WorldWideScience

Sample records for twelve-phase ac arc

  1. A novel double quad-inverter configuration for multilevel twelve-phase open-winding converter

    DEFF Research Database (Denmark)

    Padmanaban, Sanjeevi Kumar; Blaabjerg, Frede; Wheeler, Patrick William

    2016-01-01

    This paper describes a novel proposal of double quad-inverter configuration for multilevel twelve-phase open-winding ac converter. Modular power units are developed from reconfigured eight classical three-phase voltage source inverters (VSIs). Each VSI has one additional bi-directional switching ...

  2. Heat Transfer Analysis for Industrial AC Electric Arc Furnace

    Institute of Scientific and Technical Information of China (English)

    (U)nal (C)amdali; Murat Tun(c)

    2005-01-01

    The heat transfer analysis was performed for an AC electric arc furnace (EAF). Heat losses by conduction, convection and radiation from outer surface, roof, bottom and electrodes of EAF were determined in detail. Some suggestions about decreasing heat losses were presented.

  3. Modeling of AC arc inside wet snow

    Energy Technology Data Exchange (ETDEWEB)

    Hemmatjou, H.

    2006-07-01

    Overhead transmission lines cover long distances over a broad range of topographic relief, climates, and environments. As such, the high voltage equipment is subject to pollution, wet snow and atmospheric icing. Each of these factors have been the source of power outages recorded on power transmission lines. Electric arcs can develop on outdoor insulators until they cause a total flashover. This study involved the modeling of flashover in snow-covered insulators to better understand how electric discharges initiate inside snow and how they develop into flashover. The main objective of this thesis was to develop a mathematical model to predict the flashover voltage of snow-covered insulator surfaces and to ultimately design adequate insulators for cold regions. The results obtained through mathematical modeling were in good agreement with those obtained in experiments.

  4. Transient Temperature Analysis for Industrial AC Arc Furnace Bottom

    Institute of Scientific and Technical Information of China (English)

    (U)nal (C)amdal1; Murat Tun(c)

    2004-01-01

    Heat losses from the furnaces depend on the design and size. The surface heat loss from the bottom of an industrial AC electric arc furnace (EAF) possesses an important fraction of overall losses. So in this study the transient temperature variation at the bottom of the EAF was investigated. The transient temperature analysis was carried out using MATLAB computer program. T=T(r, t) for different bottom lining layers was depicted.

  5. Water treatment by the AC gliding arc air plasma

    Science.gov (United States)

    Gharagozalian, Mehrnaz; Dorranian, Davoud; Ghoranneviss, Mahmood

    2017-06-01

    In this study, the effects of gliding arc (G Arc) plasma system on the treatment of water have been investigated experimentally. An AC power supply of 15 kV potential difference at 50 Hz frequency was employed to generate plasma. Plasma density and temperature were measured using spectroscopic method. The water was contaminated with staphylococcus aureus (Gram-positive) and salmonella bacteria (Gram-negative), and Penicillium (mold fungus) individually. pH, hydrogen peroxide, and nitride contents of treated water were measured after plasma treatment. Decontamination of treated water was determined using colony counting method. Results indicate that G Arc plasma is a powerful and green tool to decontaminate water without producing any byproducts.

  6. Effect of arc current on droplet ejection from tungsten-based electrode in multiphase AC arc

    Science.gov (United States)

    Hashizume, Taro; Tanaka, Manabu; Watanabe, Takayuki

    2017-05-01

    The dynamic behavior of droplet ejection from a tungsten electrode was successfully visualized using a high-speed camera and an appropriate band-pass filter. The effect of arc current on droplet ejection was investigated to understand the electrode erosion mechanism in the multiphase AC arc. The rate of erosion by droplet ejection increased with increasing current. This result was examined on the basis of the time variation in forces on a pending droplet at the electrode tip during the AC cycle. The relationship among electromagnetic force, surface tension, and ion pressure on the molten tip during the cathodic period is crucial for controling droplet ejection. The molten tip becomes hemispherical forming the pending droplet with an increase in the instantaneous value of arc current during the AC cycle. The pending droplet detaches from the electrode surface when electromagnetic force becomes the dominant force. Consequently, a higher rate of erosion by droplet ejection with a higher arc current resulted from a stronger electromagnetic force.

  7. Critical Length Criterion and the Arc Chain Model for Calculating the Arcing Time of the Secondary Arc Related to AC Transmission Lines

    Science.gov (United States)

    Cong, Haoxi; Li, Qingmin; Xing, Jinyuan; Li, Jinsong; Chen, Qiang

    2015-06-01

    The prompt extinction of the secondary arc is critical to the single-phase reclosing of AC transmission lines, including half-wavelength power transmission lines. In this paper, a low-voltage physical experimental platform was established and the motion process of the secondary arc was recorded by a high-speed camera. It was found that the arcing time of the secondary arc rendered a close relationship with its arc length. Through the input and output power energy analysis of the secondary arc, a new critical length criterion for the arcing time was proposed. The arc chain model was then adopted to calculate the arcing time with both the traditional and the proposed critical length criteria, and the simulation results were compared with the experimental data. The study showed that the arcing time calculated from the new critical length criterion gave more accurate results, which can provide a reliable criterion in term of arcing time for modeling and simulation of the secondary arc related with power transmission lines. supported by National Natural Science Foundation of China (Nos. 51277061 and 51420105011)

  8. New perspectives on the dynamics of AC and DC plasma arcs exposed to cross-fields

    Science.gov (United States)

    Abdo, Youssef; Rohani, Vandad; Cauneau, François; Fulcheri, Laurent

    2017-02-01

    Interactions between an arc and external fields are crucially important for the design and the optimization of modern plasma torches. Multiple studies have been conducted to help better understand the behavior of DC and AC current arcs exposed to external and ‘self-induced’ magnetic fields, but the theoretical foundations remain very poorly explored. An analytical investigation has therefore been carried out in order to study the general behavior of DC and AC arcs under the effect of random cross-fields. A simple differential equation describing the general behavior of a planar DC or AC arc has been obtained. Several dimensionless numbers that depend primarily on arc and field parameters and the main arc characteristics (temperature, electric field strength) have also been determined. Their magnitude indicates the general tendency pattern of the arc evolution. The analytical results for many case studies have been validated using an MHD numerical model. The main purpose of this investigation was deriving a practical analytical model for the electric arc, rendering possible its stabilization and control, and the enhancement of the plasma torch power.

  9. Computer Aided Mass Balance Analysis for AC Electric Arc Furnace Steelmaking

    Institute of Scientific and Technical Information of China (English)

    (ü)nal Camdali; Murat Tunc

    2005-01-01

    A mass balance analysis was undertaken for liquid steel production using a computer program specially developed for the AC electric arc furnace at an important alloy steel producer in Turkey. The data obtained by using the computer program were found to be very close to the actual production ones.

  10. Exergy analysis and efficiency in an industrial AC electric ARC furnace

    Energy Technology Data Exchange (ETDEWEB)

    Camdali, U. [Development Bank of Turkey, Ankara (Turkey); Tunc, M. [Yeditepe University, Istanbul (Turkey). Faculty of Engineering

    2003-12-01

    In this study, the steel production process in the AC electric arc furnace (EAF) is discussed and an exergy analysis has been undertaken for the EAF with scrap preheating for an alloyed steel producer in Turkey. Exergy analysis has been employed to obtain optimum design parameters and operation conditions. In this work; obtained results are compared with measured values and previous literature. (author)

  11. Determination of input/output characteristics of full-bridge AC/DC/DC converter for arc welding

    OpenAIRE

    Stefanov, Goce; Karadzinov, Ljupco; Sarac, Vasilija; Cingoski, Vlatko; Gelev, Saso

    2016-01-01

    This paper describes the design and practical implementation of AC/DC/DC converter in mode of arc welding. An analysis of the operation of AC/DC/DC converter and its input/output characteristics are determined with computer simulations. The practical part is consisted of AC/DC/DC converter prototype for arc welding with output power of 3 kW and switching frequency of 64 kHz. The operation of AC/DC/DC converter is validated with experimental measurements.

  12. 硅铁矿热炉内交流电弧稳定性理论分析%ANALYSIS OF AC ARC STABILITY IN FERROSILICON SUBMERGED ARC FURNACE

    Institute of Scientific and Technical Information of China (English)

    章俊; 李忠思; 储少军

    2015-01-01

    According to the combustion characteristics and the external circuit conditions, AC arc stability in ferrosilicon SAF is analyzed in this paper based on the actual situation of circuit in the ferrosilicon SAF. Results of the research show that AC arc in ferrosilicon SAF is more stable compared with the open arc. In addition, the AC arc stability needs cosφless than 0.84 in electric arc furnace for steel making. This conclusion can not be directly used for ferrosilicon SAF, while AC arc stability in ferrosilicon SAF should be built according to circuit theory.%依据交流电弧稳定燃烧的特点和外电路条件,结合硅铁炉炉内电路的实际情况,对硅铁炉炉内交流电弧稳定性进行了分析。研究表明,相比敞开弧,硅铁炉炉内电弧燃烧更加稳定。另外,用于炼钢电弧炉的交流电弧稳定性条件cosφ<0.84不能直接用于硅铁矿热炉炉内电弧稳定性分析,需要依据电路理论建立电弧稳定性外电路条件。

  13. The influence of Ac parameters in the process of micro-arc oxidation film electric breakdown

    Directory of Open Access Journals (Sweden)

    Ma Jin

    2016-01-01

    Full Text Available This paper studies the electric breakdown discharge process of micro-arc oxidation film on the surface of aluminum alloy. Based on the analysis of the AC parameters variation in the micro-arc oxidation process, the following conclusions can be drawn: The growth of oxide film can be divided into three stages, and Oxide film breakdown discharge occurs twice in the micro-arc oxidation process. The first stage is the formation and disruptive discharge of amorphous oxide film, producing the ceramic oxide granules, which belong to solid dielectric breakdown. In this stage the membrane voltage of the oxide film plays a key role; the second stage is the formation of ceramic oxide film, the ceramic oxide granules turns into porous structure oxide film in this stage; the third stage is the growth of ceramic oxide film, the gas film that forms in the oxide film’s porous structure is electric broken-down, which is the second breakdown discharge process, the current density on the oxide film surface could affect the breakdown process significantly.

  14. Sub-micrometer particles produced by a low-powered AC electric arc in liquids.

    Science.gov (United States)

    Jaworski, Jacek A; Fleury, Eric

    2012-01-01

    The article presents the report of the production of composites of sub-micrometer metal particles in matrix consisted of the metal compounds by means of an AC electric arc in water and paraffin solutions using electrodes carbon-metal and metal-metal (metal: Ni, Fe, Co, Cu). The advantage of this method is the low electric power (from 5 to 10 W) needed in comparison to standard DC arc-discharge methods (0.8 to 3 kW). This method enables the production of particles from conductive material also in wide range of temperature and in solvent which could be either transparent to light or opaque. Moreover the solvent can be electrolyte or insulating liquid. The microstructure of the composite layer was investigated by scanning electron microscopy (SEM), Electron Probe Microanalysis (EPMA) and X-ray. During particles production in water metal oxides were created. Additionally using cobalt-copper, nickel-copper as couple electrodes, insoluble in water copper (II) hydroxide crystal grains were created additionally which crystals shape was depended on transition metal. For iron-copper couple electrodes system the copper (II) hydroxide was not formed. Experiments with sequence production of Ni and Fe particles with C electrode assisting in molten paraffin let to obtain both Ni and Fe particles surrounded by paraffin. After solidification the material was insulator but if locally magnetic field influenced on the liquid solution in that place after solidification a new composite was created which was electric current conductor with resistivity around 0.1 omega x m, was attracted by magnetic field and presented magneto resistance around 0.4% in changing magnetic field in a range 150 mT. After mixing the concentrated paraffin with normal paraffin resistivity of the mixture increased and it became photosensitive and created small voltage under light influence.

  15. Finite element modelling of electric currents in AC submerged arc furnaces

    CSIR Research Space (South Africa)

    Mc Dougall, I

    2007-01-01

    Full Text Available . ANSYS/Multiphysics was used to predict the current density distribution in the electrodes, raw material, slag and molten metal as a result of the three phases AC current. The effect of the electrode immersion on the current path was studied...

  16. A comparative study of modelling AC electric arc by one-dimensional interpolation for power system harmonics analysis

    OpenAIRE

    Liu Yu-Jen; Hung Jen-Pan; Chen Shang-I; Lin Cheng-Wei

    2016-01-01

    Electric arc is a discharge phenomenon caused by particular electrical events and arc produced facilities in power system, for example the occurrence of short-circuit fault in feeders and the use of electric arc furnace for steel-making. All of these electric arcs have a highly nonlinear nature and can be considered as a significant source of power quality problems. To investigate the impacts of the electric arcs on power quality studies the development of the electric arc models for simulati...

  17. Physics-Based Modeling of Electric Operation, Heat Transfer, and Scrap Melting in an AC Electric Arc Furnace

    Science.gov (United States)

    Opitz, Florian; Treffinger, Peter

    2016-04-01

    Electric arc furnaces (EAF) are complex industrial plants whose actual behavior depends upon numerous factors. Due to its energy intensive operation, the EAF process has always been subject to optimization efforts. For these reasons, several models have been proposed in literature to analyze and predict different modes of operation. Most of these models focused on the processes inside the vessel itself. The present paper introduces a dynamic, physics-based model of a complete EAF plant which consists of the four subsystems vessel, electric system, electrode regulation, and off-gas system. Furthermore the solid phase is not treated to be homogenous but a simple spatial discretization is employed. Hence it is possible to simulate the energy input by electric arcs and fossil fuel burners depending on the state of the melting progress. The model is implemented in object-oriented, equation-based language Modelica. The simulation results are compared to literature data.

  18. 灭弧室结构对交流接触器电寿命影响的试验研究%Test Study of Arc Extinguish Chamber Structure’s Impact on Electrical Life of AC Contactor

    Institute of Scientific and Technical Information of China (English)

    汪从礼

    2014-01-01

    Introduction was made to the principle and method of arc extinction of contactor and analysis was made to the arc extinguish cham-ber structure of AC contactor and the impacts of effective gas escape area on electrical life. Taking the arc extinguish chamber structure of frame 150 A contactor as an example, AC-4 electrical life test was carried out for 3 sample machines. The test result shows that for same current frame contactors, its arc extinguish chamber structure has vitally important impact on electrical life, and providing the requirement of electric gap and distance is met, the bigger the effective gas escape area is, the larger the number of electrical life times is.%介绍了接触器的灭弧原理及方式,分析了交流接触器灭弧室结构及有效排气孔面积对电寿命的影响。以框架为150 A 接触器的灭弧室结构为例,对3个样机进行 AC-4电寿命试验,试验结果表明对于同电流框架的接触器,其灭弧室结构对电寿命影响至关重要,且在满足电气间隙和爬电距离时,有效排气孔面积越大,电寿命次数越大。

  19. Augmentation of Antitumor T-Cell Responses by Increasing APC T-Cell C5a/C3a-C5aR/C3aR Interactions

    Science.gov (United States)

    2013-03-01

    signaling which drives Th1/ Th17 effector cell responses (14). While we described the connection of C3aR/C5aR signaling with the PI-3Kγ- AKT-mTOR...involved in controlling the anti-tumor immune response, i.e. biasing between Th1/ Th17 effector cell vs Treg commitment, but also directly involved in

  20. Design of a portable multi-function inverter AC/DC TIG arc welder%一种便携式交流方波多功能氩弧焊机的设计

    Institute of Scientific and Technical Information of China (English)

    谭蓉

    2012-01-01

    A circuit design programme for a portable multi -function inverter TIG welder is introduced in this paper.This welding machine can not only use in AC/DC TIG welding, but also use in MMA welding.It is a multi-function arc welder.The working principles of main circuits are introduced in detail,including input circuit,EMI Filter circuit,primary inverter main circuit,Pulse Width Modulation (PWM)circuit,the driving circuit of MOSFET.overvoltage protection circuit,Input buffer circuit,AC/DC output control circuit and High Frequency (HF)control circuit.The methods to improve the reliability of the inverter welder are put forward in this paper.The experiment results show that the design programme and circuits can improve the reliability,reduce the cost and weight of the welder.The circuits and methods are of great worth in developing an new and similar TIG inverter welder.%介绍了一种便携式逆变交流方波氩弧焊机的设计方案.这种焊机既能用于AC/DC氲弧焊(TIG),又可用于直流焊条电弧焊(MMA),是一种多功能焊机.着重阐述了焊机的主要电路及其工作原理,包括输入和EMI滤波电路、一次逆变主电路、PWM脉宽调制电路和驱动电路、过电压保护和上电缓冲电路、交直流输出控制电路以及高频控制电路.介绍了焊机抗电磁干扰的一些方法.试验结果表明:这些电路和方法能够降低焊机成本,提高工作可靠性.

  1. Optical diagnostics of a gliding arc

    DEFF Research Database (Denmark)

    Sun, Z.W.; Zhu, J.J.; Li, Z.S.;

    2013-01-01

    Dynamic processes in a gliding arc plasma generated between two diverging electrodes in ambient air driven by 31.25 kHz AC voltage were investigated using spatially and temporally resolved optical techniques. The life cycles of the gliding arc were tracked in fast movies using a high-speed camera...

  2. Cathodic arcs

    Energy Technology Data Exchange (ETDEWEB)

    Anders, Andre

    2003-10-29

    Cathodic arc plasma deposition has become the technology of choice for hard, wear and corrosion resistant coatings for a variety of applications. The history, basic physics of cathodic arc operation, the infamous macroparticle problem and common filter solutions, and emerging high-tech applications are briefly reviewed. Cathodic arc plasmas standout due to their high degree of ionization, with important consequences for film nucleation, growth, and efficient utilization of substrate bias. Industrial processes often use cathodic arc plasma in reactive mode. In contrast, the science of arcs has focused on the case of vacuum arcs. Future research directions include closing the knowledge gap for reactive mode, large area coating, linear sources and filters, metal plasma immersion process, with application in high-tech and biomedical fields.

  3. Cathodic arcs

    OpenAIRE

    Anders, Andre

    2003-01-01

    Cathodic arc plasma deposition has become the technology of choice for hard, wear and corrosion resistant coatings for a variety of applications. The history, basic physics of cathodic arc operation, the infamous macroparticle problem and common filter solutions, and emerging high-tech applications are briefly reviewed. Cathodic arc plasmas stand out due to their high degree of ionization, with important consequences for film nucleation, growth, and efficient utilization of substrate bia...

  4. Resistance Characteristics of Arc in Long Air Gap

    Institute of Scientific and Technical Information of China (English)

    YU Zhanqing; YU Junjie; ZENG Rong; CHEN He; PENG Xiang

    2013-01-01

    Arc resistance is an important parameter for characterizing long arcs in air,and its laboratory testing is of importance for accurate arc modeling of electromagnetic transient caused by short circuit fault.Therefore,we constructed an experimental system to study the characteristics of long AC arc in air.Driven by currents of 10 kA or 40 kA (root mean square value),the system produces arcs with different initial lengths of 1 m,2 m and 4 m,and the movement of the arcs are captured by a high-speed camera.After performing experiments using the system,we carried out analysis and comparisons of the arc resistance of arcs with different lengths and different currents,as well as a study of the relationship between the macro-morphology and the resistance of the arcs.Conclusions were drawn from the experimental results:the arc voltage had obvious saturation characteristics; the arc resistance increased with the increase of arc length and the decrease of current; the arcs bended or extended significantly in time and the peak arc voltage within a single cycle increased correspondingly; the arcs had voltage and current in the same phase.In the end,a formula of arc resistance based on the experiment results is derived.

  5. Analysis of mathematical model for long-primary short-secondary twelve-phase linear induction motor%长初级短次级十二相直线感应电动机数学模型分析

    Institute of Scientific and Technical Information of China (English)

    饶金; 刘德志; 许金; 马伟明; 徐兴华

    2014-01-01

    To meet the requirement of the high-power linear propulsion system ,this paper designs a novel twelve-phase linear induction motor (LIM ) with double-sided long stators ,and presents its winding construction .On this basis ,a mathematical model of ABC coordinates for this novel motor is derived ,which is used to analyze the asymmetry of the end-winding leakage inductance in the twelve-phase LIM with double-sided long stators ,which is caused by the relative space position of each phase end-winding in the motor ,and compare it with the asymmetry of the end-winding leakage inductance of the multi-phase rotating motor .Thus ,a simulation model of the motor is established .The model is used for calculating the electromagnetic properties of the motor .The simulation results prove that the mathematical model is correct .%基于大功率直线推进的要求,设计了一种新型十二相双边长定子直线感应电动机,介绍了十二相直线感应电动机的绕组结构。在此基础上,推导了十二相双边长定子直线感应电动机的ABC坐标系数学模型,分析了由电机各相端部绕组空间相对位置决定的十二相直线感应电动机端部漏感的不对称规律,并与多相旋转电机端部漏感的规律进行了对比分析;建立了仿真模型,对电机的电磁性能进行了计算。仿真实验证明了该数学模型的正确性。

  6. On arc efficiency in gas tungsten arc welding

    Directory of Open Access Journals (Sweden)

    Nils Stenbacka

    2013-12-01

    Full Text Available The aim of this study was to review the literature on published arc efficiency values for GTAW and, if possible, propose a narrower band. Articles between the years 1955 - 2011 have been found. Published arc efficiency values for GTAW DCEN show to lie on a wide range, between 0.36 to 0.90. Only a few studies covered DCEP - direct current electrode positive and AC current. Specific information about the reproducibility in calorimetric studies as well as in modeling and simulation studies (considering that both random and systematic errors are small was scarce. An estimate of the average arc efficiency value for GTAW DCEN indicates that it should be about 0.77. It indicates anyway that the GTAW process with DCEN is an efficient welding method. The arc efficiency is reduced when the arc length is increased. On the other hand, there are conflicting results in the literature as to the influence of arc current and travel speed.

  7. Arc Statistics

    CERN Document Server

    Meneghetti, M; Dahle, H; Limousin, M

    2013-01-01

    The existence of an arc statistics problem was at the center of a strong debate in the last fifteen years. With the aim to clarify if the optical depth for giant gravitational arcs by galaxy clusters in the so called concordance model is compatible with observations, several studies were carried out which helped to significantly improve our knowledge of strong lensing clusters, unveiling their extremely complex internal structure. In particular, the abundance and the frequency of strong lensing events like gravitational arcs turned out to be a potentially very powerful tool to trace the structure formation. However, given the limited size of observational and theoretical data-sets, the power of arc statistics as a cosmological tool has been only minimally exploited so far. On the other hand, the last years were characterized by significant advancements in the field, and several cluster surveys that are ongoing or planned for the near future seem to have the potential to make arc statistics a competitive cosmo...

  8. Modeling Arcs

    CERN Document Server

    Insepov, Zeke; Veitzer, Seth; Mahalingam, Sudhakar

    2011-01-01

    Although vacuum arcs were first identified over 110 years ago, they are not yet well understood. We have since developed a model of breakdown and gradient limits that tries to explain, in a self-consistent way: arc triggering, plasma initiation, plasma evolution, surface damage and gra- dient limits. We use simple PIC codes for modeling plasmas, molecular dynamics for modeling surface breakdown, and surface damage, and mesoscale surface thermodynamics and finite element electrostatic codes for to evaluate surface properties. Since any given experiment seems to have more variables than data points, we have tried to consider a wide variety of arcing (rf structures, e beam welding, laser ablation, etc.) to help constrain the problem, and concentrate on common mechanisms. While the mechanisms can be comparatively simple, modeling can be challenging.

  9. Observation of gliding arc surface treatment

    DEFF Research Database (Denmark)

    Kusano, Yukihiro; Zhu, Jiajian; Ehn, A.

    2015-01-01

    surfaces. A gap was observed between the polymer surface and the luminous region of the plasma column, indicating the existence of a gas boundary layer. The thickness of the gas boundary layer is smaller at higher gas flow-rates or with ultrasonic irradiation to the AC gliding arc and the polymer surface....... Water contact angle measurements indicate that the treatment uniformity improves significantly when the AC gliding arc is tilted to the polymer surface. Thickness reduction of the gas boundary layer, explaining the improvement of surface treatment, by the ultrasonic irradiation was directly observed...

  10. A plasma-arc pyrolysis system for hazardous waste treatment

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ A laboratory system for the treatment of medical and hazardous wastes via AC plasma-arc pyrolysis was recently built up by a research team led by Prof. SHENG Hongzhi at the CAS Institute of Mechanics (IMECH) in Beijing.

  11. Gliding arc triggered microwave plasma arc at atmospheric pressure for coal gasification application

    Science.gov (United States)

    Jain, Vishal; Visani, A.; Patil, C.; Patel, B. K.; Sharma, P. K.; John, P. I.; Nema, S. K.

    2014-08-01

    Plasma torch is device that efficiently converts electrical energy in to thermal energy for various high temperature applications. The conventional plasma torch comprises of consumable electrodes namely anode and cathode electrodes. The replacement of these electrodes is a complex process owing to its cooling and process shut down requirements. However, microwave plasma arc is electrode-less plasma arc system that is an alternative method to conventional arc technology for generating plasma arc. In this technique, microwave power is efficiently coupled to generate plasma arc by using the property of polar molecule to absorb microwave power. The absorption of microwave power is in form of losses due to intermolecular friction and high collisions between the molecules. This is an efficient method because all microwave power can be absorbed by plasma arc. The main feature of microwave plasma arc is its large uniform high temperature column which is not possible with conventional arc discharge methods. Such type of plasma discharge is very useful in applications where sufficient residence time for treat materials is required. Microwave arc does not require any consumable electrodes and hence, it can be operated continuously that makes it very useful for hazardous effluent treatment applications. Further, microwave cannot ionize neutral particles at atmospheric pressure and hence, a gliding arc is initiated between two thin electrodes in the cavity by applying very low power high voltage (3kV) AC source. In this report, the method for generating microwave arc of 1kW power using commercial microwave oven is elaborated.

  12. What makes an electric welding arc perform its required function

    Energy Technology Data Exchange (ETDEWEB)

    Correy, T.B.

    1982-09-01

    The physics of direct current and alternating current welding arcs, the heat transfer of direct current welding arcs, the characteristics of dc welding and ac welding power supplies and recommendations for the procurement and maintenance of precision power supplies are discussed. (LCL)

  13. Particle tracking velocimetry of a gliding arc discharge

    DEFF Research Database (Denmark)

    Zhu, Jiajian; Gao, Jinlong; Ehn, Andreas;

    2014-01-01

    A 35 kHz AC gliding arc discharge at atmospheric pressure is generated between two diverging electrodes and extended by an air flow. The gas flow velocity is measured by particle tracking velocimetry (PTV) while the moving velocity of the plasma column of the gliding arc discharge is measured...... by analyzing the movie taken by a high-speed camera. The two-dimensional velocity vector of the gas flow and of the gliding arc in the imaging plane was determined....

  14. Stability of alternating current gliding arcs

    DEFF Research Database (Denmark)

    Kusano, Yukihiro; Salewski, Mirko; Leipold, Frank;

    2014-01-01

    that the critical length can be increased by increasing the AC frequency, decreasing the serial resistance and lowering the gas flow rate. The predicted dependence of gas flow rate on the arc length is experimentally demonstrated. The gap width is varied to study an optimal electrode design, since the extended non...

  15. Unstable Behavior of Anodic Arc Discharge for Synthesis of Nanomaterials

    Science.gov (United States)

    Gershman, Sophia; Raitses, Yevgeny

    2016-09-01

    Fast imaging and electrical current measurements reveal unstable behavior of the carbon arc discharge for synthesis of nanomaterials. The arc column and the arc attachment region to the anode move in a somewhat sporadic way with a characteristic time in a 10-3 sec range. The arc exhibits a negative differential resistance before the arc motion occurs. A physical mechanism is proposed based on the thermal processes in the arc plasma region interacting with the ablating anode which leads to the shift of the arc to a new anode region. According to the transient heat transfer analysis, the time needed to heat a new anode region is also in a 10-3 sec range. For a 0.6 cm diameter anode used in our experiments, this time yields a frequency of about 200-300 Hz, comparable to the measured frequency of the arc motion. The voltage and current measurements show oscillations with a similar characteristic frequency. The thermal model is indirectly supported by the measured negative differential resistance of the arc discharge during arc oscillations. The observed unstable behavior of the arc may be responsible for the mixing of the flow of nanoparticles during the synthesis of nanoparticles leading to poor selectivity typical for the arc synthesis. The work was supported by US DOE under Contract No. DE-AC02-09CH11466.

  16. Acoustic characteristics of electric arc furnaces

    Science.gov (United States)

    Cherednichenko, V. S.; Bikeev, R. A.; Cherednichenko, A. V.; Ognev, A. M.

    2016-06-01

    A mathematical model is constructed to describe the appearance and development of the noise characteristics of superpower electric arc furnaces. The noise formation is shown to be related to the pulsation of the axial plasma flows in arc discharges because of the electrodynamic pressure oscillations caused by the interaction of the self-magnetic field with the current passing in an arc. The pressure in the arc axis changes at a frequency of 100 Hz at the maximum operating pressure of 66 kPa for an arc current of 80 kA. The main ac arc sound frequencies are multiples of 100 Hz, which is supported in the practice of operation of electric arc furnaces. The sound intensity in the furnace laboratory reaches 160 dB and is decreased to 115-120 dB in the working furnace area due to shielding by the furnace jacket, the molten metal, and the molten slag. The appropriateness of increasing the hermetic sealing of electric furnaces and creating furnaces operating at low currents and high transformer voltages is corroborated.

  17. Gas arc constriction for plasma arc welding

    Science.gov (United States)

    McGee, William F. (Inventor); Rybicki, Daniel J. (Inventor)

    1994-01-01

    A welding torch for plasma arc welding apparatus has an inert gas applied circumferentially about the arc column externally of the constricting nozzle so as to apply a constricting force on the arc after it has exited the nozzle orifice and downstream of the auxiliary shielding gas. The constricting inert gas is supplied to a plenum chamber about the body of the torch and exits through a series of circumferentially disposed orifices in an annular wall forming a closure at the forward end of the constricting gas plenum chamber. The constricting force of the circumferential gas flow about the arc concentrates and focuses the arc column into a more narrow and dense column of energy after exiting the nozzle orifice so that the arc better retains its energy density prior to contacting the workpiece.

  18. Comportamiento del tiempo de duración, la frecuencia de los cortocircuitos y la conductividad eléctrica durante el reencendido del arco en la soldadura SMAW (AC con electrodos E6013 Behavior of short-circuit frequency and duration time and electrical conductivity on arc turn- on during SMAW (AC with E6013 electrodes

    Directory of Open Access Journals (Sweden)

    Alejandro García Rodríguez

    2009-03-01

    Full Text Available El presente trabajo tiene como objetivo la evaluación del comportamiento del tiempo de duración, la frecuencia de los cortocircuitos y la conductividad durante el reencendido del arco en el proceso de soldadura SMAW (Shielded Metal Arc Welding, con corriente alterna y electrodos E6013. El análisis estadístico no-paramétrico garantiza un procesamiento robusto de los datos, atenuando la influencia de valores atípicos y errores derivados del empleo de aproximaciones a distribuciones continuas conocidas. La mediana y la mediana de la desviación absoluta (MAD, respecto a la mediana de los datos, constituyen los estimadores de localización y dispersión utilizados, respectivamente. El electrodo, en el régimen de 160 A, presenta una mayor estabilidad, en el aporte metálico, dada por el menor valor del MAD promedio del período de cortocircuito (39,36 ms y de la duración del cortocircuito (1,43 ms, reafirmada con la presencia de una mayor conductividad eléctrica durante el reencendido (1766,17x10-3 S·s-1.The objective of this work is the valuation of the behavior of short-circuits frequency and duration time and electrical conductivity on arc reigniting in SMAW (Shielded Metal Arc Welding process with alternate current and E6013 electrodes. The non parametric statistic analysis realize a robust data processing, minimizing the outliers influence and mistakes derivates about employ of approximations to well know continues distributions. The median and the median absolute deviation (MAD respect to median of the data are the localization and dispersion estimators used, respectively. The electrode at 160 A present a better stability on metal transference supported on the most little value of MAD for the period of transference (39,36 ms, and the MAD of the short-circuit duration (1,43 ms, according with the presence of a major electric conductivity during the arc reigniting (1766,17x10-3 S·s-1.

