscles were recorded during the push-off phase and compared between seven loading conditions (0-60% of the concentric-only maximal repetition). The increase in external load increased vertical force (from 1962 N to 2559 N; P=0.0001), while movement velocity decreased (from 2.5 to 1.6 ms(-1); P=0.0001). EMG activity of tibialis anterior first peaked at 5% of the push-off phase, followed by gluteus maximus (35%), vastus lateralis and soleus (45%), rectus femoris (55%), gastrocnemius lateralis (65%) and semitendinosus (75%). This sequence of activation (P=0.67) and the amplitude of muscle activity (P=0.41) of each muscle were not affected by loading condition. However, a main effect of muscle was observed on these parameters (peak value: Ppush-off phase. Our findings suggest that muscle coordination is not influenced by external load during a ballistic squat jump. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Milanović Zoran
2017-12-01
Full Text Available The popularity of female soccer is increasing as well as the number of females playing soccer. Similarly, over the last twenty or so years, research in soccer has increased significantly, but a large disparity exists in the volume of studies involving male and female players. As a consequence of this, female players remain less well understood compared to males. The purpose of the present narrative review was to describe morphological characteristics, physiological demands, physical abilities and injuries in female soccer players. Physiological demands are similar between men’s and women’s soccer, but competitive women’s matches were characterized by nearly 33% less distance covered, although at higher intensity levels (maximum speeds greater than 15 km/h than typically found in the men’s game. Sub-elite female players also tended to run less at higher intensity levels at the end of both halves in comparison with elite female players. High intensity running is an important factor of success in soccer since many critical moments of the game occur under this condition. The ability to rapidly change direction also determined elite, sub-elite and amateur levels. The implementation of functional training, which focused on soccer-specific drills and plyometric exercises, to improve explosive power, may improve conditioning in female soccer players as well as decrease the risk of injuries which was 3-8 times higher in females compared to males. This review presents an in-depth overview of the most influential factors for determining success in female soccer.
Wagner, Julie; Armeli, Stephen; Tennen, Howard; Bermudez-Millan, Angela; Pérez-Escamilla, Rafael
2018-06-01
Stress management and relaxation (SMR) interventions can reduce symptoms of chronic disease and associated distress. However, there is little evidence that such interventions disrupt associations between symptoms and affect. This study examined whether SMR dampened the link between symptoms of hyperglycemia and proximal levels of affect. We predicted that during periods of increased hyperglycemia, individuals receiving SMR training, relative to controls, would demonstrate smaller increases in negative affect. Fifty-five adult Latinos with type 2 diabetes were randomised to either one group session of diabetes education (DE-only; N = 23) or diabetes education plus eight group sessions of SMR (DE + SMR; N = 32). After treatment, participants reported five diabetes symptoms and four affective states twice daily for seven days using a bilingual telephonic system. Mean age = 57.8 years, mean A1c = 8.4%, and ¾ was female with less than a high school education. Individuals receiving DE + SMR, compared to DE-only, showed a weaker positive within-person association between daily diabetes symptoms and nervous affect. Groups also differed on the association between symptoms and enthusiasm. Age moderated these associations in most models with older individuals showing less affect reactivity to symptoms. Findings provide partial support for theorised mechanisms of SMR.
Imaging of the female urethral diverticulum
International Nuclear Information System (INIS)
Singla, P.; Long, S.S.; Long, C.M.; Genadry, R.R.; Macura, K.J.
2013-01-01
Female urethral diverticulum is a localized out-pouching of the urethra that is becoming increasingly prevalent, but often poses a diagnostic challenge. Traditionally, conventional voiding cystourethrography has been used to make the preoperative diagnosis. With the development of higher-resolution images acquired through ultrasonography (US), computed tomography (CT), and magnetic resonance imaging (MRI), the anatomy and various abnormalities of the female urethra can be better elucidated. This article focuses on the imaging features of female urethral diverticulum, with emphasis on diagnostic pearls, particularly using MRI. Female urethral diverticulum can be best identified by their location in the posterolateral urethra and by their communication with the urethral lumen. Improved imaging techniques combined with increased physician awareness of urethral diverticulum will lead to more prompt and accurate diagnosis of this entity, leading to better treatment of affected patients
Assistive technology for visually impaired women for use of the female condom: a validation study
Directory of Open Access Journals (Sweden)
Luana Duarte Wanderley Cavalcante
2015-02-01
Full Text Available OBJECTIVE To validate assistive technology for visually impaired women to learn how to use the female condom. METHOD a methodological development study conducted on a web page, with data collection between May and October 2012. Participants were 14 judges; seven judges in sexual and reproductive health (1st stage and seven in special education (2nd stage. RESULTS All items have reached the adopted parameter of 70% agreement. In Stage 1 new materials were added to represent the cervix, and instructions that must be heard twice were included in the 2nd stage. CONCLUSION The technology has been validated and is appropriate for its objectives, structure / presentation and relevance. It is an innovative, low cost and valid instrument for promoting health and one which may help women with visual disabilities to use the female condom.
Ladjali, M; Rattray, T W; Walder, R J
1993-08-21
Female genital mutilation, also misleadingly known as female circumcision, is usually performed on girls ranging in from 1 week to puberty. Immediate physical complications include severe pain, shock, infection, bleeding, acute urinary infection, tetanus, and death. Longterm problems include chronic pain, difficulties with micturition and menstruation, pelvic infection leading to infertility, and prolonged and obstructed labor during childbirth. An estimated 80 million girls and women have undergone female genital mutilation. In Britain alone an estimated 10,000 girls are currently at risk. Religious, cultural, medical, and moral grounds rationalize the custom which is practiced primarily in sub-Saharan Africa, the Arab world, Malaysia, Indonesia, and among migrant populations in Western countries. According to WHO it is correlated with poverty, illiteracy, and the low status of women. Women who escape mutilation are not sought in marriage. WHO, the UN Population Fund, the UN Children's Fund, the International Planned Parenthood Federation, and the UN Convention on the Rights of the Child have issued declarations on the eradication of female genital mutilation. In Britain, local authorities have intervened to prevent parents from mutilating their daughters. In 1984, the Inter-African Committee Against Harmful Traditional Practices Affecting Women and Children was established to work toward eliminating female genital mutilation and other damaging customs. National committees in 26 African countries coordinate projects run by local people using theater, dance, music, and storytelling for communication. In Australia, Canada, Europe, and the US women have organized to prevent the practice among vulnerable migrants and refugees.
Quartini, Adele; Anastasia, Annalisa; Bersani, Francesco Saverio; Melcore, Claudia; Albano, Gabriella; Colletti, Chiara; Valeriani, Giuseppe; Bersani, Giuseppe
2014-01-01
Sleep disturbances have long been considered as a cardinal symptom of endogenous depression and dreams in depressed patients usually differ from those of healthy people. The aim of the present study was to investigate dream subjective experiences and their modifications in relation to clinical response in a group of escitalopram-treated depressed patients. Twenty-seven female patients meeting DSM-IV-TR criteria for Major Depressive Disorder (MDD) and starting SSRI therapy were included in the study. Data about psychopathological status and dreaming subjective experiences were collected at baseline (T0), 4 weeks after the beginning of the treatment (T1) and after further 4 weeks of therapy (T2). At T0 dream experience was impaired and negatively toned. Concomitantly with the decrease of symptoms severity, the 8-week escitalopram treatment yielded to significant improvements in the recall of both quantity and quality of dreams; those patients whit lower clinical benefits kept on reporting impaired dream experiences. The results of the present study evidence how the changes in some specific dreaming characteristics, such as the subjective recall of dream activity, the dream recall quality, the dream emotional content and the dream complexity represent reliable markers of the effectiveness of antidepressant therapy.
Preece, Siân
2008-01-01
In this paper I explore how a group of female university students, mostly British Asian and in their late teens and early twenties, perform femininities in talk about heritage languages. I argue that analysis of this talk reveals ways in which the participants enact ‘culturally intelligible’ gendered subject positions. This frequently involves negotiating the norms of ‘heteronormativity’, constituting femininity in terms of marriage, motherhood and maintenance of heritage culture and language...
Directory of Open Access Journals (Sweden)
Olivier Brock
Full Text Available The neural mechanisms controlling sexual behavior are sexually differentiated by the perinatal actions of sex steroid hormones. We recently observed using female mice deficient in alpha-fetoprotein (AFP-KO and which lack the protective actions of AFP against maternal estradiol, that exposure to prenatal estradiol completely defeminized the potential to show lordosis behavior in adulthood. Furthermore, AFP-KO females failed to show any male-directed mate preferences following treatment with estradiol and progesterone, indicating a reduced sexual motivation to seek out the male. In the present study, we asked whether neural responses to male- and female-derived odors are also affected in AFP-KO female mice. Therefore, we compared patterns of Fos, the protein product of the immediate early gene, c-fos, commonly used as a marker of neuronal activation, between wild-type (WT and AFP-KO female mice following exposure to male or estrous female urine. We also tested WT males to confirm the previously observed sex differences in neural responses to male urinary odors. Interestingly, AFP-KO females showed normal, female-like Fos responses, i.e. exposure to urinary odors from male but not estrous female mice induced equivalent levels of Fos protein in the accessory olfactory pathways (e.g. the medial part of the preoptic nucleus, the bed nucleus of the stria terminalis, the amygdala, and the lateral part of the ventromedial hypothalamic nucleus as well as in the main olfactory pathways (e.g. the piriform cortex and the anterior cortical amygdaloid nucleus, as WT females. By contrast, WT males did not show any significant induction of Fos protein in these brain areas upon exposure to either male or estrous female urinary odors. These results thus suggest that prenatal estradiol is not involved in the sexual differentiation of neural Fos responses to male-derived odors.
Directory of Open Access Journals (Sweden)
Cristiane de Oliveira Souza
2010-02-01
IgM antibodies. CONCLUSIONS: Among the 80 female students, 53 (66.2% would be susceptible to toxoplasmosis in a possible pregnancy. Twenty-seven of the female students (33.8% were considered seropositive.
Self-perception, knowledge, and awareness of halitosis among female university students
Bin Mubayrik, Azizah; Al Hamdan, Rana; Al Hadlaq, Emad M; AlBagieh, Hamad; AlAhmed, Dan; Jaddoh, Hend; Demyati, Mawadh; Abu Shryei, Rawan
2017-01-01
Background Halitosis or oral malodor is defined as an unpleasant breath odor. It can become a serious problem affecting individuals’ social communication and self-confidence. Furthermore, it is a discomforting issue for the people around the person affected, because they consider it embarrassing to inform the person of the problem. Aim This study was designed to measure self-perception, knowledge, and awareness of halitosis among female university students in Saudi Arabia. Materials and methods A cross-sectional survey was implemented with 392 volunteer participants who responded to a questionnaire on their self-perception, knowledge, and awareness of halitosis. Results The response rate was 89.1% (392/440). Self-perception of halitosis was low (21.4%), whereas a larger percentage (78.1%) indicated noticing people with bad breath. Most participants (80.4%) thought that the gastrointestinal tract is the primary source of halitosis. Seventy-seven percent preferred using personal methods such as mouthwash and chewing gum to treat oral malodor. According to 82.1% of respondents, a dentist is the most appropriate professional to treat halitosis. Conclusion The investigation revealed low self-perception and limited knowledge regarding halitosis. Therefore, the role of dentists in informing and educating their patients concerning oral malodor should be enhanced. Public education about the causes of and possible ways of managing bad breath should be increased. PMID:28603430
DEFF Research Database (Denmark)
Mouritsen, Lone; Lose, Gunnar; Møller-Bek, Karl
2014-01-01
Urethral injection therapy for treatment of stress urinary incontinence has been in use for years, but only a few long-term follow-up studies have been published. Twenty-five women, injected with polyacrylamide hydrogel 8 years earlier, were invited for follow-up. Twenty-four could be contacted; 15...... had had no further treatment, seven had been re-operated with placement of mid-urethral slings, and two had been re-injected with polyacrylamide hydrogel. Eleven women attended for objective examination; all non-attenders were interviewed by telephone. Subjectively, in 44% the stress incontinence...... was cured or much improved, with a positive outcome according to the King's Health Questionnaire. Objectively, all patients had visible polyacrylamide hydrogel deposits on vaginal ultrasonography. No local adverse reactions were seen in the vaginal mucosa. The results of a later mid-urethral sling were...
Underreporting of Concussions and Concussion-Like Symptoms in Female High School Athletes.
McDonald, Tracy; Burghart, Mark A; Nazir, Niaman
2016-01-01
Underreporting of concussions and concussion-like symptoms in athletes continues to be a serious medical concern and research focus. Despite mounting worry, little evidence exists examining incidence of underreporting and documenting characteristics of head injury in female athletes participating in high school sports. This study examined the self-reporting behaviors of female high school athletes. Seventy-seven athletes participated, representing 14 high school sports. Nearly half of the athletes (31 participants) reported a suspected concussion, with 10 of the 31 athletes refraining from reporting symptoms to training staff after injury. Only 66% reported receiving concussion education. Concussion education appeared to have no relationship with diagnosed concussion rates in athletes, removing athletes from play, or follow-up medical care after injury. In conclusion, female high school athletes underreport signs and symptoms of concussions. Concussion education should occur at higher rates among female athletes to influence reporting behaviors.
Distinct phenotype of PHF6 deletions in females.
Di Donato, N; Isidor, B; Lopez Cazaux, S; Le Caignec, C; Klink, B; Kraus, C; Schrock, E; Hackmann, K
2014-02-01
We report on two female patients carrying small overlapping Xq26.2 deletions of 100 kb and 270 kb involving the PHF6 gene. Mutations in PHF6 have been reported in individuals with Borjeson-Forssman-Lehmann syndrome, a condition present almost exclusively in males. Two very recent papers revealed de novo PHF6 defects in seven female patients with intellectual disability and a phenotype resembling Coffin-Siris syndrome (sparse hair, bitemporal narrowing, arched eyebrows, synophrys, high nasal root, bulbous nasal tip, marked clinodactyly with the hypoplastic terminal phalanges of the fifth fingers and cutaneous syndactyly of the toes, Blaschkoid linear skin hyperpigmentation, dental anomalies and occasional major malformations). The clinical presentation of these patients overlaps completely with our first patient, who carries a germline deletion involving PHF6. The second patient has a mosaic deletion and presented with a very mild phenotype of PHF6 loss in females. Our report confirms that PHF6 loss in females results in a recognizable phenotype overlapping with Coffin-Siris syndrome and distinct from Borjeson-Forssman-Lehmann syndrome. We expand the clinical spectrum and provide the first summary of the recommended medical evaluation. Copyright © 2014 Elsevier Masson SAS. All rights reserved.
Shoko, Mercy; Ibisomi, Latifat; Levin, Jonathan; Ginsburg, Carren
2018-05-01
SummaryThis study examined the relationship between orphanhood status, living arrangements and sexual debut. The study is important in the context of southern Africa, where a substantial number of children live apart from their parents because the parent is dead or living elsewhere, and where female adolescents face disproportionate sexual and reproductive health risks. Data for female adolescents were taken from Demographic and Health Surveys conducted in seven southern African countries. Unadjusted and adjusted hazard ratios of sexual debut were estimated using Cox Proportional Hazard models. The results from multivariate analyses showed that non-co-residence with biological parents was significantly associated with higher risk of sexual debut in five of the seven countries. Using pooled data, the results showed that father absence was associated with higher risk of sexual debut - whether the father was deceased or living elsewhere. Interventions to delay sexual debut among female adolescents should seek to promote father-adolescent co-residence and improve access to education.
Rosenburg, Beth S.; And Others
A study determined if anaerobic power, isometric strength, and isometric endurance are affected by the menstrual cycle and if endurance trained females and untrained females are affected in the same manner on these performance parameters. Subjects were healthy, normally menstruating females, ages 18-34 years who were classified as either trained…
Schütte, Conny; Poitevin, Olivier; Negash, Tesfaye; Dicke, Marcel
2006-01-01
Adult female Phytoseiulus persimilis Athias-Henriot (Acari, Phytoseiidae) of one of our laboratory populations (=NR-population), show the following set of symptoms: predators shrink several days after mating, cease egg production and die several days after shrinking, show a lower degree of attraction to herbivore-induced plant volatiles and a shorter choice time in olfactometer tests, have the tendency to leave a prey patch with ample food, may carry excretory crystals in the legs, may cease prey consumption, and have a lower excretion rate. We hypothesized earlier that this characteristic syndrome, called non-responding (=NR-) syndrome, is caused by a pathogen infecting P. persimilis. To further support this hypothesis we here study several transmission modes of the factor causing the NR-syndrome. In all tests we measured size, short-term fecundity, mortality, predator position, response to plant odors and crystal location, thus including 6 of the 9 symptoms known yet. No evidence was found for vertical transmission from parent to offspring. Eggs from symptomatic females of the NR-population mated by males of the NR-population gave rise to normal-sized, well performing predators, when they had been surface sterilized or transferred to a new leaf. However, such eggs gave rise to shrunken females (17%) when left on the leaf where they had been laid. In the latter case transmission via products deposited on the leaf by the mothers was possible. We therefore tested several modes of horizontal transmission by exposing females of a commercial population that never showed the NR-syndrome (=R1-population) to products related to the symptomatic NR-population. No evidence was found for transmission via food or via squashed adult females. However, symptoms were induced in adult females of the R1-population after a 3-day exposure to a live adult female of the NR-population (incubation period=3-7 days, fraction shrunken females=53%) and after a 1-day exposure to feces and
Imaging features of rosette-forming glioneuronal tumours (RGNTs): A series of seven cases
Energy Technology Data Exchange (ETDEWEB)
Medhi, Gorky; Prasad, Chandrajit; Saini, Jitender; Pendharkar, Hima; Bhat, Maya Dattatraya [National Institute of Mental Health and Neurosciences, Department of Neuroimaging and Interventional Radiology, Bangalore (India); Pandey, Paritosh [National Institute of Mental Health and Neurosciences, Department of Neurosurgery, Bangalore (India); Muthane, Yasha [National Institute of Mental Health and Neurosciences, Department of Neuropathology, Bangalore (India)
2016-01-15
Rosette-forming glioneuronal tumours (RGNTs) are a recently described, rare, distinct nosological entity of the glioneuronal family. We describe imaging findings (CT and MRI) in seven patients with RGNTs. This retrospective study includes seven RGNT patients (4 male, 3 female; age range: 7-42 years; mean age: 25 years) diagnosed and treated at our institute. MR studies were performed on 3 T and 1.5-T clinical MR systems. All patients were reviewed by two experienced neuroradiologists and imaging findings were tabulated. Five tumours were located in the posterior fossa, and two were in the pineal region. One of the tumours demonstrated multiple satellite lesions, which involved the midbrain, pons, medulla as well as the cervical cord. Tumours located in the pineal region compressed the 3rd ventricle/aqueduct and extended below the tentorium cerebelli. All the tumours demonstrated enhancement, and susceptibility was evident in six of the seven patients. CSF dissemination was present in two patients. RGNTs are usually solid-cystic tumours and frequently demonstrate peripheral/heterogeneous enhancement upon post-contrast study. Haemorrhage is a common feature which may not be evident on CT. Cerebrospinal fluid (CSF) dissemination is a feature and appropriate imaging should be performed whenever an RGNT is suspected. (orig.)
Imaging features of rosette-forming glioneuronal tumours (RGNTs): A series of seven cases
International Nuclear Information System (INIS)
Medhi, Gorky; Prasad, Chandrajit; Saini, Jitender; Pendharkar, Hima; Bhat, Maya Dattatraya; Pandey, Paritosh; Muthane, Yasha
2016-01-01
Rosette-forming glioneuronal tumours (RGNTs) are a recently described, rare, distinct nosological entity of the glioneuronal family. We describe imaging findings (CT and MRI) in seven patients with RGNTs. This retrospective study includes seven RGNT patients (4 male, 3 female; age range: 7-42 years; mean age: 25 years) diagnosed and treated at our institute. MR studies were performed on 3 T and 1.5-T clinical MR systems. All patients were reviewed by two experienced neuroradiologists and imaging findings were tabulated. Five tumours were located in the posterior fossa, and two were in the pineal region. One of the tumours demonstrated multiple satellite lesions, which involved the midbrain, pons, medulla as well as the cervical cord. Tumours located in the pineal region compressed the 3rd ventricle/aqueduct and extended below the tentorium cerebelli. All the tumours demonstrated enhancement, and susceptibility was evident in six of the seven patients. CSF dissemination was present in two patients. RGNTs are usually solid-cystic tumours and frequently demonstrate peripheral/heterogeneous enhancement upon post-contrast study. Haemorrhage is a common feature which may not be evident on CT. Cerebrospinal fluid (CSF) dissemination is a feature and appropriate imaging should be performed whenever an RGNT is suspected. (orig.)
How gender and task difficulty affect a sport-protective response in young adults
Lipps, David B.; Eckner, James T.; Richardson, James K.; Ashton-Miller, James A.
2013-01-01
We tested the hypotheses that gender and task difficulty affect the reaction, movement, and total response times associated with performing a head protective response. Twenty-four healthy young adults (13 females) performed a protective response of raising their hands from waist level to block a foam ball fired at their head from an air cannon. Participants initially stood 8.25 m away from the cannon (‘low difficulty’), and were moved successively closer in 60 cm increments until they failed to block at least 5 of 8 balls (‘high difficulty’). Limb motion was quantified using optoelectronic markers on the participants’ left wrist. Males had significantly faster total response times (p = 0.042), a trend towards faster movement times (p = 0.054), and faster peak wrist velocity (p softball pitchers and fielders should have sufficient time to protect their head from a batted ball under optimal conditions if they are adequately prepared for the task. PMID:23234296
Young females in the athletic arena.
Baum, A L
1998-10-01
There are factors that uniquely affect young females in sports. The sociologic aspects of female youth sports can be understood from a historical perspective. Athletics have an influence on the development of young girls, from gender identity and sexual orientation to the foundations of self-esteem and moral development. There is a relationship between certain psychopathologic conditions common in girls and athletics, including eating disorders, depression, and anxiety disorders. Although involvement in sports may engender some of these problems, others may be successfully treated through physical exercise.
Oliveira, Cátia; Laja, Pedro; Carvalho, Joana; Quinta Gomes, Ana; Vilarinho, Sandra; Janssen, Erick; Nobre, Pedro J
2014-11-01
Both emotions and cognitions seem to play a role in determining sexual arousal. However, no studies to date have tested the effects of self-reported thoughts on subjective sexual arousal and genital response using psychophysiological methods. The aim of the present study was to evaluate the role of self-reported thoughts and affect during exposure to erotic material in predicting subjective and genital responses in sexually healthy men. Twenty-seven men were presented with two explicit films, and genital responses, subjective sexual arousal, self-reported thoughts, and positive and negative affect were assessed. Men's genital responses, subjective sexual arousal, affective responses, and self-reported thoughts during exposure to sexual stimulus were measured. Regression analyses revealed that genital responses were predicted by self-reported thoughts (explaining 20% of the variance) but not by affect during exposure to erotic films. On the other hand, subjective sexual arousal was significantly predicted by both positive and negative affect (explaining 18% of the variance) and self-reported thoughts (explaining 37% of the variance). Follow-up analyses using the single predictors showed that "sexual arousal thoughts" were the only significant predictor of subjective response (β = 0.64; P < 0.01) and that "distracting/disengaging thoughts" were the best predictor of genital response (β = -0.51; P < 0.05). The findings of this study suggest that both affect and sexual arousal thoughts play an important role in men's subjective sexual response, whereas genital response seems to be better predicted by distracting thoughts. © 2014 International Society for Sexual Medicine.
Frillman, Sharron Ann
2011-01-01
This phenomenological study examined the experiences of twelve female African Americans enrolled as fulltime undergraduate engineering students at North Carolina Agricultural and Technical State University, an historically Black university, and seven female African Americans enrolled as undergraduate engineering students at Purdue University in…
Resilience in work-related stress among female sex workers in Hong Kong.
Yuen, Winnie Wing-Yan; Wong, William Chi-Wai; Holroyd, Eleanor; Tang, Catherine So-Kum
2014-09-01
The literature on positive psychology and resilience demonstrates that individuals utilize their personal strengths and environmental resources to facilitate positive adaptation. Using a qualitative approach, we investigated how these frameworks operated as self-protective strategies for female sex workers to maintain their psychological and physical well-being under stressful socioeconomic and work-related conditions. Twenty-three female sex workers in Hong Kong participated in in-depth interviews. We used the grounded theory approach for data analysis. The informants reported negative feelings in response to financial burden, clients' demands, threats to physical health, and stigma. Some female sex workers showed their resilience by being able to rationalize their role, believe their ability to make a change in life, and stay optimistic. They adopted strategies including emotional regulation and acceptance of their responsibility and limits to cope with stressful life events. The results help us understand the role of positive psychology and resilience in this vulnerable population. © The Author(s) 2014.
St. Martin, Gail McAllister
In order to investigate the process of nonverbal communication of emotions in a simulated intercultural context, videotapes were made in which two white Americans (one male and one female) responded to paragraphs which evoked the following emotions: sadness, disgust, anger, surprise, happiness, and fear. These portrayals were then viewed by male…
Twenty years after the Chernobyl accident
International Nuclear Information System (INIS)
2006-01-01
Full text: The April 1986 accident at the Chernobyl nuclear power plant remains a painful memory in the lives of the hundreds of thousands of people who were most affected by the accident. In addition to the emergency rescue workers who died, thousands of children contracted thyroid cancer, and thousands of other individuals will eventually die of other cancers caused by the release of radiation. Vast areas of cropland, forests, rivers and urban centres were contaminated by environmental fallout. Hundreds of thousands of people were evacuated from these affected areas - forced to leave behind their homes, possessions, and livelihoods - and resettled elsewhere, in a traumatic outcome that has had long-lasting psychological and social impacts. The commemoration of the Chernobyl tragedy is taking place in many forums this month - in Minsk, in Kiev and in other locations. At the IAEA, it might be said that we have been responding to the accident and its consequences for twenty years, in a number of ways: first, through a variety of programmes designed to help mitigate the environmental and health consequences of the accident; second, by analyzing the lessons of what went wrong to allow such an accident to occur at all; and third, by working to prevent any such accident from occurring in the future. Building a strong and effective global nuclear safety regime is a central objective of our work. This requires effective international cooperation. The explosions that destroyed the Unit 4 reactor core, and discharged its contents in a cloud of radionuclides, made painfully clear that the safety risks associated with nuclear and radiological activities extend beyond national borders. International cooperation on nuclear safety matters - sharing information, setting clear safety standards, assisting with safety upgrades, and reviewing operational performance - has therefore become a hallmark of IAEA activity, particularly at a time when we are witnessing an expansion of
NON-HODGKIN'S LYMPHOMAS OF FEMALE REPRODUCTIVE SYSTEM
Directory of Open Access Journals (Sweden)
A. V. Babkina
2008-01-01
Full Text Available Non-Hodgkin's lymphomas are extremely rare among all tumors of female reproductive system. Diagnostic mistakes and inadequate therapeu- tic tactics in these diseases are results of usual absence of alertness of gynecologists. The aims are to analyze reasons of diagnostic mistakes in patients with non-Hodgkin's lymphomas of female reproductive system and to discover definitive clinical and morphological characteristics of female reproductive system lymphoid tumors. During the period between 1989 and 2006, 305 cases of primary extranodal non-Hodgkin's lym- phomas were detected; female reproductive system was affected in 7% of patients (totally 40 patients, which were included in investigated group. In the whole analyzed group of women (n=40, median age 43 yrs, range 17-84 yrs, patients with primary lesion of female reproductive system had median age of 40 yrs and with secondary involvement - 46 yrs. Most of patients were fertile (60%, n=24. Such tumors was localized in breast in 40% of cases (n=16, in ovaries - 20% (n=8, in uterine corpus - 12,5% (n=5, in uterine cervix - 15% (n=6, and in vagina - remaining 12,5% (n=5. Average time from diagnosis to beginning of the treatment was 7,5 months. As a result, the onset of specific therapy was delayed in 65% cases (n=26 and 50% (n=20 underwent unneeded surgery. Diagnostic mistakes lead to inadequate treatment. Extranodal non-Hodgkin’s lymphomas of female reproductive system, both primary and secondary, are rare pathology. Primary lesion is more typical for older women, sec- ondary is mainly affecting younger women (in reproductive period. Chemotherapy response and prognosis are better in primary cases.
Lecture versus DVD and Attitude Change toward Female Masturbation
Keels, Megan; Lee, Zoey; Knox, David; Wilson, Ken
2013-01-01
Four-hundred and ninety eight female undergraduate students at a large southeastern university participated in a study to assess how lecture versus DVD format affected attitude change towards female masturbation. All groups were given a pre and post test to assess masturbatory attitudes. Group 1 experienced a masturbation lecture. Group 2…
An Analysis of Female Research Productivity in Nigerian Universities
Ogbogu, Christiana O.
2009-01-01
This study examines the research output of female staff and the factors that affect their research productivity in the Nigerian university system. The study was carried out with a view to promoting strategies that will enhance productivity and increase the research output of female staff in Nigerian universities. The study adopted a survey…
Nguon, K.; Ladd, B.; Sajdel-Sulkowska, E. M.
2006-01-01
We previously reported that perinatal exposure to hypergravity affects cerebellar structure and motor coordination in rat neonates. In the present study, we explored the hypothesis that neonatal cerebellar structure and motor coordination may be particularly vulnerable to the effects of hypergravity during specific developmental stages. To test this hypothesis, we compared neurodevelopment, motor behavior and cerebellar structure in rat neonates exposed to 1.65 G on a 24-ft centrifuge during discrete periods of time: the 2nd week of pregnancy [gestational day (G) 8 through G15; group A], the 3rd week of pregnancy (G15 through birth on G22/G23; group B), the 1st week of nursing [birth through postnatal day (P) 6; group C], the 2nd and 3rd weeks of nursing (P6 through P21; group D), the combined 2nd and 3rd weeks of pregnancy and nursing (G8 through P21; group E) and stationary control (SC) neonates (group F). Prenatal exposure to hypergravity resulted in intrauterine growth retardation as reflected by a decrease in the number of pups in a litter and lower average mass at birth. Exposure to hypergravity immediately after birth impaired the righting response on P3, while the startle response in both males and females was most affected by exposure during the 2nd and 3rd weeks after birth. Hypergravity exposure also impaired motor functions, as evidenced by poorer performance on a rotarod; while both males and females exposed to hypergravity during the 2nd and 3rd weeks after birth performed poorly on P21, male neonates were most dramatically affected by exposure to hypergravity during the second week of gestation, when the duration of their recorded stay on the rotarod was one half that of SC males. Cerebellar mass was most reduced by later postnatal exposure. Thus, for the developing rat cerebellum, the postnatal period that overlaps the brain growth spurt is the most vulnerable to hypergravity. However, male motor behavior is also affected by midpregnancy exposure to
Directory of Open Access Journals (Sweden)
Jonathan P Evans
Full Text Available In many species, mating with multiple males confers benefits to females, but these benefits may be offset by the direct and indirect costs associated with elevated mating frequency. Although mating frequency (number of mating events is often positively associated with the degree of multiple mating (actual number of males mated, most studies have experimentally separated these effects when exploring their implications for female fitness. In this paper I describe an alternative approach using the guppy Poecilia reticulata, a livebearing freshwater fish in which females benefit directly and indirectly from mating with multiple males via consensual matings but incur direct and indirect costs of mating as a consequence of male sexual harassment. In the present study, females were experimentally assigned different numbers of mates throughout their lives in order to explore how elevated mating frequency and multiple mating combine to influence lifetime reproductive success (LRS and survival (i.e. direct components of female fitness. Under this mating design, survival and LRS were not significantly affected by mating treatment, but there was a significant interaction between brood size and reproductive cycle (a correlate of female age because females assigned to the high mating treatment produced significantly fewer offspring later in life compared to their low-mating counterparts. This negative effect of mating treatment later in life may be important in these relatively long-lived fishes, and this effect may be further exacerbated by the known cross-generational fitness costs of sexual harassment in guppies.
Differences in job stress experienced by female and male Japanese psychiatric nurses.
Yada, Hironori; Abe, Hiroshi; Omori, Hisamitsu; Matsuo, Hisae; Masaki, Otsubo; Ishida, Yasushi; Katoh, Takahiko
2014-10-01
In psychiatric nursing, female nurses tend to spend more time building rapport with patients and developing cooperative working relationships with colleagues; they encounter more sexual harassment by patients. In contrast, male nurses respond to aggressive patients and tend to resist physically caring for female patients; they encounter more physical and verbal assault from patients. These gender differences might result in differences in job-related stress. We quantitatively examined gender differences in psychiatric nurses' job stress. The Psychiatric Nurse Job Stressor Scale and the Stress Reaction Scale of the Brief Job Stress Questionnaire were administered to 159 female and 85 male Japanese psychiatric nurses. The results indicated that female nurses had significantly higher stress levels than males related to psychiatric nursing ability, attitude towards nursing, and stress reactions of fatigue and anxiety. Moreover, the factors affecting stress reactions differed somewhat between sexes. In particular, male nurses reported that greater irritability was affected by patients' attitudes. Their anxiety and somatic symptoms were affected by their attitude towards nursing, and depressed mood was affected by psychiatric nursing ability. Knowledge of these differences can lead to better mental health-care interventions for psychiatric nurses. © 2014 Australian College of Mental Health Nurses Inc.
KERATOSIS FOLLICULARIS SPINULOSA DECALVANS - A FAMILY STUDY OF 7 MALE CASES AND 6 FEMALE CARRIERS
VANOSCH, LDM; ORANJE, AP; KEUKENS, FM; VADER, PCV
Keratosis follicularis spinulosa decalvans (KFSD) is a rare X linked disease which is characterised by follicular hyperkeratosis of the skin and corneal dystrophy. Seven male patients and six female carriers are described. Special attention has been paid to the dermatological and ophthalmic markers
Altered reward sensitivity in female offspring of cocaine-exposed fathers.
Fischer, Delaney K; Rice, Richard C; Martinez Rivera, Arlene; Donohoe, Mary; Rajadhyaksha, Anjali M
2017-08-14
Recent rodent studies have demonstrated that parental cocaine exposure can influence offspring behavior, supporting the idea that environmental insults can impact subsequent generations. However, studies on the effects of paternal cocaine exposure are limited and multiple inconsistencies exist. In the current study, we behaviorally characterize the effects of paternal cocaine exposure in a C57BL/6J intergenerational mouse model. Male sires were administered cocaine hydrochloride (20mg/kg) or saline (0.01mL/g) once a day for 75days, and bred with drug naïve females twenty-four hours after the final injection. Offspring, separated by sex, were tested in a battery of behaviors. We found that paternal cocaine exposure altered sensitivity to the rewarding and stimulant effects of psychostimulants and natural reward (sucrose) in female offspring; female cocaine-sired offspring showed blunted cocaine preference using cocaine conditioned place preference (CPP) at a low dose (5mg/kg), but displayed similar preference at a higher dose (10mg/kg) compared to saline-sired controls. Additionally, cocaine-sired female offspring exhibited higher psychomotor sensitivity to cocaine (10mg/kg) and amphetamine (2mg/kg) and consumed more sucrose. Cocaine-sired males exhibited increased psychomotor effects of cocaine and amphetamine. Male offspring also displayed an anxiety-like phenotype. No effect of paternal cocaine exposure was observed on depressive-like, learning and memory or social behavior in male or female offspring. Collectively, our findings show that paternal, chronic cocaine exposure induces intergenerational behavioral effects in male and female offspring with greatest impact on sensitivity to psychostimulants and sucrose in females. Copyright © 2017 Elsevier B.V. All rights reserved.
Termination of a fe/male transsexual patient's analysis: an example of general validity.
Quinodoz, Danielle
2002-08-01
The author describes the termination of an analysis, which, while relating to the particular case of a male-to-female transsexual patient, may be relevant to all analysts, particularly those whose patients need to integrate disavowed and split-off parts of themselves. The patient had undergone sex-change surgery at the age of 20. Having lived as a woman thereafter, she had asked for analysis some twenty years later. The author, who discussed the first three years of that analysis in an earlier paper, as well as her hesitation about undertaking it, considers that its termination after seven years illustrates not only the specific problems posed by transsexuals but also the general ones presented by "heterogeneous patients". To the best of her knowledge, this is the first published case history of a transsexual patient who has undergone surgery. In the author's view, the patient has acquired a new sense of internal unity based on a notion of sex differentiation in which mutual respect between the sexes has replaced confusion and mutual hate, and her quality of life has improved. On the general level, this termination shows how the reduction of paranoid-schizoid anxieties and the reintegration of split-off parts of the personality lead, as the depressive position is worked through, to a better toleration of internal contradictions, a new sense of cohesion of the self and a diminution of the fear of madness.
Seven challenges for neuroscience.
Markram, Henry
2013-01-01
Although twenty-first century neuroscience is a major scientific enterprise, advances in basic research have not yet translated into benefits for society. In this paper, I outline seven fundamental challenges that need to be overcome. First, neuroscience has to become "big science" - we need big teams with the resources and competences to tackle the big problems. Second, we need to create interlinked sets of data providing a complete picture of single areas of the brain at their different levels of organization with "rungs" linking the descriptions for humans and other species. Such "data ladders" will help us to meet the third challenge - the development of efficient predictive tools, enabling us to drastically increase the information we can extract from expensive experiments. The fourth challenge goes one step further: we have to develop novel hardware and software sufficiently powerful to simulate the brain. In the future, supercomputer-based brain simulation will enable us to make in silico manipulations and recordings, which are currently completely impossible in the lab. The fifth and sixth challenges are translational. On the one hand we need to develop new ways of classifying and simulating brain disease, leading to better diagnosis and more effective drug discovery. On the other, we have to exploit our knowledge to build new brain-inspired technologies, with potentially huge benefits for industry and for society. This leads to the seventh challenge. Neuroscience can indeed deliver huge benefits but we have to be aware of widespread social concern about our work. We need to recognize the fears that exist, lay them to rest, and actively build public support for neuroscience research. We have to set goals for ourselves that the public can recognize and share. And then we have to deliver on our promises. Only in this way, will we receive the support and funding we need.
Midilli, Tulay Sagkal; Yasar, Eda; Baysal, Ebru
2015-01-01
The purpose of this study was to examine the menstruation and dysmenorrhea characteristics and the factors affecting dysmenorrhea of health school students, and the knowledge and use of the methods of complementary and alternative medicine (CAM) on the part of those students with dysmenorrhea. This is a descriptive study. A descriptive analysis was made by calculating the number, percentage, mean, Pearson χ, and logistic regression analysis. A total of 488 female students participated in the research and 87.7% (n = 428) of all students experienced dysmenorrhea. It was detected that a family history of dysmenorrhea and regular menstrual cycles of the students were dysmenorrhea-affecting factors (P dysmenorrhea used CAM methods. Heat application of CAM methods for dysmenorrhea management was the most commonly used and also known by the students. The students who experienced severe pain used analgesics (P < .05) and CAM methods (P < .05).
Somatotype and performance in female futsal players
Directory of Open Access Journals (Sweden)
Marcos Roberto Queiroga
2008-07-01
Full Text Available http://dx.doi.org/10.5007/1980-0037.2008v10n1p56 The present study aimed to verify whether body somatotype was indicative of competitive success in female utsal (indoor soccer players. One hundred and twelve players (22.1 ± 5.4 years; 58.4 ± 6.9 kg; 161.8 ± 6.2 cm, from ten teams and seven different states, had participated in a national competition. The anthropometric date was analyzed using one-way ANOVA for repeated measures. The somatotype dispersion distance was applied to compare somatotypes between the champion team (reference and the other teams (from 2nd to 10th position. Anthropometric characteristics did not differ signifi cantly among teams. The results showed that the endomorphic component was predominant in relation to the mesomorphic and ectomorphic component, irrespective of a team’s ranking at the end of the competition. Therefore, the body somatotypes of female futsal teams cannot be considered as indicative of their competitive success.
Polo, Pablo; Colmenares, Fernando
2012-06-01
The formation of bonds between strangers is an event that occurs routinely in many social animals, including humans, and, as social bonds in general, they affect the individuals' welfare and biological fitness. The present study was motivated by an interest in the behavioural processes that drive bond formation in a social context of hostility, in which the incumbent partners vary greatly in physical power and reproductive interests, a situation in which individuals of many group-living species find themselves often throughout their lives. We focused on the quantitative analysis of female abductions via male aggressive herding in a nonhuman primate, the hamadryas baboon, in which intersexual bonds are known to be strong. We tested three hypotheses informed by sexual conflict/sexual coercion theory (male herding-as-conditioning and female grooming-as-appeasement) and by socioecological theory (unit size and female competition). The results supported the predictions: males resorted to coercive tactics (aggressive herding) with abducted females, and abducted females elevated the amount of grooming directed at their new unit males; in fact, they escaped from the otherwise negative effect of unit size on female-to-male grooming. These findings reveal that conflicts of interest are natural ingredients underpinning social bonds and that resorting to coercive aggression may be an option especially when partners differ greatly in their physical power. Copyright © 2012 Elsevier B.V. All rights reserved.
Incentive schemes and female leadership in financial firms
Directory of Open Access Journals (Sweden)
Björn Lantz
2013-01-01
Full Text Available Our purpose is to explore how performance in Swedish financial companies is affected by the presence of a female chief executive officer (CEO, the presence of an incentive scheme, and the proportion of female board members. The results indicate that a female CEO is associated with a lower return on equity (ROE and a lower Tobin’s Q, but we find no significant association between the proportion of female board members and firm performance. An incentive scheme is generally associated with a lower return on assets (ROA and a higher Tobin’s Q. In particular, a share-based incentive scheme is associated with a lower ROA, a lower ROE, and a higher Tobin’s Q.
Factors affecting residual exotropia after two muscle surgery for intermittent exotropia
Directory of Open Access Journals (Sweden)
Shailja Tibrewal
2017-07-01
Full Text Available AIM: To study the factors affecting residual exotropia (>10 PD at 4-6wk postoperative visit following two rectus muscle surgery for intermittent exotropia [bilateral lateral rectus (LR recession or unilateral recess resect procedure]. METHODS: A retrospective chart review of patients with intermittent exotropia ≤50 PD who underwent two rectus muscle surgery in between Jan. 2011 to Dec. 2013 was performed. Possible factors were compared between patients with residual exotropia (>10 PD and successful outcome (within 10 PD of orthotropia at the 4-6wk postoperative visit. Effect/dose ratio was calculated by dividing the effect of surgery by the total amount (mm of muscle surgery done. RESULTS: One hundred and fifty-seven patients with mean age of 14y (range 3-53y were included. Twenty-seven patients (17.2% had residual exotropia at 4-6wk postoperative follow up. Age at surgery (P=0.009 and preoperative deviation for distance (P≤0.001 and near (P=0.001 were identified as important predictors of unsuccessful outcome. The occurrence of residual exotropia was not affected by amblyopia, anisometropia, lateral incomitance, pattern deviation, vertical deviation, type of exotropia or type of surgery done (recess-resect or bilateral LR recession. The effect/dose ratio was more in deviations >40 PD in the both recess-resect and bilateral LR recession type of surgery. The effect/dose ratio was less in patients with residual exotropia as compared to the successful outcome group (1.36 PD/mm vs 2.05 PD/mm in the bilateral LR recession surgery and 1.93 PD/mm vs 2.63 PD/mm in the unilateral recess-resect surgery. CONCLUSION: Residual exotropia is seen in 17% of patients after two muscle surgery for intermittent exotropia. Patients with older age and larger preoperative deviation have greater chances of developing failure of two muscle strabismus surgery for intermittent exotropia.
Carrillo, Beatriz; Gómez-Gil, Esther; Rametti, Giuseppina; Junque, Carme; Gomez, Angel; Karadi, Kazmer; Segovia, Santiago; Guillamon, Antonio
2010-09-01
There is strong evidence of sex differences in mental rotation tasks. Transsexualism is an extreme gender identity disorder in which individuals seek cross-gender treatment to change their sex. The aim of our study was to investigate if male-to-female (MF) and female-to-male (FM) transsexuals receiving cross-sex hormonal treatment have different patterns of cortical activation during a three-dimensional (3D) mental rotation task. An fMRI study was performed using a 3-T scan in a sample of 18 MF and 19 FM under chronic cross-sex hormonal treatment. Twenty-three males and 19 females served as controls. The general pattern of cerebral activation seen while visualizing the rotated and non-rotated figures was similar for all four groups showing strong occipito-parieto-frontal brain activation. However, compared to control males, the activation of MF transsexuals during the task was lower in the superior parietal lobe. Compared to control females, MF transsexuals showed higher activation in orbital and right dorsolateral prefrontal regions and lower activation in the left prefrontal gyrus. FM transsexuals did not differ from either the MF transsexual or control groups. Regression analyses between cerebral activation and the number of months of hormonal treatment showed a significant negative correlation in parietal, occipital and temporal regions in the MF transsexuals. No significant correlations with time were seen in the FM transsexuals. In conclusion, although we did not find a specific pattern of cerebral activation in the FM transsexuals, we have identified a specific pattern of cerebral activation during a mental 3D rotation task in MF transsexuals under cross-sex hormonal treatment that differed from control males in the parietal region and from control females in the orbital prefrontal region. The hypoactivation in MF transsexuals in the parietal region could be due to the hormonal treatment or could reflect a priori cerebral differences between MF transsexual
Da Silva, Roberta Dos Santos; Cavichioli, Rodney R; Takiya, Daniela M; Mejdalani, Gabriel
2018-01-18
Seven new species of the economically important sharpshooter genus Acrogonia Stål are described and illustrated: A. falcata sp. nov. (French Guiana and state of Amazonas, Brazil), A. felixi sp. nov. (department of Loreto, Peru), A. quintasi sp. nov. (state of Pará, Brazil), A. distincta sp. nov. (state of Amazonas, Brazil), A. dentata sp. nov. (department of San Martin in Peru, French Guiana, and states of Amazonas, Mato Grosso, Pará, and Rondônia in Brazil), A. luizi sp. nov. (province of Pastaza in Ecuador and state of Amazonas in Brazil), and A. lobulata sp. nov. (province of Orellana, Ecuador). In addition to the external morphology, color pattern, and male genitalia, detailed descriptions and illustrations of the female genitalia are provided for three of the new species (A. dentata, A. luizi, and A. lobulata). Females of the other four new species are unknown. Acrogonia includes now 39 species, being among the most species-rich genera of the Proconiini.
Nutritional needs of the female athlete.
Manore, M M
1999-07-01
US women, including female athletes, are under ever increasing pressure to be thin ar thinner. this pressure to achieve and maintain a low body weight leads to potentially harmful patterns of long-term dieting or disordered eating, which can affect long-term health. Some of the health consequences of long-term energy restriction in female athletes may include poor energy and nutrient intakes, poor nutritional status, decreased RMR and total daily energy expenditure, increased psychological stress and risk for a clinical eating disorder, and increased risk for exercise-induced amenorrhea and osteoporosis. Female athletes participating in thin-build sports may be at risk for the disorders of the female athlete triad: disordered eating, amenorrhea, and osteoporosis. This triad of disorders can also produce severe health consequences that can influence present and future health. Strategies for helping active women get off the dieting "bandwagon" requires the identification of an appropriate and healthy body weight, good eating and exercise habits, and techniques for maintaining these habits throughout life.
Den site activity patterns of adult male and female swift foxes, Vulpes velox, in Northwestern Texas
Lemons, P.R.; Ballard, W.B.; Sullivan, R.M.; Sovada, M.A.
2003-01-01
Activity of Swift Foxes (Vulpes velox) at den sites was studied in northwestern Texas during pup rearing seasons in 2000 and 2001 to determine role of males in parental care. Twenty-four percent of radio-collared females with a potential to breed successfully raised pups to eight weeks of age. We intensively monitored presence and absence of male and female Swift Foxes at two den sites each year. Females were present >2.6 times more at den sites than males during the pup rearing season. Female and male Swift Foxes largely stayed at dens during diurnal hours and were active away from dens during nocturnal and crepuscular hours. Females and males spent 12.4% and 3.0% more time at dens before pups emerged, than after pups emerged, respectively. Following depredation of one male parent, the female spent 29% less time at the den site. Decrease in time spent at the den by the female following loss of her mate suggested that loss of one parent might severely impact recruitment of Swift Foxes. Our observations indicated that intense Coyote (Canis latrans) depredation may severely impact pup-rearing success as well as the parental care within Swift Fox family groups.
Leksrisompong, N; Romero-Sanchez, H; Oviedo-Rondón, E O; Brake, J
2014-07-01
A study was conducted to examine how 2 feeder space allocations during the rearing period followed by 2 feeder space allocations after photostimulation and 2 female feeding to peak programs (fast or slow) affected female broiler breeder reproductive performance and mortality. Sixteen pens of 76 breeder females each were equipped with either 4 tube feeders with a 132 cm circumference pan (7.0 cm/female) or 6 feeders (10.4 cm/female) to 21 wk of age. Thereafter, 64 females were moved to breeding pens, photostimulated, and fed sex-separate from either 3 (6.2 cm/female) or 5 (10.3 cm/female) feeders with either fast or slow feeding to peak feeding programs applied to complete a 2 × 2 × 2 factorial design. Seven males that were separately reared in a similar manner were added per pen. Individual female BW was determined at 6, 20, and 32 wk of age and BW uniformity assessed. Greater feeder space during rearing increased BW at 32 wk of age, whereas greater feeder space during lay or slow feeding to peak decreased BW at 32 wk. There were no differences in BW uniformity. Hens from the 10.4 to 10.3 cm/female combination produced a significantly greater number of eggs as compared with the 7.0 to 10.3 cm/female and 10.4 to 6.2 cm/female combinations with the 7.0 to 6.2 cm/female combination intermediate. Percentage hen-day egg production of the 10.4 to 10.3 cm/female combination hens was significantly greater than all other combinations. Livability was improved in the 10.4 to 10.3 cm/female combination relative to the 7.0 to 10.3 cm/female combination with the others intermediate. The fast feeding to peak program increased yolk weight as well as yolk:albumen ratio at 28 and 30 wk of age, but egg weight did not differ. These data indicated that increased or decreased feeder space between the growing and laying periods did not affect broiler breeder female BW, uniformity, egg weight, fertility, or hatchability. The 10.3 cm/female laying feeder space exhibited the best hen
Cífková, Renata
2015-05-01
Hypertension is the most common cardiovascular disorder affecting more males in younger age groups; in the age group of 45-64, it is equally frequent in both genders, it is more common in elderly females. Blood pressure increases more in females around the menopause. Use of hormonal replacement therapy is not associated with an BP increase but, because of increased risk of coronary events, stroke, and thromboembolic events, HRT is not re-commended in CVD prevention. There is a similar decrease in BP by antihypertensive drugs in both genders as well as benefit from antihypertensive treatment. Women report about a double rate of adverse events of antihypertensive drugs. Oral contraception use is associated with a mild BP increase in most women and development of overt hypertension in about 5 %. Pre-eclampsia is associated with increased risk of developing CVD later in life (more frequent development of hypertension, myocardial infarction, and stroke).
Aggio, Daniel; Wallace, Karen; Boreham, Nicola; Shankar, Aparna; Steptoe, Andrew; Hamer, Mark
2017-09-01
The aim of the study was to determine whether objectively measured daily physical activity and posture of sitting, standing, and sit-to-stand transitions are associated with daily assessments of affect. Participants (N = 51, 49% female) wore ActivPal accelerometers for 24 h/d for seven consecutive days. Time spent sitting, standing, and being physically active and sit-to-stand transitions were derived for each day. Participants also completed a mood inventory each evening. Multilevel models examined within- and between-person associations of daily physical activity with positive and negative affect, adjusting for age, sex, body mass index, education, and sleep duration. Within-person associations showed that a 1-hour increase in daily physical activity was associated with a decrease in negative affect over the same day (B = -0.11, 95% confidence interval [CI], -0.21 to -0.01). Between-person associations indicated a borderline significant association between higher average daily physical activity levels and higher positive affect (B = 1.85, 95% CI = -0.25 to 3.94). There were no between- or within-person associations between sitting, standing, and sit-to-stand transitions with affect. Promoting physical activity may be a potential intervention strategy to acutely suppress negative affective states.