  19. Optical diagnostics of a gliding arc.

    Science.gov (United States)

    Sun, Z W; Zhu, J J; Li, Z S; Aldén, M; Leipold, F; Salewski, M; Kusano, Y

    2013-03-11

    Dynamic processes in a gliding arc plasma generated between two diverging electrodes in ambient air driven by 31.25 kHz AC voltage were investigated using spatially and temporally resolved optical techniques. The life cycles of the gliding arc were tracked in fast movies using a high-speed camera with framing rates of tens to hundreds of kHz, showing details of ignition, motion, pulsation, short-cutting, and extinction of the plasma column. The ignition of a new discharge occurs before the extinction of the previous discharge. The developed, moving plasma column often short-cuts its current path triggered by Townsend breakdown between the two legs of the gliding arc. The emission from the plasma column is shown to pulsate at a frequency of 62.5 kHz, i.e., twice the frequency of the AC power supply. Optical emission spectra of the plasma radiation show the presence of excited N2, NO and OH radicals generated in the plasma and the dependence of their relative intensities on both the distance relative to the electrodes and the phase of the driving AC power. Planar laser-induced fluorescence of the ground-state OH radicals shows high intensity outside the plasma column rather than in the center suggesting that ground-state OH is not formed in the plasma column but in its vicinity.

  20. Innovation approaches to controlling the electric regimes of electric arc furnaces

    Science.gov (United States)

    Bikeev, R. A.; Serikov, V. A.; Ognev, A. M.; Rechkalov, A. V.; Cherednichenko, V. S.

    2015-12-01

    The processes of current passage in an ac electric arc furnace (EAF) are subjected to industrial experiments and mathematical simulation. It is shown that, when a charge is melted, arcs between charge fragments exist in series with main arc discharges, and these arcs influence the stability of the main arc discharges. The measurement of instantaneous currents and voltages allowed us to perform a real-time calculation of the electrical characteristics of a three-phase circuit and to determine the θ parameter, which characterizes the nonlinearity of the circuit segment between electrodes. Based on these studies, we created an advanced system for controlling the electric regime of EAF.

  1. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  2. High current electric arcs above the In-Ga-Sn eutectic alloy

    Science.gov (United States)

    Klementyeva, I. B.; Pinchuk, M. E.

    2016-11-01

    The results of investigations of high-current dc and ac arc discharges of atmospheric pressure emerging above the free surface of liquid metal (In-Ga-Sn eutectic alloy) are presented in the paper. The mechanism of the arc formation due to pinch-effect is discussed here.

  3. Spatiotemporally resolved characteristics of a gliding arc discharge in a turbulent air flow at atmospheric pressure

    DEFF Research Database (Denmark)

    Zhu, Jiajian; Gao, Jinlong; Ehn, Andreas

    2017-01-01

    A gliding arc discharge was generated in a turbulent air flow at atmospheric pressure driven by a 35 kHz alternating current (AC) electric power. The spatiotemporally resolved characteristics of the gliding arc discharge, including glow-type discharges, spark-type discharges, short-cutting events...

  4. Miniaturized cathodic arc plasma source

    Science.gov (United States)

    Anders, Andre; MacGill, Robert A.

    2003-04-15

    A cathodic arc plasma source has an anode formed of a plurality of spaced baffles which extend beyond the active cathode surface of the cathode. With the open baffle structure of the anode, most macroparticles pass through the gaps between the baffles and reflect off the baffles out of the plasma stream that enters a filter. Thus the anode not only has an electrical function but serves as a prefilter. The cathode has a small diameter, e.g. a rod of about 1/4 inch (6.25 mm) diameter. Thus the plasma source output is well localized, even with cathode spot movement which is limited in area, so that it effectively couples into a miniaturized filter. With a small area cathode, the material eroded from the cathode needs to be replaced to maintain plasma production. Therefore, the source includes a cathode advancement or feed mechanism coupled to cathode rod. The cathode also requires a cooling mechanism. The movable cathode rod is housed in a cooled metal shield or tube which serves as both a current conductor, thus reducing ohmic heat produced in the cathode, and as the heat sink for heat generated at or near the cathode. Cooling of the cathode housing tube is done by contact with coolant at a place remote from the active cathode surface. The source is operated in pulsed mode at relatively high currents, about 1 kA. The high arc current can also be used to operate the magnetic filter. A cathodic arc plasma deposition system using this source can be used for the deposition of ultrathin amorphous hard carbon (a-C) films for the magnetic storage industry.

  5. Wire + Arc Additive Manufacturing

    OpenAIRE

    Williams, Stewart W.; Martina, Filomeno; Addison, Adrian C.; Ding, Jialuo; Pardal, Goncalo; Colegrove, Paul A.

    2016-01-01

    Depositing large components (>10 kg) in titanium, aluminium, steel and other metals is possible using Wire + Arc Additive Manufacturing. This technology adopts arc welding tools and wire as feedstock for additive manufacturing purposes. High deposition rates, low material and equipment costs, and good structural integrity make Wire+Arc Additive Manufacturing a suitable candidate for replacing the current method of manufacturing from solid billets or large forgings, especially with regards to ...

  6. Welding arc plasma physics

    Science.gov (United States)

    Cain, Bruce L.

    1990-01-01

    The problems of weld quality control and weld process dependability continue to be relevant issues in modern metal welding technology. These become especially important for NASA missions which may require the assembly or repair of larger orbiting platforms using automatic welding techniques. To extend present welding technologies for such applications, NASA/MSFC's Materials and Processes Lab is developing physical models of the arc welding process with the goal of providing both a basis for improved design of weld control systems, and a better understanding of how arc welding variables influence final weld properties. The physics of the plasma arc discharge is reasonably well established in terms of transport processes occurring in the arc column itself, although recourse to sophisticated numerical treatments is normally required to obtain quantitative results. Unfortunately the rigor of these numerical computations often obscures the physics of the underlying model due to its inherent complexity. In contrast, this work has focused on a relatively simple physical model of the arc discharge to describe the gross features observed in welding arcs. Emphasis was placed of deriving analytic expressions for the voltage along the arc axis as a function of known or measurable arc parameters. The model retains the essential physics for a straight polarity, diffusion dominated free burning arc in argon, with major simplifications of collisionless sheaths and simple energy balances at the electrodes.

  7. WSTF electrical arc projects

    Science.gov (United States)

    Linley, Larry

    1994-09-01

    The objectives of these projects include the following: validate method used to screen wire insulation with arc tracking characteristics; determine damage resistance to arc as a function of source voltage and insulation thickness; investigate propagation characteristics of Kapton at low voltages; and investigate pyrolytic properties of polyimide insulated (Kapton) wire for low voltage (less than 35 VDC) applications. Supporting diagrams and tables are presented.

  8. First NIF ARC target shot results

    Science.gov (United States)

    Chen, Hui; di Nicola, P.; Hermann, M.; Kalantar, D.; Martinez, D.; Tommasini, R.; NIF ARC Team

    2015-11-01

    The commissioning of the Advanced Radiographic Capability (ARC) laser system in the National Ignition Facility (NIF) is currently in progress. ARC laser is designed to ultimately provide eight beamlets with pulse duration adjustable from 1 to 50 ps, and energies up to 1.7 kJ per beamlet. ARC will add critical capability for the NIF facility for creating precision x-ray backlighters needed for many current NIF ICF and HED experiments. ARC can also produce MeV electrons and protons for new science experiment on NIF. In the initial set of experiments, 4 of the 8 beamlets are being commissioned up to 1 kJ per beam at 30 ps pulse length using foil and wire targets. X-ray energy distribution, spot size and pulse duration are measured using various diagnostics. This talk will describe the shot setup and results. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.

  9. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  10. Circular-Arc Cartograms

    CERN Document Server

    Kämper, Jan-Hinrich; Nöllenburg, Martin

    2011-01-01

    We present a new circular-arc cartogram model in which countries are drawn with circular arcs instead of straight-line segments. Given a geographic map and values associated with each country in the map, the cartogram is a new map in which the areas of the countries represent the corresponding values. In the circular-arc cartogram model straight-line segments can be replaced with circular arcs in order to achieve the desired areas, while the corners of the polygons defining each country remain fixed. The countries in circular-arc cartograms have the aesthetically pleasing appearance of clouds or snowflakes, depending on whether their edges are bent outwards or inwards. This makes is easy to determine whether a country has grown or shrunk, just by its overall shape. We show that determining whether a given map and area-values can be realized with a circular-arc cartogram is an NP-hard problem. Next we describe a heuristic method for constructing circular-arc cartograms, which uses a max-flow computation on the...

  11. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  12. Pulsed plasma arc cladding

    Institute of Scientific and Technical Information of China (English)

    龙; 白钢; 李振民; 张赋升; 杨思乾

    2004-01-01

    A prototype of Pulsed Plasma Arc Cladding system was developed, in which single power source supplies both transferred plasma arc (TPA) and non-transferred plasma arc (N-TPA). Both plasmas work in turn in a high frequency controlled by an IGBT connecting nozzle and workpiece. The working frequency of IGBT ranges from 50 ~ 7000Hz, in which the plasmas can work in turn smoothly. Higher than 500 Hz of working frequency is suggested for promotion of cladding quality and protection of IGBT. Drag phenomenon of TPA intensifies as the frequency goes up, which tends to increase the current proportion of TPA and suppress N-TPA. The occupation ratio of IGBT can be regulated from 5% ~ 95%, which balances the power supplies of both plasmas. An occupation ratio higher than 50% gives adequate proportion of arc current for N-TPA to preheat powder.

  13. Filtered cathodic arc source

    Science.gov (United States)

    Falabella, Steven; Sanders, David M.

    1994-01-01

    A continuous, cathodic arc ion source coupled to a macro-particle filter capable of separation or elimination of macro-particles from the ion flux produced by cathodic arc discharge. The ion source employs an axial magnetic field on a cathode (target) having tapered sides to confine the arc, thereby providing high target material utilization. A bent magnetic field is used to guide the metal ions from the target to the part to be coated. The macro-particle filter consists of two straight solenoids, end to end, but placed at 45.degree. to one another, which prevents line-of-sight from the arc spot on the target to the parts to be coated, yet provides a path for ions and electrons to flow, and includes a series of baffles for trapping the macro-particles.

  14. Vacuum arc melting of tungsten-hafnium-carbon alloy

    Science.gov (United States)

    Ammon, R. L.; Buckman, R. W., Jr.

    1974-01-01

    The vacuum arc casting of tungsten alloys, which contain carbon as an alloy addition, require special melting procedures in order to produce melts of consistent controlled levels of alloy content. A melting procedure will be described in which elemental components of a tungsten 0.35% HfC alloy are assembled to form an electrode for ac vacuum arc melting to produce 3-in.-diam ingots. Melting procedures and analytical chemistry are discussed and compared with data for ingots produced by other techniques.

  15. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  16. Modeling of Arc Force in Plasma Arc Welding

    Institute of Scientific and Technical Information of China (English)

    GAO Zhonglin; HU Shengsun; YIN Fengliang; WANG Rui

    2008-01-01

    A three. dimensional mathematical model for the transferred-type argon arc was developed to describe arc force on the anode surface. The software ANSYS was employed to solve the model. The model includes a part of torch and tungsten electrode to achieve m ore reasonable results. The arc temperature and flow fields were derived. And the influences of welding parameters on arc force were also studied. The simulated results show that arc pressure at the anode are dependent on the welding current, plasma gas flow rate and electrode neck-in, while not sensitive to arc length.

  17. MODELING PARAMETERS OF ARC OF ELECTRIC ARC FURNACE

    Directory of Open Access Journals (Sweden)

    R.N. Khrestin

    2015-08-01

    Full Text Available Purpose. The aim is to build a mathematical model of the electric arc of arc furnace (EAF. The model should clearly show the relationship between the main parameters of the arc. These parameters determine the properties of the arc and the possibility of optimization of melting mode. Methodology. We have built a fairly simple model of the arc, which satisfies the above requirements. The model is designed for the analysis of electromagnetic processes arc of varying length. We have compared the results obtained when testing the model with the results obtained on actual furnaces. Results. During melting in real chipboard under the influence of changes in temperature changes its properties arc plasma. The proposed model takes into account these changes. Adjusting the length of the arc is the main way to regulate the mode of smelting chipboard. The arc length is controlled by the movement of the drive electrode. The model reflects the dynamic changes in the parameters of the arc when changing her length. We got the dynamic current-voltage characteristics (CVC of the arc for the different stages of melting. We got the arc voltage waveform and identified criteria by which possible identified stage of smelting. Originality. In contrast to the previously known models, this model clearly shows the relationship between the main parameters of the arc EAF: arc voltage Ud, amperage arc id and length arc d. Comparison of the simulation results and experimental data obtained from real particleboard showed the adequacy of the constructed model. It was found that character of change of magnitude Md, helps determine the stage of melting. Practical value. It turned out that the model can be used to simulate smelting in EAF any capacity. Thus, when designing the system of control mechanism for moving the electrode, the model takes into account changes in the parameters of the arc and it can significantly reduce electrode material consumption and energy consumption

  18. Arc Plasma Torch Modeling

    CERN Document Server

    Trelles, J P; Vardelle, A; Heberlein, J V R

    2013-01-01

    Arc plasma torches are the primary components of various industrial thermal plasma processes involving plasma spraying, metal cutting and welding, thermal plasma CVD, metal melting and remelting, waste treatment and gas production. They are relatively simple devices whose operation implies intricate thermal, chemical, electrical, and fluid dynamics phenomena. Modeling may be used as a means to better understand the physical processes involved in their operation. This paper presents an overview of the main aspects involved in the modeling of DC arc plasma torches: the mathematical models including thermodynamic and chemical non-equilibrium models, turbulent and radiative transport, thermodynamic and transport property calculation, boundary conditions and arc reattachment models. It focuses on the conventional plasma torches used for plasma spraying that include a hot-cathode and a nozzle anode.

  19. Arc Heated Scramjet Test Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Arc Heated Scramjet Test Facility is an arc heated facility which simulates the true enthalpy of flight over the Mach number range of about 4.7 to 8 for free-jet...

  20. ARc Welding (Industrial Processing Series).

    Science.gov (United States)

    ARC WELDING , *BIBLIOGRAPHIES), (*ARC WELDS, BIBLIOGRAPHIES), ALUMINUM ALLOYS, TITANIUM ALLOYS, CHROMIUM ALLOYS, METAL PLATES, SPOT WELDING , STEEL...INERT GAS WELDING , MARAGING STEELS, MICROSTRUCTURE, HEAT RESISTANT ALLOYS, HEAT RESISTANT METALS, WELDABILITY, MECHANICAL PROPERTIES, MOLYBDENUM ALLOYS, NICKEL ALLOYS, RESISTANCE WELDING

  1. Variable polarity arc welding

    Science.gov (United States)

    Bayless, E. O., Jr.

    1991-01-01

    Technological advances generate within themselves dissatisfactions that lead to further advances in a process. A series of advances in welding technology which culminated in the Variable Polarity Plasma Arc (VPPA) Welding Process and an advance instituted to overcome the latest dissatisfactions with the process: automated VPPA welding are described briefly.

  2. Thermal Arc Spray Overview

    Science.gov (United States)

    Hafiz Abd Malek, Muhamad; Hayati Saad, Nor; Kiyai Abas, Sunhaji; Mohd Shah, Noriyati

    2013-06-01

    Usage of protective coating for corrosion protection was on highly demand during the past decade; and thermal spray coating played a major part during that time. In recent years, the thermal arc spray coating becomes a popular coating. Many big players in oil and gas such as PETRONAS, EXXON MOBIL and SHELL in Malaysia tend to use the coating on steel structure as a corrosion protection. Further developments in coating processes, the devices, and raw materials have led to expansion of functional coatings and applications scope from conventional coating to specialized industries. It is widely used because of its ability to withstand high process temperature, offer advantages in efficiency, lower cost and acts as a corrosion protection. Previous research also indicated that the thermal arc spray offers better coating properties compared to other methods of spray. This paper reviews some critical area of thermal spray coating by discussing the process/parameter of thermal arc spray technology and quality control of coating. Coating performance against corrosion, wear and special characteristic of coating are also described. The field application of arc spray technology are demonstrated and reviewed.

  3. ALICE: ARC integration

    CERN Document Server

    Anderlik, C; Kleist, J; Peters, A; Saiz, P

    2008-01-01

    AliEn or Alice Environment is the Grid middleware developed and used within the ALICE collaboration for storing and processing data in a distributed manner. ARC (Advanced Resource Connector) is the Grid middleware deployed across the Nordic countries and gluing together the resources within the Nordic Data Grid Facility (NDGF). In this paper we will present our approach to integrate AliEn and ARC, in the sense that ALICE data management and job processing can be carried out on the NDGF infrastructure, using the client tools available in AliEn. The inter-operation has two aspects, one is the data management part and the second the job management aspect. The first aspect was solved by using dCache across NDGF to handle data. Therefore, we will concentrate on the second part. Solving it, was somewhat cumbersome, mainly due to the different computing models employed by AliEn and ARC. AliEN uses an Agent based pull model while ARC handles jobs through the more 'traditional' push model. The solution comes as a modu...

  4. ALICE-ARC integration

    DEFF Research Database (Denmark)

    Anderlik, Csaba; Gregersen, Anders Rhod; Kleist, Josva;

    2008-01-01

    Data Grid Facility (NDGF). In this paper we will present our approach to integrate AliEn and ARC, in the sense that ALICE data management and job processing can be carried out on the NDGF infrastructure, using the client tools available in AliEn. The interoperation has two aspects, one is the data...

  5. Gas tungsten arc welder

    Science.gov (United States)

    Christiansen, D.W.; Brown, W.F.

    A welder for automated closure of fuel pins by a gas tungsten arc process in which a rotating length of cladding is positioned adjacent a welding electrode in a sealed enclosure. An independently movable axial grinder is provided in the enclosure for refurbishing the used electrode between welds.

  6. Motion of polar cap arcs

    Science.gov (United States)

    Hosokawa, K.; Moen, J. I.; Shiokawa, K.; Otsuka, Y.

    2011-01-01

    A statistics of motion of polar cap arcs is conducted by using 5 years of optical data from an all-sky imager at Resolute Bay, Canada (74.73°N, 265.07°E). We identified 743 arcs by using an automated arc detection algorithm and statistically examined their moving velocities as estimated by the method of Hosokawa et al. (2006). The number of the arcs studied is about 5 times larger than that in the previous statistics of polar cap arcs by Valladares et al. (1994); thus, we could expect to obtain more statistically significant results. Polar cap arcs are found to fall into two distinct categories: the By-dependent and By-independent arcs. The motion of the former arcs follows the rule reported by Valladares et al. (1994), who showed that stable polar cap arcs move in the direction of the interplanetary magnetic field (IMF) By. About two thirds of the arcs during northward IMF conditions belong to this category. The latter arcs always move poleward irrespective of the sign of the IMF By, which possibly correspond to the poleward moving arcs in the morning side reported by Shiokawa et al. (1997). At least one third of the arcs belong to this category. The By-dependent arcs tend to move faster when the magnitude of the IMF By is larger, suggesting that the transport of open flux by lobe reconnection from one polar cap compartment to the other controls their motion. In contrast, the speed of the By-independent arcs does not correlate with the magnitude of the By. The motions of both the By-dependent and By-independent arcs are most probably caused by the magnetospheric convection. Convection in the region of By-dependent arcs is affected by the IMF By, which indicates that their sources may be on open field lines or in the closed magnetosphere adjacent to the open-closed boundary, whereas By-independent arcs seem to be well on closed field lines. Hence, the magnetospheric source of the two types of arc may be different. This implies that the mechanisms causing the

  7. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  8. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  9. Modeling rf breakdown arcs

    CERN Document Server

    Insepov, Zeke; Huang, Dazhang; Mahalingam, Sudhakar; Veitzer, Seth

    2010-01-01

    We describe breakdown in 805 MHz rf accelerator cavities in terms of a number of mechanisms. We devide the breakdown process into three stages: (1) we model surface failure using molecular dynamics of fracture caused by electrostatic tensile stress, (2) we model the ionization of neutrals responsible for plasma initiation and plasma growth using a particle in cell code, and (3) we model surface damage by assuming a process similar to unipolar arcing. Although unipolar arcs are strictly defined with equipotential boundaries, we find that the cold, dense plasma in contact with the surface produces very small Debye lengths and very high electric fields over a large area. These high fields produce strong erosion mechanisms, primarily self sputtering, compatible with the crater formation that we see. Results from the plasma simulation are included as a guide to experimental verification of this model.

  10. ALICE - ARC integration

    DEFF Research Database (Denmark)

    Anderlik, Csaba; Gregersen, Anders Rhod; Kleist, Josva;

    AliEn or Alice Environment is the Gridware developed and used within the ALICE collaboration for storing and processing data in a distributed manner. ARC (Advanced Resource Connector) is the Grid middleware deployed across the Nordic countries and gluing together the resources within the Nordic...... Data Grid Facility (NDGF). In this paper we will present our approach to integrate AliEn and ARC, in the sense that ALICE data management and job processing can be carried out on the NDGF infrastructure, using the client tools available in AliEn. The interoperation has two aspects, one is the data...... management part and the second the job management aspect. The first aspect was solved by using dCache across NDGF to handle data. dCache provides support for several data management tools (among them for xrootd the tools used by AliEn) using the so called "doors". Therefore, we will concentrate on the second...

  11. The ARCS radial collimator

    OpenAIRE

    Stone M.B.; Niedziela J.L.; Overbay M.A.; Abernathy D.L.

    2015-01-01

    We have designed, installed, and commissioned a scattered beam radial collimator for use at the ARCS Wide Angular Range Chopper Spectrometer at the Spallation Neutron Source. The collimator has been designed to work effectively for thermal and epithermal neutrons and with a range of sample environments. Other design considerations include the accommodation of working within a high vacuum environment and having the ability to quickly install and remove the collimator from the scattered beam. W...

  12. Circular arc structures

    KAUST Repository

    Bo, Pengbo

    2011-07-01

    The most important guiding principle in computational methods for freeform architecture is the balance between cost efficiency on the one hand, and adherence to the design intent on the other. Key issues are the simplicity of supporting and connecting elements as well as repetition of costly parts. This paper proposes so-called circular arc structures as a means to faithfully realize freeform designs without giving up smooth appearance. In contrast to non-smooth meshes with straight edges where geometric complexity is concentrated in the nodes, we stay with smooth surfaces and rather distribute complexity in a uniform way by allowing edges in the shape of circular arcs. We are able to achieve the simplest possible shape of nodes without interfering with known panel optimization algorithms. We study remarkable special cases of circular arc structures which possess simple supporting elements or repetitive edges, we present the first global approximation method for principal patches, and we show an extension to volumetric structures for truly threedimensional designs. © 2011 ACM.

  13. Arc-preserving subsequences of arc-annotated sequences

    CERN Document Server

    Popov, Vladimir Yu

    2011-01-01

    Arc-annotated sequences are useful in representing the structural information of RNA and protein sequences. The longest arc-preserving common subsequence problem has been introduced as a framework for studying the similarity of arc-annotated sequences. In this paper, we consider arc-annotated sequences with various arc structures. We consider the longest arc preserving common subsequence problem. In particular, we show that the decision version of the 1-{\\sc fragment LAPCS(crossing,chain)} and the decision version of the 0-{\\sc diagonal LAPCS(crossing,chain)} are {\\bf NP}-complete for some fixed alphabet $\\Sigma$ such that $|\\Sigma| = 2$. Also we show that if $|\\Sigma| = 1$, then the decision version of the 1-{\\sc fragment LAPCS(unlimited, plain)} and the decision version of the 0-{\\sc diagonal LAPCS(unlimited, plain)} are {\\bf NP}-complete.

  14. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  15. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  16. Hybrid laser-arc welding

    DEFF Research Database (Denmark)

    Hybrid laser-arc welding (HLAW) is a combination of laser welding with arc welding that overcomes many of the shortfalls of both processes. This important book gives a comprehensive account of hybrid laser-arc welding technology and applications. The first part of the book reviews...... the characteristics of the process, including the properties of joints produced by hybrid laser-arc welding and ways of assessing weld quality. Part II discusses applications of the process to such metals as magnesium alloys, aluminium and steel as well as the use of hybrid laser-arc welding in such sectors as ship...... building and the automotive industry. With its distinguished editor and international team of contributors, Hybrid laser-arc welding, will be a valuable source of reference for all those using this important welding technology. Professor Flemming Ove Olsen works in the Department of Manufacturing...

  17. Analysis of Physics Processes in the AC Plasma Torch Discharge under High Pressure

    Science.gov (United States)

    Safronov, A. A.; Vasilieva, O. B.; Dudnik, J. D.; E Kuznetsov, V.; Kuchina, J. A.; Shiryaev, V. N.; Pavlov, A. V.

    2017-04-01

    The paper is devoted to investigation of electrophysical processes in the electric discharge generated by a three-phase AC plasma torch when using a high pressure inert working gas. AC plasma torch design with end electrodes intended for work on inert gases at pressures up to 81 bar is studied. Current-voltage characteristics for different gas flow rates and pressures are presented. Physical processes characteristics of the arising voltage ripples which depend on various working parameters of the plasma torch have been investigated. Arc burning processes in the electric discharge chamber of the three-phase AC plasma torch at various working parameters were photographed.

  18. Correlation methods in cutting arcs

    Energy Technology Data Exchange (ETDEWEB)

    Prevosto, L; Kelly, H, E-mail: prevosto@waycom.com.ar [Grupo de Descargas Electricas, Departamento Ing. Electromecanica, Universidad Tecnologica Nacional, Regional Venado Tuerto, Laprida 651, Venado Tuerto (2600), Santa Fe (Argentina)

    2011-05-01

    The present work applies similarity theory to the plasma emanating from transferred arc, gas-vortex stabilized plasma cutting torches, to analyze the existing correlation between the arc temperature and the physical parameters of such torches. It has been found that the enthalpy number significantly influence the temperature of the electric arc. The obtained correlation shows an average deviation of 3% from the temperature data points. Such correlation can be used, for instance, to predict changes in the peak value of the arc temperature at the nozzle exit of a geometrically similar cutting torch due to changes in its operation parameters.

  19. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  20. Joan of Arc.

    Science.gov (United States)

    Foote-Smith, E; Bayne, L

    1991-01-01

    For centuries, romantics have praised and historians and scientists debated the mystery of Joan of Arc's exceptional achievements. How could an uneducated farmer's daughter, raised in harsh isolation in a remote village in medieval France, have found the strength and resolution to alter the course of history? Hypotheses have ranged from miraculous intervention to creative psychopathy. We suggest, based on her own words and the contemporary descriptions of observers, that the source of her visions and convictions was in part ecstatic epileptic auras and that she joins the host of creative religious thinkers suspected or known to have epilepsy, from St. Paul and Mohammed to Dostoevsky, who have changed western civilization.

  1. The ARCS radial collimator

    Directory of Open Access Journals (Sweden)

    Stone M.B.

    2015-01-01

    Full Text Available We have designed, installed, and commissioned a scattered beam radial collimator for use at the ARCS Wide Angular Range Chopper Spectrometer at the Spallation Neutron Source. The collimator has been designed to work effectively for thermal and epithermal neutrons and with a range of sample environments. Other design considerations include the accommodation of working within a high vacuum environment and having the ability to quickly install and remove the collimator from the scattered beam. We present here characterization of the collimator's performance and methodologies for its effective use.

  2. The ARCS radial collimator

    Science.gov (United States)

    Stone, M. B.; Niedziela, J. L.; Overbay, M. A.; Abernathy, D. L.

    2015-01-01

    We have designed, installed, and commissioned a scattered beam radial collimator for use at the ARCS Wide Angular Range Chopper Spectrometer at the Spallation Neutron Source. The collimator has been designed to work effectively for thermal and epithermal neutrons and with a range of sample environments. Other design considerations include the accommodation of working within a high vacuum environment and having the ability to quickly install and remove the collimator from the scattered beam. We present here characterization of the collimator's performance and methodologies for its effective use.

  3. Alternating-Polarity Arc Welding

    Science.gov (United States)

    Schwinghamer, R. J.

    1987-01-01

    Brief reversing polarity of welding current greatly improves quality of welds. NASA technical memorandum recounts progress in art of variable-polarity plasma-arc (VPPA) welding, with emphasis on welding of aluminum-alloy tanks. VPPA welders offer important advantages over conventional single-polarity gas/tungsten arc welders.

  4. Characteristics of Arcs Between Porous Carbon Electrodes

    OpenAIRE

    Carvou, Erwann; Le Garrec, Jean-Luc; Mitchell, Brian

    2013-01-01

    International audience; Arcs between carbon electrodes present some specific differences compared with metallic arcs. The arc voltage is higher, but does not attain a stable value displaying large fluctuations. Indeed, the arcs are produced by the direct sublimation of the electrodes, without passing through a molten phase. The arc production is also facilitated by both circuit breaking and electric field breakdown. In this paper, arcing has been examined under various conditions (voltage, cu...

  5. AcEST: BP915691 [AcEST

    Lifescience Database Archive (English)

    Full Text Available kyrin repeat domain-containing protein 16 ... 33 0.95 sp|Q7LC44|ARC_HUMAN Activity-regulated cytoskeleton-as...ELLERCHYEPDCRDNCGVTPFMD 220 >sp|Q7LC44|ARC_HUMAN Activity-regulated cytoskeleton-associated protein OS=Homo

  6. Arc Interference Behavior during Twin Wire Gas Metal Arc Welding Process

    Directory of Open Access Journals (Sweden)

    Dingjian Ye

    2013-01-01

    Full Text Available In order to study arc interference behavior during twin wire gas metal arc welding process, the synchronous acquisition system has been established to acquire instantaneous information of arc profile including dynamic arc length variation as well as relative voltage and current signals. The results show that after trailing arc (T-arc is added to the middle arc (M-arc in a stable welding process, the current of M arc remains unchanged while the agitation increases; the voltage of M arc has an obvious increase; the shape of M arc changes, with increasing width, length, and area; the transfer frequency of M arc droplet increases and the droplet itself becomes smaller. The wire extension length of twin arc turns out to be shorter than that of single arc welding.

  7. Epigenetic regulation of Arc and c-Fos in the hippocampus after acute electroconvulsive stimulation in the rat

    DEFF Research Database (Denmark)

    Dyrvig, Mads; Hansen, Henrik H; Christiansen, Søren Hofman Oliveira

    2012-01-01

    Electroconvulsive stimulation (ECS) remains one of the most effective treatments of major depression. However, the underlying molecular changes still remain to be elucidated. Since ECS causes rapid and significant changes in gene expression we have looked at epigenetic regulation of two important...... immediate early genes that are both induced after ECS: c-Fos and Arc. We examined Arc and c-Fos protein expression and found Arc present over 4 h, in contrast to c-Fos presence lasting only 1 h. Both genes had returned to baseline expression at 24 h post-ECS. Histone H4 acetylation (H4Ac) is one...

  8. Controllability of arc jet from arc horns with slits. Slit tsuki arc horn no arc jet seigyo tokusei

    Energy Technology Data Exchange (ETDEWEB)

    Sunabe, K.; Inaba, T.; Fukagawa, H. (Central Research Institute of Electric Power Industry, Tokyo (Japan)); Kito, Y. (Nagoya University, Nagoya (Japan))

    1993-09-20

    To improve the corona discharge characteristics, test preparation was made of hollow rod form horns with slits for the overhead power transmission line use. Two types of horn electrode were prepared. The first horn electrode is of a hollow hemisphere fitted with and divided by slits on its tip. The second horn electrode is the first one which is further fitted with rod form electrode at the center of its tip. In experiment, relation was obtained between the deflection angle of arc jet and arc current, electrode diameter, etc., through an observation of arc jet by high speed camera. Melting loss of electrode was also made clear. The following knowledge was obtained: For the first horn electrode, the deflection angle can be limited to a narrow range by a division with slits, e.g., within 30 degrees under the condition of 5kA in arc current, 4 in number of sectors and 200mm in diameter. For the second horn electrode, the deflection angle can be limited to within 20 degrees under the condition of 5kA in arc current and 4 in number of sectors. The arc current is also limited to below 5kA by an addition of 50mm diameter central electrode. As a conclusion for the first electrode, the arc jet control characteristics excels in the stronger arc current range than 5kA, while for the second electrode, they are effective in the weaker arc current range than 5kA. 6 refs., 19 figs., 1 tab.

  9. Convergent evolution of the arginine deiminase pathway: the ArcD and ArcE arginine/ornithine exchangers.

    Science.gov (United States)

    Noens, Elke E E; Lolkema, Juke S

    2017-02-01

    The arginine deiminase (ADI) pathway converts L-arginine into L-ornithine and yields 1 mol of ATP per mol of L-arginine consumed. The L-arginine/L-ornithine exchanger in the pathway takes up L-arginine and excretes L-ornithine from the cytoplasm. Analysis of the genomes of 1281 bacterial species revealed the presence of 124 arc gene clusters encoding the pathway. About half of the clusters contained the gene encoding the well-studied L-arginine/L-ornithine exchanger ArcD, while the other half contained a gene, termed here arcE, encoding a membrane protein that is not a homolog of ArcD. The arcE gene product of Streptococcus pneumoniae was shown to take up L-arginine and L-ornithine with affinities of 0.6 and 1 μmol/L, respectively, and to catalyze metabolic energy-independent, electroneutral exchange. ArcE of S. pneumoniae could replace ArcD in the ADI pathway of Lactococcus lactis and provided the cells with a growth advantage. In contrast to ArcD, ArcE catalyzed translocation of the pathway intermediate L-citrulline with high efficiency. A short version of the ADI pathway is proposed for L-citrulline catabolism and the presence of the evolutionary unrelated arcD and arcE genes in different organisms is discussed in the context of the evolution of the ADI pathway.

  10. Arc spot grouping: An entanglement of arc spot cells

    Energy Technology Data Exchange (ETDEWEB)

    Kajita, Shin, E-mail: kajita.shin@nagoya-u.jp [EcoTopia Science Institute, Nagoya University, Nagoya 464-8603 (Japan); Hwangbo, Dogyun; Ohno, Noriyasu [Graduate School of Engineering, Nagoya University, Nagoya 464-8603 (Japan); Tsventoukh, Mikhail M. [Lebedev Physical Institute, Russian Academy of Sciences, Moscow 119991 (Russian Federation); Barengolts, Sergey A. [Prokhorov General Physics Institute, Russian Academy of Sciences, Moscow 119991 (Russian Federation)

    2014-12-21

    In recent experiments, clear transitions in velocity and trail width of an arc spot initiated on nanostructured tungsten were observed on the boundary of the thick and thin nanostructured layer regions. The velocity of arc spot was significantly decreased on the thick nanostructured region. It was suggested that the grouping decreased the velocity of arc spot. In this study, we try to explain the phenomena using a simple random walk model that has properties of directionality and self-avoidance. And grouping feature was added by installing an attractive force between spot cells with dealing with multi-spots. It was revealed that an entanglement of arc spot cells decreased the spot velocity, and spot cells tend to stamp at the same location many times.

  11. Hybrid laser-arc welding

    DEFF Research Database (Denmark)

    the characteristics of the process, including the properties of joints produced by hybrid laser-arc welding and ways of assessing weld quality. Part II discusses applications of the process to such metals as magnesium alloys, aluminium and steel as well as the use of hybrid laser-arc welding in such sectors as ship...... building and the automotive industry. With its distinguished editor and international team of contributors, Hybrid laser-arc welding, will be a valuable source of reference for all those using this important welding technology. Professor Flemming Ove Olsen works in the Department of Manufacturing...

  12. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  13. AC dipole based optics measurement and correction at RHIC

    CERN Document Server

    Shen, X; Bai, M; White, S; Robert-Domolaize, G; Luo, Y; Marusic, A; Tomas, R

    2013-01-01

    Independent component analysis (ICA) was applied to the AC dipole based optics measurement at RHIC to extract beta functions as well as phase advances at each BPM. Existence of excessive beta-beat was observed in both rings of RHIC at polarized proton store energy. A unique global optics correction scheme was then developed and tested successfully during the RHIC polarized proton run in 2013. The feasibility of using horizontal closed orbit bump at sextupole for arc beta-beat correction was also demonstrated.

  14. STUDY ON THE PRESSURE IN PLASMA ARC

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The axial pressure in plasma arc is measured under different conditions. The effects of the parameters, such as welding current, plasma gas flow rate, electrode setback and arc length, on the pressure in plasma arc are investigated and quantitative analyzed to explain the relationship between the quality of weld and the matching of parameters in plasma arc welding process.

  15. Arc of opportunity.

    Science.gov (United States)

    Delaney, Adam Vai

    2011-07-01

    Born in Port Moresby, Papua New Guinea, the author had a 20 year career in diplomacy, political affairs, and development policy analysis at the Pacific Islands Forum, the United Nations in New York; the Prime Minister's Department in Papua New Guinea (PNG) and in the Foreign Ministry of PNG. He has also been involved in theatre for over a decade in PNG, and participated in a three-month program at the Eugene O'Neill Theatre Center in Connecticut, USA. He is currently the Business Development Manager at the Torres Strait Regional Authority (Commonwealth) on Thursday Island. Since 1975 the Australian government's overseas development policy has supported various sectoral programs in its neighbouring countries, in particular Papua New Guinea and the Solomon Islands. The "creative" field has not been prominent in this strategy. While natural resources and the sports sectors have gained much greater attention, in terms of being viable international commercial enterprises, the arts, have remained stagnant. In this paper the need for joint programs genuinely supporting "wellbeing" and promoting social enterprise throughout the "arc of opportunity" is described to harness Melanesian creativity to compete successfully in world-markets, starting with penetration of the largest economy at its door-step: Australia.

  16. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  17. Magnetic and electric properties of C-Co thin films prepared by vaccum arc technique

    Energy Technology Data Exchange (ETDEWEB)

    Tembre, A.; Clin, M.; Picot, J.-C. [Laboratoire de Physique de la Matiere Condensee, Universite de Picardie Jules Verne, 33 rue Saint Leu, 80039 Amiens (France); Dellis, J.-L., E-mail: jean-luc.dellis@u-picardie.fr [Laboratoire de Physique de la Matiere Condensee, Universite de Picardie Jules Verne, 33 rue Saint Leu, 80039 Amiens (France); Henocque, J. [Laboratoire de Physique de la Matiere Condensee, Universite de Picardie Jules Verne, 33 rue Saint Leu, 80039 Amiens (France); Bouzerar, R. [Laboratoire de Physique des Systemes Complexes, Universite de Picardie Jules Verne, 33 rue Saint leu, 80039 Amiens (France); Djellab, K. [Plate-forme de Microscopie Electronique, Universite de Picardie Jules Verne, 33 rue Saint Leu, 80039 Amiens (France)

    2011-09-15

    Highlights: > Cobalt doped carbon thin films have been deposited by pulsed anodic electric arc technique. > The films are composed of well-crystallized cobalt layers and complex graphitic microstructure. > An insulating to a metallic state transition at 60 K is observed. > The magnetic susceptibility measurements show anomalous behaviour around 60 K. - Abstract: Cobalt doped carbon thin films have been deposited by a pulsed anodic electric arc technique. The films were characterized by high resolution transmission electron microscopy, electric measurements under dc magnetic fields, and ac magnetic susceptibility measurements within a temperature range 15-300 K. An insulating to a metallic state transition at a critical temperature around 60 K was observed.

  18. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  19. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  20. High pressure neon arc lamp

    Science.gov (United States)

    Sze, Robert C.; Bigio, Irving J.

    2003-07-15

    A high pressure neon arc lamp and method of using the same for photodynamic therapies is provided. The high pressure neon arc lamp includes a housing that encloses a quantity of neon gas pressurized to about 500 Torr to about 22,000 Torr. At each end of the housing the lamp is connected by electrodes and wires to a pulse generator. The pulse generator generates an initial pulse voltage to breakdown the impedance of the neon gas. Then the pulse generator delivers a current through the neon gas to create an electrical arc that emits light having wavelengths from about 620 nanometers to about 645 nanometers. A method for activating a photosensitizer is provided. Initially, a photosensitizer is administered to a patient and allowed time to be absorbed into target cells. Then the high pressure neon arc lamp is used to illuminate the target cells with red light having wavelengths from about 620 nanometers to about 645 nanometers. The red light activates the photosensitizers to start a chain reaction that may involve oxygen free radicals to destroy the target cells. In this manner, a high pressure neon arc lamp that is inexpensive and efficiently generates red light useful in photodynamic therapy is provided.

  1. Applying Soft Arc Consistency to Distributed Constraint Optimization Problems

    Science.gov (United States)

    Matsui, Toshihiro; Silaghi, Marius C.; Hirayama, Katsutoshi; Yokoo, Makot; Matsuo, Hiroshi

    The Distributed Constraint Optimization Problem (DCOP) is a fundamental framework of multi-agent systems. With DCOPs a multi-agent system is represented as a set of variables and a set of constraints/cost functions. Distributed task scheduling and distributed resource allocation can be formalized as DCOPs. In this paper, we propose an efficient method that applies directed soft arc consistency to a DCOP. In particular, we focus on DCOP solvers that employ pseudo-trees. A pseudo-tree is a graph structure for a constraint network that represents a partial ordering of variables. Some pseudo-tree-based search algorithms perform optimistic searches using explicit/implicit backtracking in parallel. However, for cost functions taking a wide range of cost values, such exact algorithms require many search iterations. Therefore additional improvements are necessary to reduce the number of search iterations. A previous study used a dynamic programming-based preprocessing technique that estimates the lower bound values of costs. However, there are opportunities for further improvements of efficiency. In addition, modifications of the search algorithm are necessary to use the estimated lower bounds. The proposed method applies soft arc consistency (soft AC) enforcement to DCOP. In the proposed method, directed soft AC is performed based on a pseudo-tree in a bottom up manner. Using the directed soft AC, the global lower bound value of cost functions is passed up to the root node of the pseudo-tree. It also totally reduces values of binary cost functions. As a result, the original problem is converted to an equivalent problem. The equivalent problem is efficiently solved using common search algorithms. Therefore, no major modifications are necessary in search algorithms. The performance of the proposed method is evaluated by experimentation. The results show that it is more efficient than previous methods.

  2. Arcing phenomena in fusion devices workshop

    Energy Technology Data Exchange (ETDEWEB)

    Clausing, R.E.

    1979-01-01

    The workshop on arcing phenomena in fusion devices was organized (1) to review the pesent status of our understanding of arcing as it relates to confinement devices, (2) to determine what informaion is needed to suppress arcing and (3) to define both laboratory and in-situ experiments which can ultimately lead to reduction of impurities in the plasma caused by arcing. The workshop was attended by experts in the area of vacuum arc electrode phenomena and ion source technology, materials scientists, and both theoreticians and experimentalists engaged in assessing the importance of unipolar arcing in today's tokamaks. Abstracts for papers presented at the workshop are included.

  3. Preparation and investigation of diamond-like carbon stripper foils by filtered cathodic vacuum arc

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Qiwen, E-mail: fanqiwen0926@163.com [Department of Nuclear Physics, China Institute of Atomic Energy, P.O. Box 275(62), Beijing 102413 (China); Du, Yinghui; Zhang, Rong; Xu, Guoji [Department of Nuclear Physics, China Institute of Atomic Energy, P.O. Box 275(62), Beijing 102413 (China)

    2013-04-21

    Thin diamond-like carbon (DLC) stripper foils ∼5μg/cm{sup 2} in thickness were produced and evaluated as heavy-ion strippers for the Beijing HI-13 Tandem Accelerator. The DLC layers ∼4μg/cm{sup 2} in thickness were produced by the filtered cathodic vacuum arc technology onto glass slides coated with betaine–saccharose as releasing agent, which were previously covered with evaporated carbon layers ∼1μg/cm{sup 2} in thickness by the controlled ac arc-discharge method. Irradiation lifetimes of the DLC stripper foils were tested using the heavy-ion beams at the terminal of the Beijing HI-13 Tandem Accelerator, and compared with those of the standard carbon stripper foils made by the combined dc and ac arc-discharge method. The measurements indicate that the DLC stripper foils outlast the standard combined dc and ac arc-discharge carbon stripper foils by a factor of at least 13 and 4 for the {sup 197}Au{sup −} (∼9MeV, ∼1μA) and {sup 63}Cu{sup −} (∼9MeV, ∼1μA) ion beams, respectively. The structure and properties of the DLC foils deposited onto silicon substrates by the filtered cathodic vacuum arc technology were also evaluated and analyzed by scanning electron microscopy, Raman spectroscopy and X-ray photoelectron spectroscopy. The scanning electron microscopy images show that the DLC foils contain hardly droplets through the double 90° filters. The X-ray photoelectron spectrum indicates that sp{sup 3} bonds of the DLC foils exceed 70%. The integral intensity ratio of the D peak to the G peak (I{sub D}/I{sub G}) measured by the Raman spectroscopy is 0.78.

  4. Another Explanation for Neptune's Ring Arcs

    Science.gov (United States)

    Namouni, F.; Porco, C.

    2001-11-01

    Recent HST and Earth-based observations (Dumas et al 1999, Nature 400, 733; Sicardy et al 1999, Nature 400, 731) indicate that Neptune's ring arcs are not located at the corotation resonance with Galatea thought to be responsible for the azimuthal confinement of the arc system (Porco, 1991 Science 253, 995). Although small (5x 10-3od-1), the new observed mean motion offset puts the arcs near the resonance separatrix where the particles' semimajor axes would experience chaotic motion leading to the azimuthal spreading of the arcs within months, thereby calling into question their very existence. We have found a new resonant structure, dependent on the arcs having a small fraction of the mass of Galatea, in which Galatea's 43:42 eccentric corotation resonance, located (in the massless case) ~ 3 km inside the arcs' orbit, is made coincident with the arcs' semimajor axis. The arcs are primarily confined by this resonance, which is stronger ( e Galatea) than the inclined corotation resonance ( I2 Galatea) invoked in the Porco model. Moreover, the coupling of all the resonances in the arcs' neighborhood (eccentric corotation, inclined corotation and Lindblad resonances) modifies the interaction potential, creating smaller structures at the arcs' location. Consequently, this new confinement mechanism can simultaneously explain the arcs' confinement, the general spacing of the arcs, the Fraternité arc length of ~ 10o, and smaller-scale features seen in the arc system. Finally, the possibility of non-massless arcs supports an earlier suggestion by Porco et al (1991, in Neptune and Triton, the University of Arizona Series) that the rapid expected radial migration of the arc system, due to Galatea's secular torques, can be slowed down if the arcs have substantial mass.

  5. Study of mechanism of activating flux increasing weld penetration of AC A-TIG welding for aluminum alloy

    Institute of Scientific and Technical Information of China (English)

    HUANG Yong; FAN Ding; FAN Qinghua

    2007-01-01

    When multi-component flux AF305 is used as surface activating flux for an aluminum alloy, the weld penetration of activating flux-tungsten inert-gas (A-TIG)welding is over two times more than that of conventional TIG welding. Using A-TIG welding with the modes of alternating current (AC), direct current electrode negative (DCEN) and direct current electrode positive (DCEP), respectively, the flux differently affects weld penetration when the polarity is different. After studied the effect of compelled arc constriction on weld penetration of AC welding, it is believed that the constriction of the whole arc root is not the main mechanism that flux AF305 dramatically improves weld penetration. The penetration has a relationship with the separate distribution of slag on the weld surface. Then, an observation of scanning electron microscopy (SEM) and an electronic data systems (EDS) analysis of slag were performed respectively. The separate distribution of slag on the weld pool during welding and the great constriction of arc spots were confirmed by TIG welding with helium shielding gas. The relationship between slag distribution and weld penetration was studied by adding aluminum powder into flux AF305 to change the distribution of slag. During welding, the separate distribution of slag on the weld pool results in the great constriction of arc spots, an increase in arc spot force, and an increase in Lorentz force within the arc and weld pool. Finally, the weld penetration is increased.

  6. Voltage Flicker Mitigation in Electric Arc Furnace using D-STATCOM

    Directory of Open Access Journals (Sweden)

    Deepthisree Madathil

    2014-10-01

    Full Text Available The major power quality issue of voltage flicker has resulted as a serious concern for the customers and heavy power companies. Voltage flicker is an impression of unsteadiness of visual sensation induced by a light source whose luminance fluctuates with time. This phenomenon is experienced when an Electric Arc Furnace (EAF as load is connected to the power system. Flexible AC transmission devices (FACTS devices were gradually utilized for voltage flicker reduction. In this paper the FACTS device of Distribution Static Synchronous Compensator (D-STATCOM is used to serve the purpose of mitigating voltage flickering caused by electric arc furnace load, which is efficiently controlled by Icosɸ control algorithm. The model of electric arc furnace is considered as a current source controlled by a non linear resistance, which had been simulated and performance was analyzed using MATLAB/SIMULINK Software.

  7. Gas Tungsten Arc Welding and Plasma Arc Cutting. Teacher Edition.

    Science.gov (United States)

    Fortney, Clarence; And Others

    This welding curriculum guide treats two topics in detail: the care of tungsten electrodes and the entire concept of contamination control and the hafnium electrode and its importance in dual-air cutting systems that use compressed shop air for plasma arc cutting activities. The guide contains three units of instruction that cover the following…

  8. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  9. AcEST: DK956383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TAC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF S...AC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF Sb

  10. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  11. Rotating Drive for Electrical-Arc Machining

    Science.gov (United States)

    Fransen, C. D.

    1986-01-01

    Rotating drive improves quality of holes made by electrical-arc machining. Mechanism (Uni-tek, rotary head, or equivalent) attached to electrical-arc system. Drive rotates electrode as though it were mechanical drill, while an arc disintegrates metal in workpiece, thereby creating hole. Rotating electrode method often used in electric-discharge machining. NASA innovation is application of technique to electrical-arc machining.

  12. Vacuum Gas Tungsten Arc Welding

    Science.gov (United States)

    Weeks, J. L.; Todd, D. T.; Wooten, J. R.

    1997-01-01

    A two-year program investigated vacuum gas tungsten arc welding (VGTAW) as a method to modify or improve the weldability of normally difficult-to-weld materials. After a vacuum chamber and GTAW power supply were modified, several difficult-to-weld materials were studied and key parameters developed. Finally, Incoloy 903 weld overlays were produced without microfissures.

  13. Hooded arc ion-source

    CERN Multimedia

    1972-01-01

    The positioning system for the hooded arc ion-source, shown prior to mounting, consists of four excentric shafts to locate the ion-source and central electrodes. It will be placed on the axis of the SC and introduced into the vacuum tank via the air locks visible in the foreground.

  14. Warm storage for arc magmas.

    Science.gov (United States)

    Barboni, Mélanie; Boehnke, Patrick; Schmitt, Axel K; Harrison, T Mark; Shane, Phil; Bouvier, Anne-Sophie; Baumgartner, Lukas

    2016-12-06

    Felsic magmatic systems represent the vast majority of volcanic activity that poses a threat to human life. The tempo and magnitude of these eruptions depends on the physical conditions under which magmas are retained within the crust. Recently the case has been made that volcanic reservoirs are rarely molten and only capable of eruption for durations as brief as 1,000 years following magma recharge. If the "cold storage" model is generally applicable, then geophysical detection of melt beneath volcanoes is likely a sign of imminent eruption. However, some arc volcanic centers have been active for tens of thousands of years and show evidence for the continual presence of melt. To address this seeming paradox, zircon geochronology and geochemistry from both the frozen lava and the cogenetic enclaves they host from the Soufrière Volcanic Center (SVC), a long-lived volcanic complex in the Lesser Antilles arc, were integrated to track the preeruptive thermal and chemical history of the magma reservoir. Our results show that the SVC reservoir was likely eruptible for periods of several tens of thousands of years or more with punctuated eruptions during these periods. These conclusions are consistent with results from other arc volcanic reservoirs and suggest that arc magmas are generally stored warm. Thus, the presence of intracrustal melt alone is insufficient as an indicator of imminent eruption, but instead represents the normal state of magma storage underneath dormant volcanoes.

  15. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  16. STRUVE arc and EUPOS® stations

    Science.gov (United States)

    Lasmane, Ieva; Kaminskis, Janis; Balodis, Janis; Haritonova, Diana

    2013-04-01

    The Struve Geodetic Arc was developed in Years 1816 to 1855, 200 years ago. Historic information on the points of the Struve Geodetic Arc are included in the UNESCO World Heritage list in 2005. Nevertheless, the sites of many points are still not identified nor included in the data bases nowadays. Originally STRUVE arc consisted of 258 main triangles with 265 triangulation points. Currently 34 of the original station points are identified and included in the in the UNESCO World Heritage list. identified original measurement points of the Meridian Arc are located in Sweden (7 points), Norway (15), Finland (83), Russia (1), Estonia (22), Latvia (16), Lithuania (18), Belorussia (28), Ukraine (59) and Moldova (27). In Year 2002 was initiated another large coverage project - European Position Determination System "EUPOS®". Currently there are about 400 continuously operating GNSS (Global Navigation Satellite Systems) stations covering EU countries Estonia, Latvia, Lithuania, Poland, Czech Republic, Slovakia, Hungary, Bulgaria, Romania and East European countries Ukraine and Moldavia. EUPOS® network is a ground based GNSS augmentation system widely used for geodesy, land surveying, geophysics and navigation. It gives the opportunity for fast and accurate position determination never available before. It is an honorable task to use the EUPOS® system for research of the Struve triangulation former sites. Projects with Struve arc can popularize geodesy, geo-information and its meaning in nowadays GIS and GNSS systems. Struve Arc and its points is unique cooperation cross-border object which deserve special attention because of their natural beauty and historical value for mankind. GNSS in geodesy discovers a powerful tool for the verification and validation of the height values of geodetic leveling benchmarks established historically almost 200 years ago. The differential GNSS and RTK methods appear very useful to identify vertical displacement of landscape by means of

  17. The structure and singularities of arc complexes

    DEFF Research Database (Denmark)

    Penner, Robert

    boundary components. The main result of this paper is the determination of those arc complexes Arc(F) that are also spherical. This classification has consequences for Riemann's moduli space via its known identification with an analogous arc complex in the punctured case with no boundary. Namely...

  18. Laboratory experiments on arc deflection and instability

    Energy Technology Data Exchange (ETDEWEB)

    Zweben, S.; Karasik, M.

    2000-03-21

    This article describes experiments on arc deflection instability carried out during the past few years at the Princeton University Plasma Physics Laboratory (PPPL). The approach has been that of plasma physicists interested in arcs, but they believe these results may be useful to engineers who are responsible for controlling arc behavior in large electric steel furnaces.

  19. Making Conductive Polymers By Arc Tracking

    Science.gov (United States)

    Daech, Alfred F.

    1992-01-01

    Experimental technique for fabrication of electrically conductive polymeric filaments based on arc tracking, in which electrical arc creates conductive carbon track in material that initially was insulator. Electrically conductive polymeric structures made by arc tracking aligned along wire on which formed. Alignment particularly suited to high conductivity and desirable in materials intended for testing as candidate superconductors.

  20. Magnification Bias in Gravitational Arc Statistics

    Energy Technology Data Exchange (ETDEWEB)

    Caminha, G. B. [Rio de Janeiro, CBPF; Estrada, J. [Fermilab; Makler, M. [Rio de Janeiro, CBPF

    2013-08-29

    The statistics of gravitational arcs in galaxy clusters is a powerful probe of cluster structure and may provide complementary cosmological constraints. Despite recent progresses, discrepancies still remain among modelling and observations of arc abundance, specially regarding the redshift distribution of strong lensing clusters. Besides, fast "semi-analytic" methods still have to incorporate the success obtained with simulations. In this paper we discuss the contribution of the magnification in gravitational arc statistics. Although lensing conserves surface brightness, the magnification increases the signal-to-noise ratio of the arcs, enhancing their detectability. We present an approach to include this and other observational effects in semi-analytic calculations for arc statistics. The cross section for arc formation ({\\sigma}) is computed through a semi-analytic method based on the ratio of the eigenvalues of the magnification tensor. Using this approach we obtained the scaling of {\\sigma} with respect to the magnification, and other parameters, allowing for a fast computation of the cross section. We apply this method to evaluate the expected number of arcs per cluster using an elliptical Navarro--Frenk--White matter distribution. Our results show that the magnification has a strong effect on the arc abundance, enhancing the fraction of arcs, moving the peak of the arc fraction to higher redshifts, and softening its decrease at high redshifts. We argue that the effect of magnification should be included in arc statistics modelling and that it could help to reconcile arcs statistics predictions with the observational data.

  1. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  2. Thermal analysis of an arc heater electrode with a rotating arc foot

    Science.gov (United States)

    Milos, Frank S.; Shepard, Charles E.

    1993-01-01

    A smoothly rotating arc foot and an arc foot that jumps between multiple sticking points were analyzed using analytic formulations and numerical solution procedures. For each case the temperature distribution for a copper electrode was obtained for the plausible range of operating conditions. It is shown that the smoothly rotating arc foot is an extremely safe mode of operation, whereas the jumping arc foot produces excessively high electrode surface temperatures which are not greatly alleviated by increasing the average rotational frequency of the arc foot. It is suggested to eliminate arc-foot rotation and rely on the distribution of fixed electrodes with stationary arc attachment to avoid electrode failure at high current.

  3. Total AC loss of YBCO coated conductor carrying AC transport current in AC transverse magnetic field with various orientations

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, Naoyuki [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Jiang, Zhenan [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Iijima, Yasuhiro [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Kakimoto, Kazuomi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Saitoh, Takashi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan)

    2004-08-01

    Using an electro-magnetic method, we measured the total AC loss of a YBCO coated conductor carrying an AC transport current in an AC transverse magnetic field with various orientations. We measured the magnetization loss (energy flow from the external magnetic field) and the transport loss (energy flow from the transport current circuit) independently during simultaneous application of an AC transverse magnetic field and AC transport current. Their sum gave us the total AC loss. The transport loss increases with increasing AC transverse magnetic field, and the magnetization loss increases with increasing AC transport current. The AC transverse magnetic field and the AC self magnetic field interact with each other at the conductor edges. This nonlinear interaction is a possible cause of the increase in AC loss. Due to the high aspect ratio of YBCO coated conductors, this increase in AC loss due to the interaction between the AC transverse and AC self magnetic fields is observed even when the transverse magnetic field is nearly parallel to the conductor wide-face. When the total AC losses for various transport currents and various field orientations are plotted against a transverse magnetic field component which is perpendicular to the conductor wide-face, the plots with different field angles but identical transport current all agree quite well with each other. The total AC loss is dominated by the self magnetic field and the perpendicular component of the transverse magnetic field, both of which mostly penetrate from the conductor edges.

  4. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    DR OKE

    Present MGs incorporate AC and DC sources and loads along with storage and power ... Keywords: Microgrid (MG), Distributed Energy Resources (DER), Particle ... But in case of renewable based MGs, where small and intermittent sources ...

  5. Analysis of the ArcA regulon in anaerobically grown Salmonella enterica sv. Typhimurium

    Directory of Open Access Journals (Sweden)

    Porwollik Steffen

    2011-03-01

    Full Text Available Abstract Background Salmonella enterica serovar Typhimurium (S. Typhimurium is a Gram-negative pathogen that must successfully adapt to the broad fluctuations in the concentration of dissolved dioxygen encountered in the host. In Escherichia coli, ArcA (Aerobic Respiratory Control helps the cells to sense and respond to the presence of dioxygen. The global role of ArcA in E. coli is well characterized; however, little is known about its role in anaerobically grown S. Typhimurium. Results We compared the transcriptional profiles of the virulent wild-type (WT strain (ATCC 14028s and its isogenic arcA mutant grown under anaerobic conditions. We found that ArcA directly or indirectly regulates 392 genes (8.5% of the genome; of these, 138 genes are poorly characterized. Regulation by ArcA in S. Typhimurium is similar, but distinct from that in E. coli. Thus, genes/operons involved in core metabolic pathways (e.g., succinyl-CoA, fatty acid degradation, cytochrome oxidase complexes, flagellar biosynthesis, motility, and chemotaxis were regulated similarly in the two organisms. However, genes/operons present in both organisms, but regulated differently by ArcA in S. Typhimurium included those coding for ethanolamine utilization, lactate transport and metabolism, and succinate dehydrogenases. Salmonella-specific genes/operons regulated by ArcA included those required for propanediol utilization, flagellar genes (mcpAC, cheV, Gifsy-1 prophage genes, and three SPI-3 genes (mgtBC, slsA, STM3784. In agreement with our microarray data, the arcA mutant was non-motile, lacked flagella, and was as virulent in mice as the WT. Additionally, we identified a set of 120 genes whose regulation was shared with the anaerobic redox regulator, Fnr. Conclusion(s We have identified the ArcA regulon in anaerobically grown S. Typhimurium. Our results demonstrated that in S. Typhimurium, ArcA serves as a transcriptional regulator coordinating cellular metabolism, flagella

  6. Tectonomagmatism in continental arcs: evidence from the Sark arc complex

    Science.gov (United States)

    Gibbons, Wes; Moreno, Teresa

    2002-07-01

    The island of Sark (Channel Islands, UK) exposes syntectonic plutons and country rock gneisses within a Precambrian (Cadomian) continental arc. This Sark arc complex records sequential pulses of magmatism over a period of 7 Ma (ca. 616-609 Ma). The earliest intrusion (ca. 616 Ma) was a composite sill that shows an ultramafic base overlain by a magma-mingled net vein complex subsequently deformed at near-solidus temperatures into the amphibolitic and tonalitic Tintageu banded gneisses. The deformation was synchronous with D 2 deformation of the paragneissic envelope, with both intrusion and country rock showing flat, top-to-the-south LS fabrics. Later plutonism injected three homogeneous quartz diorite-granodiorite sheets: the Creux-Moulin pluton (150-250 m; ca. 614 Ma), the Little Sark pluton (>700 m; 611 Ma), and the Northern pluton (>500 m; 609 Ma). Similar but thinner sheets in the south (Derrible-Hogsback-Dixcart) and west (Port es Saies-Brecqhou) are interpreted as offshoots from the Creux-Moulin pluton and Little Sark pluton, respectively. All these plutons show the same LS fabric seen in the older gneisses, with rare magmatic fabrics and common solid state fabrics recording syntectonic crystallisation and cooling. The cooling rate increased rapidly with decreasing crystallisation age: >9 Ma for the oldest intrusion to cool to lower amphibolite conditions, 7-8 Ma for the Creux Moulin pluton, 5-6 Ma for the Little Sark pluton, and 10 -14 s -1) that focussed extensional deformation into the Sark area. The increased rates of extension allowed ingress of the subsequent quartz diorite-granodiorite sheets, although strain rate slowly declined as the whole complex cooled during exhumation. The regional architecture of syntectonic Cadomian arc complexes includes flat-lying "Sark-type" and steep "Guernsey-type" domains produced synchronously in shear zone networks induced by oblique subduction: a pattern seen in other continental arcs such as that running from Alaska

  7. A Contribution to Arc Length Discussion

    Directory of Open Access Journals (Sweden)

    Stephan Egerland

    2015-09-01

    Full Text Available Abstract An investigation was raising the question: "What does 'arc length' mean?" Actually, it is considered expressing a kind of natural relationship between arc voltage and arc column shape. Statements such as "The higher the voltage the longer the arc" or "The arc voltage proves approximately proportional to the arc length", are frequently noticed in this conjunction. However, the author suggests that there is no general possibility of describing 'arc length' over the whole welding process range. Instances are represented in this paper, showing both theoretical attempts of definition and practical observations. This paper intends to contribute to a serious discussion of something trivial, indeed very well-known or used among welding experts, but actually yet hardly understood, at least as when it comes to closer examination

  8. Zircon Recycling in Arc Intrusions

    Science.gov (United States)

    Miller, J.; Barth, A.; Matzel, J.; Wooden, J.; Burgess, S.