Fairfield, Beth; Mammarella, Nicola; Di Domenico, Alberto; D'Aurora, Marco; Stuppia, Liborio; Gatta, Valentina
2017-08-30
False memories are common memory distortions in everyday life and seem to increase with affectively connoted complex information. In line with recent studies showing a significant interaction between the noradrenergic system and emotional memory, we investigated whether healthy volunteer carriers of the deletion variant of the ADRA2B gene that codes for the α2b-adrenergic receptor are more prone to false memories than non-carriers. In this study, we collected genotype data from 212 healthy female volunteers; 91 ADRA2B carriers and 121 non-carriers. To assess gene effects on false memories for affective information, factorial mixed model analysis of variances (ANOVAs) were conducted with genotype as the between-subjects factor and type of memory error as the within-subjects factor. We found that although carriers and non-carriers made comparable numbers of false memory errors, they showed differences in the direction of valence biases, especially for inferential causal errors. Specifically, carriers produced fewer causal false memory errors for scripts with a negative outcome, whereas non-carriers showed a more general emotional effect and made fewer causal errors with both positive and negative outcomes. These findings suggest that putatively higher levels of noradrenaline in deletion carriers may enhance short-term consolidation of negative information and lead to fewer memory distortions when facing negative events. Copyright © 2017 Elsevier B.V. All rights reserved.
The twenty-eight lodges (xiu 宿)
Morgan, Daniel Patrick
2018-01-01
The twenty-eight lodges (xiu 宿). Named and numbered in the central circle, the twenty-eight lodges, represent uneven orange-segment-like divisions of the celestial sphere running from pole to pole through the ‘guide stars’ (juxing 距星) at/near the western extremity of the constellations after which they are named. In the inner circle are the modern identifications of those guide stars. In the outer circle are the equatorial lodge widths in contemporary use in du 度 / days, where the number of d...
Pilot Study on The Thermographic Change of Seven Acupoints by Digital Infrared Thermographic Imaging
Directory of Open Access Journals (Sweden)
Lee Yun-kyu
2005-12-01
Full Text Available Objective : This study was designed to find out the effect of seven acupoints of stroke in cerebrovascular hemiplegia patients. Methods : This study was performed on 6 patients with cerebrovascular hemiplegia (test group and 6 health persons(control group. We measured temperature of skin surface of test and control group using digital infrared thermographic imaging(D.I.T.I. after acupunture on seven acupoints of stroke. And we calculated difference of skin temperature between healthful and affected side for each groups. Results : There was significant difference in area 3 in both two groups between before and after acupuncture. But in general there was no significant difference between two groups on thermographic change. Conclusions : This is pilot study, so further studies are required to find out the effect of seven acupoints of stroke in cerebrovascular hemiplegia patients.
Elevated dioxin levels in chloracne cases twenty years after the Seveso, Italy accident
Energy Technology Data Exchange (ETDEWEB)
Baccarelli, A.; Pesatori, A.C.; Consonni, D.; Bonzini, M.; Giacomini, S.M.; Bertazzi, P.A. [EPOCA Research Center, Univ. of Milan (Italy); Mocarelli, P. [Dept. of Lab. Medicine, Univ. of Milan-Bicocca, Desio (Italy); Patterson, D.G. Jr. [Centers for Disease Control and Prevention, Atlanta, GA (United States); Caporaso, N.E.; Landi, M.T. [Div. of Cancer Epidemiology and Genetics, National Cancer Inst., NIH, DHHS, Bethesda, MD (United States)
2004-09-15
In July 1976, an industrial accident contaminated a residential area surrounding Seveso, Italy, with high levels of 2,3,7,8-Tetrachlorodibenzo-p-dioxin (TCDD). The exposure was acute, relatively pure, and affected more than 45,000 men, women, and children. By February 1978, 193 chloracne cases, mostly children, had been identified in the exposed population. Twenty years after, we conducted a case-control study on subjects diagnosed with chloracne and control subjects, who had not developed chloracne after the accident, to evaluate their TCDD plasma levels, as well as the exposure-response relationship and possible determinants of susceptibility to TCDD effects in this population.
Lemos,Walkymário de Paulo; Ramalho,Francisco de Souza; Serrão,José Eduardo; Zanuncio,José Cola
2005-01-01
The morphology of the reproductive tract of Podisus nigrispinus (Dallas) females fed with Alabama argillacea (Hübner) larvae, artificial diet, Tenebrio molitor L. larvae or Musca domestica L. larvae were studied. The reproductive tract of females of this species presented yellow coloration and independent of the diet, each ovary had seven ovarioles joined through terminal filaments and forming a bunch shape structure. The histological data revealed that the ovary of P. nigrispinus was of mero...
Bajoghli, Hafez; Joshaghani, Narges; Gerber, Markus; Mohammadi, Mohammad-Reza; Holsboer-Trachsler, Edith; Brand, Serge
2013-06-01
Experiencing romantic love is important in individual development. Little is known about romantic love among adolescents in non-Western countries. The aim of the present study was to explore romantic love among Iranian male and female adolescents. A total of 201 adolescents (mean age: 17.73 years) took part in the study; of these, 81 indicated they were experiencing romantic love at the time of survey, and 120 indicated they were not in love. Participants answered questionnaires related to affective states (hypomania, depressive symptoms, state and trait anxiety) and exercise, and completed a sleep log for seven consecutive nights. Compared to controls, participants in love displayed favourable hypomania scores, fewer depressive symptoms and increased concentration during the day. However, participants in love also had higher state anxiety scores. Moreover, hypomanic-like stages increased with duration of relationship in female, but not in male participants. The pattern of results suggests a favourable association between being currently in love and emotional and cognitive processes. Sleep, however, seemed unrelated to this specific state.
Directory of Open Access Journals (Sweden)
Kathy Darragh
2017-11-01
Full Text Available Sex-specific pheromones are known to play an important role in butterfly courtship, and may influence both individual reproductive success and reproductive isolation between species. Extensive ecological, behavioural and genetic studies of Heliconius butterflies have made a substantial contribution to our understanding of speciation. Male pheromones, although long suspected to play an important role, have received relatively little attention in this genus. Here, we combine morphological, chemical and behavioural analyses of male pheromones in the Neotropical butterfly Heliconius melpomene. First, we identify putative androconia that are specialized brush-like scales that lie within the shiny grey region of the male hindwing. We then describe putative male sex pheromone compounds, which are largely confined to the androconial region of the hindwing of mature males, but are absent in immature males and females. Finally, behavioural choice experiments reveal that females of H. melpomene, H. erato and H. timareta strongly discriminate against conspecific males which have their androconial region experimentally blocked. As well as demonstrating the importance of chemical signalling for female mate choice in Heliconius butterflies, the results describe structures involved in release of the pheromone and a list of potential male sex pheromone compounds.
Simpson, Amber; Che, S. Megan
2016-01-01
Utilizing a descriptive phenomenological design, this study examines the lived experiences of seven middle grade students, four females and three males, enrolled in a single-sex mathematics classroom within a coeducational school setting. The intent of the study is to understand, from students themselves, about the experience of single-sex…
Prevalence and risk factors for female sexual dysfunction among Egyptian women.
Ibrahim, Zakia Mahdy; Ahmed, Magdy Refaat; Sayed Ahmed, Waleed Ali
2013-06-01
To assess sexual function among married women and determine associated risk factors for sexual dysfunction. Cross-sectional hospital-based study involving 509 non-pregnant married females 20-59 years old who were enrolled into the study after approval of the ethics committee. The study population was recruited among women attending gynecology outpatient clinic or their relatives visiting inpatients of obstetrics and gynecology department at Suez Canal University Hospital. Female and male partner-related data were collected using an interview questionnaire. Sexual dysfunction was assessed using female sexual function index (FSFI). Mean female age was 39.5 years. About half of the participants were premenopausal (48.7 %). Most of the females were circumcised (71.7 %). Desire and Orgasm domains were the most affected with 52.8 % of the participants having sexual dysfunction. Total FSFI score of ≤26.55 was the cutoff value for diagnosis of FSD and female age, postmenopausal status, duration of marriage, circumcision, partner's age, and the presence of male sexual dysfunction were found to be significant associated factors with FSD. FSD is highly prevalent in Egypt and orgasm and desire scores were the most affected domains. Several personal (female age, postmenopausal status, duration of marriage and circumcision) and male partner (age, and the presence of sexual dysfunction) factors were significantly associated.
Proceedings: Twenty years of energy policy: Looking toward the twenty-first century
International Nuclear Information System (INIS)
1992-01-01
In 1973, immediately following the Arab Oil Embargo, the Energy Resources Center, University of Illinois at Chicago initiated an innovative annual public service program called the Illinois Energy Conference. The objective was to provide a public forum each year to address an energy or environmental issue critical to the state, region and nation. Twenty years have passed since that inaugural program, and during that period we have covered a broad spectrum of issues including energy conservation nuclear power, Illinois coal, energy policy options, natural gas, alternative fuels, new energy technologies, utility deregulation and the National Energy Strategy
Proceedings: Twenty years of energy policy: Looking toward the twenty-first century
Energy Technology Data Exchange (ETDEWEB)
1992-12-31
In 1973, immediately following the Arab Oil Embargo, the Energy Resources Center, University of Illinois at Chicago initiated an innovative annual public service program called the Illinois Energy Conference. The objective was to provide a public forum each year to address an energy or environmental issue critical to the state, region and nation. Twenty years have passed since that inaugural program, and during that period we have covered a broad spectrum of issues including energy conservation nuclear power, Illinois coal, energy policy options, natural gas, alternative fuels, new energy technologies, utility deregulation and the National Energy Strategy.
Why the American public supports twenty-first century learning.
Sacconaghi, Michele
2006-01-01
Aware that constituent support is essential to any educational endeavor, the AOL Time Warner Foundation (now the Time Warner Foundation), in conjunction with two respected national research firms, measured Americans' attitudes toward the implementation of twenty-first century skills. The foundation's national research survey was intended to explore public perceptions of the need for changes in the educational system, in school and after school, with respect to the teaching of twenty-first century skills. The author summarizes the findings of the survey, which were released by the foundation in June 2003. One thousand adults were surveyed by telephone, including African Americans, Latinos, teachers, and business executives. In general, the survey found that Americans believe today's students need a "basics-plus" education, meaning communication, technology, and critical thinking skills in addition to the traditional basics of reading, writing, and math. In fact, 92 percent of respondents stated that students today need different skills from those of ten to twenty years ago. Also, after-school programs were found to be an appropriate vehicle to teach these skills. Furthermore, the survey explored how well the public perceives schools to be preparing youth for the workforce and postsecondary education, which twenty-first century skills are seen as being taught effectively, and the level of need for after-school and summer programs. The survey results provide conclusive evidence of national support for basics-plus education. Thus, a clear opportunity exists to build momentum for a new model of education for the twenty-first century.
DEFF Research Database (Denmark)
Tuominen, Lauri; Miettunen, Jouko; Cannon, Dara M
2017-01-01
scores from 91 healthy males and 56 healthy females. We specifically tested if the association between neuroticism and serotonin transporter is different in females and males. Results: We found that neuroticism and thalamic serotonin transporter binding potentials were associated in both males......). Conclusions: The finding is in agreement with recent studies showing that the serotonergic system is involved in affective disorders differently in males and females and suggests that contribution of thalamic serotonin transporter to the risk of affective disorders depends on sex....... and females, but with opposite directionality. Higher neuroticism associated with higher serotonin transporter binding potential in males (standardized beta 0.292, P=.008), whereas in females, higher neuroticism associated with lower serotonin transporter binding potential (standardized beta -0.288, P=.014...
Female circumcision and child mortality in urban Somalia.
Mohamud, O A
1991-01-01
In Somalia, a demographer analyzed urban data obtained from the Family Health Survey to examine the effect female circumcision has on child mortality and the mechanism of that effect. Girls undergo female circumcision between 5-12 years old in Somalia. Since sunni circumcision (removal of the clitoral prepuce and tip of the clitoris) and clitoridectomy (removal of the entire clitoris) did not affect child mortality, he used them as the reference group. Infibulation (entire removal of the clitoris and of the labia minora and majora with the remains of the labia majora being sewn together allowing only a small opening for passage of urine) did affect child mortality. Female children who underwent infibulation and whose mothers most likely also underwent infibulation experienced higher mortality (13-72%) than those from other circumcised mothers. Female mortality exceeded male mortality indicating possible son preference. Mothers with clitoridectomy or infibulation had significantly higher infant mortality than those with sunni circumcision with the strongest effects during the neonatal period (95% and 42% higher mortality, respectively; p=.01). The effect of female circumcision on child mortality decreased with increased child's age. This higher than expected mortality among women with clitoridectomy may have been because women with infibulation had more stillbirths which were not counted as births. The exposed vagina of clitoridectomized women is more likely to be infected resulting in high risk of stillbirths and premature births than the closed vagina of infibulated women. The researcher suggested that the policies promoting education and consciousness raising may eventually eradicate female circumcision. This longterm campaign should use mass media, senior women of high status, and respected religious leaders. Legislation prohibiting this practice would only drive it underground under unsanitary conditions. Demographers should no longer ignore female circumcision
Event segmentation and seven types of narrative discontinuity in popular movies.
Cutting, James E
2014-06-01
Using a sample of 24 movies I investigate narrative shifts in location, characters, and time frame that do and do not align with viewer segmentations of events (scenes and subscenes) in popular movies. Taken independently these dimensions create eight categories, seven of change and one of nonchange. Data show that the more dimensions that are changed the more viewers agree on their segmentations, although the nonadditive variations across the seven change types are large and systematic. Dissolves aid segmentation but over the last 70 years they have been used less and less by filmmakers, except for two infrequent shift types. Locations and characters are strongly yoked, jointly accounting for most narrative shifts. There are also interactions of shift types over the 70-year span and across genres, as well as differences that affect the scale of the establishing shot in a new scene. In addition, several aspects of the narratives of individual movies affect the distributions of shift types. Together these results suggest that there are at least four different signatures of narrative shifts to be found in popular movies - general patterns across time, patterns of historical change, genre-specific patterns, and film-specific patterns. Copyright © 2014 The Author. Published by Elsevier B.V. All rights reserved.
Twenty lectures on thermodynamics
Buchdahl, H A
2013-01-01
Twenty Lectures on Thermodynamics is a course of lectures, parts of which the author has given various times over the last few years. The book gives the readers a bird's eye view of phenomenological and statistical thermodynamics. The book covers many areas in thermodynamics such as states and transition; adiabatic isolation; irreversibility; the first, second, third and Zeroth laws of thermodynamics; entropy and entropy law; the idea of the application of thermodynamics; pseudo-states; the quantum-static al canonical and grand canonical ensembles; and semi-classical gaseous systems. The text
Kouidhi, Wided; Desmetz, Catherine; Nahdi, Afef; Bergès, Raymond; Cravedi, Jean-Pierre; Auger, Jacques; El May, Michèle; Canivenc-Lavier, Marie Chantal
2012-06-01
It has been suggested that hormonally controlled submandibular salivary gland (SSG) development and secretions may be affected by endocrine disruptor compounds. We investigated the effects of oral gestation-lactation exposure to 1 mg/kg body weight daily dose of the estrogenic soy-isoflavone genistein and/or the anti-androgenic food contaminant vinclozolin in female rats. The SSGs of female offspring were collected at postnatal day 35 to study gland morphogenesis and mRNA expression of sex-hormone receptors and endocrine growth factors as sex-dependent biomarkers. Because of high expression in neonatal SSG, mRNA expression of transforming growth factor α was also studied. Exposure to genistein, vinclozolin, or a genistein+vinclozolin mixture resulted in significantly lower numbers of striated ducts linked to an increase in their area and lower acinar proliferation (Ki-67-positive nuclei). Exposure to the mixture had the highest significant effects, which were particularly associated with repression of epidermal growth factor, nerve growth factor, and transforming growth factor α expression. In conclusion, early exposure to low doses of genistein and vinclozolin can affect glandular structure and endocrine gene mRNA expression in prepubertal SSG in female rats, and the effects are potentialized by the genistein+vinclozolin mixture. Our study provides the first evidence that SSG are targeted by both estrogenic and anti-androgenic disrupting compounds and are more sensitive to mixtures.
Individualistic Aptitude and Biofeedback on Improvement of Coordination in Young Athletes
Directory of Open Access Journals (Sweden)
Saha Srilekha
2015-01-01
Full Text Available Sports cognition encompasses the primary affective-motivational aspect related to primordial fight-or flight responses, which are essentially the precursors for both the BAS (behavioural activation system - the reward system and BIS (behavioural inhibition system- the punishment or fear-eliciting system. In Asian and especially South-Asian perspective, impulsivity and aggressive out-bursts are by and large considered as conduct disorders, thus more acceptable docile tendency in children and pre-adolescent lead them to a cognitive-motivational make-up of BIS orientation. With such a background the present study was carried out to identify the extent of cognitive-affective competence of the skilled competitive players in enhancing bilateral motor coordination required for high sport performance. Eighty-one high performing female ball game players matched with their performance-specific motor coordination ability, were categorised into three differential groups based on their psychobiological competence, viz; Group A- consisted of twenty-seven players diagnosed with moderate level of sympathovagal balance; Group B (N = 27 – consisted of twenty-seven players diagnosed with discordant sympathovagal balance, while Group C (n = 27 were identified as having high sympathovagal balance. Thereafter, players of Group B & C were introduced to training of skin-conductance biofeedback tailored for musculoskeletal enhancement (20 min.s/ day; three days/ week for twelve weeks. Mid-term analyses of motor coordination as well as the post-intervention analyses (carried out after the twelfth week revealed that players having higher sympathovagal balance had higher efficiency in modulation of muscle tension as well as in perceptual –motor adaptation, which have prompted them to have enhanced bilateral and visual-motor coordination compared to their counterparts.
Castro, Beatriz; Sánchez, Pilar; Torres, Jesús M; Ortega, Esperanza
2015-10-01
Early-life exposure to the endocrine disruptor bisphenol A (BPA) affects brain function and behavior, which might be attributed to its interference with hormonal steroid signaling and/or neurotransmitter systems. Alternatively, the use of structural analogs of BPA, mainly bisphenol F (BPF) and bisphenol S (BPS), has increased recently. However, limited in vivo toxicity data exist. We investigated the effects of BPA, BPF and BPS on 5α-reductase (5α-R), a key enzyme involved in neurosteroidogenesis, as well as on dopamine (DA)- and serotonin (5-HT)-related genes, in the prefrontal cortex (PFC) of juvenile female rats. Gestating Wistar rats were treated with either vehicle or 10 μg/kg/day of BPA, BPF or BPS from gestational day 12 to parturition. Then, female pups were exposed from postnatal day 1 through day 21 (PND21), when they were euthanized and RT-PCR, western blot and quantitative PCR-array experiments were performed. BPA decreased 5α-R2 and 5α-R3 mRNA and protein levels, while both BPF and BPS decreased 5α-R3 mRNA levels in PFC at PND21. Further, BPA, BPF and BPS significantly altered, respectively, the transcription of 25, 56 and 24 genes out of the 84 DA and 5-HT-related genes assayed. Of particular interest was the strong induction by all these bisphenols of Cyp2d4, implicated in corticosteroids synthesis. Our results demonstrate for the first time that BPA, BPF and BPS differentially affect 5α-R and genes related to DA/5-HT systems in the female PFC. In vivo evidence of the potential adverse effects of BPF and BPS in the brain of mammals is provided in this work, raising questions about the safety of these chemicals as substitutes for BPA. Copyright © 2015 Elsevier Inc. All rights reserved.
Factors affecting disclosure of serostatus to children attending Jinja ...
African Journals Online (AJOL)
Factors affecting disclosure of serostatus to children attending Jinja Hospital ... twenty children and all (ten) health workers at Jinja Hospital paediatric HIV clinic. ... and child attending psychosocial support group (OR 7.4 CI 3.6-15.3 p < 0.001).
Histophilus somni is a fastidious gram-negative opportunistic pathogenic Pasteurellacea that affects multiple organ systems and is one of the principle bacterial species contributing to bovine respiratory disease complex (BRDC) in feed yard cattle. Here we present seven closed genomes isolated from...
de Godoy, M R C; Ochi, K; de Oliveira Mateus, L F; de Justino, A C C; Swanson, K S
2015-05-01
The objective of this study was to investigate whether increased dietary water content and feeding frequency increased voluntary physical activity of young, lean adult female cats. A replicated 4 × 4 Latin square design with a 2 × 2 factorial treatment arrangement (feeding frequency and water content) was used. The 4 treatments consisted of 1 meal daily dry pet food without added water (1D; 12% moisture as is), 1 meal daily dry pet food with added water (1W; 70% total water content), 4 meals daily dry pet food without added water (4D; 12% moisture as is), and 4 meals daily dry pet food with added water (4W; 70% total water content). Eight healthy adult, lean, intact, young, female domestic shorthair cats were used in this experiment. Voluntary physical activity was evaluated using Actical activity monitors placed on collars and worn around the cats' necks for the last 7 d of each experimental period of 14 d. Food anticipatory activity (FAA) was calculated based on 2 h prior to feeding periods and expressed as a percentage of total daily voluntary physical activity. Increased feeding frequency (4 vs. 1 meal daily) resulted in greater average daily activity (P = 0.0147), activity during the light period (P = 0.0023), and light:dark activity ratio (P = 0.0002). In contrast, physical activity during the dark period was not altered by feeding frequency (P > 0.05). Cats fed 4 meals daily had increased afternoon FAA (P= 0.0029) compared with cats fed once daily. Dietary water content did not affect any measure of voluntary physical activity. Increased feeding frequency is an effective strategy to increase the voluntary physical activity of cats. Thus, it may assist in the prevention and management of obesity.
Spinelli, Letizia; Imbriaco, Massimo; Nappi, Carmela; Nicolai, Emanuele; Giugliano, Giuseppe; Ponsiglione, Andrea; Diomiaiuti, Tommaso Claudio; Riccio, Eleonora; Duro, Giovanni; Pisani, Antonio; Trimarco, Bruno; Cuocolo, Alberto
2018-04-01
Hybrid 18 F-fluorodeoxyglucose (FDG) positron emission tomography and magnetic resonance imaging may differentiate mature fibrosis or scar from fibrosis associated to active inflammation in patients with Anderson-Fabry disease, even in nonhypertrophic stage. This study was designed to compare the results of positron emission tomography and magnetic resonance cardiac imaging with those of speckle-tracking echocardiography in heterozygous Anderson-Fabry disease females. Twenty-four heterozygous females carrying α-galactosidase A mutation and without left ventricular hypertrophy underwent cardiac positron emission tomography and magnetic resonance using 18 F-FDG for glucose uptake and 2-dimensional strain echocardiography. 18 F-FDG myocardial uptake was quantified by measuring the coefficient of variation (COV) of the standardized uptake value using a 17-segment model. Focal 18 F-FDG uptake with COV >0.17 was detected in 13 patients, including 2 patients with late gadolinium enhancement at magnetic resonance. COV was 0.30±0.14 in patients with focal 18 F-FDG uptake and 0.12±0.03 in those without ( P 0.17 compared with those with COV ≤0.17 (-18.5±2.7% versus -22.2±1.8%; P =0.024). For predicting COV >0.17, a global longitudinal strain >-19.8% had 77% sensitivity and 91% specificity and a value >2 dysfunctional segments 92% sensitivity and 100% specificity. In females carrying α-galactosidase A mutation, focal 18 F-FDG uptake represents an early sign of disease-related myocardial damage and is associated with impaired left ventricular longitudinal function. These findings support the hypothesis that inflammation plays an important role in glycosphingolipids storage disorders. © 2018 American Heart Association, Inc.
Buchbinder, Eli; Goldblatt, Hadass
2011-01-01
This article describes and analyzes the relationship disenchantment of couplehood among female survivors of violence and their family-of-origin experiences of abuse. Twenty Israeli women who were survivors of violence participated in this qualitative research. Each woman underwent three in-depth interviews, two for data collection and one for…
DeSouza, Eros R.; Cerqueira, Elder
2009-01-01
Sexual harassment has been investigated mostly in developed countries. The authors examined frequency rates and consequences of sexual harassment among female domestic workers in Brazil. Twenty-six percent had been sexually harassed at work during the past year. Live-in workers were at significantly greater risk for experiencing sexual harassment…
Female Employment and Fertility in Rural China
Fang, Hai; Eggleston, Karen N.; Rizzo, John A.; Zeckhauser, Richard Jay
2010-01-01
Data on 2,288 married women from the 2006 China Health and Nutrition Survey are deployed to study how off-farm female employment affects fertility. Such employment reduces a married woman’s actual number of children by 0.64, her preferred number by 0.48, and her probability of having more than one child by 54.8 percent. Causality flows in both directions; hence, we use well validated instrumental variables to estimate employment status. China has deep concerns with both female employment an...
Perineal hernia with bladder retroflexion in a female cocker spaniel
International Nuclear Information System (INIS)
Niles, J.D.; Williams, J.M.
1999-01-01
Perineal herniation in the bitch is rare and its complication by bladder retroflexion in the bitch has not been previously reported in the literature. This case report describes a multigravid, five-year-old female cocker spaniel with bilateral perineal hernias, complicated by marked rectal sacculation and ventral bladder retroflexion. The case was managed initially by cystopexy and colopexy, followed seven days later by bilateral perineal herniorrhaphy. There was no recurrence of the problem by 12 months postsurgery
The Twenty Statement Test in Teacher Development
Directory of Open Access Journals (Sweden)
Ahmet Aypay
2011-10-01
Full Text Available The purpose of this study is to describe teacher characteristics using Twenty Statements Test (TST. Study group includes a total of thirty-five individuals, including teachers, guidance and counselors and research assistants. The study used a qualitative approach on teacher identity. TST is one of the qualitative methods that were used to determine individual self-conceptualization. Study group were requested to write twenty statements that describe themselves responding to the question “Who I am?” in a free format. The findings indicated that teachers were overwhelmingly in group c (reflective. No differences were found in terms of gender and profession. Only few significant differences have been found based on marital status. The utility of TST in teacher training and development was discussed.
The Twenty Statement Test in Teacher Development
Directory of Open Access Journals (Sweden)
Ahmet Aypay
2011-04-01
Full Text Available The purpose of this study is to describe teacher characteristics using Twenty Statements Test (TST. Study group includes a total of thirty-five individuals, including teachers, guidance and counselors and research assistants. The study used a qualitative approach on teacher identity. TST is one of the qualitative methods that were used to determine individual self-conceptualization. Study group were requested to write twenty statements that describe themselves responding to the question “Who I am?” in a free format. The findings indicated that teachers were overwhelmingly in group c (reflective. No differences were found in terms of gender and profession. Only few significant differences have been found based on marital status. The utility of TST in teacher training and development was discussed
Neumann, Lily; Lerner, Ella; Glazer, Yael; Bolotin, Arkady; Shefer, Alexander; Buskila, Dan
2008-12-01
We examined the relationship between body mass index (BMI) and measures of tenderness, quality of life, and physical functioning in female fibromyalgia (FMS) patients. A random sample of 100 female FMS patients from a database of 550 FMS individuals was interviewed and assessed according to a structured questionnaire that included FMS-related symptoms, measures of tenderness (point count and dolorimetry), quality of life (SF-36), physical functioning, and BMI. Weight was defined as normal, overweight, and obesity according to BMI. Twenty-seven percent of the FMS patients had normal BMI, 28% were overweight, and 45% were obese. BMI was negatively correlated with quality of life (r = -0.205, P = 0.044) and tenderness threshold (r = -0.238, P = 0.021) and positively correlated with physical dysfunctioning (r = 0.202, P = 0.047) and point count (r = 0.261, P = 0.011). Obese FMS patients display higher pain sensitivity and lower levels of quality of life. In designing studies that explore factors affecting tenderness, BMI should be included in addition to sex, age, etc.
Menstrual cycle disorders in female volleyball players.
Wodarska, M; Witkoś, J; Drosdzol-Cop, A; Dąbrowska, J; Dąbrowska-Galas, M; Hartman, M; Plinta, R; Skrzypulec-Plinta, V
2013-07-01
The aim of this study was to examine the relation between increased physical activity and menstrual disorders in adolescent female volleyball players. The study was conducted on 210 Polish female volleyball players, aged 13-17 years, the authorship questionnaire was used. The results of the study showed that irregular menstruation occurred in 19% of girls, spotting between menstrual periods in 27% and heavy menstruation was reported in 33% of girls. Out of all volleyball female players participating in the study, 94 girls (45%) declared absence of menstrual periods after regular cycles. Statistical analysis showed that the more training hours per week, the bigger probability of the occurrence of irregular menstruation. It was concluded that the number of hours of volleyball training per week affects regularity of menstrual cycles in female volleyball players. The absence of menstruation might be caused by the duration of training per week or years of training.
Nieto, Julián Alexander Mendivil; Aldrete, Alfonso Neri García; Obando, Ranulfo González
2017-02-06
Seven species of Loneura from natural areas of Valle del Cauca, Colombia, are described and illustrated. The female of L. andina is described for the first time. Two additional species, known only from the National Natural Park Gorgona (Cauca), are also recorded in Valle del Cauca. The new species are assigned to the infrageneric groups known in the genus. An identification key to males of Loneura is included.
The unforgotten sisters female astronomers and scientists before Caroline Herschel
Bernardi, Gabriella
2016-01-01
Taking inspiration from Siv Cedering’s poem in the form of a fictional letter from Caroline Herschel that refers to “my long, lost sisters, forgotten in the books that record our science”, this book tells the lives of twenty-five female scientists, with specific attention to astronomers and mathematicians. Each of the presented biographies is organized as a kind of "personal file" which sets the biographee’s life in its historical context, documents her main works, highlights some curious facts, and records citations about her. The selected figures are among the most representative of this neglected world, including such luminaries as Hypatia of Alexandra, Hildegard of Bingen, Elisabetha Hevelius, and Maria Gaetana Agnesi. They span a period of about 4000 years, from En HeduAnna, the Akkadian princess, who was one of the first recognized female astronomers, to the dawn of the era of modern astronomy with Caroline Herschel and Mary Somerville. The book will be of interest to all who wish to learn more ...
Social and seasonal influences on the reproductive cycle in female mandrills (Mandrillus sphinx).
Setchell, Joanna M; Wickings, E Jean
2004-09-01
We present 12 years of perineal swelling data for a semifree-ranging colony of mandrills (Mandrillus sphinx), and evaluate the influence of rank, parity, and seasonality on reproductive parameters. Female sexual swellings showed a seasonal pattern, with August the median month of ovulation. Overlapping periovulatory periods did not decrease the likelihood of conception. Females showed their first genital swelling at age 3.6 years (n = 28; range, 3.2-4.6 years), and higher-ranking females experienced their first swelling earlier than low-ranking females. Median postpartum amenorrhea (PPA) duration was 208 days (n = 92; range, 74-538 days). PPA was longer in primiparous females than in multiparous females, but PPA duration was unrelated to female rank. Median follicular phase duration was 24 days for the first cycle after parturition (n = 84; range, 12-40 days), shortening to 17 days in subsequent cycles (n = 55; range, 6-39 days). The follicular phase was longer in nulliparous females than in parous females, but was unrelated to female rank. Median cycle length (from one sexual swelling breakdown to the next) was 38 days (n = 57; range, 18-108 days). Eighty-seven percent of conceptions occurred within two cycles, and half of the nulliparous females conceived during their first swelling cycle. Lower-ranking females were more likely to require more cycles to conceive than higher-ranking females. The cycling phase was significantly longer in nulliparous females than in parous females, and was also significantly longer in lower-ranking females than in higher-ranking females. We discuss the influence of provisioning on female reproductive parameters, the influence of parity and rank on the different phases of the interbirth interval, and the evolution of long and variable follicular phases in mandrills. Copyright 2004 Wiley-Liss, Inc.
Marijuana, the Endocannabinoid System and the Female Reproductive System
Brents, Lisa K.
2016-01-01
Marijuana use among women is highly prevalent, but the societal conversation on marijuana rarely focuses on how marijuana affects female reproduction and endocrinology. This article reviews the current scientific literature regarding marijuana use and hypothalamic-pituitary-ovarian (HPO) axis regulation, ovarian hormone production, the menstrual cycle, and fertility. Evidence suggests that marijuana can reduce female fertility by disrupting hypothalamic release of gonadotropin releasing hormo...
Ahmad, Nur Syamsina; Abdul Aziz, Azlina; Kong, Kin Weng; Hamid, Mohamad Shariff A; Cheong, Jadeera Phaik Geok; Hamzah, Sareena Hanim
2017-12-01
Tualang honey (TH) contains antioxidants such as ascorbic acid, phenolic acids, and flavonoids that may be protective against oxidative stress of exercise. The aim of this study was to examine the postprandial antioxidant activity and oxidative stress after ingestion of high and low dosages of TH in female athletes. Twenty female athletes (aged 21.3 [2.1] years; body weight [BW] 54.1 [5.7] kg) were randomly assigned into two groups and consumed either 1.5 g/kg BW TH (high honey; HH; n = 10) or 0.75 g/kg BW TH (low honey; LH; n = 10). Blood sample was collected at fasting and at 0.5, 1, 2, and 3 h after TH consumption. Plasma was analyzed for total phenolic content (TPC), antioxidant activity (ferric reducing antioxidant power [FRAP]), and oxidative stress biomarkers (malondialdehyde [MDA] and reactive oxygen species [ROS]). The 3-h area under the curve (AUC) for MDA was significantly lower in the LH group compared with HH group, suggesting less oxidative stress in the LH group. However, the AUCs for TPC, FRAP, and ROS were not affected by the dosages. The concentrations of TPC and FRAP increased from baseline to 2 and 1 h after TH consumption, respectively, and concentrations returned toward baseline at 3 h in both LH and HH groups. MDA concentration significantly decreased (p antioxidant activity and suppressing oxidative stress in female athletes. The time-course effect of TH that provides optimal antioxidant activity and oxidative stress protection was between 1 and 2 h after its consumption.
Directory of Open Access Journals (Sweden)
Rafael Nogueira Furtado
2014-12-01
Full Text Available Was evaluated the influence of alternative methods of detoxification of castor cake on nitrogen balance and ruminal evaluation in sheep fed isocaloric and isonitrogenous experimental diets. Twenty sheep (ten males and ten females were used in five treatments (castor cake untreated, treated with limestone, treated with urea, treated with phosphate monodicalcium and autoclaved and four repetitions. For nitrogen balance we used a randomized block design, with the blocks according to the sex and the variables pH and ammonia nitrogen (NH3-N in the experimental design was split plot, with plots in the diets subplots and the collection times (0, 2, 5 and 8 hours postprandial.The treatments did not influence N intake, N urinary, urea and N-urea concentration in plasma. The Urinary N was higher in diet containing castor cake treated with phosphate monodicalcium (FOS when compared with those containing castor cake treated by autoclave (ACL. Already the nitrogen balance (BN was higher in diet ACL when compared to FOS diet. The pH and N-NH3 were within the normal range of sheep, being little affected by diet. Diets with methods of detoxification of castor cake promoted moderate changes in nitrogen balance with emphasis on the castor cake autoclaved and treated with limestone. The males sheep showed higher nitrogen balance than females.
Elhennawy, Karim; Manton, David John; Crombie, Felicity; Zaslansky, Paul; Radlanski, Ralf J; Jost-Brinkmann, Paul-Georg; Schwendicke, Falk
2017-11-01
To systematically assess and contrast reported differences in microstructure, mineral density, mechanical and chemical properties between molar-incisor-hypomineralization-affected (MIH) enamel and unaffected enamel. Studies on extracted human teeth, clinically diagnosed with MIH, reporting on the microstructure, mechanical properties or the chemical composition and comparing them to unaffected enamel were reviewed. Electronic databases (PubMed, Embase and Google Scholar) were screened; hand searches and cross-referencing were also performed. Twenty-two studies were included. Fifteen studies on a total of 201 teeth investigated the structural properties, including ten (141 teeth) on microstructure and seven (60 teeth) on mineral density; six (29 teeth) investigated the mechanical properties and eleven (87 teeth) investigated the chemical properties of MIH-affected enamel and compared them to unaffected enamel. Studies unambiguously found a reduction in mineral quantity and quality (reduced Ca and P content), reduction of hardness and modulus of elasticity (also in the clinically sound-appearing enamel bordering the MIH-lesion), an increase in porosity, carbon/carbonate concentrations and protein content compared to unaffected enamel. were ambiguous with regard to the extent of the lesion through the enamel to the enamel-dentin junction, the Ca/P ratio and the association between clinical appearance and defect severity. There is an understanding of the changes related to MIH-affected enamel. The association of these changes with the clinical appearance and resulting implications for clinical management are unclear. MIH-affected enamel is greatly different from unaffected enamel. This has implications for management strategies. The possibility of correlating the clinical appearance of MIH-affected enamel with the severity of enamel changes and deducing clinical concepts (risk stratification etc.) is limited. Crown Copyright © 2017. Published by Elsevier Ltd. All
A 15-Year Review of Trends in Representation of Female Subjects in Islamic Bioethics Research.
Hussain, Zeenat; Kuzian, Edyta; Hussain, Naveed
2017-02-01
Gender representation in Islamic bioethics research in the twenty-first century has not been studied. To study temporal trends in representation of female subjects in Islamic bioethics research, PubMed-listed publications on Islamic bioethics from years 2000 to 2014 were reviewed for gender participation in human subjects' research. There were temporal trends of increasing publications of Islamic bioethics-related human subjects' research (64 papers over 15 years; R 2 = 0.72; p < 0.0004). Female subjects were well represented with a trend toward increasing participation. This was true for women from Muslim-majority countries even in non-gender-focused studies over the past 15 years.
Papa, Riccardo; Madia, Francesca; Bartolomeo, Domenico; Trucco, Federica; Pedemonte, Marina; Traverso, Monica; Broda, Paolo; Bruno, Claudio; Zara, Federico; Minetti, Carlo; Fiorillo, Chiara
2016-02-01
Female carriers of Duchenne muscular dystrophy (DMD), although usually asymptomatic, develop muscle weakness up to 17% of the time, and a third present cardiac abnormalities or cognitive impairment. Clinical features of DMD carriers during childhood are poorly known. We describe a cohort of pediatric DMD carriers, providing clinical, genetic, and histopathologic features, with a mean follow-up of 7 years. Fifteen females with a DMD mutation (age range 5 to 18 years) were included. Seven patients (46%) presented with clinically evident symptoms and signs such as limb girdle weakness, abnormal gait, and exercise intolerance. The other eight patients (53%) were evaluated because of an incidental finding of elevated level of creatine kinase. Creatine kinase level was elevated in all, ranging from 392 to 13,000 U/L. Calf hypertrophy was observed in eight patients (53%). No patient developed respiratory or cardiac involvement. The most frequent complication was scoliosis (46%). Four patients (29%) also presented minor learning disabilities or behavioral problems. We performed electromyography in half of patients, showing myopathic pattern in four (53%). Muscle biopsy revealed a mosaic reduction of dystrophin in nine available cases. DMD gene mutations were mostly deletions (71%), resulting in loss of reading frame in five patients (36%). The three patients who experienced the most severe disease course were affected either by a nonsense or frameshift mutation. Our analysis suggests that DMD gene mutations may be suspected in a female child with persistently elevated levels of creatine kinase. Evidence of scoliosis, calf hypertrophy, or myopathic pattern at electromyography may also be helpful, and muscle biopsy is always indicative. DMD carriers should be followed for subtle orthopedic and psychiatric complications during childhood. Copyright © 2016 Elsevier Inc. All rights reserved.
Knowledge and perceptions of family leave policies among female faculty in academic medicine.
Gunn, Christine M; Freund, Karen M; Kaplan, Samantha A; Raj, Anita; Carr, Phyllis L
2014-01-01
The purpose of this research was to examine the knowledge and perceptions of family leave policies and practices among senior leaders including American Association of Medical College members of the Group on Women in Medicine and Science (GWIMS) to identify perceived barriers to career success and satisfaction among female faculty. In 2011 and 2012, GWIMS representatives and senior leaders at 24 medical schools were invited to participate in an interview about faculty perceptions of gender equity and overall institutional climate. An inductive, thematic analysis of the qualitative data was conducted to identify themes represented in participant responses. The research team read and reviewed institutional family leave policies for concordance with key informant descriptions. There were 22 GWIMS representatives and senior leaders in the final sample. Participants were all female; 18 (82%) were full professors with the remainder being associate professors. Compared with publicly available policies at each institution, the knowledge of nine participants was consistent with policies, was discrepant for six, with the remaining seven acknowledging a lack of knowledge of policies. Four major themes were identified from the interview data: 1) Framing family leave as a personal issue undermines its effect on female faculty success; 2) poor communication of policies impairs access and affects organizational climate; 3) discrepancies in leave implementation disadvantage certain faculty in terms of time and pay; and 4) leave policies are valued and directly related to academic productivity. Family leave policies are an important aspect of faculty satisfaction and academic success, yet policy awareness among senior leaders is lacking. Further organizational support is needed to promote equitable policy creation and implementation to support women in medical academia. Copyright © 2014 Jacobs Institute of Women's Health. Published by Elsevier Inc. All rights reserved.
Oxytocin Differentially Affects Sucrose Taking and Seeking in Male and Female Rats
Zhou, Luyi; Ghee, Shannon M.; See, Ronald E.; Reichel, Carmela M.
2015-01-01
Oxytocin has a modulatory role in natural and drug reward processes. While the role of oxytocin in pair bonding and reproduction has been extensively studied, sex differences in conditioned and unconditioned behavioral responses to oxytocin treatment have not been fully characterized. Here, we determined whether male and female rats would show similar dose response curves in response to acute oxytocin on measures of locomotor activity, sucrose seeking, and sucrose intake. Male and freely cycl...
Fort-Vanmeerhaeghe, Azahara; Montalvo, Alicia; Latinjak, Alexander; Unnithan, Viswanath
2016-12-01
There were two aims of this study: first, to investigate physical fitness and match performance differences between under-16 (U16) and under-18 (U18) female basketball players, and second, to evaluate the relationship between physical fitness and game-related performances. Twenty-three young, female, elite Spanish basketball players (16.2 1.2 years) participated in the study. The sample was divided into two groups: U16 and U18 players. The average scores from pre- and post-season physical fitness measurements were used for subsequent analyses. Anthropometric variables were also measured. To evaluate game performance, game-related statistics, including the number of games and minutes played, points, rebounds, assists, steals and blocks per game, were recorded for every competitive match in one season. When anthropometric and physical performance variables were compared between groups, the U18 group demonstrated significantly (pagility, anaerobic power, repeated sprint ability and aerobic power (p ≤ 0.005). These findings can help optimize training programs for young, elite female basketball players.
Establishing the R&D Agenda for Twenty-First Century Learning
Kay, Ken; Honey, Margaret
2006-01-01
Much ink has flowed over the past few years describing the need to incorporate twenty-first century skills into K-12 education. Preparing students to succeed as citizens, thinkers, and workers--the bedrock of any educational system--in this environment means arming them with more than a list of facts and important dates. Infusing twenty-first…
Directory of Open Access Journals (Sweden)
Shervin Assari
2018-05-01
Full Text Available Background: Although male partners' socioeconomic status (SES and substance use is associated with worse health of female partners, the mechanism behind this link is still unknown.Objectives: To investigate whether intimate partner violence (IPV is a mechanism by which male partners' SES and substance use influence female partners' self-rated health (SRH as victims and survivors of IPV.Materials and Methods: Fragile Families and Child Wellbeing Study (FFCWS is an ongoing population-based cohort. Male and female partners' SES, anxiety, depression, and substance use, and their relationship status were measured at baseline. IPV victimization was also asked among female partners' at baseline. Female partners' subjective health was measured 3 times (baseline−1998, 3 years later−2001, and 5 years later−2003. Using AMOS, we fitted two structural equation models (SEM for data analysis. In Model 1 we tested direct paths from male partners' SES and mental health to female partners' SRH, in the absence of IPV. In the Model 2 we conceptualized female partners' IPV victimization between male partners' SES and mental health and female partners' SRH. In both models we controlled for the effect of female partners' SES and mental health.Results: In Model 1, male partners' poor SES and substance use were associated with worse trajectory of SRH of female partner. In Model 2, male to female IPV was the mechanism by which male partners' SES and substance use were associated with female partners' SRH.Conclusions: IPV is one of the mechanisms by which male partners' SES and substance use can influence female partners' health. That is, IPV may operate as a vehicle by which male partners' social and psychological risk factors impact female partners' health. Thus, this study demonstrates how male partners' socio-ecological risk factors such as low SES and substance use impact female partners' health. Therefore, there is a need for broader socio-ecological approach
Changes in personality among male and female dental graduates.
McCreary, C P; Gershen, J A
1982-05-01
This study examines changes in personality traits in male and female dental students and recent graduates. The Comrey Personality Scales were administered to two freshman classes, and the test was readministered two months after graduation for one class and twenty-six months after graduation for the other class. Sex. class, and test/retest scores were analyzed using a three-way analysis of variance with repeated measures for each scale. Significant test/retest differences consisted of increases on the Orderliness versus Lack of Compulsion Scale and Conformity versus Rebelliousness Scale and a decrease on the Activity versus Lack of Energy Scale. There were significant sex differences on the Activity versus Lack of Energy, Emotional Stability versus Neuroticism, and Masculinity versus Femininity Scales; a decrease on the Empathy versus Egocentrism Scale occurred among females in one of the classes. Dental students became increasingly more orderly and identified with established social values; they also became less competitive and less driven to excel. The dental school experience may partially explain these changes; however, other conditions, such as maturation and societal influences, may have been involved.
History of the Treatment of Female Sexual Dysfunction(s).
Kleinplatz, Peggy J
2018-01-22
This article reviews the history of the treatment of women's sexual problems from the Victorian era to the twenty-first century. The contextual nature of determining what constitutes female sexual psychopathology is highlighted. Conceptions of normal sexuality are subject to cultural vagaries, making it difficult to identify female sexual dysfunctions. A survey of the inclusion, removal, and collapsing of women's sexual diagnoses in the Diagnostic and Statistical Manual of Mental Disorders from 1952 to 2013 illuminates the biases in the various editions. Masters and Johnson's models of sexual response and dysfunction paved the way for the diagnosis and treatment of women's sexual dysfunctions. Their sex therapy paradigm is described. Conceptions of and treatments for anorgasmia, arousal difficulties, vaginismus, dyspareunia, and low desire are reviewed. The medicalization of human sexuality and the splintering of sex therapy are discussed, along with current trends and new directions in sexual health care for women. Expected final online publication date for the Annual Review of Clinical Psychology Volume 14 is May 7, 2018. Please see http://www.annualreviews.org/page/journal/pubdates for revised estimates.
Treatment outcomes of female germ cell tumors: The Egyptian National Cancer Institute experience
International Nuclear Information System (INIS)
Saber, M.M.; Zeeneldin, A.A.; El Gammal, M.M.; Salem, S.E.; Darweesh, A.D.; Abdelaziz, A.A.; Monir, M.
2014-01-01
Introduction: Female germ cell tumors (GCTS) are rare tumors that carry a good prognosis. Aim: To report the experience of the Egyptian National Cancer Institute (ENCI) in managing female GCTs. Methods: This retrospective study included 19 females with ovarian GCTs presenting to the ENCI between 2006 and 2010. Results: The median age was 23 years. Ovaries were the primary site in all patients. Dysgerminoma and teratoma were the predominant pathologies followed by mixed GCT in females. Unilateral ovariectomy or ovarian tumorectomy were the classic surgical procedures with R0 resection being feasible in most cases. Surveillance was adopted in six patients with stage I disease. Chemotherapy was administered in 63% of ovarian GCTs with BEP being the commonest regimen with reasonable tolerability and good response rates. The median OS and EFS were not reached. The projected 5-year OS rate was 93.8%. Both OS and EFS were better in patients responding to chemotherapy than non-responders (p< 0.002). Stage of disease did not significantly affect OS or EFS. Conclusions: Female GCTs rarely affect Egyptian females. They have good prognosis.
Follicular lymphoma of the ocular adnexal region
DEFF Research Database (Denmark)
Rasmussen, Peter Kristian; Ralfkiaer, E.; Prause, J.U.
2015-01-01
Purpose To characterize the clinicopathological features of follicular lymphoma of the ocular adnexal region. Methods Retrospective nation-based study of Danish patients with ocular adnexal follicular lymphoma from January 1st 1980 through December 31st 2009. Results Twenty-four patients...... with ocular adnexal follicular lymphoma were identified. Fourteen (58%) of the patients were females. The median age was 63 years (range: 42–96 years). Eleven (46%) of the patients had primary ocular adnexal lymphoma, seven (29%) had an ocular adnexal lesion in conjunction with a concurrent systemic lymphoma...... and six patients (25%) presented with an ocular adnexal relapse. The most frequently affected sites were the lacrimal gland (38%) and the orbit (33%). Thirteen patients (54%) presented with Ann Arbor stage IE lymphoma, four (17%) had stage IIE, two patients (8%) stage IIIE, and five patients (21%) had...
Directory of Open Access Journals (Sweden)
Emma eHoffman
2015-04-01
Full Text Available The integration of newly generated neurons persists throughout life in the mammalian olfactory bulb and hippocampus, regions involved in olfactory and spatial learning. Social cues can be potent stimuli for increasing adult neurogenesis; for example, odors from dominant but not subordinate male mice increase neurogenesis in both brain regions of adult females. However, little is known about the role of neurogenesis in social recognition or the assessment of potential mates. Dominant male mice scent-mark territories using urine that contains a number of pheromones including darcin (MUP20, a male-specific major urinary protein that stimulates rapid learned attraction to the spatial location and individual odor signature of the scent owner. Here we investigate whether exposure to darcin stimulates neurogenesis in the female brain. Hippocampal neurons and cellular proliferation in the lateral ventricles that supply neurons to the olfactory bulbs increased in females exposed for seven days to male urine containing at least 0.5µg/µl darcin. Darcin was effective whether presented alone or in the context of male urine, but other information in male urine appeared to modulate the proliferative response. When exposed to urine from wild male mice, hippocampal proliferation increased only if urine was from the same individual over seven days, suggesting that consistency of individual scent signatures is important. While seven days exposure to male scent initiated the first stages of increased neurogenesis, this caused no immediate increase in female attraction to the scent or in the strength or robustness of spatial learning in short-term conditioned place preference tests. The reliable and consistent stimulation of neurogenesis by a pheromone important in rapid social learning suggests that this may provide an excellent model to explore the relationship between the integration of new neurons and plasticity in spatial and olfactory learning in a socially
Wallace, Janice; Wallin, Dawn; Viczko, Melody; Anderson, Heather
2014-01-01
Our research situates, contextualizes, and analyzes the lived experiences of ten female academics who were among the first women in the academic discipline of educational administration in seven of the ten provinces in Canada. Using institutional ethnography and life history to inform our analysis, this article explores three of the themes that…
Survey of siting practices for selected management projects in seven countries
International Nuclear Information System (INIS)
Hardin, E.; Aahagen, H.
1992-06-01
This paper surveys siting practices for deep geologic disposal in seven countries, and attempts to formulate generalizations which could be useful for the upcoming review of the Swedish plan for siting the SFL repository (R and D 92). Comparison of projects in different countries is done with full appreciation of the technical, legal, and cultural differences. The seven countries were selected for experience with siting in crystalline rock, similarity of siting practices to Sweden, and the availability of published information. Local governments have demonstrated effective veto power in each of the seven countries surveyed, although this power is exercised in different ways. This paper shows how the siting strategy itself affects the ability and the inclination of localities to block the project. It shows by example that public involvement, parallel vs. sequential characterization, schedule for siting activities, and the existence of interim waste storage capability have an impact on the success of siting. The focus of this paper is deep geologic disposal. Shallow land disposal and non-radioactive wastes are not discussed in detail, with three exceptions: LLW disposal siting in the U.S. and Canada, and the SAKAB incinerator projects in Sweden. These provide insight into siting approaches and demonstrate that conclusions regarding deep geologic disposal are supported by other experience. (114 refs.) (au)
Directory of Open Access Journals (Sweden)
Abbas Rahimi
2012-07-01
Full Text Available Background and Aim: Reviewing the literature reveals a possible correlation between the obesity and the potential foot, spine and stability problems. Investigating the important parameters affecting the balance of obese people and prevention from falling are of high importance to reduce the resulting expenditures. This study aimed to assess the acts and the counter acts between the medial longitudinal arch (MLA and the thoracic and lumbar curvatures with the static and dynamic stability in obese females. Materials and Methods: Twenty eight obese females (age= 25±8 years old, BMI=37±4 and twenty nine non-obese females (age= 23±4 years old, BMI=23±3 were recruited in this case-control study with the cross-sectional technique. The MLA, spinal curve angles and the static or dynamic balance index of the subjects were measured using the navicular drop, flexible ruler and Biodex balance system tools, respectively. The static balance test was carried out using a modified Clinical Test of Sensory Interaction and Balance (CTSIB test in both the open and closed eyes while the subjects stood on their dominant legs. The order of the dynamic and static tests was selected randomly.Results: The findings of this study showed that in closed eye condition, most changes happened between the global Stability Index (SI and BMI; while in open eye condition, most changes occurred between the lateral-medial stability index and BMI (r=0.5. Also during an open eye condition, a moderate correlation was found between the navicular drop and lateral-medial stability index (r=0.05. In closed eyes condition, no significant changes were found between the SI and lumbar lordosis (r=0.0004; while a weak correlation was found between the thoracic curve angle and lateral-medial stability index (r=0.04.Conclusion: The dynamic stability is not only correlated to their BMI, but is highly dependent on their foot curvature types and slightly on their thoracic curve angle. Abdominal
The next twenty years - IAEA's role
International Nuclear Information System (INIS)
Tape, G.F.