    2008-12-01

    Recycling of zircon has been well established in arc intrusions and arc volcanoes, but a better understanding of where and how zircons are recycled can help illuminate how arc magma systems are constructed. To that end, we are conducting age, trace element (including Ti-in-zircon temperatures; TzrnTi) and isotopic studies of zircons from the Late Cretaceous (95-85 Ma) Tuolumne Intrusive Suite (TIS) in the Sierra Nevada Batholith (CA). Within the TIS zircons inherited from ancient basement sources and/or distinctly older host rocks are uncommon, but recycled zircon antecrysts from earlier periods of TIS-related magmatism are common and conspicuous in the inner and two most voluminous units of the TIS, the Half Dome and Cathedral Peak Granodiorites. All TIS units have low bulk Zr ([Zr]825°C), [Zr] in the TIS is a factor of 2 to 3 lower than saturation values. Low [Zr] in TIS rocks might be attributed to a very limited supply of zircon in the source, by disequilibrium melting and rapid melt extraction [1], by melting reactions involving formation of other phases that can incorporate appreciable Zr [2], or by removal of zircon at an earlier stage of magma evolution. Based on a preliminary compilation of literature data, low [Zr] is common to Late Cretaceous N.A. Cordilleran granodioritic/tonalitic intrusions (typically Tzrnsat [3]. A corollary is that slightly older zircon antecrysts that are common in the inner units of the TIS could be considered inherited if they are derived from remelting of slightly older intrusions. Remelting at such low temperatures in the arc would require a source of external water. Refs: [1] Sawyer, J.Pet 32:701-738; [2] Fraser et al, Geology 25:607-610; [3] Harrison et al, Geology 35:635- 638

  9. History of Neptune's Ring Arcs

    Science.gov (United States)

    Esposito, L. W.; Colwell, J. E.; Canup, R. M.

    1997-07-01

    The recent dynamical calculations for Neptune's Adams ring arcs by Foryta and Sicardy (1996) and Hanninen and Porco (1997) determine the basic evolutionary parameters for this system. The ring evolution is dominated by stochastic events, particularly chaotic motion that causes a migration between the corotation sites (FS96) and collisions near quadrature (HP97). A basic problem is that the high velocity collisions that produce the dusty arcs at the Galatea corotation resonances rapidly depopulate these sites (Colwell and Esposito 1990). With the new results in hand for the evolution of the ring particles over periods of less than a century, we can now calculate the long-term stochastic evolution of the Adams ring. Using a finite Markov chain as a model for this stochastic process, we follow the suggestion by FS96 that corotation sites provide preferential locations for accretion. A more general conclusion is that the longitudinal concentration of material in a few nearby sites (and that the majority of the Adams ring material is residing there) requires either an exceedingly recent event (EC92) or that the corotation sites be absorbing states of the Markov chain.In the latter case, the competing processes of chaotic diffusion and frustrated accretion can provide the arc and clump features as recurrent transient events near the Roche limit. Similar phenomena would be expected for Saturn's F and G rings.

  10. H_2O and CO_2 in magmas from the Mariana arc and back arc systems

    OpenAIRE

    Newman, Sally; Stolper, Edward; STERN, Robert

    2000-01-01

    We examined the H2O and CO2 contents of glasses from lavas and xenoliths from the Mariana arc system, an intraoceanic convergent margin in the western Pacific, which contains an active volcanic arc, an actively spreading back arc basin, and active behind-the-arc cross-chain volcanoes. Samples include (1) glass rims from Mariana arc, Mariana trough, and cross-chain submarine lavas; (2) glass inclusions in arc and trough phenocrysts; and (3) glass inclusions from a gabbro + anorthosite xenolith...

  11. Arc Root Attachment on the Anode Surface of Arc Plasma Torch Observed with a Novel Method

    Institute of Scientific and Technical Information of China (English)

    PAN Wen-Xia; LI Teng; MENG Xian; CHEN Xi; WU Cheng-Kang

    2005-01-01

    @@ The arc-root attachment on the anode surface of a dc non-transferred arc plasma torch has been successfullyobserved using a novel approach. A specially designed copper mirror with a boron nitride film coated on itssurface central-region is employed to avoid the effect of intensive light emitted from the arc column upon theobservation of weakly luminous arc root. It is found that the arc-root attachment is diffusive on the anode surfaceof the argon plasma torch, while constricted arc roots often occur when hydrogen or nitrogen is added into argonas the plasma-forming gas.

  12. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed.......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  13. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  14. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  15. Electrothermal ac electro-osmosis

    Science.gov (United States)

    Gagnon, Zachary R.; Chang, Hsueh-Chia

    2009-01-01

    Two ac polarization mechanisms, charge accumulation due to electrode double layer charging and bulk permittivity/conductivity gradients generated by Joule heating, are combined in the double layer by introducing zwitterions to produce a new ac electrokinetic pump with the largest velocity (>1 mm/s) and flow penetration depth (100 μm) reported for low-conductivity fluids. The large fluid velocity is due to a quartic scaling with respect to voltage, as is true of electrothermal flow, but exhibits a clear maximum at a frequency corresponding to the electrode double layer inverse RC time.

  16. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  17. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  18. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  19. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  20. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  1. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  2. AcEST: DK947455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Picea... 246 9e-64 tr|A8QIH7|A8QIH7_MORAL Chlor...DPTARSDNGSCEYEFKE 479 >tr|A8QIH7|A8QIH7_MORAL Chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase ac

  3. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  4. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  5. AcEST: BP917678 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LL Rhodopsin (Fragment) OS=Idiosepius notoides Align length 105 Score (bit) 39.3 E-value 0.15 Report BLASTX ...MOLL Rhodopsin (Fragment) OS=Idiosepius notoid... 39 0.15 tr|Q0D323|Q0D323_9MOLL Rhodopsin (Fragment) OS=Arc...OS=Culex... 33 8.1 >tr|Q6QE87|Q6QE87_9MOLL Rhodopsin (Fragment) OS=Idiosepius not

  6. Stability of Neptune's ring arcs in question

    Science.gov (United States)

    Dumas, Christophe; Terrile, Richard J.; Smith, Bradford A.; Schneider, Glenn; Becklin, E. E.

    1999-08-01

    Although all four of the gas-giant planets in the Solar System have ring systems, only Neptune exhibits `ring arcs'-stable clumps of dust that are discontinuous from each other. Two basic mechanisms for confining the dust to these arcs have been proposed. The firstrelies on orbital resonances with two shepherding satellites, while the second invokes a single satellite (later suggested to be Galatea) to produce the observed ring arc structures. Here we report observations of the ring arcs and Galatea, which show that there isa mismatch between the locations of the arcs and the site of Galatea's co-rotation inclined resonance. This result calls into question Galatea's sole role in confining the arcs.

  7. Programming ArcGIS with Python cookbook

    CERN Document Server

    Pimpler, Eric

    2015-01-01

    Programming ArcGIS with Python Cookbook, Second Edition, is written for GIS professionals who wish to revolutionize their ArcGIS workflow with Python. Whether you are new to ArcGIS or a seasoned professional, you almost certainly spend time each day performing various geoprocessing tasks. This book will teach you how to use the Python programming language to automate these geoprocessing tasks and make you a more efficient and effective GIS professional.

  8. Statistical analysis of geographic information with ArcView GIS and ArcGIS

    National Research Council Canada - National Science Library

    Wong, David W. S; Lee, Jay

    2005-01-01

    ... of its capabilities for spatial-quantitative synthesis. Now, David Wong and Jay Lee update their comprehensive handbook with Statistical Analysis of Geographic Information with ArcView GIS and ArcGIS...

  9. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  10. The Confinement of Neptune's Ring Arcs

    Science.gov (United States)

    Porco, C.; Namouni, F.

    2002-09-01

    The stability of the narrow ring arcs of Neptune has been a puzzle since their discovery. First detected in 1984 from the Earth in stellar occultations and imaged by the Voyager spacecraft in 1989, the 5 arcs spanning approximately 40 deg in longitude are apparently confined against the rapid azimuthal and radial spreading that results from energy dissipation in inter-particle collisions. Voyager data were used to argue in favor of an arc confinement model (Goldreich et al. AJ 1986; Porco, Science 1991) that relies on both the vertical and mean angular motions of the nearby Neptunian moon, Galatea, to produce a pair of Lindblad (LR) and corotation inclination (CIR) resonances capable of trapping ring particles into a sequence of arcs. However, HST and Earth-based observations taken in 1998 (Dumas et al. Nature 1999; Sicardy et al. Nature 1999) indicate a revised arc mean angular motion which displaces the arcs away from the CIR, leaving their stability once again unexplained. In this presentation, we will discuss the workings of a hitherto neglected resonance which relies on Galatea's orbital eccentricity and which, together with the LR, is likely responsible for the angular confinement of the arcs. The action of this resonance, which operates through the precession of Galatea's eccentric orbit forced by the arcs' inertia, will allow a determination of the arcs' mass from future measurements of Galatea's eccentricity. We acknowledge the financial support of NASA's Planetary Geology and Geophysics Program and the Southwest Research Institute's Internal Research Grant program.

  11. The Team Orienteering Arc Routing Problem

    OpenAIRE

    Archetti, Claudia; Speranza, M. Grazia; Corberan, Angel; Sanchís Llopis, José María; Plana, Isaac

    2014-01-01

    The team orienteering arc routing problem (TOARP) is the extension to the arc routing setting of the team orienteering problem. In the TOARP, in addition to a possible set of regular customers that have to be serviced, another set of potential customers is available. Each customer is associated with an arc of a directed graph. Each potential customer has a profit that is collected when it is serviced, that is, when the associated arc is traversed. A fleet of vehicles with a given maximum trav...

  12. Electrode Evaporation Effects on Air Arc Behavior

    Institute of Scientific and Technical Information of China (English)

    LI Xingwen; CHEN Degui; LI Rui; WU Yi; NIU Chunping

    2008-01-01

    A numerical study of the effects of copper and silver vapours on the air arc behavior is performed. The commercial software FLUENT is adapted and modified to develop a two-dimensional magneto-hydrodynamic (MHD) models of arc with the thermodynamic properties and transport coefficients, net emission coefficient for the radiation model of 99% ai-1% Cu, 99% air-1% Ag, and pure air, respectively. The simulation result demonstrates that vaporization of the electrode material may cool the arc center region and reduce the arc velocity. The effects of Ag vapour are stronger compared to those of Cu vapour.

  13. Metals purification by improved vacuum arc remelting

    Science.gov (United States)

    Zanner, Frank J.; Williamson, Rodney L.; Smith, Mark F.

    1994-12-13

    The invention relates to improved apparatuses and methods for remelting metal alloys in furnaces, particularly consumable electrode vacuum arc furnaces. Excited reactive gas is injected into a stationary furnace arc zone, thus accelerating the reduction reactions which purify the metal being melted. Additionally, a cooled condensation surface is disposed within the furnace to reduce the partial pressure of water in the furnace, which also fosters the reduction reactions which result in a purer produced ingot. Methods and means are provided for maintaining the stationary arc zone, thereby reducing the opportunity for contaminants evaporated from the arc zone to be reintroduced into the produced ingot.

  14. Class `E` protective headwear: electric arc exposure

    Energy Technology Data Exchange (ETDEWEB)

    Jones, E.

    1997-04-01

    A series of tests were conducted using electric arcs under laboratory conditions to determine what, if any, damages can be inflicted upon class `E` hard hats. Ten hard hats were subjected to different levels of arc exposure to see if the hat would ignite, melt, drip, stick to the head, etc. It was noted that there is no standard on hard hat exposure to an electric arc. It was recommended that the CSA committee revise the protective headwear standard to include a requirement for flame/arc resistance, including specification of pass/fail criteria. 1 tab., 3 figs.

  15. Boxicity of Circular Arc Graphs

    OpenAIRE

    Bhowmick, Diptendu; Chandran, L. Sunil

    2008-01-01

    A $k$-dimensional box is the cartesian product $R_1 \\times R_2 \\times ... \\times R_k$ where each $R_i$ is a closed interval on the real line. The {\\it boxicity} of a graph $G$, denoted as $box(G)$, is the minimum integer $k$ such that $G$ can be represented as the intersection graph of a collection of $k$-dimensional boxes: that is two vertices are adjacent if and only if their corresponding boxes intersect. A circular arc graph is a graph that can be represented as the intersection graph of ...

  16. Antibacterial efficacy of advanced silver-amorphous carbon coatings deposited using the pulsed dual cathodic arc technique

    Energy Technology Data Exchange (ETDEWEB)

    Endrino, J L; Anders, A; Albella, J M; Horton, J A; Horton, T H; Ayyalasomayajula, P R; Allen, M, E-mail: jlendrino@icmm.csic.es

    2010-11-01

    Amorphous carbon (a-C) also referred as diamond-like carbon (DLC) films are well known to be a biocompatible material with good chemical in ertness; this makes it a strong candidate to be used as a matrix that embeds metallic elements with an antimicrobial effect. We have deposited as et of a-C:Ag films using a dual-cathode pulsed filtered cathodic arc source, the arc pulse frequency of the silver and graphite cathodes was controlled in order to obtain samples with various silver contents. In this study, we show the deposition of silver and carbon ions using this technique and analyze the advantages of incorporating silver into a-C by studying the antimicrobial properties against staphylococcus of samples deposited on Ti{sub 6}Al{sub 4}V coupons and evaluated using 24-well tissue culture plates.

  17. Feedback Linearization Based Arc Length Control for Gas Metal Arc Welding

    DEFF Research Database (Denmark)

    Thomsen, Jesper Sandberg

    2005-01-01

    In this paper a feedback linearization based arc length controller for gas metal arc welding (GMAW) is described. A nonlinear model describing the dynamic arc length is transformed into a system where nonlinearities can be cancelled by a nonlinear state feedback control part, and thus, leaving only...

  18. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  19. ATLAS DDM integration in ARC

    DEFF Research Database (Denmark)

    Behrmann, Gerd; Cameron, David; Ellert, Mattias;

    2008-01-01

    The Nordic Data Grid Facility (NDGF) consists of Grid resources running ARC middleware in Denmark, Finland, Norway and Sweden. These resources serve many virtual organisations and contribute a large fraction of total worldwide resources for the ATLAS experiment, whose data is distributed and mana......The Nordic Data Grid Facility (NDGF) consists of Grid resources running ARC middleware in Denmark, Finland, Norway and Sweden. These resources serve many virtual organisations and contribute a large fraction of total worldwide resources for the ATLAS experiment, whose data is distributed...... and managed by the DQ2 software. Managing ATLAS data within NDGF and between NDGF and other Grids used by ATLAS (the Enabling Grids for E-sciencE Grid and the Open Science Grid) presents a unique challenge for several reasons. Firstly, the entry point for data, the Tier 1 centre, is physically distributed...... outside the worker node environment. Also, the service used for cataloging the location of data files is different from otherGrids but must still be useable by DQ2 and ATLAS users to locate data within NDGF. This paper presents in detail how we solve these issues to allow seamless access worldwide to data...

  20. Evolution of residual stresses in micro-arc oxidation ceramic coatings on 6061 Al alloy

    Science.gov (United States)

    Shen, Dejiu; Cai, Jingrui; Guo, Changhong; Liu, Peiyu

    2013-11-01

    Most researches on micro-arc oxidation mainly focus on the application rather than discovering the evolution of residual stresses. However, residual stresses in the surface coatings of structural components have adverse effects on their properties, such as fatigue life, dimensional stability and corrosion resistance, etc. The micro-arc oxidation ceramic coatings are produced on the surfaces of 6061 aluminum alloy by a homemade asymmetric AC type of micro-arc oxidation equipment of 20 kW. A constant current density of 4.4±0.1 A/dm2 and a self-regulated composite electrolyte are used. The micro-arc oxidation treatment period ranges from 10 min to 40 min, and the thickness of the ceramic coatings is more than 20 μm. Residual stresses attributed to γ-Al2O3 constituent in the coatings at different micro-arc oxidation periods are analyzed by an X-ray diffractometer using the sin2 ψ method. The analysis results show that the residual stress in the ceramic coatings is compressive in nature, and it increases first and then decreases with micro-arc oxidation time increase. The maximum stress value is 1 667±20 MPa for period of 20 min. Through analyzing the coating thickness, surface morphology and phase composition, it is found that the residual stress in the ceramic coatings is linked closely with the coating growth, the phase composition and the micro cracks formed. It is also found that both the heat treatment and the ultrasonic action release remarkably the residual compressive stress. The heat treatment makes the residual compressive stress value decrease 1 378 MPa. The ultrasonic action even alters the nature of the residual stress, making the residual compressive stress change into a residual tensile stress.

  1. Characterization of Micro-arc Oxidized Titanium

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    The observation of the sparkling discharges during the micro-arc oxidation process in KOH aqueous electrolyte was achieved. The change of surface morphology was progressively observed and a plausible pore formation mechanism is proposed. Cell proliferation and ALP activity of micro-arc oxidized titanium was evaluated by human body derived osteoblasts and slightly better than those of blasted surface.

  2. Measurement of an Electric Arc Spectra

    OpenAIRE

    Šimek, D.

    2015-01-01

    Article is focused on electric arc spectroscopy diagnostics related to electric low voltage apparatuses. The first attempts of spectroscopy measurements are dealt with. An example of radiation spectra of the electric arc burning between copper electrodes is presented. The problems connected with the measurements are discussed.

  3. Modeling and Simulation of Low Voltage Arcs

    NARCIS (Netherlands)

    Ghezzi, L.; Balestrero, A.

    2010-01-01

    Modeling and Simulation of Low Voltage Arcs is an attempt to improve the physical understanding, mathematical modeling and numerical simulation of the electric arcs that are found during current interruptions in low voltage circuit breakers. An empirical description is gained by refined electrical

  4. Implementing RapidArc into clinical routine

    DEFF Research Database (Denmark)

    Van Esch, Ann; Huyskens, Dominique P; Behrens, Claus F;

    2011-01-01

    With the increased commercial availability of intensity modulated arc therapy (IMAT) comes the need for comprehensive QA programs, covering the different aspects of this newly available technology. This manuscript proposes such a program for the RapidArc (RA) (Varian Medical Systems, Palo Alto...

  5. Are the Arcs of Neptune Really Stable?

    Science.gov (United States)

    Hanninen, J.; Porco, C.

    1994-12-01

    The Voyager mission discovered a system of rings and ring arcs around Neptune. It was later found that the arcs appear to be azimuthally and radially confined by resonant interactions with the nearby satellite, Galatea, yielding a maximum spread in ring particle semimajor axes of 0.6 km and a spread in forced eccentricities large enough to explain the arc's 15 km radial widths (Porco, 1991, Science 253, 995). We have modified an N-body simulation method (e.g. Hanninen and Salo, 1992, Icarus 97, 228) to include Neptune's second and fourth gravitational harmonics in order to be able to study the effects of collisions and self-gravity on the stability of the ring arcs. We have tested the simulation method and verified the shepherding mechanism in the collisionless and non-self-gravitational case. Preliminary simulation results with collisions over (1)/(2) a libration period indicate that collisions among putative 10-m sized source bodies within the arcs are indeed capable of arc disruption. However, whether or not collisions occur over this time scale depends, among other factors, on the number density of such bodies. We will explore the effects on arc stability of varying simulation parameters, such as the sizes and number density of the source bodies and the coefficient of restitution. Also, we will examine the effect of Galatea's previously neglected nearby vertical resonance on arc particle orbits.

  6. The structure and singularities of arc complexes

    DEFF Research Database (Denmark)

    Penner, Robert

    A classical combinatorial fact is that the simplicial complex consisting of disjointly embedded chords in a convex planar polygon is a sphere. For any surface F with non-empty boundary, there is an analogous complex Arc(F) consisting of suitable equivalence classes of arcs in F connecting its bou...

  7. Modeling and Simulation of Low Voltage Arcs

    NARCIS (Netherlands)

    Ghezzi, L.; Balestrero, A.

    2010-01-01

    Modeling and Simulation of Low Voltage Arcs is an attempt to improve the physical understanding, mathematical modeling and numerical simulation of the electric arcs that are found during current interruptions in low voltage circuit breakers. An empirical description is gained by refined electrical m

  8. The next-generation ARC middleware

    DEFF Research Database (Denmark)

    Appleton, O.; Cameron, D.; Cernak, J.

    2010-01-01

    The Advanced Resource Connector (ARC) is a light-weight, non-intrusive, simple yet powerful Grid middleware capable of connecting highly heterogeneous computing and storage resources. ARC aims at providing general purpose, flexible, collaborative computing environments suitable for a range of use...

  9. Copper coating specification for the RHIC arcs

    Energy Technology Data Exchange (ETDEWEB)

    Blaskiewicz, M.

    2010-12-01

    Copper coating specifications for the RHIC arcs are given. Various upgrade scenarios are considered and calculations of resistive wall losses in the arcs are used to constrain the necessary quality and surface thickness of a copper coating. We find that 10 {mu}m of high purity copper will suffice.

  10. TIG Wire and Arc Additive Manufacturing of 5A06 Aluminum Alloy

    Directory of Open Access Journals (Sweden)

    HUANG Dan

    2017-03-01

    Full Text Available Wire and arc additive manufacturing(WAAM was investigated by tungsten inert gas arc welding method(TIG, in which φ1.2mm filler wire of aluminum alloy 5A06(Al-6Mg-Mn-Si was selected as deposition metal. The prototyping process was conducted by a TIG power source(working in AC mode manipulated by a four-axis linkage CNC machine. Backplate preheating temperature and arc current on deposited morphologies of single layer and multi-layer were researched. The microstructure was observed and the sample tensile strength was tested. For single layer, a criterion that describes the correlation between backplate preheating temperature and arc peak current, of which both contribute to the smoothening of the deposited layer. The results show that the layer height drops sharply from the first layer of 3.4mm and keeps at 1.7mm after the 8th layer. Fine dendrite grain and equiaxed grain are found inside a layer and coarsest columnar dendrite structure at layer boundary zone; whereas the microstructure of top region of the deposited sample changes from fine dendrite grain to equiaxed grain that turns to be the finest structure. Mechanical property of the deposited sample is isotropic, in which the tensile strength is approximately 295MPa with the elongation around 36%.

  11. Dimensionless factors for an alternating-current non-thermal arc plasma

    Science.gov (United States)

    Zhang, Si-Yuan; Li, Xiao-Song; Liu, Jin-Bao; Liu, Jing-Lin; Li, He-Ping; Zhu, Ai-Min

    2016-12-01

    A gliding arc discharge, as a source of warm plasma combining advantages of both thermal and cold plasmas, would have promising application prospects in the fields of fuel conversion, combustion enhancement, material synthesis, surface modifications, pollution control, etc. In order to gain insight into the features of an alternating-current gliding arc discharge plasma, three dimensionless factors, i.e., the extinction span (ψ), current lag (δ), and heating lag (χ) factors are proposed in this letter based on the measured waveforms of the discharge voltage and current in an AC gliding arc discharge plasma. The influences of the driving frequency of the power supply (f) on these three dimensionless parameters are investigated experimentally with the explanations on the physical meanings of these factors. The experimental results show that a higher value of f would lead to the lower values of ψ and δ, as well as a higher value of χ. These experimental phenomena indicate a lower threshold ignition voltage of the discharges, a lower current-growth inertia of the gliding arcs and a larger relative thermal inertia of the plasmas with increase the driving frequency of the power supply in the operating parameter range studied in this letter.

  12. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  13. Numerical Study on Arc Plasma Behavior During Arc Commutation Process in Direct Current Circuit Breaker

    Institute of Scientific and Technical Information of China (English)

    杨飞; 马瑞光; 吴翊; 孙昊; 纽春萍; 荣命哲

    2012-01-01

    This paper focuses on the numerical investigation of arc plasma behavior during arc commutation process in a medium-voltage direct current circuit breaker (DCCB) contact system. A three-dimensional magneto-hydrodynamic (MHD) model of air arc plasma in the contact system of a DCCB is developed, based on commercial software FLUENT. Coupled electromagnetic and gas dynamic interactions are considered as usual, and a thin layer of nonlinear electrical resistance elements is used to represent the voltage drop of plasma sheath and the formation of new arc root. The distributions of pressure, temperature, gas flow and current density of arc plasma in arc region are calculated. The simulation results indicate that the pressure distribution related to the contact system has a strong effect on the arc commutation process, arising from the change of electrical conductivity in the arc root region. In DCCB contact system, the pressure of arc root region will be concentrated and higher if the space above the moving contact is enclosed, which is not good for arc root commutation. However, when the region is opened, the pressure distribution would be lower and more evenly, which is favorable for the arc root commutation.

  14. Arc burst pattern analysis fault detection system

    Science.gov (United States)

    Russell, B. Don (Inventor); Aucoin, B. Michael (Inventor); Benner, Carl L. (Inventor)

    1997-01-01

    A method and apparatus are provided for detecting an arcing fault on a power line carrying a load current. Parameters indicative of power flow and possible fault events on the line, such as voltage and load current, are monitored and analyzed for an arc burst pattern exhibited by arcing faults in a power system. These arcing faults are detected by identifying bursts of each half-cycle of the fundamental current. Bursts occurring at or near a voltage peak indicate arcing on that phase. Once a faulted phase line is identified, a comparison of the current and voltage reveals whether the fault is located in a downstream direction of power flow toward customers, or upstream toward a generation station. If the fault is located downstream, the line is de-energized, and if located upstream, the line may remain energized to prevent unnecessary power outages.

  15. Low voltage arc formation in railguns

    Science.gov (United States)

    Hawke, Ronald S.

    1987-01-01

    A low voltage plasma arc is first established across the rails behind the projectile by switching a low voltage high current source across the rails to establish a plasma arc by vaporizing a fuse mounted on the back of the projectile, maintaining the voltage across the rails below the railgun breakdown voltage to prevent arc formation ahead of the projectile. After the plasma arc has been formed behind the projectile a discriminator switches the full energy bank across the rails to accelerate the projectile. A gas gun injector may be utilized to inject a projectile into the breech of a railgun. The invention permits the use of a gas gun or gun powder injector and an evacuated barrel without the risk of spurious arc formation in front of the projectile.

  16. Collisional Simulations of Neptune's Ring Arcs

    Science.gov (United States)

    Hänninen, J.; Porco, C.

    1997-03-01

    The currently accepted model for Neptune arc confinement relies on the radial and azimuthal confining perturbations due to the nearby satellite, Galatea. This model calls for arc particle orbits exhibiting a negative eccentricity gradient and crossing at quadrature, a configuration that paradoxically leads to collisions energetic enough to disrupt arc confinement. We confirm with numerical collisional N-body simulations that the confinement mechanism relying on a 42:43 corotation-inclination resonance and a 42:43 outer Lindblad resonance with Galatea is indeed capable of confining a large population of 10-m-size and bigger particles over short time scales. Moreover, we find that an 84:86 outer vertical resonance, also due to Galatea, falling within 20 m of the arcs' radial position, effectively reduces the collision frequency and relative collisional velocities and consequently stabilizes the arcs over long time scales against the disruptive effects of collisions.

  17. An explanation for Neptune's ring arcs

    Science.gov (United States)

    Porco, Carolyn C.

    1991-08-01

    The Voyager mission revealed a complex system of rings and ring arcs around Neptune and uncovered six new satellites, four of which occupy orbits well inside the ring region. Analysis of Voyager data shows that a radial distortion with an amplitude of approximately 30 kilometers is traveling through the ring arcs, a perturbation attributable to the nearby satellite Galatea. Moreover, the arcs appear to be azimuthally confined by a resonant interaction with the same satellite, yielding a maximum spread in ring particle semimajor axes of 0.6 kilometer and a spread in forced eccentricities large enough to explain the arc's 15-kilometer radial widths. Additional ring arcs discovered in the course of this study give further support to this model.

  18. Metrology in arc plasmas - A new cathode

    Science.gov (United States)

    Croche, R.

    1980-02-01

    A new radiating source consisting of an electric arc under argon pressure is described, with power varying between about 0.2 and 1.5 kW, and with the plasma furnishing a continuous spectrum between 115 and 350 nm. The arc functions from 5 to 50 A, with a voltage varying between 30 and 35 V. The cathode of the transfer arc is described in detail, including such advantages as easy igniting of the arc and the possibility of re-sharpening the tip of the cathode. Most important, the new 'knife-shaped' form of the tungsten cathode has improved the stability and reproducibility of the ultraviolet continuum emitted by the plasma of the arc, which is used at the French National Institute of Metrology as a transfer standard of spectral radiance in the vacuum ultraviolet.

  19. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  20. An Arc in Saturn's G Ring

    Science.gov (United States)

    Burns, Joseph A.; Hedman, M.; Tiscareno, M.; Porco, C.; Jones, G.; Roussos, E.; Krupp, N.

    2006-09-01

    The G ring is a narrow, faint ring located between the orbits of Janus and Mimas. Approximately 4000 km wide, it has a strongly asymmetric brightness profile with a sharp inner edge between 167,000 km and 168,000 km from Saturn's center and a more diffuse outer part. In Cassini images, a portion of the ring contains a bright arc that abuts the G-ring's inner edge and extends over 30 degrees in longitude. By tracking this arc over the first two years of the Cassini Mission, we find its orbital period is 0.80813 day, corresponding to a semi-major axis of 167,496 km. Since this location places the arc within 6 km of the Mimas 7:6 Co-rotation Eccentricity Resonance and within 12 km of the Mimas 7:6 Inner Lindblad Resonance, the arc is likely confined in longitude by Mimas just as Neptune's ring arcs are held in place by Galatea. The arc's longitude relative to Mimas is consistent with this model. Cassini now has the opportunity to study the dynamics of this sort of system in detail over a period of years. The arc, which may be the debris of a fragmented moon, may also supply the particles found in the rest of the G ring; micron-sized grains drift outwards by non-gravitational processes in this region. The G-ring is responsible for a broad, relatively modest decrease in the fluxes of magnetospheric charged particles. When Cassini passed over the G ring in the vicinity of the arc, on September 5, 2005, the MIMI instrument detected a particularly sharp and deep charged particle absorption signature. Such a pronounced charged particle absorption was not seen in the other G-ring passages that occurred longitudinally far from the arc. The nature of this absorption provides constraints on the population of large particles in this arc.

  1. Analysis of arc emission spectra of stainless steel electric arc furnace slag affected by fluctuating arc voltage.

    Science.gov (United States)

    Aula, Matti; Mäkinen, Ari; Fabritius, Timo

    2014-01-01

    Control of chromium oxidation in the electric arc furnace (EAF) is a significant problem in stainless steel production due to variations of the chemical compositions in the EAF charge. One potential method to control chromium oxidation is to analyze the emission spectrum of the electric arc in order to find indicators of rising chromium content in slag. The purpose of this study was to determine if slag composition can be gained by utilizing electric arc emission spectra in the laboratory environment, despite electric arc voltage fluctuations and varying slag composition. The purpose of inducing voltage fluctuation was to simulate changes in the industrial EAF process. The slag samples were obtained from Outokumpu Stainless Oy Tornio Works, and three different arc currents were used. The correlation analysis showed that the emission spectra offer numerous peak ratios with high correlations to the X-ray fluorescence-measured slag CrO(x)/FeO(x) and MnO/SiO2 ratios. These ratios are useful in determining if the reduction agents have been depleted in the EAF. The results suggest that analysis of laboratory-scale electric arc emission spectra is suitable for indicating the high CrO(x) or MnO content of the slag despite the arc fluctuations. Reliable analysis of other slag components was not successful.

  2. ATLAS DDM integration in ARC

    DEFF Research Database (Denmark)

    Behrmann, Gerd; Cameron, David; Ellert, Mattias;

    The Nordic Data Grid Facility (NDGF) consists of Grid resources running ARC middleware in Scandinavia and other countries. These resources serve many virtual organisations and contribute a large fraction of total worldwide resources for the ATLAS experiment, whose data is distributed and managed...... by the DQ2 software. Managing ATLAS data within NDGF and between NDGF and other Grids used by ATLAS (the LHC Computing Grid and the Open Science Grid) presents a unique challenge for several reasons. Firstly, the entry point for data, the Tier 1 centre, is physically distributed among heterogeneous...... environment. Also, the service used for cataloging the location of data files is different from other Grids but must still be useable by DQ2 and ATLAS users to locate data within NDGF. This paper presents in detail how we solve these issues to allow seamless access worldwide to data within NDGF....

  3. INTERPOLATION WITH RESTRICTED ARC LENGTH

    Institute of Scientific and Technical Information of China (English)

    Petar Petrov

    2003-01-01

    For given data (ti,yi), I= 0,1,…,n,0 = t0 <t1 <…<tn = 1we study constrained interpolation problem of Favard type inf{‖f"‖∞|f∈W2∞[0,1],f(ti)=yi,i=0,…,n,l(f;[0,1])≤l0}, wherel(f";[0,1])=∫1 0 / 1+f'2(x)dx is the arc length off in [0,1]. We prove the existence of a solution f* of the above problem, that is a quadratic spline with a second derivative f"* , which coincides with one of the constants - ‖f"*‖∞,0,‖f"*‖∞ between every two consecutive knots. Thus, we extend a result ofKarlin concerning Favard problem, to the case of restricted length interpolation.

  4. Computer simulation to arc spraying

    Institute of Scientific and Technical Information of China (English)

    梁志芳; 李午申; 王迎娜

    2004-01-01

    The arc spraying process is divided into two stages: the first stage is atomization-spraying stream (ASS) and the second one is spraying deposition (SD). Then study status is described of both stages' physical model and corresponding controlling-equation. Based on the analysis of study status, the conclusion as follows is got. The heat and mass transfer models with two or three dimensions in ASS stage should be established to far deeply analyses the dynamical and thermal behavior of the overheat droplet. The statistics law of overheated droplets should be further studied by connecting simulation with experiments. More proper validation experiments should be designed for flattening simulation to modify the models in SD stage.

  5. Sustained diffusive alternating current gliding arc discharge in atmospheric pressure air

    DEFF Research Database (Denmark)

    Zhu, Jiajian; Gao, Jinlong; Li, Zhongshan

    2014-01-01

    current (AC) power source. The plasma column extended beyond the water-cooled stainless steel electrodes and was stabilized by matching the flow speed of the turbulent air jet with the rated output power. Comprehensive investigations were performed using high-speed movies measured over the plasma column......, synchronized with simultaneously recorded current and voltage waveforms. Dynamic details of the novel non-equilibrium discharge are revealed, which is characterized by a sinusoidal current waveform with amplitude stabilized at around 200 mA intermediate between thermal arc and glow discharge, shedding light...

  6. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  7. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  8. Contribution For Arc Temperature Affected By Current Increment Ratio At Peak Current In Pulsed Arc

    Science.gov (United States)

    Kano, Ryota; Mitubori, Hironori; Iwao, Toru

    2015-11-01

    Tungsten Inert Gas (TIG) Welding is one of the high quality welding. However, parameters of the pulsed arc welding are many and complicated. if the welding parameters are not appropriate, the welding pool shape becomes wide and shallow.the convection of driving force contributes to the welding pool shape. However, in the case of changing current waveform as the pulse high frequency TIG welding, the arc temperature does not follow the change of the current. Other result of the calculation, in particular, the arc temperature at the reaching time of peak current is based on these considerations. Thus, the accurate measurement of the temperature at the time is required. Therefore, the objective of this research is the elucidation of contribution for arc temperature affected by current increment ratio at peak current in pulsed arc. It should obtain a detail knowledge of the welding model in pulsed arc. The temperature in the case of increment of the peak current from the base current is measured by using spectroscopy. As a result, when the arc current increases from 100 A to 150 A at 120 ms, the transient response of the temperature didn't occur during increasing current. Thus, during the current rise, it has been verified by measuring. Therefore, the contribution for arc temperature affected by current increment ratio at peak current in pulsed arc was elucidated in order to obtain more knowledge of welding model of pulsed arc.

  9. Electric Arc Furnace Modeling with Artificial Neural Networks and Arc Length with Variable Voltage Gradient

    Directory of Open Access Journals (Sweden)

    Raul Garcia-Segura

    2017-09-01

    Full Text Available Electric arc furnaces (EAFs contribute to almost one third of the global steel production. Arc furnaces use a large amount of electrical energy to process scrap or reduced iron and are relevant to study because small improvements in their efficiency account for significant energy savings. Optimal controllers need to be designed and proposed to enhance both process performance and energy consumption. Due to the random and chaotic nature of the electric arcs, neural networks and other soft computing techniques have been used for modeling EAFs. This study proposes a methodology for modeling EAFs that considers the time varying arc length as a relevant input parameter to the arc furnace model. Based on actual voltages and current measurements taken from an arc furnace, it was possible to estimate an arc length suitable for modeling the arc furnace using neural networks. The obtained results show that the model reproduces not only the stable arc conditions but also the unstable arc conditions, which are difficult to identify in a real heat process. The presented model can be applied for the development and testing of control systems to improve furnace energy efficiency and productivity.

  10. Reconstruction of Late Cretaceous Magmatic Arcs in the Northern Andes: Single Versus Multiple Arc Systems

    Science.gov (United States)

    Cardona, A.; Jaramillo, J. S.; Leon, S.; Hincapie, S.; Mejia, D.; Patino, A. M.; Vanegas, J.; Zapata, S.; Valencia, V.; Jimenez, G.; Monsalve, G.

    2014-12-01

    Although magmatic rocks are major tracers of the geological evolution of convergent margins, pre-collisional events such as subduction erosion, collisional thrusting or late collisional strike slip segmentation may difficult the recognizing of multiple arc systems and therefore the existence of paleogeographic scenarios with multiple subduction systems. New field, U-Pb geochronology and whole rock geochemistry constraints from the northwestern segment of the Central Cordillera in the states of Antioquia and Caldas (Colombia) are used to understand the nature of the Late Cretaceous arc magmatism and evaluate the existence of single or multiple Pacific and Caribbean arc systems in the growth of the Northwestern Andes. The new results integrated with additional field and published information is used to suggest the existence of at least three different magmatic arcs. (1) An Eastern Continental arc built within a well defined Permian to Triassic continental crust that record a protracted 90-70 Ma magmatic evolution, (2) a 90-80 arc formed within attenuated continental crust and associated oceanic crust, (3) 90-88 Ma arc formed over a Late Cretaceous plateau crust. The eastern arcs were formed as part of double eastern vergent subduction system, where the most outboard arc represent a fringing arc formed over detached fragments of continental crust, whereas the easternmost continental arc growth by the closure an subduction of and older and broad Triassic to Early Jurassic back-arc ocean. Its closure also end up in ophiolite emplacement. The third allochtonous oceanic arc was formed over the Caribbean plateau crust and was accreted to the continental margin in the Late Cretaceous. Ongoing paleomagnetic, deformational, gravimetric and basin analysis will be integrate to test this model and understand the complex Late Cretaceous tectonic evolution of the Northern Andes.

  11. Towards a theory for Neptune's arc rings

    Science.gov (United States)

    Goldreich, P.; Tremaine, S.; Borderies, N.

    1986-01-01

    It is proposed that the incomplete rings of Neptune consist of a number of short arcs centered on the corotation resonances of a single satellite. The satellite must have a radius of the order of 100 km or more and move on an inclined orbit. Corotation resonances are located at potential maxima. Thus, mechanical energy dissipated by interparticle collisions must be continually replenished to prevent the arcs from spreading. It is shown that each corotation resonance is associated with a nearby Lindblad resonance, which excites the ring particles' orbital eccentricity, thus supplying the energy required to maintain the arc. The ultimate energy reservoir is the satellite's orbital energy. Therefore, interaction with the arcs damps the satellite's orbital inclination. The self-gravity of the arcs limits their contraction and enforces a relation between arc length and mass. The estimated arc masses are so small, of the order of 10 to the 16th g, that the satellite's orbital inclination suffers negligible decay over the age of the solar system. The inferred surface mass densities are comparable to those found in the major rings of Saturn and Uranus.

  12. METHOD OF CONJUGATED CIRCULAR ARCS TRACING

    Directory of Open Access Journals (Sweden)

    N. Ageyev Vladimir

    2017-01-01

    Full Text Available The geometric properties of conjugated circular arcs connecting two points on the plane with set directions of tan- gent vectors are studied in the work. It is shown that pairs of conjugated circular arcs with the same conditions in frontier points create one-parameter set of smooth curves tightly filling all the plane. One of the basic properties of this set is the fact that all coupling points of circular arcs are on the circular curve going through the initially given points. The circle radius depends on the direction of tangent vectors. Any point of the circle curve, named auxiliary in this work, determines a pair of conjugated arcs with given boundary conditions. One more condition of the auxiliary circle curve is that it divides the plane into two parts. The arcs going from the initial point are out of the circle limited by this circle curve and the arcs coming to the final point are inside it. These properties are the basis for the method of conjugated circular arcs tracing pro- posed in this article. The algorithm is rather simple and allows to fulfill all the needed plottings using only the divider and ruler. Two concrete examples are considered. The first one is related to the problem of tracing of a pair of conjugated arcs with the minimal curve jump when going through the coupling point. The second one demonstrates the possibility of trac- ing of the smooth curve going through any three points on the plane under condition that in the initial and final points the directions of tangent vectors are given. The proposed methods of conjugated circular arcs tracing can be applied in solving of a wide variety of problems connected with the tracing of cam contours, for example pattern curves in textile industry or in computer-aided-design systems when programming of looms with numeric control.

  13. Formation of the G-ring arc

    Science.gov (United States)

    Araujo, N. C. S.; Vieira Neto, E.; Foryta, D. W.

    2016-09-01

    Since 2004, the images obtained by the Cassini spacecraft's on-board cameras have revealed the existence of several small satellites in the Saturn system. Some of these small satellites are embedded in arcs of particles. While these satellites and their arcs are known to be in corotation resonances with Mimas, their origin remains unknown. This work investigates one possible process for capturing bodies into a corotation resonance, which involves increasing the eccentricity of a perturbing body. Therefore, through numerical simulations and analytical studies, we show a scenario in which the excitation of Mimas's eccentricity could capture particles in a corotation resonance. This is a possible explanation for the origin of the arcs.

  14. Formation of the G-ring arc

    CERN Document Server

    Araujo, N C S; Foryta, D W

    2016-01-01

    Since 2004, the images obtained by Cassini spacecraft's on-board cameras have revealed the existence of several small satellites in the Saturn system. Some of these small satellites are embedded in arcs of particles. While these satellites and their arcs are known to be in corotation resonances with Mimas, their origin remains unknown. This work investigates one possible process for capturing bodies into a corotation resonance, which involves raising the eccentricity of a perturbing body. Therefore, through numerical simulations and analytical studies, we show a scenario that the excitation of Mimas' eccentricity could capture particles in a corotation resonance and given a possible explanation for the origin for the arcs.

  15. The Global Array of Primitve Arc Melts

    Science.gov (United States)

    Schmidt, M. W.; Jagoutz, O. E.

    2015-12-01

    A longstanding question concerns the nature of the melts forming in the subarc mantle and giving rise to arc magmatism. The global array of primitive arc melts (1180 volcanic rocks in 25 arcs extracted from the georoc database, calculated to be in equilibrium with mantle olivine) yields five principal melt types: calc-alkaline basalts and high-Mg andesites, tholeiitic basalts and high-Mg andesites, and shoshonitic or alkaline arc melts; many arcs have more than one type. Primitive calc-alkaline basalts occur in 11 arcs but most strikingly, 8 continental arcs (incl. Aleutians, Cascades, Japan, Mexico, Kamtschatka) have a continuous range of calc-alkaline basalts to high-Mg andesites with mostly 48-58 wt% SiO2. In each arc, these are spatially congruent, trace element patterns overlap, and major elements form a continuum. Their Ca-Mg-Si systematics suggests saturation in olivine+opx+cpx. We hence interpret the large majority of high-Mg andesites as derived from primitive calc-alkaline basalts through fractionation and reaction in the shallower mantle. Removal of anhydrous mantle phases at lower pressures increases SiO2 and H2O-contents while Mg# and Ni remain buffered to mantle values. Primitive tholeiitic basalts (Cascades, Kermadec, Marianas, Izu-Bonin, Japan, Palau, Sunda) have a much lesser subduction signal (e.g. in LILE) than the calc-alkaline suite. These tholeiites have been interpreted to form through decompression melting, but also characterize young intraoceanic arcs. In the two continental arcs with both tholeiitic and calc-alkaline primitive basalts (clearly distinct in trace patterns), there is no clear spatial segregation (Casacades, Japan). Three intraoceanic arcs (Marianas, Izu-Bonin, Tonga) have primitive tholeiitic, highly depleted high-Mg andesites (boninites) with HFSE and HREE slightly above primitive mantle values. These deviate in majors from the array formed by the basalts and calc-alkaline andesites suggesting that only these formed from a

  16. Cathodic Vacuum Arc Plasma of Thallium

    OpenAIRE

    Yushkov, Georgy Yu.; Anders, Andre

    2006-01-01

    Thallium arc plasma was investigated in a vacuum arc ion source. As expected from previous consideration of cathode materials in the Periodic Table of the Elements, thallium plasma shows lead-like behavior. Its mean ion charge state exceeds 2.0 immediately after arc triggering, reaches the predicted 1.60 and 1.45 after about 100 microsec and 150 microsec, respectively. The most likely ion velocity is initially 8000 m/s and decays to 6500 m/s and 6200 m/s after 100 microsec and 150 micros...

  17. Linear volcanic segments in the Sunda Arc, Indonesia: Implications for arc lithosphere control upon volcano distribution

    Science.gov (United States)

    Macpherson, C. G.; Pacey, A.; McCaffrey, K. J.

    2012-12-01

    The overall curvature of many subduction zones is immediately apparent and the term island arc betrays the common assumption that subduction zone magmatism occurs in curved zones. This assumption can be expressed by approximating island arcs as segments of small circles on the surface of a sphere. Such treatments predict that the location of arc volcanoes is related to their vertical separation from the slab (in fact, the depth to seismicity in the slab) and require that the primary control on the locus of magmatism lies either within the subducted slab or the mantle wedge that separates the subducted and overriding lithospheric plates. The concept of curved arcs ignores longstanding observations that magmatism in many subduction systems occurs as segments of linearly arranged volcanic centres. Further evidence for this distribution comes from the close relationship between magmatism and large scale, arc-parallel fabrics in some arcs. Similarly, exposures of deep arc crust or mantle often reveal elongation of magmatic intrusions sub-parallel to the inferred trend of the arc. The Sunda Arc forms the Indonesian islands from Sumatra to Alor and provides an important test for models of volcano distribution for several reasons. First, Sunda has hosted abundant historic volcanic activity. Second, with the notable exception of Krakatau, every volcano in the arc is subaerial from base to cone and, therefore, can be readily identified where there is a suitable extent of local mapping that can be used to ground-truth satellite imagery. Third, there are significant changes in the stress regime along the length of the arc, allowing the influence of the upper plate to be evaluated by comparison of different arc segments. Finally, much of the Sunda Arc has proved difficult to accommodate in models that try to relate volcano distribution to the depth to the subducted slab. We apply an objective line-fitting protocol; the Hough Transform, to explore the distribution of volcanoes

  18. CyberArc: a non-coplanar-arc optimization algorithm for CyberKnife

    Science.gov (United States)

    Kearney, Vasant; Cheung, Joey P.; McGuinness, Christopher; Solberg, Timothy D.

    2017-07-01

    The goal of this study is to demonstrate the feasibility of a novel non-coplanar-arc optimization algorithm (CyberArc). This method aims to reduce the delivery time of conventional CyberKnife treatments by allowing for continuous beam delivery. CyberArc uses a 4 step optimization strategy, in which nodes, beams, and collimator sizes are determined, source trajectories are calculated, intermediate radiation models are generated, and final monitor units are calculated, for the continuous radiation source model. The dosimetric results as well as the time reduction factors for CyberArc are presented for 7 prostate and 2 brain cases. The dosimetric quality of the CyberArc plans are evaluated using conformity index, heterogeneity index, local confined normalized-mutual-information, and various clinically relevant dosimetric parameters. The results indicate that the CyberArc algorithm dramatically reduces the treatment time of CyberKnife plans while simultaneously preserving the dosimetric quality of the original plans.

  19. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  20. Prostate treatments, 1MRT o RapidArc; Tratamiento de prostata, IMART o RapidArc?

    Energy Technology Data Exchange (ETDEWEB)

    Castro novais, J.; Ruiz Maqueda, S.; Pardo Perez, E.; Molina Lopez, M. Y.; Cerro Penalver, E.

    2015-07-01

    Techniques that modulate the dose (as IMRT or RapidArcTM) improve dose homogeneity within the target volume decreasing the dose in healthy organs. The aim of this work is to study the dosimetric differences in prostate radiotherapy treatments with IMRT and RapidArcTM. The results of the 109 patients studied show that plans to RapidArcTM have better coverage, compliance and dose gradient outside the target volume. (Author)

  1. 49 CFR 195.226 - Welding: Arc burns.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding: Arc burns. 195.226 Section 195.226 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.226 Welding: Arc burns. (a) Each arc burn must be repaired. (b) An arc burn...

  2. Palaeomagnetic constraints on the geodynamic evolution of the Gibraltar Arc

    NARCIS (Netherlands)

    Krijgsman, W.; Garces, M.

    2004-01-01

    Subduction zone roll-back was recently put forward as a convincing model to explain the geometry and evolution of the Gibraltar Arc. For other subduction-related arc systems of the Mediterranean, such as the Calabrian Arc and the Hellenic Arc, palaeomagnetic rotation data from Neogene extensional ba

  3. Effect of arc on radiation thermometry in welding process

    Institute of Scientific and Technical Information of China (English)

    李亮玉; 王燕; 武宝林

    2002-01-01

    The effect of arc on radiation thermometry is analyzed in a field close to the arc during the welding process, and the ratio of signal to noise and other factors are obtained for a small current arc .The method of the temperature measurement is feasible when the arc current is decreased to a smaller value in the welding process.

  4. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  5. Seldovia, Alaska 1 arc-second DEM

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Seldovia, Alaska Elevation Grid provides bathymetric data in ASCII raster format of 1 arc-second resolution in geographic coordinates. This grid is strictly for...

  6. Seward, Alaska 1 arc-second DEM

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 1 arc-second Seward Alaska Elevation Grid provides bathymetric data in ASCII raster format of .89-second resolution in geographic coordinates. This grid is...

  7. Arc tracks on nanostructured surfaces after microbreakdowns

    Science.gov (United States)

    Sinelnikov, D.; Bulgadaryan, D.; Hwangbo, D.; Kajita, S.; Kolodko, D.; Kurnaev, V.; Ohno, N.

    2016-09-01

    Studying of initial steps of unipolar arc ignition process is important for reduction of probability of arcing between the plasma and the wall in thermonuclear devices. Tungsten nano-fuzz surface formed by helium plasma irradiation at high fluences and temperatures is a perfect material for arc ignition. Snowflake-like craters were detected on the fuzzy surfaces after short micro-breakdowns. Such sort of craters have not been observed before on any other metallic surfaces. These specific traces are formed due to unique properties of the fuzz structure. The nano-fuzz could be easily melted and vaporized by micro-breakdown current, due to its porosity and bad thermal conductivity, and formation of low conducting metallic vapour under the cathode spot causes discharge movement to the nearest place. Thus, even low current arc can easily move and leave traces, which could be easily observed by a secondary electron microscope.

  8. Asymptotic Markov inequality on Jordan arcs

    Science.gov (United States)

    Totik, V.

    2017-03-01

    Markov's inequality for the derivative of algebraic polynomials is considered on C^2-smooth Jordan arcs. The asymptotically best estimate is given for the kth derivative for all k=1,2,\\dots . The best constant is related to the behaviour around the endpoints of the arc of the normal derivative of the Green's function of the complementary domain. The result is deduced from the asymptotically sharp Bernstein inequality for the kth derivative at inner points of a Jordan arc, which is derived from a recent result of Kalmykov and Nagy on the Bernstein inequality on analytic arcs. In the course of the proof we shall also need to reduce the analyticity condition in this last result to C^2-smoothness. Bibliography: 21 titles.

  9. Seward, Alaska 3 arc-second DEM

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 3 arc-second Seward Alaska Elevation Grid provides bathymetric data in ASCII raster format of 2.67-second resolution in geographic coordinates. This grid is...

  10. Laboratory arc furnace features interchangeable hearths

    Science.gov (United States)

    Armstrong, J. L.; Kruger, O. L.

    1967-01-01

    Laboratory arc furnace using rapidly interchangeable hearths gains considerable versatility in casting so that buttons or special shaped castings can be produced. It features a sight glass for observation.

  11. Arc -furnace Flicker Compensation in Ethiopia.

    African Journals Online (AJOL)

    supply system of the Ethiopian Electric Light and ... independent of the magnitude of the arc furnace load. They were intolerable ..... Weather sealing (Important in Ethi- opia). 3. .... nace currents during the worst periods of initial melt- ing down.

  12. Sensitivity of collapsed arc QA method for delivery errors in Volumetric Modulated Arc Therapy (VMAT)

    Science.gov (United States)

    Young, Tony; Xing, Aitang; Vial, Philp; Thwaites, David; Holloway, Lois; Arumugam, Sankar

    2015-01-01

    In this paper the sensitivity of an Electronic Portal Imaging Device (EPID) to detecting introduced Volumetric Arc Therapy (VMAT) treatment errors was studied using the Collapsed Arc method. Two clinical Head and Neck (H&N) and Prostate treatment plans had gantry dependent dose and MLC errors introduced to the plans. These plans were then delivered to an Elekta Synergy Linear Accelerator EPID and compared to the original treatment planning system Collapsed Arc dose matrix. With the Collapsed Arc technique the EPID was able to detect MLC errors down to 2mm and dose errors of down to 3% depending on the treatment plan complexity and gamma tolerance used.

  13. Rapid magmatic processes accompany arc-continent collision: the Western Bismarck arc, Papua New Guinea

    Science.gov (United States)

    Cunningham, Heather; Gill, Jim; Turner, Simon; Caulfield, John; Edwards, Louise; Day, Simon

    2012-11-01

    New U-Th-Ra, major and trace element, and Sr-Nd-Pb isotope data are presented for young lavas from the New Britain and Western Bismarck arcs in Papua New Guinea. New Britain is an oceanic arc, whereas the latter is the site of an arc-continent collision. Building on a recent study of the Manus Basin, contrasts between the two arcs are used to evaluate the processes and timescales of magma generation accompanying arc-continent collision and possible slab detachment. All three suites share many attributes characteristic of arc lavas that can be ascribed to the addition of a regionally uniform subduction component derived from the subducting altered oceanic crust and sediment followed by dynamic melting of the modified mantle. However, the Western Bismarck arc lavas diverge from the Pb isotope mixing array formed by the New Britain and the Manus Basin lavas toward elevated 208Pb/204Pb. We interpret this to reflect a second and subsequent addition of sediment melt at crustal depth during collision. 238U and 226Ra excesses are preserved in all of the lavas and are greatest in the Western Bismarck arc. High-Mg andesites with high Sr/Y ratios in the westernmost arc are attributed to recent shallow mantle flux melting at the slab edge. Data for two historical rhyolites are also presented. Although these rhyolites formed in quite different tectonic settings and display different geochemical and isotopic compositions, both formed from mafic parents within millennia.

  14. Arcing flow phenomena; Visualisation des ecoulements en presence d'un arc de coupure

    Energy Technology Data Exchange (ETDEWEB)

    Rachard, H.; Mottet, C. [Schneider Electric, Centre de Recherches A2, 75 - Paris (France)

    2002-06-01

    Optical diagnostic techniques have been used for studying electric arcing phenomena at Schneider Electric for many years now, and are integrated in new-product development practice. Studies have so far focused on electric arc behaviour, but today we are especially interested in studying the interaction of an electric arc with its immediate environment, i.e. gaseous medium and neighbouring materials. This article starts by discussing the specificities of electric arcs in low-voltage circuit-breakers, then goes on to examine diagnostic methods for viewing the physical phenomena of interest. After setting out and analysing the results obtained, we conclude with details on planned upgrades targeting enhanced diagnostic performance. (author)

  15. Influence of metal vapour on arc temperatures in gas-metal arc welding: convection versus radiation

    Science.gov (United States)

    Murphy, Anthony B.

    2013-06-01

    The presence of metal vapour in gas-metal arc welding has been shown to have two strong effects on the arc plasma: a decrease in temperature throughout the arc, and the formation of a local temperature minimum near the arc axis. These effects have been attributed, on the basis of different computational models, to either the increased radiative emission associated with the presence of metal vapour in the arc plasma, or the influence of the metal vapour influx on convective flow in the arc. This question is investigated using a three-dimensional computational model in which the production and the transport of metal vapour are taken into account self-consistently. Parameters relevant to welding of thin sheets of aluminum are examined. For these conditions, it is found that the first effect (the decrease in temperature throughout the arc) is due to both the increased radiative emission and the influence of the metal vapour influx on flow. The second effect (the local temperature minimum, which in this case occurs just below the wire electrode) is a consequence of the influence of aluminum vapour produced from the wire electrode on flow in the arc. By examining published results and the energy balance in the plasma, it is shown that for welding of steel with higher arc currents, the increased radiative emission can lead to a local temperature minimum at a greater distance from the wire electrode.

  16. Basins in ARC-continental collisions

    Science.gov (United States)

    Draut, Amy E.; Clift, Peter D.; Busby, Cathy; Azor, Antonio

    2012-01-01

    Arc-continent collisions occur commonly in the plate-tectonic cycle and result in rapidly formed and rapidly collapsing orogens, often spanning just 5-15 My. Growth of continental masses through arc-continent collision is widely thought to be a major process governing the structural and geochemical evolution of the continental crust over geologic time. Collisions of intra-oceanic arcs with passive continental margins (a situation in which the arc, on the upper plate, faces the continent) involve a substantially different geometry than collisions of intra-oceanic arcs with active continental margins (a situation requiring more than one convergence zone and in which the arc, on the lower plate, backs into the continent), with variable preservation potential for basins in each case. Substantial differences also occur between trench and forearc evolution in tectonically erosive versus tectonically accreting margins, both before and after collision. We examine the evolution of trenches, trench-slope basins, forearc basins, intra-arc basins, and backarc basins during arc-continent collision. The preservation potential of trench-slope basins is low; in collision they are rapidly uplifted and eroded, and at erosive margins they are progressively destroyed by subduction erosion. Post-collisional preservation of trench sediment and trench-slope basins is biased toward margins that were tectonically accreting for a substantial length of time before collision. Forearc basins in erosive margins are usually floored by strong lithosphere and may survive collision with a passive margin, sometimes continuing sedimentation throughout collision and orogeny. The low flexural rigidity of intra-arc basins makes them deep and, if preserved, potentially long records of arc and collisional tectonism. Backarc basins, in contrast, are typically subducted and their sediment either lost or preserved only as fragments in melange sequences. A substantial proportion of the sediment derived from

  17. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  18. Where exactly are the arcs of Neptune?

    Science.gov (United States)

    Horanyi, Mihaly; Porco, Carolyn C.

    1993-12-01

    A largely neglected secular perturbation that changes the effective mean motion is noted to occur on the osculating longitude at epoch, due to periodic close encounters between arc particles of Neptune and Galatea. This perturbation is here examined both analytically and numerically. It is shown that the confinement mechanism, based on single-satellite shepherding by Galatea, remains in force at the new position of the arc-confining resonances.

  19. Study on Ceramic Cutting by Plasma Arc

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Engineering ceramics are typical difficult-to-machine materials because of high hardness and brittleness. PAC (Plasma Arc Cutting) is a very important thermal cutting process and has been successfully used in cutting stainless steel and other difficult-to-machine alloys. PAC's application in cutting ceramics, however, is still limited because the most ceramics are not good electronic conducts, and transferred plasma arc cannot be produced between cathode and work-piece. So we presented a method of plasma ...

  20. New method for capturing arc of moving on switching apparatus

    Institute of Scientific and Technical Information of China (English)

    LIU Jiao-min; WANG Jing-hong

    2007-01-01

    The switching arc that occurs in contact gap when contact of low voltage apparatus closes or breaks in electric circuit is harmful to the contacts, insulation, and reliability of electrical gear because of its very high temperature. As arcing time is very short in switching gear, it is very difficult to observe arc phenomena directly for researchers. Therefore, visualization of switching arc is important for understanding arc phenomena, to analyze the arc features, and to improve the design and reliability of switching gear. Based on analyzing the visualization methods proposed by researchers, a new switching arc capturing approach is introduced in this paper. Arc image acquisition, and image processing techniques were studied. A switching arc image acquisition and visual simulation software based on high speed CCD camera hard ware system was designed and implemented to yield enhanced arc image with good visual effect.

  1. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  2. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  3. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  4. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  5. Magnesium isotope geochemistry in arc volcanism

    Science.gov (United States)

    Teng, Fang-Zhen; Hu, Yan; Chauvel, Catherine

    2016-06-01

    Incorporation of subducted slab in arc volcanism plays an important role in producing the geochemical and isotopic variations in arc lavas. The mechanism and process by which the slab materials are incorporated, however, are still uncertain. Here, we report, to our knowledge, the first set of Mg isotopic data for a suite of arc lava samples from Martinique Island in the Lesser Antilles arc, which displays one of the most extreme geochemical and isotopic ranges, although the origin of this variability is still highly debated. We find the δ26Mg of the Martinique Island lavas varies from -0.25 to -0.10, in contrast to the narrow range that characterizes the mantle (-0.25 ± 0.04, 2 SD). These high δ26Mg values suggest the incorporation of isotopically heavy Mg from the subducted slab. The large contrast in MgO content between peridotite, basalt, and sediment makes direct mixing between sediment and peridotite, or assimilation by arc crust sediment, unlikely to be the main mechanism to modify Mg isotopes. Instead, the heavy Mg isotopic signature of the Martinique arc lavas requires that the overall composition of the mantle wedge is buffered and modified by the preferential addition of heavy Mg isotopes from fluids released from the altered subducted slab during fluid-mantle interaction. This, in turn, suggests transfer of a large amount of fluid-mobile elements from the subducting slab to the mantle wedge and makes Mg isotopes an excellent tracer of deep fluid migration.

  6. Magnesium isotope geochemistry in arc volcanism.

    Science.gov (United States)

    Teng, Fang-Zhen; Hu, Yan; Chauvel, Catherine

    2016-06-28

    Incorporation of subducted slab in arc volcanism plays an important role in producing the geochemical and isotopic variations in arc lavas. The mechanism and process by which the slab materials are incorporated, however, are still uncertain. Here, we report, to our knowledge, the first set of Mg isotopic data for a suite of arc lava samples from Martinique Island in the Lesser Antilles arc, which displays one of the most extreme geochemical and isotopic ranges, although the origin of this variability is still highly debated. We find the δ(26)Mg of the Martinique Island lavas varies from -0.25 to -0.10, in contrast to the narrow range that characterizes the mantle (-0.25 ± 0.04, 2 SD). These high δ(26)Mg values suggest the incorporation of isotopically heavy Mg from the subducted slab. The large contrast in MgO content between peridotite, basalt, and sediment makes direct mixing between sediment and peridotite, or assimilation by arc crust sediment, unlikely to be the main mechanism to modify Mg isotopes. Instead, the heavy Mg isotopic signature of the Martinique arc lavas requires that the overall composition of the mantle wedge is buffered and modified by the preferential addition of heavy Mg isotopes from fluids released from the altered subducted slab during fluid-mantle interaction. This, in turn, suggests transfer of a large amount of fluid-mobile elements from the subducting slab to the mantle wedge and makes Mg isotopes an excellent tracer of deep fluid migration.

  7. Electric arc furnace models for flicker study

    Directory of Open Access Journals (Sweden)

    Catalina González Castaño

    2016-06-01

    Full Text Available Objective: The aim of this paper is to evaluate voltage fluctuations or flicker of two electric arc furnace models through comparison with real data.Method: The first proposed model is founded on the energy conservation principle, which generates a non-linear differential equation modelling the electric arc voltage – current characteristics. Voltage fluctuations are generated using a chaotic circuit that modulates the amplitude of arc voltage. The second model is based on the empirical relationship between the arc diameter or length as well as voltage and electrical current on the arc. Voltage fluctuations are considered adding a random signal in the arc length. Both models are implemented in PSCADTM.Results: The results of both models are compared with real data taken at the most critical stage of the operation of the furnace, and they show that the model based on energy conservation has a lower average mean square error in the voltages and currents 5.6 V and 1.7 kA against 27,2 V y 3.38 kA obtained with the second model.Conclusions: Both models consider the nonlinearity and random behavior present in this type of load, validating their inclusion in computer models of electric power systems.