1977-01-01
The twentieth anniversary of an institution is an appropriate time to look back and to ask what has been achieved. It is also an appropriate time to look ahead and to ask what should be the mission for the future. How can the strengths of the International Atomic Energy Agency (IAEA) be best utilized, what new opportunities should be seized upon, and what challenges should the IAEA be prepared to meet in the next twenty years? Forward planning is a very necessary activity in today's world. There are so many demands on national or institutional resources that careful analysis of options is necessary to establish priorities and ultimately to provide for implementation. But such planning must be done carefully with full appreciation for the validity and sensitivity of the input assumptions and data. Furthermore, today's plan, while setting goals and directions, cannot be so inflexible that it cannot be responsive to ever-changing political, economic and technical constraints or opportunities. Thus in looking ahead, the plan must contain provisions for flexibility to provide for further modifications in the light of ever-changing knowledge, attitudes, and world conditions. The experience of the past five years in the energy field, and especially in nuclear energy, underscores this need. In looking ahead for the next twenty years, we are attempting to describe the International Atomic Energy Agency and its role through the twentieth century. In doing so, we are automatically laying the base for the Agency's work going into the twenty-first century. In short, we are trying to visualize a programme that can serve the coming generation and, in doing so, creating a base from which the needs of the succeeding generation can be met. This is a large order and the crystal ball is less than clear. (author)
Sidibe, Turquoise; Turner, Kea; Sparks, Alicia; Woods-Jaeger, Briana; Lightfoot, Alexandra
2018-01-01
African Americans have the highest rate of new HIV infection in the United States. This photovoice study explored the perspectives and experiences of African American female youth and sought to understand how adolescent development impacts HIV risk. This study used the photovoice methodology with seven African American or Biracial female youth, in…
Ottenheimer Carrier, Lydia; Leca, Jean-Baptiste; Pellis, Sergio; Vasey, Paul L
2015-10-01
In certain populations, female Japanese macaques (Macaca fuscata) mount both males and females. Vasey (2007) proposed that female-female sexual mounting in Japanese macaques may be a neutral evolutionary by-product of a purported adaptation, namely, female-male mounting. In this study, we aim to further examine the proposed link between female-male and female-female mounting in Japanese macaques by comparing the structural characteristics that define both forms of mounting. We do so using Eshkol-Wachman Movement Notation (EWMN), a globographic reference system that can be used to describe the position of body segments. No significant differences were observed in the female mounters' positioning of eight different body segments (i.e., lower torso, mid-torso, upper torso, upper arm, lower arm, upper leg, lower leg, and foot) during female-male and female-female mounting. This finding lends support to the conclusion that female-female and female-male mounting are structurally, and thus, evolutionarily, related. Copyright © 2015 Elsevier B.V. All rights reserved.
Capital, Inequality and Education in Conflict-Affected Contexts
Novelli, Mario
2016-01-01
Piketty's "Capital in the Twenty-First Century" has brought the issue of inequality to the centre of political debate. This article explores contemporary research on the relationship between education and inequality in conflict-affected contexts with a view to seeing how Piketty's work speaks to these issues as a field of research and…
Pereira, Lucas A; Nimphius, Sophia; Kobal, Ronaldo; Kitamura, Katia; Turisco, Luiz A L; Orsi, Rita C; Cal Abad, César Cs; Loturco, Irineu
2018-02-22
The aims of this study were to (1) assess the relationship between selected speed-power related abilities (determined by 20-m sprint, unloaded countermovement and squat jumps [CMJ and SJ] and loaded jump squat [JS]) and performance in two distinct change of direction (COD) protocols (Zigzag and T-Test), and (2) determine the magnitude of difference between female and male Brazilian National Olympic Team handball athletes. Fifteen male and twenty-three female elite handball athletes volunteered to perform the following assessments: SJ and CMJ; Zigzag and T-Test; 20-m sprint with 5-, 10-, and 20-m splits, and mean propulsive power (MPP) in JS. Pearson product moment correlation (Phandball athletes.
Estrous cycle affects the neurochemical and neurobehavioral profile of carvacrol-treated female rats
International Nuclear Information System (INIS)
Trabace, L.; Zotti, M.; Morgese, M.G.; Tucci, P.; Colaianna, M.; Schiavone, S.; Avato, P.; Cuomo, V.
2011-01-01
Carvacrol is the major constituent of essential oils from aromatic plants. It showed antimicrobial, anticancer and antioxidant properties. Although it was approved for food use and included in the chemical flavorings list, no indication on its safety has been estimated. Since the use of plant extracts is relatively high among women, aim of this study was to evaluate carvacrol effects on female physiology and endocrine profiles by using female rats in proestrus and diestrus phases. Serotonin and metabolite tissue content in prefrontal cortex and nucleus accumbens, after carvacrol administration (0.15 and 0.45 g/kg p.o.), was measured. Drug effects in behavioral tests for alterations in motor activity, depression, anxiety-related behaviors and endocrine alterations were also investigated. While in proestrus carvacrol reduced serotonin and metabolite levels in both brain areas, no effects were observed in diestrus phase. Only in proestrus phase, carvacrol induced a depressive-like behavior in forced swimming test, without accompanying changes in ambulation. The improvement of performance in FST after subchronic treatment with fluoxetine (20 mg/kg) suggested a specific involvement of serotonergic system. No differences were found across the groups with regard to self-grooming behavior. Moreover, in proestrus phase, carvacrol reduced only estradiol levels without binding hypothalamic estradiol receptors. Our study showed an estrous-stage specific effect of carvacrol on depressive behaviors and endocrine parameters, involving serotonergic system. Given the wide carvacrol use not only as feed additive, but also as cosmetic essence and herbal remedy, our results suggest that an accurate investigation on the effects of its chronic exposure is warranted. - Highlights: → Carvacrol induced a depressive-like phenotype in rats, depending on ovarian cyclicity. → Carvacrol selectively reduced serotonin content in female rats in proestrus phase. → Carvacrol reduced serotonin
Physical Education and Female Participation: A Case Study of Teachers' Perspectives and Strategies
Murphy, Brooke; Dionigi, Rylee A.; Litchfield, Chelsea
2014-01-01
We argue that gender issues in physical education (PE) remain in some schools, despite advances in PE research and curricula aimed at engaging females in PE. We interviewed five Australian PE teachers (1 male and 4 females) at a co-educational, regional high school about the factors affecting female participation in PE and the strategies they used…
The Importance of Social Learning Environment Factors for Affective Well-Being among Students
Idsoe, Ella Maria Cosmovici
2016-01-01
We investigated whether perceived inclusion and exclusion with peers at school, as well as self-reported bullying exposure, affected positive and negative affect among 1161 students from grades five through seven. Positive affect was significantly, but only weakly, affected by perceived exclusion and inclusion. Negative affect was not related to…
A STUDY ON CUTANEOUS FUNGAL DISORDERS IN DIABETES MELLITUS
Directory of Open Access Journals (Sweden)
Sampath Kumar G
2016-09-01
Full Text Available BACKGROUND Skin problems are usually not considered and never attended in diabetics. They are usually neglected and they are only taken note of when they pose problems. Many of these skin problems that go undiagnosed diabetic patients later complicate diabetes and its treatment. The common skin infections that can cause major problems and are associated with increased blood glucose levels and Advanced Glycation Products (AGPs. Skin disorders in diabetics are usually consistent as in the medical literature, but the data is limited with respect to early stage skin disorders in diabetic patients. Awareness is needed for better understanding the importance of skin disorders in diabetes patients for prevention and management. MATERIALS AND METHODS This study was done in the Department of Dermatology, Travancore Medical College, Kollam. The study was done from June 2015 to December 2015. Sixty patients were identified and the study was conducted. INCLUSION CRITERIA The patients were known diabetic for at least five years. EXCLUSION CRITERIA Patients who were treated with immune suppressant drugs were not included in the present study. Skin scrapings were taken and were subjected to KOH preparation. The result that was available was taken for statistical analysis. The statistical analysis was done using the latest SPSS software 2015 (California. RESULTS In the present study, maximum number of fungal infections was seen in male sex, which amounted to forty one cases and was as in the female sex the number was nineteen. Out of the forty one male cases, maximum number of cases belonged to age group of forty to sixty years, which amounted to sixteen cases followed by age group sixty to eighty years, which amounted to fourteen cases followed by twenty to forty years, which amounted to seven cases. Age group zero to twenty years and age group of more than eighty years amounted to two cases each. In cases of females, age group forty to sixty years had maximum
The Influence of Physical Qualities on Activity Profiles of Female Australian Football Match-Play.
Black, Georgia M; Gabbett, Tim J; Johnston, Rich D; Cole, Michael H; Naughton, Geraldine; Dawson, Brian
2017-10-16
The rapid transition of female Australian football players from amateur to semi-elite competitions has the potential for athletes to be underprepared for match-play. To gain an understanding the match demands of female football, the aims of this study were three-fold: (1) to highlight the physical qualities that discriminate selected and non-selected female Australian Football players, (2) to investigate activity profiles of female Australian Football players, and (3) to gain an understanding of the influence of physical qualities on running performance in female Australian Football match-play. Twenty-two female Australian football (AF) state academy players (mean ± SD age, 23.2 ± 4.5 years) and 27 non-selected players (mean ± SD age, 23.4 ± 4.9 years) participated in this study. The Yo-Yo Intermittent Recovery Test (Level 1), countermovement jump and 30m sprint tests were completed prior to the competitive season. During 14 matches, players wore global positioning system (GPS) units to describe the running demands of female AF match-play. Selected players were faster over 30 metres (ES=0.57; p=0.04) and covered greater distances on the Yo-Yo IR1 test (ES=1.09; pfemale AF players were faster and had greater intermittent running ability than players not selected to a State academy program. An emphasis should be placed on the development of physical fitness in this playing group to ensure optimal preparation for the national competition.
Affective changes during the postpartum period: Influences of genetic and experiential factors.
Agrati, Daniella; Lonstein, Joseph S
2016-01-01
This article is part of a Special Issue "Parental Care". The postpartum period involves some truly transformational changes in females' socioemotional behaviors. For most female laboratory rodents and women, these changes include an improvement in their affective state, which has positive consequences for their ability to sensitively care for their offspring. There is heterogeneity among females in the likelihood of this positive affective change, though, and some women experience elevated anxiety or depression (or in rodents anxiety- or depression-related behaviors) after giving birth. We aim to contribute to the understanding of this heterogeneity in maternal affectivity by reviewing selected components of the scientific literatures on laboratory rodents and humans examining how mothers' physical contact with her infants, genetics, history of anxiety and depression and early-life and recent-life experiences contribute to individual differences in postpartum affective states. These studies together indicate that multiple biological and environmental factors beyond female maternal state shape affective responses during the postpartum period, and probably do so in an interactive manner. Furthermore, the similar capacity of some of these factors to modulate anxiety and depression in human and rodent mothers suggests cross-species conservation of mechanisms regulating postpartum affectivity. Copyright © 2015 Elsevier Inc. All rights reserved.
The prevalence of lifetime abuse among older adults in seven European countries.
Eslami, Bahareh; Viitasara, Eija; Macassa, Gloria; Melchiorre, Maria Gabriella; Lindert, Jutta; Stankunas, Mindaugas; Torres-Gonzalez, Francisco; Barros, Henrique; Ioannidi-Kapolou, Elisabeth; Soares, Joaquim J F
2016-11-01
To investigate the lifetime prevalence rate of abuse among older persons and to scrutinize the associated factors (e.g. demographics). This cross-sectional population-based study had 4467 participants, aged 60-84, from seven European cities. Abuse (psychological, physical, sexual, financial and injuries) was measured based on The Revised Conflict Tactics Scale, and the UK survey of abuse/neglect of older people. Over 34 % of participants reported experiencing lifetime psychological, 11.5 % physical, 18.5 % financial and 5 % sexual abuse and 4.3 % reported injuries. Lifetime psychological abuse was associated with country, younger age, education and alcohol consumption; physical abuse with country, age, not living in partnership; injuries with country, female sex, age, education, not living in partnership; financial abuse with country, age, not living in partnership, education, benefiting social/partner income, drinking alcohol; and sexual abuse with country, female sex and financial strain. High lifetime prevalence rates confirm that elder abuse is a considerable public health problem warranting further longitudinal studies. Country of residence is an independent factor associated with all types of elder abuse which highlights the importance of national interventions alongside international collaborations.
Nuclear energy into the twenty-first century
International Nuclear Information System (INIS)
Hammond, G.P.
1996-01-01
The historical development of the civil nuclear power generation industry is examined in the light of the need to meet conflicting energy-supply and environmental pressures over recent decades. It is suggested that fission (thermal and fast) reactors will dominate the market up to the period 2010-2030, with fusion being relegated to the latter part of the twenty-first century. A number of issues affecting the use of nuclear electricity generation in Western Europe are considered including its cost, industrial strategy needs, and the public acceptability of nuclear power. The contribution of nuclear power stations to achieving CO2 targets aimed at relieving global warming is discussed in the context of alternative strategies for sustainable development, including renewable energy sources and energy-efficiency measures. Trends in the generation of nuclear electricity from fission reactors are finally considered in terms of the main geopolitical groupings that make up the world in the mid-1990s. Several recent, but somewhat conflicting, forecasts of the role of nuclear power in the fuel mix to about 2020 are reviewed. It is argued that the only major expansion in generating capacity will take place on the Asia-Pacific Rim and not in the developing countries generally. Nevertheless, the global nuclear industry overall will continue to be dominated by a small number of large nuclear electricity generating countries; principally the USA, France and Japan. (UK)
Factors influencing fluoxetine-induced sexual dysfunction in female rats
Adams, Sarah; Heckard, Danyeal; Hassell, James; Uphouse, Lynda
2012-01-01
Treatment with selective serotonin reuptake inhibitors, such as fluoxetine, produces sexual side effects with low sexual desire being the most prevalent effect in females. In few studies have preclinical models for such antidepressant-induced sexual dysfunction been fruitful. In the current manuscript, the effects of fluoxetine on multiple measures of female sexual motivation and sexual receptivity were examined. Ovariectomized, Fischer rats were primed with 10 μg estradiol benzoate and 500 μg progesterone. Partner preference, active investigation of the male, and measures of sexual behavior were examined after injection with 15 mg/kg fluoxetine. Factors (pretesting for sexual behavior, size of the test arena, non-contact time with a male) that differ among experiments designed to study antidepressant-induced female rat sexual dysfunction were studied. The male preference ratio was not affected by fluoxetine treatment but active investigation of the male was reduced; lordosis behavior was inhibited and pretesting for sexual receptivity amplified fluoxetine's inhibition; size of the testing arena or non-contact experience with the male had no effect. Regardless of test condition, when given the opportunity to escape from the male, fluoxetine-treated females displayed escape behavior. Measures of male preference and active investigation, but not lordosis behavior, appeared to be affected by fluoxetine's impact on activity. The collective data provided a behavioral profile of fluoxetine-induced sexual dysfunction. These findings reinforce the value of multiple measures when attempting to model antidepressant-induced female sexual dysfunction. PMID:22835821
Use of a functional movement screening tool to determine injury risk in female collegiate athletes.
Chorba, Rita S; Chorba, David J; Bouillon, Lucinda E; Overmyer, Corey A; Landis, James A
2010-06-01
Athletes often utilize compensatory movement strategies to achieve high performance. However, these inefficient movement strategies may reinforce poor biomechanical movement patterns during typical activities, resulting in injury. This study sought to determine if compensatory movement patterns predispose female collegiate athletes to injury, and if a functional movement screening (FMS™) tool can be used to predict injuries in this population. Scores on the FMS™, comprised of seven movement tests, were calculated for 38 NCAA Division II female collegiate athletes before the start of their respective fall and winter sport seasons (soccer, volleyball, and basketball). Seven athletes reported a previous history of anterior cruciate ligament reconstruction (ACLR). Injuries sustained while participating in sport activities were recorded throughout the seasons. The mean FMS™ score and standard deviation for all subjects was 14.3±1.77 (maximum score of 21). Eighteen injuries (17 lower extremity, 1 lower back) were recorded during this study. A score of 14/21 or less was significantly associated with injury (P=0.0496). Sixty-nine percent of athletes scoring 14 or less sustained an injury. Odds ratios were 3.85 with inclusion of all subjects, and 4.58 with exclusion of ACLR subjects. Sensitivity and specificity were 0.58 and 0.74 for all subjects, respectively. A significant correlation was found between low-scoring athletes and injury (P=0.0214, r=0.76). A score of 14 or less on the FMS™ tool resulted in a 4-fold increase in risk of lower extremity injury in female collegiate athletes participating in fall and winter sports. The screening tool was able to predict injury in female athletes without a history of major musculoskeletal injury such as ACLR. Compensatory fundamental movement patterns can increase the risk of injury in female collegiate athletes, and can be identified by using a functional movement screening tool.
Archer, H L; Evans, J; Edwards, S; Colley, J; Newbury‐Ecob, R; O'Callaghan, F; Huyton, M; O'Regan, M; Tolmie, J; Sampson, J; Clarke, A; Osborne, J
2006-01-01
Objective To determine the frequency of mutations in CDKL5 in both male and female patients with infantile spasms or early onset epilepsy of unknown cause, and to consider whether the breadth of the reported phenotype would be extended by studying a different patient group. Methods Two groups of patients were investigated for CDKL5 mutations. Group 1 comprised 73 patients (57 female, 16 male) referred to Cardiff for CDKL5 analysis, of whom 49 (42 female, 7 male) had epileptic seizure onset in the first six months of life. Group 2 comprised 26 patients (11 female, 15 male) with infantile spasms previously recruited to a clinical trial, the UK Infantile Spasms Study. Where a likely pathogenic mutation was identified, further clinical data were reviewed. Results Seven likely pathogenic mutations were found among female patients from group 1 with epileptic seizure onset in the first six months of life, accounting for seven of the 42 in this group (17%). No mutations other than the already published mutation were found in female patients from group 2, or in any male patient from either study group. All patients with mutations had early signs of developmental delay and most had made little developmental progress. Further clinical information was available for six patients: autistic features and tactile hypersensitivity were common but only one had suggestive Rett‐like features. All had a severe epileptic seizure disorder, all but one of whom had myoclonic jerks. The EEG showed focal or generalised changes and in those with infantile spasms, hypsarrhythmia. Slow frequencies were seen frequently with a frontal or fronto‐temporal predominance and high amplitudes. Conclusions The spectrum of the epileptic seizure disorder, and associated EEG changes, in those with CDKL5 mutations is broader than previously reported. CDKL5 mutations are a significant cause of infantile spasms and early epileptic seizures in female patients, and of a later intractable seizure disorder
Harakalova, Magdalena; van den Boogaard, Marie-Jose; Sinke, Richard; van Lieshout, Stef; van Tuil, Marc C.; Duran, Karen; Renkens, Ivo; Terhal, Paulien A.; de Kovel, Carolien; Nijman, Ies J.; van Haelst, Mieke; Knoers, Nine V. A. M.; van Haaften, Gijs; Kloosterman, Wigard; Hennekam, Raoul C. M.; Cuppen, Edwin; van Amstel, Hans Kristian Ploos
Background We present a large Dutch family with seven males affected by a novel syndrome of X-linked intellectual disability, hypogonadism, gynaecomastia, truncal obesity, short stature and recognisable craniofacial manifestations resembling but not identical to Wilson-Turner syndrome. Seven female
Harakalova, Magdalena; van den Boogaard, Marie-Jose; Sinke, Richard; van Lieshout, Stef; van Tuil, Marc C.; Duran, Karen; Renkens, Ivo; Terhal, Paulien A.; de Kovel, Carolien; Nijman, Ies J.; van Haelst, Mieke; Knoers, Nine V. A. M.; van Haaften, Gijs; Kloosterman, Wigard; Hennekam, Raoul C. M.; Cuppen, Edwin; Ploos van Amstel, Hans Kristian
2012-01-01
Background We present a large Dutch family with seven males affected by a novel syndrome of X-linked intellectual disability, hypogonadism, gynaecomastia, truncal obesity, short stature and recognisable craniofacial manifestations resembling but not identical to Wilson-Turner syndrome. Seven female
Harakalova, M.; van den Boogaard, M.J.; Sinke, R.; van Lieshout, S.; van Tuil, M.C.; Duran, K.; Renkens, I.; Terhal, P.A.; de Kovel, C.; Nijman, I.J.; van Haelst, M.; Knoers, N.V.; van Haaften, G.; Kloosterman, W.; Hennekam, R.C.; Cuppen, E.; Ploos van Amstel, H.K.
2012-01-01
BACKGROUND: We present a large Dutch family with seven males affected by a novel syndrome of X-linked intellectual disability, hypogonadism, gynaecomastia, truncal obesity, short stature and recognisable craniofacial manifestations resembling but not identical to Wilson-Turner syndrome. Seven female
Buddeberg-Fischer, B; Stamm, M; Buddeberg, C; Bauer, G; Hämmig, O; Knecht, Michaela; Klaghofer, R
2010-01-01
Abstract Background The profile of the medical profession is changing in regard to feminization, attitudes towards the profession, and the lifestyle aspirations of young physicians. The issues addressed in this study are the careers of female and male physicians seven years after graduation and the impact of parenthood on career development. Methods Data reported originates from the fifth assessment (T5) of the prospective SwissMedCareer Study, beginning in 2001 (T1). At T5 in 2009, 579 resid...
Gračanin, Asmir; van Assen, Marcel A L M; Omrčen, Višnja; Koraj, Ivana; Vingerhoets, Ad J J M
2017-01-01
Gelstein et al. reported the results of three experiments suggesting a dampening influence of inhalation of female emotional tears on males' arousal and perception of female sexual attractiveness, specifically in non-sexual situations. This prompted the hypothesis that crying exerts its influence on others not only via the auditory and visual mode but also via chemosignals. In three studies, we attempted to replicate and extend Gelstein et al.'s findings by including an additional condition with irritant tears, by using pictures of sexually attractive women, and by testing related hypotheses on the pro-social effects of exposure to tears. All three studies, separately or combined in a meta-analysis, failed to replicate the original inhibitory effects of tears. In addition, sniffing tears did not affect measures of connectedness, aggression and pro-social behaviour. It is concluded that the effects of female tears on male arousal and perception of female sexual attractiveness, if any, are very weak at best. Rather, it seems that crying exerts its strong inter-personal effects through the visual and auditory sensory channels.
Indication to Open Anatrophic Nephrolithotomy in the Twenty-First Century: A Case Report
Directory of Open Access Journals (Sweden)
Alfredo Maria Bove
2012-01-01
Full Text Available Introduction. Advances in endourology have greatly reduced indications to open surgery in the treatment of staghorn kidney stones. Nevertheless in our experience, open surgery still represents the treatment of choice in rare cases. Case Report. A 71-year-old morbidly obese female patient complaining about occasional left flank pain, and recurrent cystitis for many years, presented bilateral staghorn kidney stones. Comorbidities were obesity (BMI 36.2, hypertension, type II diabetes, and chronic obstructive pulmunary disease (COPD hyperlipidemia. Due to these comorbidities, endoscopic and laparoscopic approaches were not indicated. We offered the patient staged open anatrophic nephrolithotomy. Results. Operative time was 180 minutes. Blood loss was 500 cc. requiring one unit of packed red blood cells. Hospital stay was 7 days. The renal function was unaffected based on preoperative and postoperative serum creatinine levels. Stone-free status of the left kidney was confirmed after surgery with CT scan. Conclusions. Open surgery can represent a valid alterative in the treatment of staghorn kidney stones of very selected cases. A discussion of the current indications in the twenty-first century is presented.
Understanding the leaky engineering pipeline: Motivation and job adaptability of female engineers
Saraswathiamma, Manjusha Thekkedathu
This dissertation is a mixed-method study conducted using qualitative grounded theory and quantitative survey and correlation approaches. This study aims to explore the motivation and adaptability of females in the engineering profession and to develop a theoretical framework for both motivation and adaptability issues. As a result, this study endeavors to design solutions for the low enrollment and attenuation of female engineers in the engineering profession, often referred to as the "leaky female engineering pipeline." Profiles of 123 female engineers were studied for the qualitative approach, and 98 completed survey responses were analyzed for the quantitative approach. The qualitative, grounded-theory approach applied the constant comparison method; open, axial, and selective coding was used to classify the information in categories, sub-categories, and themes for both motivation and adaptability. The emergent themes for decisions motivating female enrollment include cognitive, emotional, and environmental factors. The themes identified for adaptability include the seven job adaptability factors: job satisfaction, risk- taking attitude, career/skill development, family, gender stereotyping, interpersonal skills, and personal benefit, as well as the self-perceived job adaptability factor. Illeris' Three-dimensional Learning Theory was modified as a model for decisions motivating female enrollment. This study suggests a firsthand conceptual parallelism of McClusky's Theory of Margin for the adaptability of female engineers in the profession. Also, this study attempted to design a survey instrument to measure job adaptability of female engineers. The study identifies two factors that are significantly related to job adaptability: interpersonal skills (related.
Automobile driving in older adults: factors affecting driving restriction in men and women.
Marie Dit Asse, Laetitia; Fabrigoule, Colette; Helmer, Catherine; Laumon, Bernard; Lafont, Sylviane
2014-11-01
To identify factors associated with driving restriction in elderly men and women. Prospective cohort study of French drivers from 2003 to 2009. The Three-City Cohort of Bordeaux, a prospective study of 2,104 people aged 65 and older. Five hundred twenty-three drivers with a mean age of 76 (273 male, 250 female). Sociodemographic characteristics, driving habits, health variables, cognitive evaluation and dementia diagnosis. Predementia was defined as no dementia at one follow-up and dementia at the next follow-up. Over the 6-year period, 54% of men and 63% of women stopped driving or reduced the distance they drove. Predementia, Parkinson's disease, older age, and a high number of kilometers previously driven were common restriction factors in both sexes. Prevalent dementia, depressive symptomatology, a decline in one or more instrumental activities of daily living, and poor visual working memory were specific factors in men. In women, low income, fear of falling, slow processing speed, and severe decline in global cognitive performance all affected driving restriction. Older women restricted their driving activity more than older men, regardless of the number of kilometers previously driven, physical health, and cognitive status. Factors affecting driving restriction differed according to sex, and women were more likely to stop driving than men in the period preceding a dementia diagnosis. © 2014, Copyright the Authors Journal compilation © 2014, The American Geriatrics Society.
Gigantism of the foot: our experience in seven cases.
Turra, S; Santini, S; Cagnoni, G; Jacopetti, T
1998-01-01
We report our experience in seven patients with congenital gigantism of the foot with the following diagnoses: neurofibromatosis (two), fibrolipomatosis (two), Proteus syndrome (two), and idiopathic localized gigantism (one). Our purpose is to introduce a new classification of foot gigantism, based on the concept of "neuroinduction." In our experience, intraoperative examination and subsequent histologic examination show consistently pathologic findings in the plantar nerve and its terminal branches in the foot affected by gigantism. Limited surgical treatment was used in five patients. To prevent forefoot enlargement and recurrence of deformity, we suggest complete ray resection. We evaluated our results using radiographs, functional status, and cosmetic considerations.
Li, Qiwei; Kadhim, Muayad; Zhang, Lijun; Cheng, Xiangjun; Zhao, Qun; Li, Lianyong
2014-12-01
Few reports are available describing knee changes in neglected developmental dysplasia of the hip (DDH). The purpose of this study was to assess the radiographic morphology of knee joints in adults with neglected DDH. Thirty-seven patients (35 females and two males) with neglected DDH were prospectively recruited with an average age of 32.6 years. Twenty-three patients had unilateral and 14 patients had bilateral neglected DDH. Thirty-seven healthy individuals were recruited to form a matched control group. Three groups of knee joints were examined: affected knees (on the same side of the neglected DDH), unaffected knees (contralateral to the neglected DDH in patients with unilateral involvement), and control knees. A series of radiographic parameters of the knee joint were measured in the coronal and sagittal plane, and they were compared between patients and normal controls. In the coronal plane, the affected knees had increased valgus angulation related to increased height of the medial femoral condyle, decreased height of the lateral femoral condyle and decreased lateral distal femoral angle compared to control knees. In the sagittal plane, both distal femoral and proximal tibial joints of the affected knees developed a decrease in posterior angles. Additionally, the unaffected knees also developed radiographic changes compared to control knees. Patients with neglected DDH may develop changes in both knee joints. These changes should be considered during surgery to the hip, femur and knee to prevent potential complications. Level 2. Copyright © 2014 Elsevier B.V. All rights reserved.
Custom rotating hinge total knee arthroplasty in patients with poliomyelitis affected limbs.
Rahman, Jeeshan; Hanna, Sammy A; Kayani, Babar; Miles, Jonathan; Pollock, Robin C; Skinner, John A; Briggs, Timothy W; Carrington, Richard W
2015-05-01
Total knee arthroplasty (TKA) in limbs affected by poliomyelitis is a technically challenging procedure. These patients often demonstrate acquired articular and metaphyseal angular deformities, bone loss, narrowness of the intramedullary canals, impaired quadriceps strength, flexion contractures and ligamentous laxity producing painful hyperextension. Thus, using condylar knee designs in these patients will likely result in early failure because of instability and abnormal load distribution. The aim of this study was to assess the outcomes associated with use of the customised (SMILES) rotating-hinge knee system at our institution for TKA in poliomyelitis-affected limbs. We retrospectively reviewed the outcome of 14 TKAs using the (SMILES) prosthesis in 13 patients with limbs affected by poliomyelitis. All patients had painful unstable knees with hyperextension. There were ten females and three males with a mean age of 66 years (range 51-84) at time of surgery. Patients were followed up clinically, radiologically and functionally with the Oxford knee score (OKS). Mean follow-up was 72 months (16-156). There were no immediate or early complications. One patient fell and sustained a peri-prosthetic fracture at seven months requiring revision to a longer stem. Radiological evaluation showed satisfactory alignment with no signs of loosening in all cases. Mean OKS improved from 11.6 (4-18) to 31.5 (18-40) postoperatively (p poliomyelitis. The device compensates well for ligamentous insufficiency as well as for any associated bony deformity.
Twenty-One at TREC-8: using Language Technology for Information Retrieval
Kraaij, Wessel; Pohlmann, Renée; Hiemstra, Djoerd; Voorhees, E.M; Harman, D.K.
2000-01-01
This paper describes the official runs of the Twenty-One group for TREC-8. The Twenty-One group participated in the Ad-hoc, CLIR, Adaptive Filtering and SDR tracks. The main focus of our experiments is the development and evaluation of retrieval methods that are motivated by natural language
Inflammatory myoglandular colorectal polyps: a series of seven cases and review of literature.
Becheanu, G; Gheorghe, C; Dumbravă, M; Serban-Barbu, V; Diculescu, M
2011-01-01
Inflammatory myoglandular polyp is an unusual but distinct, non-neoplastic type of colorectal polyp, commonly with a distal localization at the recto-sigmoidian level. It was first described in 1992 by Nakamura and his colleagues and it is considered to have few particular histological features. We report a series of seven cases (two male and five female patients) of myoglandular polyps with different localization from 15 to 40 cm from anus. Only four out of seven cases presented with rectal bleeding, the others polyps we incidentally discovered. The polyps varied between 4 and 30 mm in the maximum diameter. Grossly, they had firm consistency and smooth reddish surface. Histological examination of the specimens revealed hyperplastic glands with occasional cystic dilatation, proliferation of smooth muscle with no regular distribution, a variable amount of granulation tissue (usually minimal) and no evidence of epithelial dysplasia. All the lesions were removed endoscopically without any complications. Inflammatory myoglandular polyps are distinct histopathological entities, with insufficiently investigated pathogenesis that can include local trauma, mucosal prolapse or ischemia. Being benign they can be removed endoscopically, surgical treatment being reserved in selected cases.
[Does self-esteem affect body dissatisfaction levels in female adolescents?].
Fortes, Leonardo de Sousa; Cipriani, Flávia Marcele; Coelho, Fernanda Dias; Paes, Santiago Tavares; Ferreira, Maria Elisa Caputo
2014-09-01
To evaluate the influence of self-esteem on levels of body dissatisfaction among adolescent females. A group of 397 adolescents aged 12 to 17 years were enrolled in the study. The Body Shape Questionnaire (BSQ) was applied to assess body dissatisfaction. The Rosenberg Self-Esteem Scale was used to assess self-esteem. Weight, height, and skinfold thickness were also measured. These anthropometric data were controlled in the statistical analyses. The multiple regression model indicated influence of "positive self-esteem" (R(2)=0.16; p=0.001) and "negative self-esteem" (R(2)=0.23; p=0.001) subscales on the BSQ scores. Univariate analysis of covariance demonstrated differences in BSQ scores (p=0.001) according to groups of self-esteem. It was concluded that self-esteem influenced body dissatisfaction in adolescent girls from Juiz de Fora, MG. Copyright © 2014 Sociedade de Pediatria de São Paulo. Publicado por Elsevier Editora Ltda. All rights reserved.
Chemical composition and antioxidant activity of seven cultivars of guava (Psidium guajava) fruits.
Flores, Gema; Wu, Shi-Biao; Negrin, Adam; Kennelly, Edward J
2015-03-01
The antioxidant activity and identification of phenolic compounds of seven edible guava (Psidium guajava) cultivars that varied in colour from white to pink were examined. In the DPPH assay all four pink-pulp guavas (Barbie Pink, Homestead, Sardina 1, Sardina 2) included in the study showed higher activity than the white pulp cultivars (Yen 2 and Sayla) and less than the red pulp guava cultivar (Thai Maroon). In the ABTS(+) assay this trend was the same up to 20 min, but from 20 to 40 min Barbie Pink showed lower activity than the white guavas. Twenty-one compounds were characterised in the cultivars, and ten of them are reported for the first time in this fruit. Principle component analysis was performed to identify differences in chemistry among these cultivars. Our results suggest that the antioxidant activity and phytochemical composition of P. guajava vary significantly according to the cultivar and pulp colour. Copyright © 2014. Published by Elsevier Ltd.
Sexual HIV Risk Among Male Parolees and Their Female Partners: The Relate Project.
Comfort, Megan; Reznick, Olga Grinstead; Dilworth, Samantha E; Binson, Diane; Darbes, Lynae A; Neilands, Torsten B
The massively disproportionate impact of America's prison boom on communities of color has raised questions about how incarceration may affect health disparities, including disparities in HIV. Primary partners are an important source of influence on sexual health. In this paper, we investigate sexual HIV risk among male-female couples following a man's release from prison. We draw upon data from the Relate Project, a novel cross-sectional survey of recently released men and their female partners in Oakland and San Francisco, California (N=344). Inferential analyses use the actor-partner model to explore actor and partner effects on sexual HIV risk outcomes. Dyadic analyses of sexual HIV risk among male parolees and their female partners paint a complex portrait of couples affected by incarceration and of partners' influences on each other. Findings indicate that demographic factors such as education level and employment status, individual psycho-social factors such as perception of risk, and relationship factors such as commitment and power affect sexual HIV risk outcomes. The Relate Project provides a novel dataset for the dyadic analysis of sexual risk among male parolees and their female partners, and results highlight the importance of focusing on the couple as a unit when assessing HIV risk and protective behaviors. Results also indicate potentially fruitful avenues for population-specific interventions that may help to reduce sexual health disparities among couples affected by incarceration.
Directory of Open Access Journals (Sweden)
Barrak F Alobeidy
Full Text Available Previous genome-wide association studies (GWAS in multiple populations identified several genetic loci for coronary heart diseases (CHD. Here we utilized a 2-stage candidate gene association strategy in Chinese Han population to shed light on the putative association between several metabolic-related candidate genes and CHD. At the 1(st stage, 190 patients with CHD and 190 controls were genotyped through the MassARRAY platform. At the 2(nd stage, a larger sample including 400 patients and 392 controls was genotyped by the High Resolution Melt (HRM method to confirm or rule out the associations with CHD. MLXIP expression level was quantified by the real time PCR in 65 peripheral blood samples. From the 21 studied single nucleotide polymorphisms (SNPs of seven candidate genes: MLXIPL, MLXIP, MLX, ADIPOR1, VDR, SREBF1 and NR1H3, only one tag SNP rs4758685 (T→C was found to be statistically associated with CHD (P-value = 0.02, Odds ratio (OR of 0.83. After adjustment for the age, sex, lipid levels and diabetes, the association remained significant (P-value = 0.03. After adjustment for the hypertension, P-value became 0.20 although there was a significant difference in the allele distribution between the CHD patients with hypertension and the controls (P-value = 0.04, 406 vs 582. In conclusion, among the 21 tested SNPs, we identified a novel association between rs4758685 of MLXIP gene and CHD. The C allele of common variant rs4758685 interacted with hypertension, and was found to be protective against CHD in both allelic and genotypic models in Chinese Han population.
Strategic Leader Competencies for the Twenty-First Century
National Research Council Canada - National Science Library
Becker, Bradley A
2007-01-01
...: interpersonal skills, conceptual skills, and technical skills. From these three primary strategic leadership skills, there is a list of twenty-one competencies that a strategic leader should posses...
Hostile sexist male patients and female doctors: a challenging encounter.
Klöckner Cronauer, Christina; Schmid Mast, Marianne
2014-01-01
Patient characteristics and attitudes can affect how patients react to the physician's communication style, and this reaction can then influence consultation outcomes. The goal of the present study was to investigate whether the attitude of a sexist male patient affects how he perceives a female physician's nonverbal communication and whether this then results in expecting less positive consultation outcomes. Participants were analog patients who viewed four videotaped male and four videotaped female physicians in a consultation with one of their patients. Physician videos were preselected to represent a range of high and low patient-centered physician nonverbal behavior. Participants filled in questionnaires to assess how patient-centered they perceived the female and male physicians' nonverbal communication to be, and participants indicated how positive they expected the consultation outcomes to be. Moreover, we assessed the participants' sexist attitudes with a questionnaire measuring hostile and benevolent sexism. Students (N = 60) from a French-speaking university in Switzerland were recruited on campus. The main outcome measures were the extent to which analog patients expect the consultation outcomes to be positive (high satisfaction, increased trust in the physician, intention to adhere to treatment recommendations, and perceived physician competence) and the extent to which analog patients perceive physicians as patient-centered (judged from the physicians' nonverbal cues). Male analog patients' hostile sexism was negatively related to perceiving the physicians as patient-centered, and male analog patients' hostile sexism was also negatively related to expected positive consultation outcomes. For male patients viewing female physicians, mediation analysis revealed that perceived physician patient-centeredness mediated the negative relationship between hostile sexism and expected positive consultation outcomes. Male hostile sexist patients perceive a female
Nonverbal synchrony and affect in dyadic interactions
Directory of Open Access Journals (Sweden)
Wolfgang eTschacher
2014-11-01
Full Text Available In an experiment on dyadic social interaction, we invited participants to verbal interactions in cooperative, competitive, and 'fun task' conditions. We focused on the link between interactants' affectivity and their nonverbal synchrony, and explored which further variables contributed to affectivity: interactants' personality traits, sex, and the prescribed interaction tasks. Nonverbal synchrony was quantified by the coordination of interactants' body movement, using an automated video-analysis algorithm (Motion Energy Analysis, MEA. Traits were assessed with standard questionnaires of personality, attachment, interactional style, psychopathology and interpersonal reactivity. We included 168 previously unacquainted individuals who were randomly allocated to same-sex dyads (84 females, 84 males, mean age 27.3 years. Dyads discussed four topics of general interest drawn from an urn of eight topics, and finally engaged in a fun interaction. Each interaction lasted five minutes. In between interactions, participants repeatedly assessed their affect. Using hierarchical linear modeling, we found moderate to strong effect sizes for synchrony to occur, especially in competitive and fun task conditions. Positive affect was associated positively with synchrony, negative affect was associated negatively. As for causal direction, data supported the interpretation that synchrony entailed affect rather than vice versa. The link between nonverbal synchrony and affect was strongest in female dyads. The findings extend previous reports of synchrony and mimicry associated with emotion in relationships and suggest a possible mechanism of the synchrony-affect correlation.
Coyle, H. Elizabeth; Ellinger, Andrea
2003-01-01
Cases of four female entrepreneurs produced seven themes related to the meaning of change resulting from business start-up: definition of the transition experience within a connected self, precursors and readiness, support of informal networks, traits, risk-taking behaviors, motivations, and decision making. The results imply that entrepreneurship…
Poverty as a contextual factor affecting sexual health behavior among female sex workers in India.
Dasgupta, Satarupa
2013-06-01
A thorough understanding of the environmental and structural factors that precipitate unsafe sexual practices is necessary for HIV/AIDS-prevention research among high-risk population groups like commercial sex workers. I examined how poverty contextualizes sexual health behavior, including condom compliance among commercial female sex workers in a red light district in Calcutta, India. For my research I did an ethnographic study and conducted in-depth interviews of 37 commercial female sex workers. I found that poverty, instead of serving as a catalyst for poor health choices among sex workers, acted as an impetus for pursuing safe sex practices and remaining healthy. The results indicate that sex work, poverty, and health do not always have a paradoxical relationship.
Energy Technology Data Exchange (ETDEWEB)
Adriaensen, M.E.A.P.M., E-mail: miraude@gmail.com [Department of Radiology, Atrium Medical Center Parkstad, Heerlen (Netherlands); Department of Radiology, University Medical Center Utrecht, Utrecht (Netherlands); Schaefer-Prokop, C.M. [Department of Radiology, Meander Medical Center, Amersfoort (Netherlands); Duyndam, D.A.C. [Department of Radiology, OLVG, Amsterdam (Netherlands); Zonnenberg, B.A. [Department of Internal Medicine, University Medical Center Utrecht, Utrecht (Netherlands); Prokop, M. [Department of Radiology, University Medical Center Utrecht, Utrecht (Netherlands); Department of Radiology, Radboud University Nijmegen Medical Center, Nijmegen (Netherlands)
2011-07-15
Aim: To determine the gender-specific prevalence of pulmonary cysts typical for lymphangioleiomyomatosis (LAM) in adult patients with known tuberous sclerosis complex (TSC). Materials and methods: A retrospective, cross-sectional study in a cohort of 206 adult TSC patients was performed. Institutional review board approval was obtained, and patient informed consent was waived. Patients had routinely undergone abdominal CT scanning between 1996 and 2006. All 186 patients (mean age 38 years; range 19-72 years; 91 (49%) male patients) in whom at least the lung bases were depicted on computed tomography (CT) were included. Images were reviewed for the presence of pulmonary thin-walled cysts. Descriptive statistics, two sample t-test to compare means, and {chi}{sup 2}-test to compare proportions were applied. Results: CT demonstrated pulmonary thin-walled cysts in the lung bases in 52 (28%) of 186 patients. Size varied from 2 mm in diameter to more than 2 cm. Pulmonary cysts were detected in 40 (42%) of 95 female patients and in 12 (13%) of 91 male patients (p < 0.001). In general, cysts were larger and more numerous in women than in men. Only minimal cystic changes were found in four women and two men, moderate cystic changes were seen in three women and seven men, but considerable cystic changes were seen almost exclusively in women (33 women versus three men). Conclusion: CT demonstrated thin-walled pulmonary cysts in the lung bases in 28% of 186 included patients with tuberous sclerosis complex. Female patients were more affected than male patients.
International Nuclear Information System (INIS)
Adriaensen, M.E.A.P.M.; Schaefer-Prokop, C.M.; Duyndam, D.A.C.; Zonnenberg, B.A.; Prokop, M.
2011-01-01
Aim: To determine the gender-specific prevalence of pulmonary cysts typical for lymphangioleiomyomatosis (LAM) in adult patients with known tuberous sclerosis complex (TSC). Materials and methods: A retrospective, cross-sectional study in a cohort of 206 adult TSC patients was performed. Institutional review board approval was obtained, and patient informed consent was waived. Patients had routinely undergone abdominal CT scanning between 1996 and 2006. All 186 patients (mean age 38 years; range 19-72 years; 91 (49%) male patients) in whom at least the lung bases were depicted on computed tomography (CT) were included. Images were reviewed for the presence of pulmonary thin-walled cysts. Descriptive statistics, two sample t-test to compare means, and χ 2 -test to compare proportions were applied. Results: CT demonstrated pulmonary thin-walled cysts in the lung bases in 52 (28%) of 186 patients. Size varied from 2 mm in diameter to more than 2 cm. Pulmonary cysts were detected in 40 (42%) of 95 female patients and in 12 (13%) of 91 male patients (p < 0.001). In general, cysts were larger and more numerous in women than in men. Only minimal cystic changes were found in four women and two men, moderate cystic changes were seen in three women and seven men, but considerable cystic changes were seen almost exclusively in women (33 women versus three men). Conclusion: CT demonstrated thin-walled pulmonary cysts in the lung bases in 28% of 186 included patients with tuberous sclerosis complex. Female patients were more affected than male patients.
QUANTITATIVE DIFFERENCES WITHIN ANTHROPOMETRIC SPACE WITH FEMALE STUDENTS AT HIGH SCHOOL
Directory of Open Access Journals (Sweden)
Viktor Mitrevski
2011-03-01
Full Text Available The aim of this research is to determine the differences within anthropometric space with female students attending the regular class activity in physical education at school, the activities being held in different working conditions. Depending on these conditions the female students are divided into three (3 sub-examples, or the research includes a total of 183 entities. The analyses of results makes use of seven anthropometric parameters four of which treat the circular dimension and three treat subcutaneous fatty tissue. In order to determine differences between the three groups of female students according to the working conditions in class, the following analyses are used: univariate analysis of variance (ANOVA, t-test, and multivariate analysis of variance (MANOVA. The obtained data pointsat statistically significant differences between the groups within the whole space of anthropometric analysis. Arithmetic means are analysed between the groups with regard to all variables, and between the arithmetic means statistically significant differences are only determined with the variable of average volume of stomach (ASOS, whereas with the rest of variables statistically significant differences are not marked.
Park, Min Hee; Yang, Sook Ja; Chee, Yeon Kyung
2016-01-01
The twenty-one item Stress Measurement of Female Marriage Immigrants (SMFMI) was developed to assess stress of female marriage immigrants in Korea. This study reports the psychometric properties of a revised SMFMI (SMFMI-R) for application with female marriage immigrants to Korea who were raising children. Participants were 190 female marriage immigrants from China, Vietnam, the Philippines, and other Asian countries, who were recruited using convenience sampling between November 2013 and December 2013. Survey questionnaires were translated into study participants' native languages (Chinese, Vietnamese, and English). Principal component analysis yielded nineteen items in four factors (family, parenting, cultural, and economic stress), explaining 63.5% of the variance, which was slightly better than the original scale. Confirmatory factor analysis indicated adequate fit for the four-factor model. Based on classic test theory and item response theory, strong support was provided for item discrimination, item difficulty, and internal consistency (Cronbach's alpha = 0.923). SMFMI-R scores were negatively associated with Korean proficiency and subjective economic status. The SMFMI-R is a valid, reliable, and comprehensive measure of stress for female marriage immigrants and can provide useful information to develop intervention programs for those who may be at risk for emotional stress.
Gene : CBRC-PABE-07-0025 [SEVENS
Lifescience Database Archive (English)
Full Text Available e-82 48% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-130 78% MINDSYFSGFILLGFT...QIFIDVALYSVECILLAMMSCDRLNAICKPLHHMTIMNLQLCQGLVVISWVVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAA
Gene : CBRC-PTRO-07-0026 [SEVENS
Lifescience Database Archive (English)
Full Text Available e-79 50% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-120 76% MINDSRFSGFILLGFT...QLFIDVALYSVECILLSMMSYDRLNAICKPLHHMTIMNLQLCQGLVVISWIVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAFGTCSSHLIVVSIFYGTVRYMYTQPGNSPSQDEGKLLHIFYSIFTPTLNPSH ...
Twenty-One at TREC-7: ad-hoc and cross-language track
Hiemstra, Djoerd; Kraaij, Wessel; Voorhees, E.M; Harman, D.K.
1999-01-01
This paper describes the official runs of the Twenty-One group for TREC-7. The Twenty-One group participated in the ad-hoc and the cross-language track and made the following accomplishments: We developed a new weighting algorithm, which outperforms the popular Cornell version of BM25 on the ad-hoc
Female Physicians and the Work-Family Conflict.
Treister-Goltzman, Yulia; Peleg, Roni
2016-05-01
There has been a dramatic increase in the number of female physicians in all fields and specializations of medicine, but this increase has not resulted in a redistribution of domestic tasks and responsibilities. Reviewing the literature of the last two decades (April 1994 to April 2014) on how female physicians cope with the challenge of balancing their family and professional lives for the duration of their professional careers revealed that they suffer from the work-family conflict more than other professionals and that it has a more negative effect on women than on men. Women physicians consider work-family balance significantly when making career choices. These considerations affect their career success, their productivity as faculty members, their marital life, and parenthood. Having a supportive spouse at home and a facilitating mentor at work are important for a positive work-family balance among female physicians. Special career-supporting measures, such as flexible work schedules and expanded support for childcare over the course of work and when taking part in academic activities, are critical for female physicians.
Garnweidner, Lisa Maria; Terragni, Laura; Pettersen, Kjell Sverre; Mosdol, Annhild
2012-01-01
Objective: To explore how female immigrants from Africa and Asia perceive the host country's food culture, to identify aspects of their original food culture they considered important to preserve, and to describe how they go about preserving them. Design: Qualitative in-depth interviews. Setting: Oslo, Norway. Participants: Twenty one female…
Male risk taking, female odors, and the role of estrogen receptors.
Kavaliers, Martin; Clipperton-Allen, Amy; Cragg, Cheryl L; Gustafsson, Jan-Åke; Korach, Kenneth S; Muglia, Louis; Choleris, Elena
2012-12-05
Male risk-taking and decision making are affected by sex-related cues, with men making riskier choices and decisions after exposure to either women or stimuli associated with women. In non-human species females and, or their cues can also increase male risk taking. Under the ecologically relevant condition of predation threat, brief exposure of male mice to the odors of a sexually receptive novel female reduces the avoidance of, and aversive responses to, a predator. We briefly review evidence showing that estrogen receptors (ERs), ERα and ERβ, are associated with the mediation of these risk taking responses. We show that ERs influence the production of the female odors that affect male risk taking, with the odors of wild type (ERαWT, ERβWT), oxytocin (OT) wildtype (OTWT), gene-deleted 'knock-out' ERβ (ERβKO), but not ERαKO or oxytocin (OT) OTKO or ovariectomized (OVX) female mice reducing the avoidance responses of male mice to cat odor. We further show that administration of specific ERα and ERβ agonists to OVX females results in their odors increasing male risk taking and boldness towards a predator. We also review evidence that ERs are involved in the mediation of the responses of males to female cues, with ERα being associated with the sexual and both ERβ and ERα with the sexual and social mechanisms underlying the effects of female cues on male risk taking. The implications and relations of these findings with rodents to ERs and the regulation of human risk taking are briefly considered. Copyright © 2012 Elsevier Inc. All rights reserved.