  8. Recent ARC developments: Through modularity to interoperability

    Energy Technology Data Exchange (ETDEWEB)

    Smirnova, O; Cameron, D; Ellert, M; Groenager, M; Johansson, D; Kleist, J [NDGF, Kastruplundsgade 22, DK-2770 Kastrup (Denmark); Dobe, P; Joenemo, J; Konya, B [Lund University, Experimental High Energy Physics, Institute of Physics, Box 118, SE-22100 Lund (Sweden); Fraagaat, T; Konstantinov, A; Nilsen, J K; Saada, F Ould; Qiang, W; Read, A [University of Oslo, Department of Physics, P. O. Box 1048, Blindern, N-0316 Oslo (Norway); Kocan, M [Pavol Jozef Safarik University, Faculty of Science, Jesenna 5, SK-04000 Kosice (Slovakia); Marton, I; Nagy, Zs [NIIF/HUNGARNET, Victor Hugo 18-22, H-1132 Budapest (Hungary); Moeller, S [University of Luebeck, Inst. Of Neuro- and Bioinformatics, Ratzeburger Allee 160, D-23538 Luebeck (Germany); Mohn, B, E-mail: oxana.smirnova@hep.lu.s [Uppsala University, Department of Physics and Astronomy, Div. of Nuclear and Particle Physics, Box 535, SE-75121 Uppsala (Sweden)

    2010-04-01

    The Advanced Resource Connector (ARC) middleware introduced by NorduGrid is one of the basic Grid solutions used by scientists worldwide. While being well-proven in daily use by a wide variety of scientific applications at large-scale infrastructures like the Nordic DataGrid Facility (NDGF) and smaller scale projects, production ARC of today is still largely based on conventional Grid technologies and custom interfaces introduced a decade ago. In order to guarantee sustainability, true cross-system portability and standards-compliance based interoperability, the ARC community undertakes a massive effort of implementing modular Web Service (WS) approach into the middleware. With support from the EU KnowARC project, new components were introduced and the existing key ARC services got extended with WS technology based standard-compliant interfaces following a service-oriented architecture. Such components include the hosting environment framework, the resource-coupled execution service, the re-engineered client library, the self-healing storage solution and the peer-to-peer information system, to name a few. Gradual introduction of these new services and client tools into the production middleware releases is carried out together with NDGF and thus ensures a smooth transition to the next generation Grid middleware. Standard interfaces and modularity of the new component design are essential for ARC contributions to the planned Universal Middleware Distribution of the European Grid Initiative.

  9. Making and breaking an Island arc: a new perspective from the Oligocene Kyushu-Palau arc

    Science.gov (United States)

    Ishizuka, O.; Taylor, R. N.; Yuasa, M.; Ohara, Y.

    2010-12-01

    The Kyushu-Palau Ridge (KPR) is a 2000km long remnant island arc that is separated from the active Izu-Bonin-Mariana (IBM) arc system by a series of spreading and rift basins. In this study we present 40Ar/39Ar ages and geochemical data for new samples taken from the entire length of the Kyushu-Palau arc. As such, this data provides the first comprehensive evaluation of temporal and spatial changes that are present in an Eocene-Oligocene island arc. Kyushu-Palau arc geochemistry is evaluated alongside new data from the conjugate arc which is stranded within the IBM fore-arc. Boninitic magmatism gave way to transitional arc suites including high-Mg andesites at c. 45 Ma (Ishizuka et al., 2006). After the transitional 45-41 Ma period, a mature arc system developed through the Eocene-Oligocene time: This volcanism is now preserved as the KPR. Dating results from 33 sites indicate that the KPR was active between 25 and 43 Ma, but the majority of the exposed volcanism occurred in the final phase of this arc, between 25 and 27 Ma. Unlike the IBM, the KPR has only limited systematic along-arc trends and does not include any of the strongly HIMU lavas found to the south of Izu-Bonin. Two components found along the KPR are found to have geochemistry that suggests an origin in the supra-subduction mantle rather than from the descending ocean crust. Firstly, in the south of the arc, EM-2-like lavas are present where the West Philippine Basin was in the final stages of spreading. Secondly, EM-1-like lavas are present in a restricted section of the arc, suggesting a localised heterogeneity. Subduction flux beneath the KPR generally imparted a Pb isotope vector towards low Δ8/4 (19). This is a similar trend to the Eocene/Oligocene lavas found on the eastern side of the basins which split the arc at 25Ma. Another geochemical heterogeneity is found at the KPR-Daito Ridge intersection where arc magmatism occurred on pre-existing Daito Ridge crust: a Cretaceous remnant arc

  10. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  11. Effect of substrate bias in nitrogen incorporated amorphous carbon films with embedded nanoparticles deposited by filtered cathodic jet carbon arc technique

    Energy Technology Data Exchange (ETDEWEB)

    Panwar, O.S., E-mail: ospanwar@mail.nplindia.ernet.in [Amorphous and Microcrystalline Silicon Solar Cell Group, Physics of Energy Harvesting Division, National Physical Laboratory (C.S.I.R.), Dr. K.S. Krishnan Road, New Delhi-110012 (India); Kumar, Sushil; Ishpal,; Srivastava, A.K.; Chouksey, Abhilasha; Tripathi, R.K.; Basu, A. [Amorphous and Microcrystalline Silicon Solar Cell Group, Physics of Energy Harvesting Division, National Physical Laboratory (C.S.I.R.), Dr. K.S. Krishnan Road, New Delhi-110012 (India)

    2012-02-15

    Highlights: Black-Right-Pointing-Pointer a-C: N films having nanoparticles were deposited by filtered cathodic jet carbon arc (FCJCA) technique. Black-Right-Pointing-Pointer The effect of negative substrate bias on the properties of a-C: N films embedded with nanoparticles have been studied. Black-Right-Pointing-Pointer The properties of a-C: N films deposited by FCJCA technique have been compared with ta-C: N films deposited by FCVA process. - Abstract: The properties of nitrogen incorporated amorphous carbon (a-C: N) films with embedded nanoparticles, deposited using a filtered cathodic jet carbon arc technique, are reported. X-ray diffraction, high resolution transmission electron microscope and Raman spectroscopy measurements reveal an amorphous structure, but on closer examination the presence of clusters of nanocarbon single crystals with d-spacing close to diamond cubic-phase have also been identified. The effect of substrate bias on the microstructure, conductivity, activation energy, optical band gap, optical constants, residual stress, hardness, elastic modulus, plastic index parameter, percentage elastic recovery and density of states of a-C: N films have been studied and the properties obtained are found to depend on the substrate bias.

  12. AC polarographic determination of cloxacillin.

    Science.gov (United States)

    Núñez-Vergara, L J; Silva, M M; Squella, J A

    1982-11-01

    Hydrolysis of cloxacillin at pH 4.0 yields an electroactive product which can be determined by polarography. Depending on the concentration of cloxacillin, one of 2 peaks was obtained: The potential ac peaks for a 4.36 mM cloxacillin solution were peak I, -0.23 V and peak II, -0.13 V. For analytical purposes, the first peak was used. A linear relationship was established for levels of cloxacillin between 2.2 X 10(-5) and 2.2 X 10(-3)M. Average recovery was 98.8% (SD 1.8), indicating satisfactory accuracy for the method. Individual capsule and composite assays as well as interference tests are described.

  13. Effects of process parameters on arc shape and penetration in twin-wire indirect arc welding

    Institute of Scientific and Technical Information of China (English)

    Shun-shan ZHANG; Mei-qing CAO; Dong-ting WU; Zeng-da ZOU

    2009-01-01

    In this study, the effects of variable parameters on arc shape and depth of penetration in twin-wire indirect arc gas shielded welding were investigated. The variation of arc shape caused by changes of the parameters was recorded by a high-speed camera,and the depths of penetration of specimen were measured after bead welding by an optical microscope. Experiments indicated that proper parameters give birth to a concentrated and compressed welcimg arc, which Would increase the depth of penetration as the incensement of the arc foice Several pnncipal parameters including toe distance ot twin wires intersecting point to base metal,the included angle,and the content of shielding gas were determined. The arc turned more concentrated and the depth of penetration increased obviously as the welding current increased,the arc turned brighter while unobvlous change of penetration occurred as the arc voltage increased,and the deepest penetration was obtained when the welding speed was 10.5 mm/s..

  14. Effect of acoustic field parameters on arc acoustic binding during ultrasonic wave-assisted arc welding.

    Science.gov (United States)

    Xie, Weifeng; Fan, Chenglei; Yang, Chunli; Lin, Sanbao

    2016-03-01

    As a newly developed arc welding method, power ultrasound has been successfully introduced into arc and weld pool during ultrasonic wave-assisted arc welding process. The advanced process for molten metals can be realized by utilizing additional ultrasonic field. Under the action of the acoustic wave, the plasma arc as weld heat source is regulated and its characteristics make an obvious change. Compared with the conventional arc, the ultrasonic wave-assisted arc plasma is bound significantly and becomes brighter. To reveal the dependence of the acoustic binding force on acoustic field parameters, a two-dimensional acoustic field model for ultrasonic wave-assisted arc welding device is established. The influences of the radiator height, the central pore radius, the radiator radius, and curvature radius or depth of concave radiator surface are discussed using the boundary element method. Then the authors analyze the resonant mode by this relationship curve between acoustic radiation power and radiator height. Furthermore, the best acoustic binding ability is obtained by optimizing the geometric parameters of acoustic radiator. In addition, three concave radiator surfaces including spherical cap surface, paraboloid of revolution, and rotating single curved surface are investigated systematically. Finally, both the calculation and experiment suggest that, to obtain the best acoustic binding ability, the ultrasonic wave-assisted arc welding setup should be operated under the first resonant mode using a radiator with a spherical cap surface, a small central pore, a large section radius and an appropriate curvature radius.

  15. GUI for studying the parameters influence of the electric arc model for a three-phase electric arc furnace

    Science.gov (United States)

    Ghiormez, L.; Prostean, O.; Panoiu, M.; Panoiu, C.

    2017-01-01

    This paper presents an analysis regarding the modeling of the behavior for a three-phase electric arc furnace installation. Therefore, a block diagram is implemented in Simulink that represents the modeling of the entire electric arc furnace installation. This block diagram contains also the modeling of the electric arc which is the element that makes the electric arc furnace behaving as a nonlinear load. The values for the model parameters of the electric arc furnace installation are like the ones from the real installation taken into consideration. Other model parameters are the electric arc model ones. In order to study the influence of the parameters of the electric arc models, it is developed a Matlab program that contains the graphical user interfaces. These interfaces make connection with the models of the electric arc implemented in Simulink. The interfaces allow the user to modify parameters for each of the electric arc model. Current and voltage of the electric arc are the variables taken into account to study the influence of the parameters on the electric arc models. Waveforms for voltage and current of the electric arc are illustrated when a parameter of the model is modified in order to analyze the importance of this parameter on the electric arc model. Also, for each of the models is presented the voltage-current characteristic of the electric arc because this characteristic gives information about the behavior of the electric arc furnace installation.

  16. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  17. Recent development of high efficiency arc welding systems in Japan

    Institute of Scientific and Technical Information of China (English)

    USHIO Masao; SUGITANI Yuji; TANAKA Manabu

    2005-01-01

    The paper describes recent trends to carry forward the automation in welding process in Japanese industries.The present situation on the introduction of computer integrated manufacturing is surveyed and its concept and relation among the constituent subsystems are shown.Also recent developments of arc welding processes and related tools are reviewed.They are as follows.1) Schematic image of the structure of computer integrated manufacturing system (CIM).2) Short descriptions for the trend of introducing CIM system.An example of multi-robot welding system in shipyard,virtual factory,network monitoring of welding quality,clarification of welder's skill.3) Development of high efficiency welding processes.Copper-less wire electrode,tandem large fillet welding,tandem pulse GMA welding,digital wire feeder with new push-pull system,overhead horizontal tandem GMA welding for ship bottom shell,one-sided fillet groove GMA welding for construction machinery,ultra-NGW hot wire GTA process,Al-alloy sheet welding with laser assisted AC pulsed MIG process.

  18. Method to reduce arc blow during DC arc welding of pipelines

    Energy Technology Data Exchange (ETDEWEB)

    Espina-Hernandez, J. H.; Rueda-Morales, G.L.; Caleyo, F.; Hallen, J. M. [Instituto Politecnico Nacional, Mexico, (Mexico); Lopez-Montenegro, A.; Perz-Baruch, E. [Pemex Exploracion y Produccion, Tabasco, (Mexico)

    2010-07-01

    Steel pipelines are huge ferromagnetic structures and can be easily subjected to arc blow during the DC arc welding process. The development of methods to avoid arc blow during pipeline DC arc welding is a major objective in the pipeline industry. This study developed a simple procedure to compensate the residual magnetic field in the groove during DC arc welding. A Gaussmeter was used to perform magnetic flux density measurements in pipelines in southern Mexico. These data were used to perform magnetic finite element simulations using FEMM. Different variables were studied such as the residual magnetic field in the groove or the position of the coil with respect to the groove. An empirical predictive equation was developed from these trials to compensate for the residual magnetic field. A new method of compensating for the residual magnetic field in the groove by selecting the number of coil turns and the position of the coil with respect to the groove was established.

  19. Research of Arc Chamber Optimization Techniques Based on Flow Field and Arc Joint Simulation

    Science.gov (United States)

    Zhong, Jianying; Guo, Yujing; Zhang, Hao

    2016-03-01

    The preliminary design of an arc chamber in the 550 kV SF6 circuit breaker was proposed in accordance with the technical requirements and design experience. The structural optimization was carried out according to the no-load flow field simulation results and verified by no-load pressure measurement. Based on load simulation results such as temperature field variation at the arc area and the tendency of post arc current under different recovery voltage, the second optimal design was completed and its correctness was certificated by a breaking test. Results demonstrate that the interrupting capacity of an arc chamber can be evaluated by the comparison of the gas medium recovery speed and post arc current growth rate.

  20. Overview of ArcGIS Engine Controls%ArcGIS Engine控件综述

    Institute of Scientific and Technical Information of China (English)

    刘磊

    2010-01-01

    ArcGIS Engine是ESRI公司发布的嵌入式地理信息系统软件开发包.基于ArcGIS Engine开发的应用程序一般有3类:独立非可视化应用程序、独立可视化应用程序和嵌入式应用程序,由于ArcGIS Engine提供了一套可复用、跨平台、设计良好的ArcGIS控件,因此利用控件开发可视化的GIS应用程序是一种常用的开发方式.重点探讨了ArcGIS Engine自带控件的功能、使用方法以及与伙伴控件之间的联系机制.

  1. BASIC THEORY AND METHOD OF WELDING ARC SPECTRAL INFORMATION

    Institute of Scientific and Technical Information of China (English)

    Li Junyue; Li Zhiyong; Li Huan; Xue Haitao

    2004-01-01

    Arc spectral information is a rising information source which can solve many problems that can not be done with arc electric information and other arc information.It is of important significance to develop automatic control technique of welding process.The basic theory and methods on it play an important role in expounding and applying arc spectral information.Using concerned equation in plasma physics and spectrum theory,a system of equations including 12 equations which serve as basic theory of arc spectral information is set up.Through analyzing of the 12 equations,a basic view that arc spectral information is the reflection of arc state and state variation,and is the most abundant information resource reflecting welding arc process is drawn.Furthermore,based on the basic theory,the basic methods of test and control of arc spectral information and points out some applications of it are discussesed.

  2. Friction properties of amorphous carbon ultrathin films deposited by filtered cathodic vacuum arc and radio-frequency sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Matlak, J.; Komvopoulos, K., E-mail: kyriakos@me.berkeley.edu

    2015-03-31

    The friction properties of ultrathin films of amorphous carbon (a-C) deposited on Si(100) substrates by filtered cathodic vacuum arc and radio-frequency sputtering were investigated by surface force microscopy. Deposition parameters yielding a-C films with high sp{sup 3} content were used to deposit films of thickness between 5 and 35 nm. The coefficient of friction of both types of a-C films was measured with a 1-μm-radius conical diamond tip and normal loads in the range of 20–640 μN. The results show a strong dependence of the friction properties on the surface roughness, thickness, and structure of the a-C films, which are influenced by the intricacies of the deposition method. The dependence of the coefficient of friction on normal load and the dominance of adhesion and plowing friction mechanisms are interpreted in terms of the through-thickness variation of carbon atom hybridization of the a-C films. - Highlights: • Comparison of nanoscale friction properties of ultrathin amorphous carbon films. • Friction dependence on film roughness, thickness, and structure (hybridization). • Effect of through-thickness changes in carbon atom hybridization on film friction. • Explanation of film friction trends in terms of competing friction mechanisms.

  3. Arc Conductance and Flow Velocity Affected by Transient Recovery Voltage

    Science.gov (United States)

    Fukuoka, Reo; Ishikawa, Yuya; Ono, Seisui; Sato, Ken; Yamamoto, Shinji; Iwao, Toru

    2016-09-01

    Recently, the stable supply of electric power is indispensable. The GCB (Gas Circuit Breaker) can prevent the spread of the fault current. However, it should have the reliability more. Therefore the GCB has been researched for performance improvement of the arc interruption of abnormal fault current without the fail. Therefore, it is important to prevent the breakdown such as the re-ignition and thermal re-ignition of arc after the arc interruption. It is necessary to reduce the arc conductance in order to prevent the re-ignition of arc. The arc conductance is derived from the temperature distribution and the volume of the arc. The temperature distribution of the arc is formed by convection. In this research, the arc conductance and flow velocity affected by transient recovery voltage are elucidated. The flow rate and temperature distribution of the arc is calculated with changing transient recovery voltage. In addition, the arc conductance is calculated in order to know the extinguish arc ability. As a result, when the transient recovery voltage increases, the probability of re-ignition increases. Therefore, the arc temperature and the arc conductance were increased.

  4. HybridArc: A novel radiation therapy technique combining optimized dynamic arcs and intensity modulation

    Energy Technology Data Exchange (ETDEWEB)

    Robar, James L., E-mail: james.robar@cdha.nshealth.ca [Department of Radiation Oncology, Dalhousie University, Halifax (Canada); Department of Physics and Atmospheric Science, Dalhousie University, Halifax (Canada); Thomas, Christopher [Department of Radiation Oncology, Dalhousie University, Halifax (Canada)

    2012-01-01

    This investigation focuses on possible dosimetric and efficiency advantages of HybridArc-a novel treatment planning approach combining optimized dynamic arcs with intensity-modulated radiation therapy (IMRT) beams. Application of this technique to two disparate sites, complex cranial tumors, and prostate was examined. HybridArc plans were compared with either dynamic conformal arc (DCA) or IMRT plans to determine whether HybridArc offers a synergy through combination of these 2 techniques. Plans were compared with regard to target volume dose conformity, target volume dose homogeneity, sparing of proximal organs at risk, normal tissue sparing, and monitor unit (MU) efficiency. For cranial cases, HybridArc produced significantly improved dose conformity compared with both DCA and IMRT but did not improve sparing of the brainstem or optic chiasm. For prostate cases, conformity was improved compared with DCA but not IMRT. Compared with IMRT, the dose homogeneity in the planning target volume was improved, and the maximum doses received by the bladder and rectum were reduced. Both arc-based techniques distribute peripheral dose over larger volumes of normal tissue compared with IMRT, whereas HybridArc involved slightly greater volumes of normal tissues compared with DCA. Compared with IMRT, cranial cases required 38% more MUs, whereas for prostate cases, MUs were reduced by 7%. For cranial cases, HybridArc improves dose conformity to the target. For prostate cases, dose conformity and homogeneity are improved compared with DCA and IMRT, respectively. Compared with IMRT, whether required MUs increase or decrease with HybridArc was site-dependent.

  5. The geochemistry and petrogenesis of the Paleoproterozoic Green Mountain arc: A composite(?), bimodal, oceanic, fringing arc

    Science.gov (United States)

    Jones, D.S.; Barnes, C.G.; Premo, W.R.; Snoke, A.W.

    2011-01-01

    The inferred subduction affinity of the ~1780-Ma Green Mountain arc, a dominantly bimodal igneous terrane (together with immature marine and volcaniclastic sedimentary rocks) accreted to the southern margin of the Wyoming province, is integral to arc-accretion models of the Paleoproterozoic growth of southern Laurentia. Conversely, the dominantly bimodal nature of many putative arc-related igneous suites throughout southern Laurentia, including the Green Mountain arc, has also been used to support models of growth by extension of pre-existing crust. We report new geochemical and isotopic data from ~1780-Ma gabbroic and granodioritic to tonalitic rocks of the Big Creek Gneiss, interpreted as consanguineous with previously studied metavolcanic rocks of the Green Mountain Formation.The ~1780-Ma Big Creek Gneiss mafic rocks show clear geochemical signatures of a subduction origin and provide no supporting evidence for extensional tectonism. The ~1780-Ma Big Creek Gneiss felsic rocks are attributed to partial melting of mafic and/or mixed lower-crustal material. The bimodal nature of the suite results from the combination of arc basalts and felsic crustal melts. The lack of andesite is consistent with the observed tholeiitic differentiation trend of the mafic magmas. The lower e{open}Nd(1780Ma) values for the felsic rocks vs. the mafic rocks suggest that the unexposed lower crust of the arc may be older than the arc and that Trans-Hudson- or Penokean-aged rocks possibly form the substratum of the arc. Our results reinforce previous interpretations that arc-related magmatism played a key role in the Paleoproterozoic crustal growth of southern Laurentia, but also support the possibility of unexposed older crust as basement to the arcs. ?? 2011 Elsevier B.V.

  6. Gas Arcs in Comet Hyakutake: Revisited

    Science.gov (United States)

    Combi, M. R.; Harris, W. M.; Kabin, K.

    2000-10-01

    The recent break-up of the nucleus of Comet LINEAR S4 demonstrates that fragmentation is an important cometary process and that it is not a rare phenomenon. Comet Hyakutake (1996 B2) underwent an outburst of gas production on March 21, 1996. Subsequent to the outburst, fragments, or condensations as they have been called, were observed moving tailward from the position of the nucleus. Arc-shaped structures were seen in images of gas species (OH, CN and C2) providing clear evidence of production of gas from cometary nucleus debris also tailward of the nucleus. We have already (Harris et al. 1997, Science 277, 676) described observations taken with the WIYN telescope consisting of a 6-hour time sequence of images on March 26, 1996 of CN and dust continuum and a single OH image showing that the arc, and by inference it's source, was generally moving tailward with the visible condensations. The entire OH arc was reproduced using a kinetic Direct Simulation Monte Carlo (DSMC) calculation for water and all its photodissociation products. DSMC is suited to this physical environment that is in transition from fluid conditions in the inner coma to free-expansion in the outer coma. Our model asuming a string of fragments within the apex of the arc (i.e., the intersection of the arc and the tailward sun-comet line) reproduced the arc. Here we present a more extensive parameter study of the arc using DSMC and a solution of the standard perfect-fluid Euler equations. We find that a secondary source just behind the apex of the arc can reproduce the OH arc, but the location of the source must be much closer to the apex than indicated by solutions of the Navier-Stokes equations (NSE) (Rodionov et al. 1998, Icarus 136, 232). We find that we must use unrealistically large collision cross sections to reproduce the NSE results, and that the NSE results are not substantially different from a simpler Euler equation approach. This work has been supported by NASA Planetary Atmospheres

  7. Plasma arc cutting technology: simulation and experiments

    Energy Technology Data Exchange (ETDEWEB)

    Cantoro, G; Colombo, V; Concetti, A; Ghedini, E; Sanibondi, P; Zinzani, F; Rotundo, F [Department of Mechanical Engineering (D.I.E.M.) and Research Center for Applied Mathematics (C.I.R.A.M.), Alma Mater Studiorum-Universita di Bologna, Via Saragozza 8, 40123 Bologna (Italy); Dallavalle, S; Vancini, M, E-mail: emanuele.ghedini@unibo.it [Cebora S.p.A., Via Andrea Costa 24, 40057 Cadriano di Granarolo (Italy)

    2011-01-01

    Transferred arc plasma torches are widely used in industrial processes for cutting of metallic materials because of their ability to cut a wide range of metals with very high productivity. The process is characterized by a transferred electric arc established between an electrode inside the torch (the cathode) and another electrode, the metallic workpiece to be cut (the anode). In order to obtain a high quality cut and a high productivity, the plasma jet must be as collimated as possible and must have the higher achievable power density. Plasma modelling and numerical simulation can be very useful tools for the designing and optimizing these devices, but research is still in the making for finding a link between simulation of the plasma arc and a consistent prevision of cut quality. Numerical modelling of the behaviour of different types of transferred arc dual gas plasma torches can give an insight on the physical reasons for the industrial success of various design and process solutions that have appeared over the last years. Diagnostics based on high speed imaging and Schlieren photography can play an important role for investigating piercing, dross generation, pilot arcing and anode attachment location. Also, the behaviour of hafnium cathodes at high current levels at the beginning of their service life can been experimentally investigated, with the final aim of understanding the phenomena that take place during those initial piercing and cutting phases and optimizing the initial shape of the surface of the emissive insert exposed to plasma atmosphere.

  8. AcEST: BP916793 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SC complexes subunit ssr2 OS=S... 66 6e-14 sp|Q9XI07|SWI3C_ARATH SWI/SNF complex subunit SWI3C OS=Arabidops...... 65 1e-12 sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidops... 66 2e-12 sp|P97496|SMRC1_MOU...2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidops... 59 9e-09 sp|Q8W475|SWI3A_ARATH SWI/SNF complex s...ional adapter ADA2 OS=Oryza sati... 47 3e-05 sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidops...... 45 2e-04 sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidops... 44 3e-04 sp|Q5ZJF3|TAD2A_C

  9. Evaluation of volumetric modulated arc therapy for cranial radiosurgery using multiple noncoplanar arcs

    Energy Technology Data Exchange (ETDEWEB)

    Audet, Chantal; Poffenbarger, Brett A.; Chang, Pauling; Jackson, Paul S.; Lundahl, Robert E.; Ryu, Stephen I.; Ray, Gordon R. [Radiation Oncology Department, Palo Alto Medical Foundation, Palo Alto, California 94301 (United States); Neurosurgery Department, Palo Alto Medical Foundation, Palo Alto, California 94301 (United States); Radiation Oncology Department, Palo Alto Medical Foundation, Palo Alto, California 94301 (United States); Neurosurgery Department, Palo Alto Medical Foundation, Palo Alto, California 94301 (United States); Radiation Oncology Department, Palo Alto Medical Foundation, Palo Alto, California 94301 (United States)

    2011-11-15

    Purpose: To evaluate a commercial volumetric modulated arc therapy (VMAT), using multiple noncoplanar arcs, for linac-based cranial radiosurgery, as well as evaluate the combined accuracy of the VMAT dose calculations and delivery. Methods: Twelve patients with cranial lesions of variable size (0.1-29 cc) and two multiple metastases patients were planned (Eclipse RapidArc AAA algorithm, v8.6.15) using VMAT (1-6 noncoplanar arcs), dynamic conformal arc (DCA, {approx}4 arcs), and IMRT (nine static fields). All plans were evaluated according to a conformity index (CI), healthy brain tissue doses and volumes, and the dose to organs at risk. A 2D dose distribution was measured (Varian Novalis Tx, HD120 MLC, 1000 MU/min, 6 MV beam) for the {approx}4 arc VMAT treatment plans using calibrated film dosimetry. Results: The CI (0-1 best) average for all plans was best for {approx}4 noncoplanar arc VMAT at 0.86 compared with {approx}0.78 for IMRT and a single arc VMAT and 0.68 for DCA. The volumes of healthy brain receiving 50% of the prescribed target coverage dose or more (V{sub 50%}) were lowest for the four arc VMAT [RA(4)] and DCA plans. The average ratio of the V{sub 50%} for the other plans to the RA(4) V{sub 50%} were 1.9 for a single noncoplanar arc VMAT [RA(1nc)], 1.4 for single full coplanar arc VMAT [RA(1f)] and 1.3 for IMRT. The V{sub 50%} improved significantly for single isocenter multiple metastases plan when two noncoplanar VMAT arcs were added to a full single coplanar one. The maximum dose to 5 cc of the outer 1 cm rim of healthy brain which one may want to keep below nonconsequential doses of 300-400 cGy, was 2-3 times greater for IMRT, RA(1nc) and RA(1f) plans compared with the multiple noncoplanar arc DCA and RA(4) techniques. Organs at risk near (0-4 mm) to targets were best spared by (i) single noncoplanar arcs when the targets are lateral to the organ at risk and (ii) by skewed nonvertical planes of IMRT fields when the targets are not lateral to the

  10. Circular arc snakes and kinematic surface generation

    KAUST Repository

    Barton, Michael

    2013-05-01

    We discuss the theory, discretization, and numerics of curves which are evolving such that part of their shape, or at least their curvature as a function of arc length, remains unchanged. The discretization of a curve as a smooth sequence of circular arcs is well suited for such purposes, and allows us to reduce evolution of curves to the evolution of a control point collection in a certain finite-dimensional shape space. We approach this evolution by a 2-step process: linearized evolution via optimized velocity fields, followed by optimization in order to exactly fulfill all geometric side conditions. We give applications to freeform architecture, including "rationalization" of a surface by congruent arcs, form finding and, most interestingly, non-static architecture. © 2013 The Author(s) Computer Graphics Forum © 2013 The Eurographics Association and Blackwell Publishing Ltd.

  11. On the proper motion of auroral arcs

    Energy Technology Data Exchange (ETDEWEB)

    Haerendel, G.; Raaf, B.; Rieger, E. (Max-Planck-Institut fuer Extraterrestrische Physik, Garching (Germany)); Buchert, S. (EISCAT Scientific Association, Kiruna (Sweden)); Hoz, C. la (Univ. of Tromso (Norway))

    1993-04-01

    The authors report on a series of measurements of the proper motion of auroral arcs, made using the EISCAT incoherent scatter radar. Radar measurements are correlated with auroral imaging from the ground to observe the arcs and sense their motion. The authors look at one to two broad classes of auroral arcs, namely the slow (approximately 100 m/s) class which are observed to move either poleward or equatorward. The other class is typically much faster, and observed to move poleward, and represents the class of events most studied in the past. They fit their observations to a previous model which provides a potential energy source for these events. The observations are consistent with the model, though no clear explanation for the actual cause of the motion can be reached from these limited measurements.

  12. Arc-welding robot. 2; Yosetsu robot

    Energy Technology Data Exchange (ETDEWEB)

    Nishikawa, S. [Yaskawa Electric Corp., Kitakyushu (Japan)

    1995-02-01

    This is an introductory lecture on the selection and handling of arc-welding robot and was explained easily in Q and A style. This is the second of its series and extraction examples of Q and A are Q: type of stations for setting works, A: fixed, slide, inversion, rotary types and their combination, Q: station type for constructing a highly universal system for a wide variety of works, A: a highly universal robot was realized owing to external shaft control function. Recently, one robot can control a maximum of 21 shafts to cope with a variety of works, Q: off-line teaching for arc-welding robot, A: yes. It is available but does not spread as much as for spot since arc welding requires a high tracing accuracy. 12 figs.

  13. ArcForm - A multimodal notation

    DEFF Research Database (Denmark)

    Allsopp, Benjamin Brink

    ArcForm (AF) is a visual notation based on a new graph-like network structure. It supports a unique approach to labeling arcs and nodes to allow diverse and grammatically normal English (or other natural language) sentences to be embedded in the network (Allsopp, 2013). In doing this AF combines ...... as a notational foundation for e-learning platforms (Allsopp 2015). We will explore a prototype supporting basic interaction with the landscape and consider how it can benefit from virtual reality, online social curating and the block chain....... of individual nodes and arcs will allow us to create new perspectives on the underlying information. This presentation will use multiple visual examples to show how AF achieves its many affordances. We will discuss how it has been used in education research (Misfeldt 2016) and how it could be used...

  14. Biocompatible Silver-containing a-C:H and a-C coatings: AComparative Study

    Energy Technology Data Exchange (ETDEWEB)

    Endrino, Jose Luis; Allen, Matthew; Escobar Galindo, Ramon; Zhang, Hanshen; Anders, Andre; Albella, Jose Maria

    2007-04-01

    Hydrogenated diamond-like-carbon (a-C:H) and hydrogen-free amorphous carbon (a-C) coatings are known to be biocompatible and have good chemical inertness. For this reason, both of these materials are strong candidates to be used as a matrix that embeds metallic elements with antimicrobial effect. In this comparative study, we have incorporated silver into diamond-like carbon (DLC) coatings by plasma based ion implantation and deposition (PBII&D) using methane (CH4) plasma and simultaneously depositing Ag from a pulsed cathodic arc source. In addition, we have grown amorphous carbon - silver composite coatings using a dual-cathode pulsed filtered cathodic-arc (FCA) source. The silver atomic content of the deposited samples was analyzed using glow discharge optical spectroscopy (GDOES). In both cases, the arc pulse frequency of the silver cathode was adjusted in order to obtain samples with approximately 5 at.% of Ag. Surface hardness of the deposited films was analyzed using the nanoindentation technique. Cell viability for both a-C:H/Ag and a-C:/Ag samples deposited on 24-well tissue culture plates has been evaluated.

  15. Magnesium isotope geochemistry in arc volcanism

    Science.gov (United States)

    Teng, Fang-Zhen; Hu, Yan

    2016-01-01

    Incorporation of subducted slab in arc volcanism plays an important role in producing the geochemical and isotopic variations in arc lavas. The mechanism and process by which the slab materials are incorporated, however, are still uncertain. Here, we report, to our knowledge, the first set of Mg isotopic data for a suite of arc lava samples from Martinique Island in the Lesser Antilles arc, which displays one of the most extreme geochemical and isotopic ranges, although the origin of this variability is still highly debated. We find the δ26Mg of the Martinique Island lavas varies from −0.25 to −0.10, in contrast to the narrow range that characterizes the mantle (−0.25 ± 0.04, 2 SD). These high δ26Mg values suggest the incorporation of isotopically heavy Mg from the subducted slab. The large contrast in MgO content between peridotite, basalt, and sediment makes direct mixing between sediment and peridotite, or assimilation by arc crust sediment, unlikely to be the main mechanism to modify Mg isotopes. Instead, the heavy Mg isotopic signature of the Martinique arc lavas requires that the overall composition of the mantle wedge is buffered and modified by the preferential addition of heavy Mg isotopes from fluids released from the altered subducted slab during fluid−mantle interaction. This, in turn, suggests transfer of a large amount of fluid-mobile elements from the subducting slab to the mantle wedge and makes Mg isotopes an excellent tracer of deep fluid migration. PMID:27303032

  16. On the Trail of Joan of Arc

    Directory of Open Access Journals (Sweden)

    Linda Joyce Forristal

    2013-12-01

    Full Text Available The year 2012 marked the 600th anniversary of the birthday of Joan of Arc (Fr., Jeanne d’Arc (1412–1431. Tributes to this national heroine can be found all over France. There are literally countless statues, streets and restaurants named after her and many sites dedicated to her life. However, despite widespread social and mechanical reproduction and cultural naming in relation to the Maid of Orléans, there is no official network or integrated signage in France to promote cultural heritage tourism to the numerous Joan of Arc sites and festivals, even though her life and death, by any measure, were seminal events in the country’s history. Unfortunately, the pilgrim who wants to follow or intersect with Joan of Arc’s trail through France, for cultural, historical or religious reasons, must do so without much help. Using Actor Network Theory and Site Sacralization Theory as framing devices, this paper explores human actors and tangible and intangible non-human factors that may have contributed to the lack of a unified tourism product despite the existence of an adequate Joan of Arc tourismscape. Insights gleaned from this research include Joan’s conflicted status as both/either saint and/or patriot, the existence of no cooperation or linkage between Joan of Arc sites, and cautious French tourism development policies. Several possible scenarios are suggested as suitable means to help implement or foster the creation of an on-the-ground or virtual Joan of Arc trail or tour.

  17. Arcing Model of a Disconnector and its Effect on VFTO

    Science.gov (United States)

    Lin, Xin; Wang, Na; Xu, Jianyuan

    2013-07-01

    In the computational process of very fast transient over-voltage (VFTO), it is essential to find an accurate model for a gas insulated substation. The arcing model of the disconnector is particularly important. The general arcing model is not able to give a good description of the arc development process. In this paper, based on the physical process of arcing and existing arc models (the exponential time-varying resistance model and the segmental arcing models), a dynamic arcing model is proposed, which is divided into two stages before and after the zero crossing. The dynamic arcing model combines hyperbola time-varying resistance and the Mayr model to describe the dynamic process of arcing. The present paper creates an arc model blockset upon the Matlab/Simulink software platform. Moreover for a specific 1100 kV station, VFTO is simulated in detail based on different arcing models. It is demonstrated that the dynamic arcing model can describe the physical arc process precisely and is useful for improving the accuracy of VFTO simulations.

  18. Ion source based on the cathodic arc

    Science.gov (United States)

    Sanders, David M.; Falabella, Steven

    1994-01-01

    A cylindrically symmetric arc source to produce a ring of ions which leave the surface of the arc target radially and are reflected by electrostatic fields present in the source to a point of use, such as a part to be coated. An array of electrically isolated rings positioned in the source serves the dual purpose of minimizing bouncing of macroparticles and providing electrical insulation to maximize the electric field gradients within the source. The source also includes a series of baffles which function as a filtering or trapping mechanism for any macroparticles.

  19. Plasma distribution of cathodic ARC deposition system

    Energy Technology Data Exchange (ETDEWEB)

    Anders, S.; Raoux, S.; Krishnan, K.; MacGill, R.A.; Brown, I.G. [Lawrence Berkeley National Lab., CA (United States)

    1996-08-01

    The plasma distribution using a cathodic arc plasma source with and without magnetic macroparticle filter has been determined by depositing on a transparent plastic substrate and measuring the film absorption. It was found that the width of the distribution depends on the arc current, and it also depends on the cathode material which leads to a spatial separation of the elements when an alloy cathode is used. By applying a magnetic multicusp field near the exit of the magnetic filter, it was possible to modify the plasma distribution and obtain a flat plasma profile with a constant and homogeneous elemental distribution.

  20. Architectural Surfaces and Structures from Circular Arcs

    KAUST Repository

    Shi, Ling

    2013-12-01

    In recent decades, the popularity of freeform shapes in contemporary architecture poses new challenges to digital design. One of them is the process of rationalization, i.e. to make freeform skins or structures affordable to manufacture, which draws the most attention from geometry researchers. In this thesis, we aim to realize this process with simple geometric primitives, circular arcs. We investigate architectural surfaces and structures consisting of circular arcs. Our focus is lying on how to employ them nicely and repetitively in architectural design, in order to decrease the cost in manufacturing. Firstly, we study Darboux cyclides, which are algebraic surfaces of order ≤ 4. We provide a computational tool to identify all families of circles on a given cyclide based on the spherical model of M ̈obius geometry. Practical ways to design cyclide patches that pass through certain inputs are presented. In particular, certain triples of circle families on Darboux cyclides may be suitably arranged as 3-webs. We provide a complete classification of all possible 3-webs of circles on Darboux cyclides. We then investigate the circular arc snakes, which are smooth sequences of circu- lar arcs. We evolve the snakes such that their curvature, as a function of arc length, remains unchanged. The evolution of snakes is utilized to approximate given surfaces by circular arcs or to generated freeform shapes, and it is realized by a 2-step pro- cess. More interestingly, certain 6-arc snake with boundary constraints can produce a smooth self motion, which can be employed to build flexible structures. Another challenging topic is approximating smooth freeform skins with simple panels. We contribute to this problem area by approximating a negatively-curved 5 surface with a smooth union of rational bilinear patches. We provide a proof for vertex consistency of hyperbolic nets using the CAGD approach of the rational B ́ezier form. Moreover, we use Darboux transformations for the

  1. Using arc voltage to locate the anode attachment in plasma arc cutting

    Science.gov (United States)

    Osterhouse, D. J.; Lindsay, J. W.; Heberlein, J. V. R.

    2013-06-01

    Plasma arc cutting is a widely used industrial process in which an electric arc in the form of a high velocity plasma jet is used to melt and blow away metal. The arc attaches inside the resulting cut slot, or kerf, where it both provides a large heat flux and determines the flow dynamics of the plasma. Knowledge of the position of the arc attachment is essential for understanding the phenomena present at the work piece. This work presents a new method of measuring the location of the arc attachment in which the arc voltage is measured during the cutting of a range of work piece thicknesses. The attachment location is then interpreted from the voltages. To support the validity of this method, the kerf shape, dross particle size and dross adhesion to the work piece are also observed. While these do not conclusively give an attachment location, they show patterns which are consistent with the attachment location found from the voltage measurements. The method is demonstrated on the cutting of mild steel, where the arc attachment is found to be stationary in the upper portion of the cut slot and in reasonable agreement with existing published findings. For a process optimized for the cutting of 12.7 mm mild steel, the attachment is found at a depth of 1.5-3.4 mm. For a slower process optimized for the cutting of 25.4 mm mild steel, the attachment is found at a depth of 3.4-4.8 mm, which enhances heat transfer further down in the kerf, allowing cutting of the thicker work piece. The use of arc voltage to locate the position of the arc attachment is unique when compared with existing methods because it is entirely independent of the heat distribution and visualization techniques.

  2. The multilayered structure of ultrathin amorphous carbon films synthesized by filtered cathodic vacuum arc deposition

    KAUST Repository

    Wang, Na

    2013-08-01

    The structure of ultrathin amorphous carbon (a-C) films synthesized by filtered cathodic vacuum arc (FCVA) deposition was investigated by high-resolution transmission electron microscopy, electron energy loss spectroscopy, and x-ray photoelectron spectroscopy. Results of the plasmon excitation energy shift and through-thickness elemental concentration show a multilayered a-C film structure comprising an interface layer consisting of C, Si, and, possibly, SiC, a buffer layer with continuously increasing sp 3 fraction, a relatively thicker layer (bulk film) of constant sp 3 content, and an ultrathin surface layer rich in sp 2 hybridization. A detailed study of the C K-edge spectrum indicates that the buffer layer between the interface layer and the bulk film is due to the partial backscattering of C+ ions interacting with the heavy atoms of the silicon substrate. The results of this study provide insight into the minimum thickness of a-C films deposited by FCVA under optimum substrate bias conditions. Copyright © 2013 Materials Research Society.

  3. Synthesis and characterization of silver-carbon nanoparticles produced by high-current pulsed arc

    Energy Technology Data Exchange (ETDEWEB)

    Maya, F., E-mail: fermr@correo.unam.m [Departamento de Microscopia Electronica, Centro de Investigacion en Materiales Avanzados, Miguel de Cervantes 120, Chihuahua, Chih., CP 3110 (Mexico); Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, 04510 (Mexico); Muhl, S.; Pena, O. [Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, 04510 (Mexico); Miki-Yoshida, M. [Departamento de Microscopia Electronica, Centro de Investigacion en Materiales Avanzados, Miguel de Cervantes 120, Chihuahua, Chih., CP 3110 (Mexico)

    2009-12-31

    In this paper, we report the formation of silver-carbon encapsulated metal nanoparticles (EMN's) using a high-current pulsed arc system in an argon atmosphere. The deposits were studied by Optical Extinction Spectroscopy (OES), X-ray diffraction (XRD) and Transmission Electron Microscopy (TEM); the chemical analysis of the deposits was performed using Energy Dispersion X-ray spectroscopy (EDX). Using the total nanoparticle diameter, the bulk crystalline density of silver and an estimate amorphous carbon (a-C) density we have calculated the size of the silver nucleus and the thickness of the a-C coating as a function of the argon gas pressure. The OES spectra of the EMN's exhibited two peaks characteristic of the Surface Plasmon Resonance (SPR) of elongated/very close silver nanoparticles; a subsequent thermal annealing strongly increased the SPR peaks. The double peak SPR spectra were modeled using calculations based on the existence of silver nanoparticles in the form of prolate spheroids. The main advantage of our preparation method is that the metal nanoparticles are encapsulated in a-C from the beginning and this layer acts as an efficient chemical barrier.

  4. Memory effect in ac plasma displays

    Science.gov (United States)

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  5. ESD and secondary arcing powered by the solar array -Toward full arc-free power lines

    OpenAIRE

    Payan, D.; Inguimbert, V; Siguier, J.M.

    2016-01-01

    International audience; We crossed all the experiments made over 15 years at ONERA during CNES R&D activities; we made hundreds of secondary arcing on Solar Panels or coupons, connectors, SADM1 or simple aged cracked wires. Thanks to the knowledge we have, from ESD2 or secondary arc triggering, to the analysis of in-flight anomalies; we deduct very simple design rules reducing drastically the probability of secondary arcing.Let’s follow the trail of the power line to find where there would be...

  6. Cross-arc Variations in Lava Chemistry in the Tonga Arc-Lau Back Arc System, 19- 23°S

    Science.gov (United States)

    Michael, P. J.; Bezos, A.; Langmuir, C. H.; Escrig, S.; Matzen, A. K.; Asimow, P.; Arculus, R.

    2007-12-01

    The Tonga arc system from 19°-23°S consists of the active Tofua arc, the Eastern Lau Spreading Center (ELSC; a back arc spreading center), and numerous seamounts between them. We use the excellent sampling of ELSC and 34 nearby seamounts, along with sparser published analyses of Tofua arc, to examine the spatial relations of chemistry and melting in this subduction system. The spatial constraints can be used to better understand the nature and mechanism of enrichment that is caused by subduction. Geochemistry along the axis of ELSC is related to its distance to the Tofua arc, which decreases continuously from 100 km in the north to 40 km in the south. The subduction influence (e.g., fluid mobile elements) along ELSC increases in several sharp gradients towards the south as ELSC gets closer to the arc. The six different tectonic segments of ELSC display mixing relationships in trace element ratio-ratio diagrams (e.g., Ba/La vs Th/La) in which one end member is a subduction component that is distinctive for each segment (Escrig et al., this meeting). We explore whether the distinctive subduction components of each ELSC segment are reflected by the Tofua arc that is adjacent to that segment, and by the intervening seamounts. Relationships between the arc, back arc and seamounts are different in the north and the south. In the south where the arc-back arc distance is smaller, the Tofua arc volcanic rocks share the distinctive trace element characteristics of their corresponding ELSC segment, and extend the mixing trajectories to higher, more arc-like values. Seamounts that are located between Tofua arc and ELSC also share the distinctive trace element characteristics of the local arc + back-arc, and are intermediate in their trace element ratios. These observations are consistent with the model of Langmuir et al., (2006) in which magmas of back arc spreading centers form from two components: a dry side similar to mid-ocean ridges and a wet (trenchward) side that

  7. Modeling Vacuum Arcs On Spacecraft Solar Panel Arrays Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Spacecraft charging and subsequent vacuum arcing poses a significant threat to satellites in LEO and GEO plasma conditions. Localized arc discharges can cause a...

  8. PNW River Reach Files -- 1:100k Watercourses (arcs)

    Data.gov (United States)

    Pacific States Marine Fisheries Commission — This feature class includes the ARC features from the 2001 version of the PNW River Reach files Arc/INFO coverage. Separate, companion feature classes are also...

  9. Radiotherapy with volumetric modulated arc therapy for hepatocellular carcinoma patients ineligible for surgery or ablative treatments

    Energy Technology Data Exchange (ETDEWEB)

    Wang, P.M.; Chung, N.N.; Chang, F.L. [Cheng-Ching General Hospital, Taichung, Taiwan (China). Dept. of Radiation Oncology; Hsu, W.C. [Cheng-Ching General Hospital, Taichung, Taiwan (China). Dept. of Radiation Oncology; Asia Univ., Taichung, Taiwan (China). Dept. of Healthcare Administration; Fogliata, A.; Cozzi, L. [Oncology Institute of Southern Switzerland, Bellinzona (Switzerland)

    2013-04-15

    The aim of this article is to report the dosimetric and clinical findings in the treatment of primary hepatocellular carcinoma (HCC) with volumetric modulated arc therapy (VMAT, RapidArc). A total of 138 patients were investigated. Dose prescription ranged from 45-66 Gy. Most patients (88.4 %) presented AJCC stage III or IV and 83 % were N0-M0. All were classified as Barcelona Clinic Liver Cancer (BCLC) stage A-C. All patients were treated using 10 MV photons with single or multiple, coplanar or non-coplanar arcs, and cone-down technique in case of early response of tumors. The patients' median age was 66 years (range 27-87 years), 83 % were treated with 60 Gy (12 % at 45 Gy, 6 % at 66 Gy), 62 % with cone-down, 98 % with multiple arcs. The mean initial planning target volume (PTV) was 777 {+-} 632 cm{sup 3}; the mean final PTV (after the cone-down) was 583 {+-} 548 cm{sup 3}. High target coverage was achieved. The final PTV was V{sub 98%} > 98 %. Kidneys received on average 5 and 8 Gy (left and right), while the maximum dose to the spinal cord was 22 Gy; mean doses to esophagus and stomach were 23 Gy and 15 Gy, respectively. The average volume of healthy liver receiving more than 30 Gy was 294 {+-} 145 cm{sup 3}. Overall survival at 12 months was 45 %; median survival was 10.3 months (95 % confidence interval 7.2-13.3 months). Actuarial local control at 6 months was 95 % and 93.7 % at 12 months. The median follow-up was 9 months and a maximum of 28 months. This study showed from the dosimetric point of view the feasibility and technical appropriateness of RapidArc for the treatment of HCC. Clinical results were positive and might suggest, with appropriate care, to consider RapidArc as an additional therapeutic opportunity for these patients. (orig.)

  10. Supersonic Vortex Gerdien Arc with Magnetic Thermal Insulation

    Science.gov (United States)

    Winterberg, F.

    1988-02-01

    Temperatures up to ~ 5 x 104 oK have been obtained with water vortex Gerdien arcs, and temperatures of ~ 105oK have been reached in hydrogen plasma arcs with magnetic thermal insulation through an externally applied strong magnetic field. It is suggested that a further increase in arc temperatures up to 106oK can conceivably be attained by a combination of both techniques, using a Gerdien arc with a supersonic hydrogen gas vortex.

  11. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  12. Remote electrical arc suppression by laser filamentation

    CERN Document Server

    Schubert, Elise; Kasparian, Jérôme; Wolf, Jean-Pierre

    2015-01-01

    We investigate the interaction of narrow plasma channels formed in the filamentation of ultrashort laser pulses, with a DC high voltage. The laser filaments prevent electrical arcs by triggering corona that neutralize the high-voltage electrodes. This phenomenon, due to the electric field modulation and free electron release around the filament, opens new prospects to lightning and over-voltage mitigation.

  13. Hypergravity effects on glide arc plasma

    NARCIS (Netherlands)

    Šperka, J.; Souček, P.; van Loon, J.J.W.A.; Dowson, A.; Schwarz, C.; Krause, J.; Kroesen, G.; Kudrle, V.

    2013-01-01

    The behaviour of a special type of electric discharge - the gliding arc plasma - has been investigated in hypergravity (1g-18g) using the Large Diameter Centrifuge (LDC) at ESA/ESTEC. The discharge voltage and current together with the videosignal from a fast camera have been recorded during the exp

  14. Arc discharge sliding over a conducting surface

    NARCIS (Netherlands)

    Goor, van F.A.; Mitko, S.V.; Ochkin, V.N.; Paramonov, A.P.; Witteman, W.J.

    1997-01-01

    Results of experimental and theoretical studies of the arc discharge which slides over the surface of a conductor are reported. Experiments were performed in air and argon ambients at various pressures. It is found that the velocity of the discharge plasma front depends linearly on the strength of t

  15. Roadmap for the ARC Grid Middleware

    DEFF Research Database (Denmark)

    Kleist, Josva; Eerola, Paula; Ekelöf, Tord

    2006-01-01

    The Advanced Resource Connector (ARC) or the NorduGrid middleware is an open source software solution enabling production quality computational and data Grids, with special emphasis on scalability, stability, reliability and performance. Since its first release in May 2002, the middleware is depl...

  16. ArcAid Interactive Archery Assistant

    Directory of Open Access Journals (Sweden)

    Jeroen Vervaeke

    2015-12-01

    Full Text Available This paper describes the design process of a bow aiming system, called ArcAid, which is an interactive archery assistant. The main goal of ArcAid is to introduce a way for beginner Robin Hoods to learn the art of archery to its fullest. In order to achieve this goal, our smartphone-based design focuses on a fun and interactive learning process that gives constant feedback to the user on how to hit a certain goal. A SPIKE high- end laser sensor is used for the distance measurement and the smartphone’s accelerometer is used to define the angle of inclination. To measure the force on the arrow and the displacement of the string, a flex sensor is attached upon one of the arcs of the bow. All sensor data is processed in an Arduino Nano microprocessor and feedback to the user is given by a dedicated smartphone app. In this paper, we mainly focus on the construction, mechanics and electronics of the ArcAid bow and on the design of the mobile app, which is the game controller. Furthermore, we briefly discuss some future development ideas.

  17. Nonlinear Study of Industrial Arc Spring Dampers

    DEFF Research Database (Denmark)

    Lahriri, Said; Santos, Ilmar; Hartmann, Henning

    2011-01-01

    The objective of this paper is to present a numerical approach for analyzing parameter excited vibrations on a gas compressor, induced by the nonlinear characteristic of the arc spring feature of certain designs of squeeze film dampers, SFDs. The behavior of the journal is studied in preparation ...

  18. Gas tungsten arc welder with electrode grinder

    Science.gov (United States)

    Christiansen, David W.; Brown, William F.

    1984-01-01

    A welder for automated closure of fuel pins by a gas tungsten arc process in which a rotating length of cladding is positioned adjacent a welding electrode in a sealed enclosure. An independently movable axial grinder is provided in the enclosure for refurbishing the used electrode between welds.

  19. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  20. H2O and CO2 in magmas from the Mariana arc and back arc systems

    Science.gov (United States)

    Newman, Sally; Stolper, Edward; Stern, Robert

    2000-05-01

    We examined the H2O and CO2 contents of glasses from lavas and xenoliths from the Mariana arc system, an intraoceanic convergent margin in the western Pacific, which contains an active volcanic arc, an actively spreading back arc basin, and active behind-the-arc cross-chain volcanoes. Samples include (1) glass rims from Mariana arc, Mariana trough, and cross-chain submarine lavas; (2) glass inclusions in arc and trough phenocrysts; and (3) glass inclusions from a gabbro + anorthosite xenolith from Agrigan (Mariana arc). Glass rims of submarine arc lavas contain 0.3-1.9 wt % H2O, and CO2 is below detection limits. Where they could be compared, glass inclusions in arc phenocrysts contain more H2O than their host glasses; most arc glasses and phenocryst inclusions contain no detectable CO2, with the exception of those from a North Hiyoshi shoshonite, which contains 400-600 ppm. The glass inclusions from the Agrigan xenolith contain 4-6% H2O, and CO2 is below the detection limit. Glasses from the cross-chain lavas are similar to those from the arc: H2O contents are 1.4-1.7 wt %, and CO2 is below detection limits. Volatile contents in Mariana trough lava glass rims are variable: 0.2-2.8 wt % H2O and 0-300 ppm CO2. Glass inclusions from trough phenocrysts have water contents similar to the host glass, but they can contain up to 875 ppm CO2. Volatile contents of melt inclusions from trough and arc lavas and from the xenolith imply minimum depths of crystallization of ~1-8 km. H2O and CO2 contents of Mariana trough glasses are negatively correlated, indicating saturation of the erupting magma with a CO2-H2O vapor at the pressure of eruption (~400 bars for these samples), with the vapor ranging from nearly pure CO2 at the CO2-rich end of the glass array to nearly pure H2O at the H2O-rich end. Degassing of these magmas on ascent and eruption leads to significant loss of CO2 (thereby masking preeruptive CO2 contents) but minimal disturbance of preeruptive H2O contents. For

  1. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  2. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Energy Technology Data Exchange (ETDEWEB)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  3. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  4. 29 CFR 1910.254 - Arc welding and cutting.

    Science.gov (United States)

    2010-07-01

    ..., hoists, and elevators shall not be used to carry welding current. (iv) Where a structure, conveyor, or... following limits shall not be exceeded: (i) Alternating-current machines (A) Manual arc welding and cutting...-current machines (A) Manual arc welding and cutting—100 volts. (B) Automatic (machine or mechanized) arc...

  5. Evaluation of the clinical usefulness of modulated Arc treatment

    CERN Document Server

    Lee, Young Kyu; Kim, Yeon Sil; Choi, Byung Ock; Nam, Sang Hee; Park, Hyeong Wook; Kim, Shin Wook; Shin, Hun Joo; Lee, Jae Choon; Kim, Ji Na; Park, Sung Kwang; Kim, Jin Young; Kang, Young-Nam

    2015-01-01

    The purpose of this study is to evaluate the clinical usefulness of modulated arc (mARC) treatment techniques. The mARC treatment plans of the non-small cell lung cancer (NSCLC) patients were performed in order to verify the clinical usefulness of mARC. A pre study was conducted to find the most competent plan condition of mARC treatment and the usefulness of mARC treatment plan was evaluated by comparing it with the other Arc treatment plans such as Tomotherapy and RapidArc. In the case of mARC, the optimal condition for the mARC plan was determined by comparing the dosimetric performance of the mARC plans with the use of various parameters. The various parameters includes the photon energies (6 MV, 10 MV), optimization point angle (6{\\deg}-10{\\deg} intervals), and total segment number (36-59 segment). The best dosimetric performance of mARC was observed at 10 MV photon energy and the point angle 6 degree, and 59 segments. The each treatment plans of three different techniques were compared with the followin...

  6. Process characteristics of fibre-laser-assisted plasma arc welding

    Energy Technology Data Exchange (ETDEWEB)

    Mahrle, A; Schnick, M; Rose, S; Demuth, C; Beyer, E; Fuessel, U, E-mail: achim.mahrle@iws.fraunhofer.de [Dresden University of Technology, Institute of Surface and Manufacturing Technology, PO Box, D-01062 Dresden (Germany)

    2011-08-31

    Experimental and theoretical investigations on fibre-laser-assisted plasma arc welding (LAPW) were performed. Welding experiments were carried out on aluminium and steel sheets. In the case of a highly focused laser beam and a separate arrangement of plasma torch and laser beam, high-speed video recordings of the plasma arc and corresponding measurements of the time-dependent arc voltage revealed differences in the process behaviour for both materials. In the case of aluminium welding, a sharp decline in arc voltage and stabilization and guiding of the anodic arc root was observed whereas in steel welding the arc voltage was slightly increased after the laser beam was switched on. However, significant improvement of the melting efficiency with the combined action of plasma arc and laser beam was achieved for both types of material. Theoretical results of additional numerical simulations of the arc behaviour suggest that the properties of the arc plasma are mainly influenced not by a direct interaction with the laser radiation but by the laser-induced evaporation of metal. Arc stabilization with increased current densities is predicted for moderate rates of evaporated metal only whereas metal vapour rates above a certain threshold causes a destabilization of the arc and reduced current densities along the arc axis.

  7. Optimal planning strategy among various arc arrangements for prostate stereotactic body radiotherapy with volumetric modulated arc therapy technique

    Directory of Open Access Journals (Sweden)

    Kang Sang Won

    2017-03-01

    Full Text Available The aim of this study was to determine the optimal strategy among various arc arrangements in prostate plans of stereotactic body radiotherapy with volumetric modulated arc therapy (SBRT-VMAT.

  8. Anatomy of Intra-Oceanic Arc Systems

    Science.gov (United States)

    Stern, R. J.

    2007-12-01

    Intra-oceanic arc systems (IOAS) are ultimately embedded in orogenic belts and added to the continental crust. Reconstructing fossil IOASs in collision zones requires understanding the salient features of a typical IOAS. IOASs have the relative dimensions of tagliatelle (flat) pasta: much wider (~250 km) than thick (10-30 km), much longer (1000's of km) than wide. IOASs begin to form when subduction begins, either spontaneously (SNSZ) or by forced convergence (INSZ). For SNSZ, IOASs start as broad zones of seafloor spreading associated with subsidence of the adjacent lithosphere, whereas INSZ IOASs are built on trapped crust. IOAS magmatism manifests the evolution of its subduction zone and indirectly the breadth of the subducted ocean. Two stages in SNSZ IOAS magmato-tectonic evolution exist: infancy and maturity. Infancy lasts 5-10 Ma and results in broad zones of seafloor spreading of tholeiite/boninite; this becomes forearc for the mature IOAS and is emplaced as ophiolite during collision (subduction zone failure). Arc maturity begins with true subduction, as the subducted slab reaches depths ~130 km, focusing magmatism to begin building the magmatic arc ~200km away from the trench and allowing the forearc to cool and hydrate. Mature magmatic arcs mostly yield low-K tholeiitic and medium-K calc-alkaline magmas. Magmatic focusing begins crustal thickening beneath the magmatic arc, at ~500m/Ma for the Izu-Bonin-Mariana IOAS. No systematic compositional evolution to more LIL-enriched primitive magmas occurs once IOAS maturity is reached, except when upper plate stress regime (BAB formation, strike- slip faulting) or the nature of subducted material (more/different sediments, young oceanic crust) changes. Thickening is accompanied by processing of crust beneath the magmatic arc, with progressive differentiation into upper volcanic, middle tonalitic, and lower mafic layers, producing an increasingly effective density filter for magma ascent. Crustal layer formation

  9. Bulk arc strain, crustal thickening, magma emplacement, and mass balances in the Mesozoic Sierra Nevada arc

    Science.gov (United States)

    Cao, Wenrong; Paterson, Scott; Saleeby, Jason; Zalunardo, Sean

    2016-03-01

    Quantifying crustal deformation is important for evaluating mass balance, material transfer, and the interplay between tectonism and magmatism in continental arcs. We present a dataset of >650 finite strain analyses compiled from published works and our own studies with associated structural, geochronologic, and geobarometric information in central and southern Sierra Nevada, California, to quantify the arc crust deformation. Our results show that Mesozoic tectonism results in 65% arc-perpendicular bulk crust shortening under a more or less plane strain condition. Mesozoic arc magmatism replaced ∼80% of this actively deforming arc crust with plutons requiring significantly greater crustal thickening. We suggest that by ∼85 Ma, the arc crust thickness was ∼80 km with a 30-km-thick arc root, resulting in a ∼5 km elevation. Most tectonic shortening and magma emplacement must be accommodated by downward displacements of crustal materials into growing crustal roots at the estimated downward transfer rate of 2-13 km/Myr. The downward transfer of crustal materials must occur in active magma channels, or in "escape channels" in between solidified plutons that decrease in size with time and depth resulting in an increase in the intensity of constrictional strain with depth. We argue that both tectonism and magmatism control the thickness of the crust and surface elevation with slight modification by surface erosion. The downward transported crustal materials initially fertilize the MASH zone thus enhancing to the generation of additional magmas. As the crustal root grows it may potentially pinch out and cool the mantle wedge and thus cause reduction of arc magmatism.

  10. Electric-arc synthesis of soot with high content of higher fullerenes in parallel arc

    Science.gov (United States)

    Dutlov, A. E.; Nekrasov, V. M.; Sergeev, A. G.; Bubnov, V. P.; Kareev, I. E.

    2016-12-01

    Soot with a relatively high content of higher fullerenes (C76, C78, C80, C82, C84, C86, etc.) is synthesized in a parallel arc upon evaporation of pure carbon electrodes. The content of higher fullerenes in soot extract amounts to 13.8 wt % when two electrodes are simultaneously burnt in electric-arc reactor. Such a content is comparable with the content obtained upon evaporation of composite graphite electrodes with potassium carbonate impurity.