The Antecedent Variables of Quality of Life Among Female Factory Workers
Directory of Open Access Journals (Sweden)
Sylvia Diana Purba
2017-08-01
Full Text Available This study aims to examine the quality of life of female factory workers that is hypothesized as affected by work-family conflict and job satisfaction and moderated by perceived organizational support and labor union support. The respondents of the research are female factory workers who are already married and have children, in which 158 respondents are from Jabodetabek and 66 are from Batam. The result shows that work-family conflict significantly decreases quality of life, and perceived organizational support also has a significant positive moderating effect toward quality of life. The quality of life is affected by job satisfaction and work-family conflict but not moderated by labor union support. This research describes that although the work-family conflict of female factory workers has no influence on job satisfaction but it reduces the quality of life directly with the result that job satisfaction is not an intervening variable.
Female sexual dysfunction: a focus on flibanserin
Directory of Open Access Journals (Sweden)
Lodise NM
2017-10-01
Full Text Available Nicole M Lodise Department of Pharmacy Practice, Albany College of Pharmacy and Health Sciences, Albany, NY, USA Abstract: Flibanserin is the first US Food and Drug Administration (FDA-approved option for sexual dysfunction, specifically low sexual desire. Until recently, there were no FDA-approved medication options to assist the ~40% of women affected by female sexual dysfunction (FSD. Often, patients report feeling uncomfortable discussing sexual health, identifying a strong need for health care professionals (HCPs to proactively reach out to patients to identify concerns and initiate a discussion about sexual health and the available treatment options. Within the Diagnostic and Statistical Manual of Mental Disorders, 5th Edition (DMS-5, the criteria of female sexual interest/arousal disorder (FSIAD are outlined, encompassing one of the most common sexual concerns, formerly in its own category defined as hypoactive sexual desire disorder (HSDD or low sexual desire. HSDD is the absence or deficiency of sexual interest and/or desire leading to significant distress and interpersonal difficulties. HCPs offer an important service in assessing their patients and providing information about treatment considerations while ensuring patient comfort with this topic. This article provides an overview of the types and potential causes associated with FSD and the role of flibanserin in practice as a treatment option. Despite a need for additional study in diverse populations, flibanserin has demonstrated efficacy with increased female sexual function index (FSFI total and desire domain scores in clinical studies indicating benefit in sexual desire. Common patient or provider-administered assessment tools to assist in identifying affected patients and patient counseling strategies are reviewed. Keywords: female sexual dysfunction, low sexual desire, hypoactive sexual desire disorder, pharmacotherapy, flibanserin
Bixler, D; Higgins, M; Hartsfield, J
1984-07-01
This report describes two families with the Nance-Horan syndrome, an X-linked trait featuring lenticular cataracts and anomalies of tooth shape and number. Previous reports have described blindness in affected males but posterior sutural cataracts with normal vision as the primary ocular expression in heterozygous females. In one of these two families, the affected female is not only blind in one eye but reportedly had supernumerary central incisors (mesiodens) removed. This constitutes the most severe ocular and dental expression of this gene in heterozygous females yet reported.
Red-cockaded woodpecker male/female foraging differences in young forest stands.
Energy Technology Data Exchange (ETDEWEB)
Franzreb, Kathleen, E.
2010-07-01
ABSTRACT The Red-cockaded Woodpecker (Picoides borealis) is an endangered species endemic to pine (Pinus spp.) forests of the southeastern United States. I examined Red-cockaded Woodpecker foraging behavior to learn if there were male/female differences at the Savannah River Site, South Carolina. The study was conducted in largely young forest stands (,50 years of age) in contrast to earlier foraging behavior studies that focused on more mature forest. The Redcockaded Woodpecker at the Savannah River site is intensively managed including monitoring, translocation, and installation of artificial cavity inserts for roosting and nesting. Over a 3-year period, 6,407 foraging observations covering seven woodpecker family groups were recorded during all seasons of the year and all times of day. The most striking differences occurred in foraging method (males usually scaled [45% of observations] and females mostly probed [47%]),substrate used (females had a stronger preference [93%] for the trunk than males [79%]), and foraging height from the ground (mean 6 SE foraging height was higher for males [11.1 6 0.5 m] than females [9.8 6 0.5 m]). Niche overlap between males and females was lowest for substrate (85.6%) and foraging height (87.8%), and highest for tree species (99.0%), tree condition (98.3%), and tree height (96.4%). Both males and females preferred to forage in older, large pine trees. The habitat available at the Savannah River Site was considerably younger than at most other locations, but the pattern of male/female habitat partitioning observed was similar to that documented elsewhere within the range attesting to the species’ ability to adjust behaviorally.
Development of multi-dimensional body image scale for malaysian female adolescents.
Chin, Yit Siew; Taib, Mohd Nasir Mohd; Shariff, Zalilah Mohd; Khor, Geok Lin
2008-01-01
The present study was conducted to develop a Multi-dimensional Body Image Scale for Malaysian female adolescents. Data were collected among 328 female adolescents from a secondary school in Kuantan district, state of Pahang, Malaysia by using a self-administered questionnaire and anthropometric measurements. The self-administered questionnaire comprised multiple measures of body image, Eating Attitude Test (EAT-26; Garner & Garfinkel, 1979) and Rosenberg Self-esteem Inventory (Rosenberg, 1965). The 152 items from selected multiple measures of body image were examined through factor analysis and for internal consistency. Correlations between Multi-dimensional Body Image Scale and body mass index (BMI), risk of eating disorders and self-esteem were assessed for construct validity. A seven factor model of a 62-item Multi-dimensional Body Image Scale for Malaysian female adolescents with construct validity and good internal consistency was developed. The scale encompasses 1) preoccupation with thinness and dieting behavior, 2) appearance and body satisfaction, 3) body importance, 4) muscle increasing behavior, 5) extreme dieting behavior, 6) appearance importance, and 7) perception of size and shape dimensions. Besides, a multidimensional body image composite score was proposed to screen negative body image risk in female adolescents. The result found body image was correlated with BMI, risk of eating disorders and self-esteem in female adolescents. In short, the present study supports a multi-dimensional concept for body image and provides a new insight into its multi-dimensionality in Malaysian female adolescents with preliminary validity and reliability of the scale. The Multi-dimensional Body Image Scale can be used to identify female adolescents who are potentially at risk of developing body image disturbance through future intervention programs.
Frequency of non-traumatic anterior knee pain in secondary school students
International Nuclear Information System (INIS)
Shafiq, W.; Ajmad, F.; Ahmed, A.; Fatima, M.
2017-01-01
To find out the frequency of non-traumatic anterior knee pain in secondary school students of Lahore, Pakistan. Methodology: This observational study was conducted among 350 students of secondary school of Lahore during a 3 months period. Both males and females of age 11-17 years were included in the study. A questionnaire was completed which included demographic data, Numeric Rating scale (NRS) and Kujala Scale. The data were being analyzed using SPSS version 21.0. Results: Out of 350 secondary school students, 145 (41%) had anterior knee pain (AKP). Twenty seven (19%) had pain in the left knee only, 54 (37%) had pain in right knee only while 64 (44%) had pain in both knees. The incidence of AKP was highest among 11 to 15 years old students. Moreover, the girls reported high frequency of AKP then the boys. The activities that were affected because of AKP included running, walking, stair climbing and jumping. Conclusion: Non-traumatic AKP is common among students of age 11-17 years, with a peak during adolescence (11-15). This pain not only affects the sports activities but also affects the activity of daily livings. (author)
The Benslimane's Artistic Model for Females' Gaze Beauty: An Original Assessment Tool.
Benslimane, Fahd; van Harpen, Laura; Myers, Simon R; Ingallina, Fabio; Ghanem, Ali M
2017-02-01
The aim of this paper is to analyze the aesthetic characteristics of the human females' gaze using anthropometry and to present an artistic model to represent it: "The Frame Concept." In this model, the eye fissure represents a painting, and the most peripheral shadows around it represent the frame of this painting. The narrower the frame, the more aesthetically pleasing and youthful the gaze appears. This study included a literature review of the features that make the gaze appear attractive. Photographs of models with attractive gazes were examined, and old photographs of patients were compared to recent photographs. The frame ratio was defined by anthropometric measurements of modern portraits of twenty consecutive Miss World winners. The concept was then validated for age and attractiveness across centuries by analysis of modern female photographs and works of art acknowledged for portraying beautiful young and older women in classical paintings. The frame height inversely correlated with attractiveness in modern female portrait photographs. The eye fissure frame ratio of modern idealized female portraits was similar to that of beautiful female portraits idealized by classical artists. In contrast, the eye fissure frames of classical artists' mothers' portraits were significantly wider than those of beautiful younger women. The Frame Concept is a valid artistic tool that provides an understanding of both the aesthetic and aging characteristics of the female periorbital region, enabling the practitioner to plan appropriate aesthetic interventions. This journal requires that authors assign a level of evidence to each article. For a full description of these Evidence-Based Medicine ratings, please refer to the Table of Contents or the A3 online Instructions to Authors. www.springer.com/00266 .
Rusmadi, Siti Zulaikha; Syed Ismail, Sharifah Norkhadijah; Praveena, Sarva Mangala
2015-01-01
Many cases of dermatologic complication were reported with the use of skin lightening products. This study assessed the skin lightening practice and health symptoms among female students. Self-administered questionnaire was distributed to 104 female students (56 undergraduates and 48 postgraduates) aged 24 ± 2 years in Universiti Putra Malaysia. A total of 60.6% (N = 63) of the female students used skin lightening products (61.9% of undergraduates and 38.1% of postgraduates). Reasonable price (N = 35, 55.6%) and ingredients (N = 29, 46%) were considered the most important factors in the product selection. Most respondents purchased the product from drugstores (N = 39, 61.9%). Twenty-two respondents (34.9%) in this study experienced skin problem from the products they used. Skin peeling (N = 13, 12.5%) and acne (N = 9, 8.7%) were the most frequent symptoms experienced. Most of the respondents have the perception that lighter skin provides high self-esteem (N = 56, 53.8%) and looks beautiful and healthier (N = 54, 51.9%). The use of skin lightening products is common among female students in this study and some of these products can cause skin problems such as skin peeling, acne, and itching.
Wang, He; Xiao, Meng; Kong, Fanrong; Chen, Sharon; Dou, Hong-Tao; Sorrell, Tania; Li, Ruo-Yu; Xu, Ying-Chun
2011-01-01
Eleven reference and 25 clinical isolates of Fusarium were subject to multilocus DNA sequence analysis to determine the species and haplotypes of the fusarial isolates from Beijing and Shandong, China. Seven loci were analyzed: the translation elongation factor 1 alpha gene (EF-1α); the nuclear rRNA internal transcribed spacer (ITS), large subunit (LSU), and intergenic spacer (IGS) regions; the second largest subunit of the RNA polymerase gene (RPB2); the calmodulin gene (CAM); and the mitochondrial small subunit (mtSSU) rRNA gene. We also evaluated an IGS-targeted PCR/reverse line blot (RLB) assay for species/haplotype identification of Fusarium. Twenty Fusarium species and seven species complexes were identified. Of 25 clinical isolates (10 species), the Gibberella (Fusarium) fujikuroi species complex was the commonest (40%) and was followed by the Fusarium solani species complex (FSSC) (36%) and the F. incarnatum-F. equiseti species complex (12%). Six FSSC isolates were identified to the species level as FSSC-3+4, and three as FSSC-5. Twenty-nine IGS, 27 EF-1α, 26 RPB2, 24 CAM, 18 ITS, 19 LSU, and 18 mtSSU haplotypes were identified; 29 were unique, and haplotypes for 24 clinical strains were novel. By parsimony informative character analysis, the IGS locus was the most phylogenetically informative, and the rRNA gene regions were the least. Results by RLB were concordant with multilocus sequence analysis for all isolates. Amphotericin B was the most active drug against all species. Voriconazole MICs were high (>8 μg/ml) for 15 (42%) isolates, including FSSC. Analysis of larger numbers of isolates is required to determine the clinical utility of the seven-locus sequence analysis and RLB assay in species classification of fusaria. PMID:21389150
Montalvo, Alicia; Latinjak, Alexander; Unnithan, Viswanath
2016-01-01
Abstract There were two aims of this study: first, to investigate physical fitness and match performance differences between under-16 (U16) and under-18 (U18) female basketball players, and second, to evaluate the relationship between physical fitness and game-related performances. Twenty-three young, female, elite Spanish basketball players (16.2 1.2 years) participated in the study. The sample was divided into two groups: U16 and U18 players. The average scores from pre- and post-season physical fitness measurements were used for subsequent analyses. Anthropometric variables were also measured. To evaluate game performance, game-related statistics, including the number of games and minutes played, points, rebounds, assists, steals and blocks per game, were recorded for every competitive match in one season. When anthropometric and physical performance variables were compared between groups, the U18 group demonstrated significantly (pjump capacity, speed, agility, anaerobic power, repeated sprint ability and aerobic power (p ≤ 0.005). These findings can help optimize training programs for young, elite female basketball players. PMID:28149421
Age Differences in Adults' Free Recall of Pictures and Words.
Gounard, Beverley Roberts; Keitz, Suzanne M.
This study was designed to determine whether adults' memory for pictorial and word stimuli might be differentially affected by age. Twenty female secretaries, median age 22.1, and 20 female members of a senior citizens' center, median age 69.4, were asked to learn lists of pictorial and word stimuli under free recall conditions. Eight trials were…
Goldenberg, Shira M; Muzaaya, Godfrey; Akello, Monica; Nguyen, Paul; Birungi, Josephine; Shannon, Kate
2016-09-01
Sex workers (SWs) in sub-Saharan Africa face a disproportionate HIV burden and growing concerns of severe human rights violations. Given the dearth of evidence on the burden and correlates of HIV among SWs in sub-Saharan Africa, particularly within conflict-affected settings, we examined the relationship between structural determinants (eg, war-related abduction, incarceration) and HIV infection among conflict-affected SWs in Northern Uganda. Cross-sectional community-based research study among female SWs in conflict-affected Gulu, Northern Uganda. Interview questionnaires and voluntary HIV testing were conducted with participants recruited through SW/peer-led outreach and time-location sampling from 2011 to 2012. HIV prevalence was calculated, and bivariable and multivariable logistic regression was used to identify independent associations with HIV seroprevalence. Of 400 SWs, 135 (33.75%) were HIV seropositive; of whom one-third were new/previously undiagnosed HIV infections. In multivariable analysis, after adjusting for age of sex work entry and education, lifetime incarceration (adjusted odds ratio: 1.93, 95% confidence interval: 1.17 to -3.20) was independently associated with HIV seroprevalence, and history of wartime abduction (adjusted odds ratio: 1.62, 95% confidence interval: 1.00 to 2.63) was marginally associated (P = 0.051). This study documented a high rate of undiagnosed HIV infections and associations between war-related human rights violations, incarceration, and a heavy HIV burden among SWs in conflict-affected Northern Uganda. These findings highlight the serious harms of conflict and criminalization of marginalized women in sub-Saharan African contexts. SW-led interventions that address conflict experiences and policy shifts to promote a rights-based approach to HIV prevention and care remain critically needed.
The pregnant female surgical resident
Directory of Open Access Journals (Sweden)
Shifflette V
2018-05-01
Full Text Available Vanessa Shifflette,1 Susannah Hambright,2 Joseph Darryl Amos,1 Ernest Dunn,3 Maria Allo4 1Associates in Surgical Acute Care, Methodist Dallas Medical Center, Dallas, TX, USA; 2Methodist Surgical Associates, Methodist Dallas Medical Center, Dallas, TX, USA; 3Graduate Medical Education - General Surgery, Methodist Dallas Medical Center, Dallas, TX, USA; 4Santa Clara Valley Medical Center, San Jose, CA, USA Background: Surgery continues to be an intense, time-consuming residency. Many medical students decide against surgery as a profession due to the long work hours and family strain. The pregnant female surgical resident has an added stress factor compared to her male counterpart. Methods: We distributed an electronic, online 26-question survey to 32 general surgery programs in the southwestern region of the United States. Each program distributed our survey to the female surgical residents who had been pregnant during residency in the last 5 years. Each program was re-contacted 6 weeks after the initial contact. Most questions were in a 5-point Likert scale format. The responses were collected and analyzed using the Survey Monkey website. Results: An unvalidated survey was sent to 32 general surgery programs and 26 programs responded (81%. Each program was asked for the total number of possible responses from female residents that met our criteria (60 female residents. Seven of the programs (27% stated that they have had zero residents pregnant. We had 22 residents respond (37%. Over half of the residents (55% were pregnant during their 2nd or 3rd year of residency, with only 18% pregnant during a research year. Thirty-one percent had a lower American Board of Surgery In-Training Exam (ABSITE score. Ninety percent of the residents were able to take 4 weeks or more for maternity leave. Most of the residents (95% stated that they would do this again during residency given the opportunity, but many of the residents felt that returning back to work
Cioffi, Iacopo; Farella, Mauro; Festa, Paola; Martina, Roberto; Palla, Sandro; Michelotti, Ambrosina
2015-01-01
To investigate the effects of the application of an acute alteration of the occlusion (ie, interference) on the habitual masseter electromyographic (EMG) activity of females with temporomandibular disorders (TMD)-related muscular pain during wakefulness. Seven female volunteers with masticatory myofascial pain participated in a crossover randomized clinical trial. Gold foils were glued on an occlusal contact area (active occlusal interference, AI) or on the vestibular surface of the same molar (dummy interference, DI) and left for 8 days. The masseter electromyogram was recorded during wakefulness in the natural environment by portable recorders under interference-free, dummy-interference, and active-interference conditions. The number, amplitude, and duration of EMG signal fractions with amplitudes above 10% of the maximum voluntary contraction (activity periods, APs) were computed in all experimental conditions. Muscle pain, headache, and perceived stress were each assessed with a visual analog scale (VAS), and an algometer was used to assess masseter and temporalis pressure pain thresholds. Data were analyzed by means of analysis of variance. The frequency and duration of the recorded APs did not differ significantly between the experimental conditions (P>.05), but a small and significant reduction of the EMG mean amplitude of the APs occurred with AI (P.05). An active occlusal interference in female volunteers with masticatory muscle pain had little influence on the masseter EMG activity pattern during wakefulness and did not affect the pressure tenderness of the masseter and temporalis.
Availability and Price of High Quality Day Care and Female Employment
DEFF Research Database (Denmark)
Simonsen, Marianne
In this paper I analyse to what degree availability and price of high quality publicly subsidised childcare affects female employment for women living in couples following maternity leave. The results show that unrestricted access to day care has a significantly positive effct on female employment.......The price effect is significantly negative: An increase in the price of child care of C=1 will decrease the female employment with 0.08% corresponding to a price elasticity of −0.17. This effect prevails during the first 12 months after childbirth....
Frega, A; Verrone, A; Schimberni, M; Manzara, F; Ralli, E; Catalano, A; Schimberni, M; Torcia, F; Cozza, G; Bianchi, P; Marziani, R; Lukic, A
2015-01-01
Traditional surgery presents some disadvantages, such as the necessity for general anesthesia, hemorrhage, recurrence of pathology, and the possible onset of dyspareunia due to an excessive scarring. CO2 laser surgery might resolve these problems and might be employed in a wider range of clinical indications than usual. We examined the results of CO2 laser surgery in patients affected by benign pathologies and congenital malformations of the female lower genital tract. In this observational study, we enrolled 49 women who underwent CO2 laser surgery for the following indications: Bartholin's gland cyst, imperforate hymen, vaginal septum, Nabothian cyst, and vaginal polyps. Feasibility, cost-effectiveness, complication rate, recurrence rate, short- and long-term outcomes were assessed. All procedures were carried out in a short operative time, without any intraoperative complications. Only 1 (2.0%) out of 49 patients required a hemostatic suture for bleeding. Postoperative period was uneventful in all patients, except 6 (12.2%) out of 49 patients who reported pain one day after surgery, successfully treated with paracetamol. Healing was rapid and excellent in all cases; no wound infection, scarring or stenosis were noticed. Preoperative symptoms reduced or disappeared in all cases. No recurrence was observed and no re-intervention was needed. CO2 laser surgery provides several advantages over traditional surgery, as its systematic use in treating pre-invasive, benign, and congenital pathologies of the female lower genital tract reduces patient discomfort, improves short- and long-term outcomes, and optimizes cost-effectiveness.
Muldoon, Katherine A; Akello, Monica; Muzaaya, Godfrey; Simo, Annick; Shoveller, Jean; Shannon, Kate
2017-01-01
Sex workers in sub-Saharan Africa experience a high burden of HIV with a paucity of data on violence and links to HIV risk among sex workers, and even less within conflict-affected environments. Data are from a cross-sectional survey of female sex workers in Gulu, northern Uganda (n = 400). Logistic regression was used to determine the specific association between policing and recent physical/sexual violence from clients. A total of 196 (49.0%) sex workers experienced physical/sexual violence by a client. From those who experienced client violence the most common forms included physical assault (58.7%), rape (38.3%), and gang rape (15.8%) Police harassment was very common, a total of 149 (37.3%) reported rushing negotiations with clients because of police presence, a practice that was significantly associated with increased odds of client violence (adjusted odds ratio: 1.61, 95% confidence intervals: 1.03-2.52). Inconsistent condom use with clients, servicing clients in a bar, and working for a manager/pimp were also independently associated with recent client violence. Structural and community-led responses, including decriminalisation, and engagement with police and policy stakeholders, remain critical to addressing violence, both a human rights and public health imperative.
The information needs of female Police Officers involved in undercover prostitution work
Directory of Open Access Journals (Sweden)
Lynda M. Baker
2004-01-01
Full Text Available The purpose of this study was to examine the information behavior of female police officers involved in undercover prostitution work. Seven Vice Officers were interviewed during the summer of 2003 and two were observed during one decoy operation. The model, Information Seeking of Professionals, provided the framework for understanding their needs within the context of their role as decoys. The results revealed that the officers need a variety of information and start seeking it before they transfer to the Vice Unit. Their work demands the use several methods of informal communication, including signals and dress code. Information sources include the men who solicit their services, the female sex workers with whom they share space, members of the community, and their fellow officers who are responsible for protecting their lives.
Fertility and sexual function in female Hodgkin lymphoma survivors of reproductive age.
Eeltink, Corien M; Incrocci, Luca; Witte, Birgit I; Meurs, Saskia; Visser, Otto; Huijgens, Peter; Verdonck-de Leeuw, Irma M
2013-12-01
To assess the perceived fertility status and to determine the association between perceived fertility status and sexual function, as reported by young female Hodgkin lymphoma survivors. Young female Hodgkin lymphoma survivors are at risk of infertility and impaired sexual function. However, little is known about their awareness of infertility and its association with sexual functioning. A descriptive questionnaire survey. In this cross-sectional study, a survey was completed by female Hodgkin lymphoma survivors (40 years). Outcome measures included self-reported fertility status and sexual problems and the internationally validated Female Sexual Function Index. In total, 36 survivors were included (mean age 32 years, SD 4). Eighteen women (50%) thought themselves fertile. Eight survivors (22%) who perceived themselves as being infertile were more often treated with alkylator-based chemotherapy, and 63% reported sexual dysfunction. Ten survivors (28%) were not aware as to whether they were fertile or not; seven of these would like to have children. The reported fertility status was related to age and chemotherapy regimen. Regarding sexuality, 14 (39%) of the female Hodgkin lymphoma survivors reported one or more sexual problem and none reported recovery. Female sexual dysfunction according to the Female Sexual Function Index was reported by 11 (31%) survivors. Almost 30% of Hodgkin lymphoma survivors do not know whether they are fertile or not. Overall sexual dysfunction is common in Hodgkin lymphoma survivors and comparable to the general population. However, a lack of desire was significantly more often reported in female Hodgkin lymphoma survivors. To prevent assumed infertility and unintended childlessness by postponing parenthood in young female survivors, awareness of fertility status is needed. There is also a need to routinely assess sexual function and provide adequate interventions to improve arousal and lubrication problems. © 2013 John Wiley & Sons Ltd.
Virtual Characters: Visual Realism Affects Response Time and Decision-Making
Sibuma, Bernadette
2012-01-01
This study integrates agent research with a neurocognitive technique to study how character faces affect cognitive processing. The N170 event-related potential (ERP) was used to study face processing during simple decision-making tasks. Twenty-five adults responded to facial expressions (fear/neutral) presented in three designs…
Perspectives in Theory: Anthology of Theorists affecting the Educational World
Bicking, Misty M., Ed.; Collins, Brian, Ed.; Fernett, Laura, Ed.; Taylor, Barbara, Ed.; Sutton, Kathleen, Ed.
2008-01-01
A compilation of research papers on theorists that affect the educational world are collected in this anthology. Twenty-one students, through the course of their education class, Social and Psychological Conditions of Learning--EDUC 320, researched and applied their knowledge in the elementary and secondary school environments. The contributing…
Directory of Open Access Journals (Sweden)
Megan T Wyman
Full Text Available Males of all polygynous deer species (Cervinae give conspicuous calls during the reproductive season. The extreme interspecific diversity that characterizes these vocalizations suggests that they play a strong role in species discrimination. However, interbreeding between several species of Cervinae indicates permeable interspecific reproductive barriers. This study examines the contribution of vocal behavior to female species discrimination and mating preferences in two closely related polygynous deer species known to hybridize in the wild after introductions. Specifically, we investigate the reaction of estrous female red deer (Cervus elaphus to playbacks of red deer vs. sika deer (Cervus nippon male mating calls, with the prediction that females will prefer conspecific calls. While on average female red deer preferred male red deer roars, two out of twenty females spent more time in close proximity to the speaker broadcasting male sika deer moans. We suggest that this absence of strict vocal preference for species-specific mating calls may contribute to the permeability of pre-zygotic reproductive barriers observed between these species. Our results also highlight the importance of examining inter-individual variation when studying the role of female preferences in species discrimination and intraspecific mate selection.
Auerbach, Randy P; Tarlow, Naomi; Bondy, Erin; Stewart, Jeremy G; Aguirre, Blaise; Kaplan, Cynthia; Yang, Wenhui; Pizzagalli, Diego A
2016-07-01
Borderline personality disorder (BPD) is debilitating, and theoretical models have postulated that cognitive-affective biases contribute to the onset and maintenance of BPD symptoms. Despite advances, our understanding of BPD pathophysiology in youth is limited. The present study used event-related potentials (ERPs) to identify cognitive-affective processes that underlie negative self-referential processing in BPD youth. Healthy females ( n = 33) and females with BPD ( n = 26) 13 to 22 years of age completed a self-referential encoding task while 128-channel electroencephalography data were recorded to examine early (i.e., P1 and P2) and late (late positive potential [LPP]) ERP components. Whole-brain standardized low-resolution electromagnetic tomography explored intracortical sources underlying significant scalp ERP effects. Compared to healthy females, participants with BPD endorsed, recalled, and recognized fewer positive and more negative words. Moreover, unlike the healthy group, females with BPD had faster reaction times to endorse negative versus positive words. In the scalp ERP analyses, the BPD group had greater P2 and late LPP positivity to negative as opposed to positive words. For P2 and late LPP, whole-brain standardized low-resolution electromagnetic tomography analyses suggested that females with BPD overrecruit frontolimbic circuitry in response to negative stimuli. Collectively, these findings show that females with BPD process negative self-relevant information differently than healthy females. Clinical implications and future directions are discussed.
van der Meer, Sascha; Sebrechts, Thomas; Vanderstraeten, Sylvette; Jacquemyn, Hans
2017-12-01
In gynodioecious plant species, females can only persist when they have a reproductive advantage in comparison with hermaphrodites. However, several studies have shown that females do not necessarily produce more seeds than hermaphrodites, since seed production can be affected by population characteristics, such as female frequency or population size. The aim of this study was to quantify the female advantage across a large number of natural populations, examine its relationship with population sex ratio and size, and to assess the role of competition on the magnitude of the female advantage. We sampled 27 populations of Plantago coronopus (nuclear-cytoplasmic gynodioecy) along the Belgian and Dutch coast. In each population, we estimated population sex ratio and size, and assessed seed production per flower and seed production per plant. Subsequently, germination, growth, and competition experiments were performed in the greenhouse to determine the female advantage regarding offspring quality. Females produced fewer seeds per plant than hermaphrodites (FA = 0.90), and seed production was negatively related to female frequency. Since both sex morphs were equally affected by pollen availability, the female advantage was not related to population sex ratio. On the other hand, offspring of females showed higher germination and growth rates, resulting in higher competitive abilities when seeds of a female and a hermaphrodite were grown together. Overall, these results indicate that differences in competitive abilities between the offspring of females and hermaphrodites may have contributed to the maintenance of females in relatively high frequencies in populations of this short-lived gynodioecious plant species.
Oxidative stress and antioxidants: exposure and impact on female fertility
Ruder, Elizabeth H.; Hartman, Terryl J.; Blumberg, Jeffrey; Goldman, Marlene B.
2009-01-01
Background Reproductive failure is a significant public health concern. Although relatively little is known about factors affecting fertility and early pregnancy loss, a growing body of literature suggests that environmental and lifestyle factors play an important role. There is sufficient evidence to hypothesize that diet, particularly its constituent antioxidants, and oxidative stress (OS) may influence the timing and maintenance of a viable pregnancy. We hypothesize that conditions leading to OS in the female affect time-to-pregnancy and early pregnancy loss. Methods We review the epidemiology of female infertility related to antioxidant defenses and oxidation and examine potential sources of OS from the ovarian germ cell through the stages of human pregnancy and pregnancy complications related to infertility. Articles were identified through a search of the PubMed database. Results Female OS is a likely mediator of conception and threshold levels for OS exist, dependent on anatomic location and stage of preconception. Conclusions Prospective pregnancy studies with dietary assessment and collection of biological samples prior to conception with endpoints of time-to-pregnancy and early pregnancy loss are needed. PMID:18535004
The Summit of «Group of Twenty» – 2016: geopolitical assessments
Directory of Open Access Journals (Sweden)
O. S. Vonsovych
2016-08-01
Full Text Available The article investigated the geopolitical assessments of the results of the Summit of «Group of Twenty», which took place in Hangzhou from 4 till 5 September, 2016. The main idea of this event was the development of innovation, healthy, coherent and inclusive economy. Moreover, important for the geopolitical consolidation of efforts of member countries in the context of further development of the world economy was making such documents as: Contours of the innovative growth of «Group of Twenty», Action plan of «Group of Twenty» in connection with a new industrial revolution, Hangzhou action plan, which set out a strategy for overall and confident growth and also initiative of «Group of twenty» in development and cooperation in the field of digital economy. Important thing is that analysis of the Summit’s results for world regions is important from a geopolitical point of view. We can predict that in the future geopolitical dialogue between the EU and the US in the economy will become more vital for both sides, and will enable to contribute to the implementation of more global challenges of the global economy. We should mention that Summit of «Group of Twenty» largely determined the prospects of global economic processes and build a new world economic order with the introduction of innovative approaches and elements of the digital economy. Activity on the functioning of the global economy should be based on the collective efforts of all participants and take into account all the realities on the international stage. No less important is that the Summit proved the presence of leading geopolitical centers that affect not only the balance of power in the world, but also the further development of key economic processes. Each of these centers sees its future not only the global economy but the global system as a whole as well as its geopolitical influence in certain regions and countries. On the one hand, as for the development of
Peri-ictal signal changes in seven patients with status epilepticus: interesting MRI observations
Energy Technology Data Exchange (ETDEWEB)
Goyal, Manoj K; Sinha, Sanjib [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neurology, Bangalore, Karnataka (India); Ravishankar, Shivshankar; Shivshankar, Jai Jai [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neuroimaging and Interventional Radiology, Bangalore (India)
2009-03-15
Transient peri-ictal changes on imaging had been described following status epilepticus (SE), but its cause is not very well understood. We analyzed the magnetic resonance imaging (MRI) findings in SE patients in order to elucidate such changes including peri-ictal signal. This prospective study involved 34 patients (M/F 23:11, mean age 25.8 {+-} 17.2 years) who experienced SE. MRI was performed during or within 96 h of cessation of seizures. Twenty-five patients had generalized convulsive status epilectus (GCSE; ten secondary GCSE and 15 primary GCSE). Seven patients had epilepsia partialis continua and two patients non-convulsive SE. Eight patients had a history of seizures and three patients previous SE. The mean duration of SE prior to MRI was 89.2 {+-} 105.3 h (range 2-360 h). MRI provided diagnosis in 17 patients, and in 13 patients, no structural cause was identified. Peri-ictal focal signal changes with restricted diffusion on apparent diffusion coefficient maps were present in seven (20.6%) patients with SE (generalized convulsive, three; partial, three; non-convulsive, one). The changes were observed when MRI was performed during SE in 3/10 (30%) patients, or within 24 h in 1/7 (14.3%), 48 h in 1/5 (20%), 72 h in 1/6 (16.7%), or 96 h in 1/6 (16.7%) patients after cessation of seizures. Repeat MRI revealed disappearance of signal changes in two patients. Peri-ictal MR changes with restricted diffusion appear to be an effect rather than the cause of SE. (orig.)
Peri-ictal signal changes in seven patients with status epilepticus: interesting MRI observations
International Nuclear Information System (INIS)
Goyal, Manoj K.; Sinha, Sanjib; Ravishankar, Shivshankar; Shivshankar, Jai Jai
2009-01-01
Transient peri-ictal changes on imaging had been described following status epilepticus (SE), but its cause is not very well understood. We analyzed the magnetic resonance imaging (MRI) findings in SE patients in order to elucidate such changes including peri-ictal signal. This prospective study involved 34 patients (M/F 23:11, mean age 25.8 ± 17.2 years) who experienced SE. MRI was performed during or within 96 h of cessation of seizures. Twenty-five patients had generalized convulsive status epilectus (GCSE; ten secondary GCSE and 15 primary GCSE). Seven patients had epilepsia partialis continua and two patients non-convulsive SE. Eight patients had a history of seizures and three patients previous SE. The mean duration of SE prior to MRI was 89.2 ± 105.3 h (range 2-360 h). MRI provided diagnosis in 17 patients, and in 13 patients, no structural cause was identified. Peri-ictal focal signal changes with restricted diffusion on apparent diffusion coefficient maps were present in seven (20.6%) patients with SE (generalized convulsive, three; partial, three; non-convulsive, one). The changes were observed when MRI was performed during SE in 3/10 (30%) patients, or within 24 h in 1/7 (14.3%), 48 h in 1/5 (20%), 72 h in 1/6 (16.7%), or 96 h in 1/6 (16.7%) patients after cessation of seizures. Repeat MRI revealed disappearance of signal changes in two patients. Peri-ictal MR changes with restricted diffusion appear to be an effect rather than the cause of SE. (orig.)
Experimental feeding of DDE and PCB to female big brown bats (Eptesicus fuscus)
Clark, D.R.; Prouty, R.M.
1977-01-01
Twenty-two female big brown bats (Eptesicus fuscus) were collected in a house attic in Montgomery County, Maryland. Seventeen were fed mealworms (Tenebrio molitor larvae) that contained 166 ppm DDE; the other five were fed uncontaminated mealworms. After 54 days of feeding, six dosed bats were frozen and the remaining 16 were starved to death. In a second experiment, 21 female big brown bats were collected in a house attic in Prince Georges County, Maryland. Sixteen were fed mealworms that contained 9.4 ppm Aroclor 1254 (PCB). After 37 days, two bats had died, four dosed bats were frozen, and the remaining 15 were starved to death. Starvation caused mobilization of stored residues. After the feeding periods, average weights of all four groups (DDE-dosed, DDE control, PCB-dosed, PCB control) had increased. However, weights of DDE-dosed bats had increased significantly more than those of their contols, whereas weights of PCB-dosed bats had increased significantly less than those of their controls. During starvation, PCB-dosed bats lost weight significantly more slowly than controls. Because PCB levels in dosed bats resembled levels found in some free-living big brown bats, PCBs may be slowing metabolic rates of some free-living bats. It is not known how various common organochlorine residues may affect metabolism in hibernating bats. DDE and PCB increased in brains of starving bats as carcass fat was metabolized. Because the tremors and/or convulsions characteristic of neurotoxicity were not observed, we think even the maximum brain levels attained (132 ppm DDE, 20 ppm PCB) were sublethal. However, extrapolation of our DDE data predicted lethal brain levels when fat reserves declined sufficiently. PCB-dosed bats were probably in no danger of neurotoxic poisoning. However, PCB can kill by a nonneurotoxic mode, and this could explain the deaths of two bats on PCB dosage.
DEFF Research Database (Denmark)
Söderqvist, Thomas
2011-01-01
Today, scientific biography is primarily thought of as a way of writing contextual history of science. But the genre has other functions as well. This article discusses seven kinds of ideal-typical subgenres of scientific biography. In addition to its mainstream function as an ancilla historiae...
Evolutionary rate of a gene affected by chromosomal position.
Perry, J; Ashworth, A
1999-09-09
Genes evolve at different rates depending on the strength of selective pressure to maintain their function. Chromosomal position can also have an influence [1] [2]. The pseudoautosomal region (PAR) of mammalian sex chromosomes is a small region of sequence identity that is the site of an obligatory pairing and recombination event between the X and Y chromosomes during male meiosis [3] [4] [5] [6]. During female meiosis, X chromosomes can pair and recombine along their entire length. Recombination in the PAR is therefore approximately 10 times greater in male meiosis compared with female meiosis [4] [5] [6]. The gene Fxy (also known as MID1 [7]) spans the pseudoautosomal boundary (PAB) in the laboratory mouse (Mus musculus domesticus, C57BL/6) such that the 5' three exons of the gene are located on the X chromosome but the seven exons encoding the carboxy-terminal two-thirds of the protein are located within the PAR and are therefore present on both the X and Y chromosomes [8]. In humans [7] [9], the rat, and the wild mouse species Mus spretus, the gene is entirely X-unique. Here, we report that the rate of sequence divergence of the 3' end of the Fxy gene is much higher (estimated at 170-fold higher for synonymous sites) when pseudoautosomal (present on both the X and Y chromosomes) than when X-unique. Thus, chromosomal position can directly affect the rate of evolution of a gene. This finding also provides support for the suggestion that regions of the genome with a high recombination frequency, such as the PAR, may have an intrinsically elevated rate of sequence divergence.
Perron, Liette; Senikas, Vyta; Burnett, Margaret; Davis, Victoria
2013-11-01
To strengthen the national framework for care of adolescents and women affected by female genital cutting (FGC) in Canada by providing health care professionals with: (1) information intended to strengthen their knowledge and understanding of the practice; (2) directions with regard to the legal issues related to the practice; (3) clinical guidelines for the management of obstetric and gynaecological care, including FGC related complications; and (4) guidance on the provision of culturally competent care to adolescents and women with FGC. Published literature was retrieved through searches of PubMed, CINAHL, and The Cochrane Library in September 2010 using appropriate controlled vocabulary (e.g., Circumcision, Female) and keywords (e.g., female genital mutilation, clitoridectomy, infibulation). We also searched Social Science Abstracts, Sociological Abstracts, Gender Studies Database, and ProQuest Dissertations and Theses in 2010 and 2011. There were no date or language restrictions. Searches were updated on a regular basis and incorporated in the guideline to December 2011. Grey (unpublished) literature was identified through searching the websites of health technology assessment and health technology-related agencies, clinical practice guideline collections, clinical trial registries, and national and international medical specialty societies. The quality of evidence in this document was rated using the criteria described in the Report of the Canadian Task Force on Preventive Health Care (Table 1). Summary Statements 1. Female genital cutting is internationally recognized as a harmful practice and a violation of girls' and women's rights to life, physical integrity, and health. (II-3) 2. The immediate and long-term health risks and complications of female genital cutting can be serious and life threatening. (II-3) 3. Female genital cutting continues to be practised in many countries, particularly in sub-Saharan Africa, Egypt, and Sudan. (II-3) 4. Global migration
Gillingham, Erica
2018-04-25
Representations of lesbian, gay, bisexual, transgender, and queer (LGBTQ) characters in comics for an all-ages readership have emerged in the United States in the early twenty-first century. This essay examines the narrative constructions of same-sex relationships between female characters in two all-ages speculative fiction comics, Princess Princess Ever After by Katie O'Neill, and Lumberjanes, created by Shannon Watters, Grace Ellis, Noelle Stevenson, and Brooke Allen.
Cirigliano, V.; Dekens, W.; de Vries, J.; Graesser, M. L.; Mereghetti, E.
2017-12-01
We analyze neutrinoless double beta decay (0 νββ) within the framework of the Standard Model Effective Field Theory. Apart from the dimension-five Weinberg operator, the first contributions appear at dimension seven. We classify the operators and evolve them to the electroweak scale, where we match them to effective dimension-six, -seven, and -nine operators. In the next step, after renormalization group evolution to the QCD scale, we construct the chiral Lagrangian arising from these operators. We develop a power-counting scheme and derive the two-nucleon 0 νββ currents up to leading order in the power counting for each lepton-number-violating operator. We argue that the leading-order contribution to the decay rate depends on a relatively small number of nuclear matrix elements. We test our power counting by comparing nuclear matrix elements obtained by various methods and by different groups. We find that the power counting works well for nuclear matrix elements calculated from a specific method, while, as in the case of light Majorana neutrino exchange, the overall magnitude of the matrix elements can differ by factors of two to three between methods. We calculate the constraints that can be set on dimension-seven lepton-number-violating operators from 0 νββ experiments and study the interplay between dimension-five and -seven operators, discussing how dimension-seven contributions affect the interpretation of 0 νββ in terms of the effective Majorana mass m ββ .
Confronting quasi-exponential inflation with WMAP seven
International Nuclear Information System (INIS)
Pal, Barun Kumar; Pal, Supratik; Basu, B.
2012-01-01
We confront quasi-exponential models of inflation with WMAP seven years dataset using Hamilton Jacobi formalism. With a phenomenological Hubble parameter, representing quasi exponential inflation, we develop the formalism and subject the analysis to confrontation with WMAP seven using the publicly available code CAMB. The observable parameters are found to fair extremely well with WMAP seven. We also obtain a ratio of tensor to scalar amplitudes which may be detectable in PLANCK
False memories for affective information in Schizophrenia
Directory of Open Access Journals (Sweden)
Beth Fairfield
2016-11-01
Full Text Available Studies have shown a direct link between memory for emotionally salient experiences and false memories. In particular, emotionally arousing material of negative and positive valence enhanced reality monitoring compared to neutral material since emotional stimuli can be encoded with more contextual details and thereby facilitate the distinction between presented and imagined stimuli. Individuals with schizophrenia appear to be impaired in both reality monitoring and memory for emotional experiences. However, the relationship between the emotionality of the-to-be-remembered material and false memory occurrence has not yet been studied. In this study, twenty-four patients and twenty-four healthy adults completed a false memory task with everyday episodes composed of 12 photographs that depicted positive, negative or neutral outcomes. Results showed how patients with schizophrenia made a higher number of false memories than normal controls (p0.05 resulting from erroneous inferences but did interact with plausible, script consistent errors in patients (i.e. neutral episodes yielded a higher degree of errors than positive and negative episodes. Affective information reduces the probability of generating causal errors in healthy adults but not in patients suggesting that emotional memory impairments may contribute to deficits in reality monitoring in schizophrenia when affective information is involved.
Babiolakis, Corinne S; Kuk, Jennifer L; Drake, Janessa D M
2015-01-01
Low back pain is highly prevalent in nurses. This study aimed to determine which physical fitness, physical activity (PA) and biomechanical characteristics most clearly distinguish between nurses with [recently injured (RInj)] and without [not recently injured (NRInj)] a recent back injury. Twenty-seven (8 RInj, 19 NRInj) female nurses completed questionnaires (pain, work, PA), physical fitness, biomechanical and low back discomfort measures, and wore an accelerometer for one work shift. Relative to NRInj nurses, RInj nurses exhibited reduced lumbopelvic control (41.4% more displayed a moderate loss of frontal plane position), less active occupational behaviours (less moderate PA; less patient lifts performed alone; more sitting and less standing time) and more than two times higher low back discomfort scores. Despite no physical fitness differences, the lumbopelvic control, occupational behaviours and discomfort measures differed between nurses with and without recent back injuries. It is unclear whether poor lumbopelvic control is causal or adaptive in RInj nurses and may require further investigation. Practitioner Summary: It is unclear which personal modifiable factors are most clearly associated with low back pain in nurses. Lumbopelvic control was the only performance-based measure to distinguish between nurses with and without recent back injuries. Future research may investigate whether reduced lumbopelvic control is causal or adaptive in recently injured nurses.
Game Demands of Seven-A-Side Soccer in Young Players.
Barbero-Alvarez, José C; Gómez-López, Maite; Castagna, Carlo; Barbero-Alvarez, Verónica; Romero, David V; Blanchfield, Anthony W; Nakamura, Fábio Y
2017-07-01
Barbero-Alvarez, JC, Gómez-López, M, Castagna, C, Barbero-Alvarez, V, Romero, DV, Blanchfield, AW, and Nakamura, FY. Game demands of seven-a-side soccer in young players. J Strength Cond Res 31(7): 1771-1779, 2017-The aim of this study was to examine the activity patterns and physiological demands of 7-a-side youth soccer matches across 2 chronological age categories (U12 and U14). Twenty-two soccer players of a national youth soccer academy were investigated. Players of each age category performed 2 training matches (2 × 25 minutes) and were monitored by global positioning system and heart rate monitor units. Players of both categories covered similar total distance (5,348 ± 307 m), at similar mean heart rate values (86 ± 4% of maximum). However, the number of high-intensity runs (82.5 ± 17.4 vs. 69.7 ± 15.2) and total distance covered during sprints (264 ± 207 vs. 128 ± 74 m) were significantly (p ≤ 0.05) higher in U14 compared with U12. The results suggest a highly demanding nature of 7-a-side soccer for skilled players, with physical maturity possibly influencing the match-related high-intensity performance at these ages.
Gender affects skin wound healing in plasminogen deficient mice
DEFF Research Database (Denmark)
Rønø, Birgitte; Engelholm, Lars Henning; Lund, Leif Røge
2013-01-01
closure in female versus male plasmin deficient mice. Further studies showed that this gender effect could not be reversed by ovariectomy, suggesting that female sex-hormones did not mediate the accelerated skin wound healing in plasmin deficient female mice. Histological examination of healed wounds...... functional plasmin thus display decreased tumor growth in a variety of cancer models. Interestingly, this role of plasmin has, in regard to skin cancer, been shown to be restricted to male mice. It remains to be clarified whether gender also affects other phenotypic characteristics of plasmin deficiency...... or if this gender effect is restricted to skin cancer. To investigate this, we tested the effect of gender on plasmin dependent immune cell migration, accumulation of hepatic fibrin depositions, skin composition, and skin wound healing. Gender did not affect immune cell migration or hepatic fibrin accumulation...
Peritoneal mesothelioma in a woman who has survived for seven years: a case report
Directory of Open Access Journals (Sweden)
Pourgholami Mohammad H
2011-01-01
Full Text Available Abstract Introduction Malignant peritoneal mesothelioma is a rare cancer with poor patient survival. Female gender has been identified as a positive prognostic factor. Recently, it has been suggested that the expression of estrogen receptor β in malignant mesothelioma leads to tumor suppression and a better prognosis. Case presentation We report the case of a 48-year-old Caucasian woman who is alive and disease-free seven years after the initial diagnosis and treatment of malignant peritoneal mesothelioma. Conclusion This patient's long survival may be attributable to a combination of factors, including minimal disease, complete cytoreductive surgery and hyperthermic intraperitoneal chemotherapy plus the estrogen receptor β positivity of the tumor.
How Going to School Affects the Family
DEFF Research Database (Denmark)
Landersø, Rasmus; Nielsen, Helena Skyt; Simonsen, Marianne
in school starting age induced by date of birth, we find that the timing of these transitions affect parental outcomes. At child age seven, for example, being one year older at school start increases maternal employment with four percentage points. At child age 15, similarly, being one year older at school...
Kaplan, Kalman J.; Harrow, Martin; Clews, Kelsey
2016-01-01
The Chicago Follow-up Study has followed the course of severe mental illness among psychiatric patients for over 20 years after their index hospitalization. Among these patients are 97 schizophrenia patients, 45 patients with schizoaffective disorders, 102 patients with unipolar nonpsychotic depression, and 53 patients with a bipolar disorder. Maximum suicidal activity (suicidal ideation, suicidal attempts and suicide completions) generally declines over the three time periods (early, middle, and late follow-ups) following discharge from the acute psychiatric hospitalization for both males and females across diagnostic categories with two exceptions: female schizophrenia patients and female bipolar patients. A weighted mean suicidal activity score tended to decrease across follow-ups for male patients in the schizophrenia, schizoaffective and depressive diagnostic groups with an uneven trend in this direction for the male bipolars. No such pattern emerges for our female patients except for female depressives. Males’ suicidal activity seems more triggered by psychotic symptoms and potential chronic disability while females’ suicidal activity seems more triggered by affective symptoms. PMID:26881891
Twenty-First Century Literacy: A Matter of Scale from Micro to Mega
Brown, Abbie; Slagter van Tryon, Patricia J.
2010-01-01
Twenty-first century technologies require educators to look for new ways to teach literacy skills. Current communication methods are combinations of traditional and newer, network-driven forms. This article describes the changes twenty-first century technologies cause in the perception of time, size, distance, audience, and available data, and…
Nutritional Practices of National Female Soccer Players: Analysis and Recommendations
Martin, Louise; Lambeth, Anneliese; Scott, Dawn
2006-01-01
The aim of the study was to establish the nutritional practices and activity patterns of elite female soccer players. The nutritional intake of 16 female England Soccer players was self-reported over a seven-day period. Participants were provided with written and verbal guidelines for the completion of the diaries. Training details were also recorded, and used in combination with BMR predictions to calculate daily energy expenditure. Energy, macronutrient and micronutrient intakes were determined using DietMaster 4.0 software. Results suggest that energy intake was low (1904 ± 366.3 kcal) in relation to previous recommendations for soccer players. Energy expenditure (2153.5 ± 596.2 kcal) was not significantly different (p > 0.05) from intake, suggesting energy balance was achieved. Carbohydrate (53.8 ± 6.8%), protein (16.8 ± 2.1%) and fat (28.8 ± 6.6%) intakes were in line with recommendations. Fluid intake (2466 ± 1350.5ml·day-1) was sufficient to meet baseline recommendations, but would need to be higher to meet the additional requirement of training and competition. With the exception of vitamin A and iron, all micronutrient intakes were higher than the DRI. In conclusion, recommendations for female soccer players are to encourage consumption of carbohydrate-electrolyte beverages to enhance carbohydrate intake and increase fluid intake, and ensure sufficient iron rich foods are included in the diet to meet the DRI. Key points Female soccer players demonstrate a low energy intake in relation to predicted requirements, but were in energy balance in this study. Increased carbohydrate intake may be beneficial to both training and competition performance of elite female soccer players Fluid requirements should be addressed on an individual basis and matched to player requirements. The iron status of female soccer players may be compromised due to insufficient dietary intake to meet the DRV. PMID:24198690
Nutritional practices of national female soccer players: analysis and recommendations.
Martin, Louise; Lambeth, Anneliese; Scott, Dawn
2006-01-01
The aim of the study was to establish the nutritional practices and activity patterns of elite female soccer players. The nutritional intake of 16 female England Soccer players was self-reported over a seven-day period. Participants were provided with written and verbal guidelines for the completion of the diaries. Training details were also recorded, and used in combination with BMR predictions to calculate daily energy expenditure. Energy, macronutrient and micronutrient intakes were determined using DietMaster 4.0 software. Results suggest that energy intake was low (1904 ± 366.3 kcal) in relation to previous recommendations for soccer players. Energy expenditure (2153.5 ± 596.2 kcal) was not significantly different (p > 0.05) from intake, suggesting energy balance was achieved. Carbohydrate (53.8 ± 6.8%), protein (16.8 ± 2.1%) and fat (28.8 ± 6.6%) intakes were in line with recommendations. Fluid intake (2466 ± 1350.5ml·day(-1)) was sufficient to meet baseline recommendations, but would need to be higher to meet the additional requirement of training and competition. With the exception of vitamin A and iron, all micronutrient intakes were higher than the DRI. In conclusion, recommendations for female soccer players are to encourage consumption of carbohydrate-electrolyte beverages to enhance carbohydrate intake and increase fluid intake, and ensure sufficient iron rich foods are included in the diet to meet the DRI. Key pointsFemale soccer players demonstrate a low energy intake in relation to predicted requirements, but were in energy balance in this study.Increased carbohydrate intake may be beneficial to both training and competition performance of elite female soccer playersFluid requirements should be addressed on an individual basis and matched to player requirements.The iron status of female soccer players may be compromised due to insufficient dietary intake to meet the DRV.