  11. The arc arises: The links between volcanic output, arc evolution and melt composition

    Science.gov (United States)

    Brandl, Philipp A.; Hamada, Morihisa; Arculus, Richard J.; Johnson, Kyle; Marsaglia, Kathleen M.; Savov, Ivan P.; Ishizuka, Osamu; Li, He

    2017-03-01

    Subduction initiation is a key process for global plate tectonics. Individual lithologies developed during subduction initiation and arc inception have been identified in the trench wall of the Izu-Bonin-Mariana (IBM) island arc but a continuous record of this process has not previously been described. Here, we present results from International Ocean Discovery Program Expedition 351 that drilled a single site west of the Kyushu-Palau Ridge (KPR), a chain of extinct stratovolcanoes that represents the proto-IBM island arc, active for ∼25 Ma following subduction initiation. Site U1438 recovered 150 m of oceanic igneous basement and ∼1450 m of overlying sediments. The lower 1300 m of these sediments comprise volcaniclastic gravity-flow deposits shed from the evolving KPR arc front. We separated fresh magmatic minerals from Site U1438 sediments, and analyzed 304 glass (formerly melt) inclusions, hosted by clinopyroxene and plagioclase. Compositions of glass inclusions preserve a temporal magmatic record of the juvenile island arc, complementary to the predominant mid-Miocene to recent activity determined from tephra layers recovered by drilling in the IBM forearc. The glass inclusions record the progressive transition of melt compositions dominated by an early 'calc-alkalic', high-Mg andesitic stage to a younger tholeiitic stage over a time period of 11 Ma. High-precision trace element analytical data record a simultaneously increasing influence of a deep subduction component (e.g., increase in Th vs. Nb, light rare earth element enrichment) and a more fertile mantle source (reflected in increased high field strength element abundances). This compositional change is accompanied by increased deposition rates of volcaniclastic sediments reflecting magmatic output and maturity of the arc. We conclude the 'calc-alkalic' stage of arc evolution may endure as long as mantle wedge sources are not mostly advected away from the zones of arc magma generation, or the rate of

  12. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  13. THE IMPACT OF ARCS MOTIVATION MODEL ON MOTIVATION AND SUCCESS LEVEL OF PRIMARY 4TH GRADE STUDENTS IN SOCIAL STUDIES

    OpenAIRE

    Mustafa TAHİROĞLU

    2015-01-01

    The purpose of this study is to detect the impact of a teaching-learning process, structured taking the components of ARCS Motivation Model into consideration, on the motivation and success level of primary grade 4 students in social studies. In scope of the study, grouped pretest-posttest testing model is used. The experimental group consists of 32, and the control group 30 students. In order to collect research data, the “Grade 4 and 5 Social Studies Motivation Scale” and “Social Studies Ac...

  14. Oceanic, island arc, and back-arc remnants into eastern Kamchatka accretionary complexes

    Energy Technology Data Exchange (ETDEWEB)

    Fedorchuk, A.V.; Vishnevskaya, V.S.; Izvekov, I.N. (Institute of the Lithosphere, Moscow (USSR))

    1990-06-01

    The Kamchatsky Mts. accretionary complex in the Eastern Kamchatka orogenic belt was studied for identification of the oceanic and suprasubduction components into accretionary wedges. That complex is divided into two tectonic units. The Lower unit is formed sedimentary and tectonic melanges containing arc-related components (Late Senonian volcaniclastics and boninitic gabbro) and oceanic fragments (Fe-Ti-tholeiites, ocean island basalts, and pelagic sediments of Valanginian to Turonian age). The Upper unit consists of ductile deformed oceanic cumulates from troctolites to Fe-Ti-gabbro, 151 to 172 Ma, which are intruded MORB-like diabases with suprasubduction characteristics, 122 to 141 Ma, and are overlain by basalts similar to latter. The Lower and Upper units are separated by a SW-dipping thrust, which is related by an ophiolitoclastic olistostrome of Late Campanian to Early Maestrichtian age. Both units are covered by Paleocene authoclastic deposits. They are all thrusted over the early Neogene island arc complex, 16 to 20 Ma. The Lower unit of the Kamchatsky Mys accretionary complex was originated in a shear zone between a Late Cretaceous island arc and an Early Cretaceous oceanic plate. The Upper unit represents a Jurassic oceanic remnant that formed a basement of Early Cretaceous back-arc or fore-arc basin. Both units were superposed in the latest Cretaceous. The Kamchatsky Mys accretionary complex was emplaced into the Eastern Kamchatka orogenic belt during late Neogene by collision of the early Neogene island arc.

  15. Investigation of the AC Plasma Torch Working Conditions for the Plasma Chemical Applications

    Science.gov (United States)

    Safronov, A. A.; Vasilieva, O. B.; Dudnik, J. D.; E Kuznetsov, V.; Shiryaev, V. N.; Subbotin, D. I.; Pavlov, A. V.

    2017-04-01

    The presented design and parameters of a three-phase AC plasma torch with the power up to 500 kW, flow rate of air 30-50 g/s (temperature up to 5000 K) could be used in different plasma chemical processes. Range of measured plasma temperature is 3500-5000 K. The paper presents investigations of the plasma torch operation modes for its application in plasma chemical technologies. Plasma chemical technologies for various purposes (processing, destruction of various wastes, including technological and hazardous waste, conversion or production of chemicals to obtain nanoscale materials, etc.) are very promising in terms of the process efficiency. Their industrial use is difficult due to the lack of inexpensive and reliable plasma torches providing the desired level of temperature, enthalpy of the working gas and other necessary conditions for the process. This problem can be solved using a considered design of a three-phase alternating current plasma torch with power of 150-500 kW with working gas flow rate of 30-50 g/s with mass average temperature up to 5000K on the basis of which an industrial plasma chemical plant can be created. The basis of the plasma torch operation is a railgun effect that is the principle of arc movement in the field of its own current field. Thanks to single supply of power to the arc, arcs forming in the discharge chamber of the plasma torch move along the electrodes under the action of electrodynamic forces resulting from the interaction of the arc current with its own magnetic field. Under the condition of the three-phase supply voltage, arc transits from the electrode to the electrode with change in the anodic and cathodic phases with frequency of 300 Hz. A special feature of this design is the ability to organize the movement of the arc attachment along the electrode, thus ensuring an even distribution of the thermal load and thus achieve long time of continuous operation of the plasma torch. The parameters of the plasma jet of the

  16. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  17. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  18. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  19. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  20. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  1. Driven Motion and Instability of an Atmospheric Pressure Arc

    Energy Technology Data Exchange (ETDEWEB)

    Max Karasik

    1999-12-01

    Atmospheric pressure arcs are used extensively in applications such as welding and metallurgy. However, comparatively little is known of the physics of such arcs in external magnetic fields and the mechanisms of the instabilities present. In order to address questions of equilibrium and stability of such arcs, an experimental arc furnace is constructed and operated in air with graphite cathode and steel anode at currents 100-250 A. The arc is diagnosed with a gated intensified camera and a collimated photodiode array, as well as fast voltage and current probes.

  2. VLT/NACO observations of Neptune's ring arcs

    Science.gov (United States)

    Renner, S.; Sicardy, B.; Souami, D.; Dumas, C.

    2011-10-01

    We present NACO adaptative optics observations of Neptune's ring arcs at 2.2 μm (K band), taken with the VLT-Yepun telescope in August 2007. We give improved mean motion values for the arcs and Galatea, thus confirming the mismatch between the arcs' position and the location of the 42:43 corotation inclination resonance. We compare the photometry of the arcs with previous observations. We finally use the data to constrain the masses and positions of the coorbital satellites which could confine the arcs, while allowing a slow evolution of the system.

  3. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  4. NTWV-based sensing keyhole dimension in plasma arc welding

    Institute of Scientific and Technical Information of China (English)

    Jia Chuanbao; Wu Chuansong; Zhang Yuming

    2008-01-01

    During stable keyhole plasma arc welding, the pilot arc and the transferred arc exist at the meantime, and the arcs can be considered as a composition of two parts inside and outside the nozzle, respectively. Under the mechanical constriction and thermal contraction effects, the inside arc has certain arc length, electron density and arc profile etc. Inducing constant tungsten-to-nozzle voltage. However, the arc outside the nozzle diverges at about 5 degrees and has certain characteristics similar to the free arcs. The nozzle-to-workpiece voltage (NTWV) depends mainly on the length of the arc, which gets bigger as increasing of the weld penetration and keyhole size. The NTWV sensor is developed for monitoring NTWV in real time. The welding experiments are designed to get different penetrations and keyhole sizes. It is found that as the weld penetration and the keyhole size increase, NTWV also increases linearly. The NTWV signals can be used as the feedback variable in automatic control of keyhole plasma arc welding.

  5. BASIC THEORY AND APPLICATIONS OF WELDING ARC SPECTRAL INFORMATION

    Institute of Scientific and Technical Information of China (English)

    LI Junyue; XUE Haitao; LI Huan; SONG Yonglun

    2007-01-01

    Welding arc spectral information is a rising welding Information source. In some occasion, it can reflect many physical phenomena of welding process and solve many problems that cannot be done with arc electric information, acoustic information and other arc information. It is of important significance in developing automatic control technique of welding process and other similar process. Many years study work on welding arc spectral information of the anthor are discussed from three aspects of theory, method and application. Basic theory, view and testing methods of welding arc spectral information has been put forward. In application aspects, many applied examples, for example, monitoring of harmful gases in arc (such as hydrogen and nitrogen) with the method of welding arc spectral information; welding arc spectral imaging of thc welding pool which is used in automatic seam tracking; controlling of welding droplet transfer with welding arc spectral information and so on, are introduced. Especially, the successful application in real time controlling of welding droplet transfer in pulsed GMAW is introduced too. These application examples show that the welding arc spectral information has great applied significance and development potentialities. These content will play an important role in applying and spreading welding arc spectral information technology.

  6. On the arc structures of the Saturnian kilometric radiation

    Science.gov (United States)

    Boudjada, M. Y.; Galopeau, P. H. M.; Rucker, H. O.; Voller, W.

    2012-09-01

    We report on the analysis of the dynamic spectra of the Saturnian kilometric radiation (SKR) recorded by the Cassini Radio and Plasma Wave Science Experiment (RPWS) in the frequency range from 100 kHz to about 1 MHz. We investigate the Saturnian kilometric spectra recorded by RPWS experiment from 01st Jan. 2004 to 31st Dec. 2007. Different Saturnian 'sources' can be defined by spectral characteristics. We show that the SKR presents different kinds of arc structures. Those arcs may be classified in two sets: the 'vertex early arcs' (VEA) and the 'vertex late arcs' (VLA). The arcs of the first group set open toward increasing time, while the arcs of the other one open towards decreasing time. A total of 556 arcs have been observed during the four investigated years, where 310 and 246 correspond, respectively, to the vertex early and late arcs. The arc occurrences are mainly observed when the spacecraft was close to the apoapses, and also when the Cassini latitude was in the range -20° and +20°. Similar VEA and VLA arc structures have been reported in the case of the Jovian hectometric (HOM) and decametric (DAM) radio emissions. In this contribution we put emphasis on the common and unusual arc features by comparing the auroral emissions related to Jupiter and Saturn.

  7. Series and parallel arc-fault circuit interrupter tests.

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Jay Dean; Fresquez, Armando J.; Gudgel, Bob; Meares, Andrew

    2013-07-01

    While the 2011 National Electrical Codeª (NEC) only requires series arc-fault protection, some arc-fault circuit interrupter (AFCI) manufacturers are designing products to detect and mitigate both series and parallel arc-faults. Sandia National Laboratories (SNL) has extensively investigated the electrical differences of series and parallel arc-faults and has offered possible classification and mitigation solutions. As part of this effort, Sandia National Laboratories has collaborated with MidNite Solar to create and test a 24-string combiner box with an AFCI which detects, differentiates, and de-energizes series and parallel arc-faults. In the case of the MidNite AFCI prototype, series arc-faults are mitigated by opening the PV strings, whereas parallel arc-faults are mitigated by shorting the array. A range of different experimental series and parallel arc-fault tests with the MidNite combiner box were performed at the Distributed Energy Technologies Laboratory (DETL) at SNL in Albuquerque, NM. In all the tests, the prototype de-energized the arc-faults in the time period required by the arc-fault circuit interrupt testing standard, UL 1699B. The experimental tests confirm series and parallel arc-faults can be successfully mitigated with a combiner box-integrated solution.

  8. Discharge Characteristics of DC Arc Water Plasma for Environmental Applications

    Institute of Scientific and Technical Information of China (English)

    LI Tianming; Sooseok CHOI; Takayuki WATANABE

    2012-01-01

    A water plasma was generated by DC arc discharge with a hafnium embedded rodtype cathode and a nozzle-type anode. The discharge characteristics were examined by changing the operation parameter of the arc current. The dynamic behavior of the arc discharge led to significant fluctuations in the arc voltage and its frequency. Analyses of the high speed image and the arc voltage waveform showed that the arc discharge was in the restrike mode and its frequency varied within several tens of kilohertz according to the operating conditions. The larger thermal plasma volume was generated by the higher flow from the forming steam with a higher restrike frequency in the higher arc current conditions. In addition, the characteristics of the water plasma jet were investigated by means of optical emission spectroscopy to identify the abundant radicals required in an efficient waste treatment process.

  9. Minimum-fuel rocket trajectories involving intermediate-thrust arcs

    Science.gov (United States)

    Breakwell, J. V.; Dixon, J. F.

    1975-01-01

    The optimal trajectories in the neighborhood of an optimal intermediate-thrust arc are investigated for the minimum-fuel orbit rendezvous problem with fixed specific impulse. Since such an arc is singular, the thrust acceleration magnitude being the singular control component, a second-variation analysis leads to the identification of a field of neighboring, singular arcs in a state space of dimension four rather than six, provided that a suitable Jacobi condition is met. A given neighboring initial six-dimensional state vector does not generally lie on a neighboring singular arc, and junction onto the appropriate singular arc must be accomplished by a short period of strong variations in the acceleration. The neighboring singular arc meets the final condition in 4 dimensions, rather than 6 dimensions, and rendezvous must be completed by another, terminal short period of strong variations in the acceleration. Implications for midcourse guidance near a singular arc are discussed.

  10. Impedance Spectroscopy Study of the AC Conductivity and Dielectric properties of 3, 5-Dimethylpyridine-Iodine Charge Transfer Complex

    Directory of Open Access Journals (Sweden)

    Uttam Mohan

    2016-05-01

    Full Text Available Solid charge transfer complex of n-donor 3, 5-dimethylpyridine (3, 5-Lutidine with σ acceptor iodine was prepared and characterised by using elemental analysis, UV-Vis, FTIR, 1H NMR spectroscopy and powder XRD techniques. The electrical parameters of the prepared complex in the pellet form were studied at various temperatures and at wide frequency range by employing AC complex impedance spectroscopic technique. The Nyquist (cole-cole plots have been successfully explained by employing (RC(RC(RC equivalent circuit corresponding to grain , grain boundary and electrode contributions. The radii of the semicircular arc decrease with increase in temperature which suggests that the material exhibits negative temperature coefficient of resistance (NTCR behaviour like semiconductors. Dielectric constant, ɛ′ and dielectric loss, ɛ″ seems to decrease sharply with increase in frequency. The ac conductivity obeys the power law of frequency.

  11. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift

  12. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  13. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  14. Numerical modeling of transferred arc melting bath heating; Modelisation numerique du chauffage de bains par arc transfere

    Energy Technology Data Exchange (ETDEWEB)

    Bouvier, A. [Electricite de France, 77 - Moret sur Loing (France). Direction des Etudes et Recherches; Trenty, L.; Guillot, J.B. [Ecole Centrale de Paris, Laboratoire EM2C. CNRS, 92 - Chatenay-Malabry (France); Delalondre, C. [Electricite de France (EDF), 78 - Chatou (France). Direction des Etudes et Recherches

    1997-12-31

    This paper presents the modeling of a transferred electric arc inside a bath of melted metal. After a recall of the context of the study, the problem of the modeling, which involves magnetohydrodynamic coupling inside the arc and the bath, is described. The equations that govern the phenomena inside the arc and the bath are recalled and the approach used for the modeling of the anode region of the arc is explained using a 1-D sub-model. The conditions of connection between arc and bath calculations are explained and calculation results obtained with a 200 kW laboratory furnace geometry are presented. (J.S.) 8 refs.

  15. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  16. Plasma Arc Augmented CO2 laser welding

    DEFF Research Database (Denmark)

    Bagger, Claus; Andersen, Mikkel; Frederiksen, Niels

    2001-01-01

    In order to reduce the hardness of laser beam welded 2.13 mm medium strength steel CMn 250, a plasma arc has been used simultaneously with a 2.6 kW CO2 laser source. In a number of systematic laboratory tests, the plasma arc current, plasma gas flow and distance to the laser source were varied...... with all laser parameters fixed. The welds were quality assessed and hardness measured transversely to the welding direction in the top, middle and root of the seam. In the seams welded by laser alone, hardness values between 275 and 304 HV1 were measured, about the double of the base material, 150 HV1...

  17. Hybrid Arc Cell Studies: Status Report

    Energy Technology Data Exchange (ETDEWEB)

    Berg J. S.

    2012-09-28

    I report on the status, at the end of FY12, of the studies of an arc cell for a hybrid synchrotron accelerating from 375 GeV/c to 750 GeV/c in momentum. Garren produced a complete lattice that gives a good outline of the structure of a hybrid synchrotron lattice. It is, however, lacking in some details: it does not maintain a constant time of flight, it lacks chromaticity correction, its cell structure is not ideal for removing aberrations from chromaticity correction, and it probably needs more space between magnets. I have begun studying cell structures for the arc cells to optimize the lattice performance and cost. I present some preliminary results for two magnets per half cell. I then discuss difficulties encountered, some preliminary attempts at resolving them, and the future plans for this work.

  18. Examining properties of arc sprayed nanostructured coatings

    Directory of Open Access Journals (Sweden)

    A. Czupryński

    2016-04-01

    Full Text Available The article presents the results of examining properties of arc sprayed coating obtained with nano-alloy on the iron matrix with a high amount of fine carbide precipitates sprayed on non-alloyed steel plates intended for high temperature operation. Powder metal cored wire EnDOtec DO*390N 1,6 mm diameter, was used to produce, dense, very high abrasion and erosion resistant coatings approx. 1,0 mm thick. Nano-material coatings characterization was done to determine abrasion resistance, erosion resistance, adhesion strength, hardness as well as metallographic examinations. Results have proved high properties of arc sprayed nano-material coatings and have shown promising industrial applications.

  19. A pulsed cathodic arc spacecraft propulsion system

    Energy Technology Data Exchange (ETDEWEB)

    Neumann, P R C; Bilek, M M M; Tarrant, R N; McKenzie, D R [School of Physics, University of Sydney, NSW 2006 Australia (Australia)

    2009-11-15

    We investigate the use of a centre-triggered cathodic arc as a spacecraft propulsion system that uses an inert solid as a source of plasma. The cathodic vacuum arc produces almost fully ionized plasma with a high exhaust velocity (>10{sup 4} m s{sup -1}), giving a specific impulse competitive with other plasma or ion thrusters. A centre trigger design is employed that enables efficient use of cathode material and a high pulse-to-pulse repeatability. We compare three anode geometries, two pulse current profiles and two pulse durations for their effects on impulse generation, energy and cathode material usage efficiency. Impulse measurement is achieved through the use of a free-swinging pendulum target constructed from a polymer material. Measurements show that impulse is accurately controlled by varying cathode current. The cylindrical anode gave the highest energy efficiency. Cathode usage is optimized by choosing a sawtooth current profile. There is no requirement for an exhaust charge neutralization system.

  20. Filtered cathodic arc deposition apparatus and method

    Science.gov (United States)

    Krauss, Alan R.

    1999-01-01

    A filtered cathodic arc deposition method and apparatus for the production of highly dense, wear resistant coatings which are free from macro particles. The filtered cathodic arc deposition apparatus includes a cross shaped vacuum chamber which houses a cathode target having an evaporable surface comprised of the coating material, means for generating a stream of plasma, means for generating a transverse magnetic field, and a macro particle deflector. The transverse magnetic field bends the generated stream of plasma in the direction of a substrate. Macro particles are effectively filtered from the stream of plasma by traveling, unaffected by the transverse magnetic field, along the initial path of the plasma stream to a macro particle deflector. The macro particle deflector has a preformed surface which deflects macro particles away from the substrate.

  1. Electrical Safety and Arc Flash Protections

    Energy Technology Data Exchange (ETDEWEB)

    R. Camp

    2008-03-04

    Over the past four years, the Electrical Safety Program at PPPL has evolved in addressing changing regulatory requirements and lessons learned from accident events, particularly in regards to arc flash hazards and implementing NFPA 70E requirements. This presentation will discuss PPPL's approaches to the areas of electrical hazards evaluation, both shock and arc flash; engineered solutions for hazards mitigation such as remote racking of medium voltage breakers, operational changes for hazards avoidance, targeted personnel training and hazard appropriate personal protective equipment. Practical solutions for nominal voltage identification and zero voltage checks for lockout/tagout will also be covered. Finally, we will review the value of a comprehensive electrical drawing program, employee attitudes expressed as a personal safety work ethic, integrated safety management, and sustained management support for continuous safety improvement.

  2. The singing arc: the oldest memristor?

    CERN Document Server

    Ginoux, Jean-Marc

    2014-01-01

    On April 30th 2008, the journal Nature announced that the missing circuit element, postulated thirty-seven years before by Professor Leon O. Chua has been found. Thus, after the capacitor, the resistor and the inductor, the existence of a fourth fundamental element of electronic circuits called "memristor" was established. In order to point out the importance of such a discovery, the aim of this article is first to propose an overview of the manner with which the three others have been invented during the past centuries. Then, a comparison between the main properties of the singing arc, i.e. a forerunner device of the triode used in Wireless Telegraphy, and that of the memristor will enable to state that the singing arc could be considered as the oldest memristor.

  3. Effect of cathode model on arc attachment for short high-intensity arc on a refractory cathode

    Science.gov (United States)

    Javidi Shirvan, Alireza; Choquet, Isabelle; Nilsson, Håkan

    2016-12-01

    Various models coupling the refractory cathode, the cathode sheath and the arc at atmospheric pressure exist. They assume a homogeneous cathode with a uniform physical state, and differ by the cathode layer and the plasma arc model. However even the most advanced of these models still fail in predicting the extent of the arc attachment when applied to short high-intensity arcs such as gas tungsten arcs. Cathodes operating in these conditions present a non-uniform physical state. A model taking into account the first level of this non-homogeneity is proposed based on physical criteria. Calculations are done for 5 mm argon arcs with a thoriated tungsten cathode. The results obtained show that radiative heating and cooling of the cathode surface are of the same order. They also show that cathode inhomogeneity has a significant effect on the arc attachment, the arc temperature and pressure. When changing the arc current (100 A, 200 A) the proposed model allows predicting trends observed experimentally that cannot be captured by the homogeneous cathode model unless restricting a priori the size of the arc attachment. The cathode physics is thus an important element to include to obtain a comprehensive and predictive arc model.

  4. Water-vortex-stabilized electric arc: III. Radial energy transport, determination of water-vapour-boundary and arc performance

    Science.gov (United States)

    Jenista, Jirí

    2003-12-01

    This paper is concerned with numerical modelling of an electric arc stabilized by a water vortex. The two-dimensional axisymmetric model presented includes the arc discharge area between the cathode and the outlet nozzle of the water plasma torch. The aims of the numerical simulations are: (1) to assess the influence of radial position of the water-vapour-boundary in the discharge chamber on arc performance and overall radial energy transport within the arc; (2) to determine the most probable mass flow rates and radii of the water-vapour-boundary in the discharge chamber for a prescribed current; (3) to demonstrate arc performance for two radiation models involved; and (4) to estimate validity of local thermodynamic equilibrium (LTE) conditions within the arc column. The rate of evaporation of water is calculated from the conduction and radiation heat fluxes at the water vapour surface for the specified mass flow rate. The behaviour of such an arc has been studied for a range of current 300-600 A. It is shown that changes of bulk magnitudes of different terms in the momentum and energy equations within the arc column as a function of arc radius enable us to reveal transitions of temperature and velocity fields from one steady state to a qualitatively different one. The best fit between experiment and numerical simulation for all currents exists for the mean arc radius ~3.3 mm. Deviations from LTE within the arc column are estimated with the criteria for kinetic equilibrium and spatial temperature gradients.

  5. Evaluation of the graphite electrode arc melter for processing heterogeneous waste

    Energy Technology Data Exchange (ETDEWEB)

    O' Connor, William K.; Turner, Paul C.; Soelberg, N.R. (Idaho National Engineering Laboratory); Anderson, G.L. (Idaho National Engineering Laboratory)

    1996-01-01

    The U.S. Bureau of Mines (USBM) conducted a series of 4 demonstration melting tests in a 3-phase AC graphite electrode arc furnace at its Albany Research Center (ALRC) thermal treatment facility in Albany, Oregon (now part of the U.S. Department of Energy, DOE). The scope of these tests provides a unique opportunity to evaluate a single melting technology regarding its applicability to the treatment of several different heterogeneous mixed wastes. The current system can continuously process combustible-bearing wastes at feedrates to 682 kg/h (1,500 lb/h), continuously tap slag or glass, and intermittently tap metal products, and includes a close-coupled thermal oxidizer and air pollution control system (APCS). The 4 demonstration melting tests were conducted in cooperation with the American Society of Mechanical Engineers (ASME), the Idaho National Engineering Laboratory (INEL), and the Westinghouse Hanford Company (WHC).

  6. Compensation for Power Quality Improvement in Electric Arc Furnace with Considering Economic Index

    Directory of Open Access Journals (Sweden)

    Ghazanfar Shahgholian

    2012-03-01

    Full Text Available In recent years, on the one hand with increasing application of nonlinear loads in power systems and no sinusoidal currents that extracted from system, and on the other hand increasing loads sensitive to power quality and destructive effects of nonlinear loads on power quality of power systems, compensation these loads has been converted to one of the main issues in power systems. The use of flexible AC transmission system (FACTS devices is one of the most progressive methods which are used for improving power quality. In this paper, series and parallel compensators of static synchronous compensator (STATCOM and dynamic voltage restorer (DVR are introduced and the comparison of these two in compensating of power quality phenomena from electric arc furnace is provided. STATCOM is a shunt active filter and DVR is a series active filter. Method which has been selected for control of every one of these devices is an optimal control way that it minimizes power losses.

  7. PSYCHOSOMATIC "ARC" IN THE PSYCHOTHERAPEUTIC PRACTICE

    OpenAIRE

    Ivanka Boncheva

    2012-01-01

    The psychoneuroimmunology, the new brain science and the endocrinology today show a lot of results, with which symptoms are better to understand. The psychotherapeutic practice shows the ways to influence them by encoding the levels of bounding between the physical symptom and the psychological condition. The aim of the study was to show the encoding of the psychosomatic arc within a real psychotherapeutic contact. 59 psychotherapeutic cases are followed. 33 of them were with somatoform disor...

  8. Vacuum arc on the polycrystalline silica cathode

    Directory of Open Access Journals (Sweden)

    D. V. Duhopel'nikov

    2014-01-01

    Full Text Available Thin films of silica and its compounds are used in modern technology to produce Li-ion batteries, wear-resistant and protective coatings, thin-films insulators, etc. This coating is produced with CVD methods, with magnetron sputtering systems or with electron-beam evaporation. The vacuum arc evaporation method, presently, is not used.The paper demonstrates a possibility for a long-term operation of vacuum arc evaporator with polycrystalline silica-aluminum alloy (90% of silica cathode and with magnetic system to create a variable form of arch-like magnetic field on the cathode surface. It was shown that archlike configuration of magnetic field provides a stable discharge and uniform cathode spots moving with the velocities up to 5 m/s with magnetic fields induction about 10 mT. Thus, there is no local melting of the cathode, and this provides its long-term work without chips, cracks and destruction. Cathodes spots move over the cathode surface leaving t big craters with melted edges on its surface. The craters size was 150-450μm. The cathode spot movement character and the craters on the cathode surface were like the spots movement, when working on the copper or aluminum cathodes. With the magnetic field induction less than 1 mT, the cathode spots movement was the same as that of on the silica mono-crystal without magnetic field. Thus, the discharge volt-ampere characteristics for different values of magnetic fields were obtained. Voltampere characteristics were increasing and were shifted to the higher voltage with increasing magnetic field. The voltage was 18.7-26.5 V for the arc current 30-140 A.So, it was confirmed that vacuum arc evaporation method could be used for effective evaporation of silica and silica-based alloys and for thin films deposition of this materials.

  9. Submarine volcanoes along the Aegean volcanic arc

    Science.gov (United States)

    Nomikou, Paraskevi; Papanikolaou, Dimitrios; Alexandri, Matina; Sakellariou, Dimitris; Rousakis, Grigoris

    2013-06-01

    The Aegean volcanic arc has been investigated along its offshore areas and several submarine volcanic outcrops have been discovered in the last 25 years of research. The basic data including swath bathymetric maps, air-gun profiles, underwater photos and samples analysis have been presented along the four main volcanic groups of the arc. The description concerns: (i) Paphsanias submarine volcano in the Methana group, (ii) three volcanic domes to the east of Antimilos Volcano and hydrothermal activity in southeast Milos in the Milos group, (iii) three volcanic domes east of Christiana and a chain of about twenty volcanic domes and craters in the Kolumbo zone northeast of Santorini in the Santorini group and (iv) several volcanic domes and a volcanic caldera together with very deep slopes of several volcanic islands in the Nisyros group. The tectonic structure of the volcanic centers is described and related to the geometry of the arc and the neotectonic graben structures that usually host them. The NE-SW direction is dominant in the Santorini and Nisyros volcanic groups, located at the eastern part of the arc, where strike-slip is also present, whereas NW-SE direction dominates in Milos and Methana at the western part, where co-existence of E-W disrupting normal faults is observed. The volcanic relief reaches 1100-1200 m in most cases. This is produced from the outcrops of the volcanic centers emerging usually at 400-600 m depth and ending either below sea level or at high altitudes of 600-700 m on the islands. Hydrothermal activity at relatively high temperatures observed in Kolumbo is remarkable whereas low temperature phenomena have been detected in the Santorini caldera around Kameni islands and in the area southeast of Milos. In Methana and Nisyros, hydrothermal activity seems to be limited in the coastal areas without other offshore manifestations.

  10. Next generation high productivity submerged arc welding

    OpenAIRE

    LANGENOJA, MARKUS; Öhrvall Karlsson, Vincent

    2012-01-01

    The task of designing concepts for the next generation of submerged arc welding heads was given by ESAB. ESAB is a global company manufacturing welding equipment for a wide span of industries and uses. In October 2011, ESAB introduced a new technology called Integrated Cold Electrode™, abbreviated and trademarked as ICE™. ICE™ is a technique which utilizes three electrodes in a highly productive and stable process. The current state of the ICE™ technique focuses on welding thick plates with c...

  11. Multi-colour detection of gravitational arcs

    Science.gov (United States)

    Maturi, Matteo; Mizera, Sebastian; Seidel, Gregor

    2014-07-01

    Strong gravitational lensing provides fundamental insights into the understanding of the dark matter distribution in massive galaxies, galaxy clusters, and the background cosmology. Despite their importance, few gravitational arcs have been discovered so far. The urge for more complete, large samples and unbiased methods of selecting candidates increases. Several methods for the automatic detection of arcs have been proposed in the literature, but large amounts of spurious detections retrieved by these methods force observers to visually inspect thousands of candidates per square degree to clean the samples. This approach is largely subjective and requires a huge amount of checking by eye, especially considering the actual and upcoming wide-field surveys, which will cover thousands of square degrees. In this paper we study the statistical properties of the colours of gravitational arcs detected in the 37 deg2 of the CFHTLS-Archive-Research Survey (CARS). Most of them lie in a relatively small region of the (g' - r', r' - i') colour-colour diagram. To explain this property, we provide a model that includes the lensing optical depth expected in a ΛCDM cosmology that, in combination with the sources' redshift distribution of a given survey, in our case CARS, peaks for sources at redshift z ~ 1. By furthermore modelling the colours derived from the spectral energy distribution of the galaxies that dominate the population at that redshift, the model reproduces the observed colours well. By taking advantage of the colour selection suggested by both data and model, we automatically detected 24 objects out of 90 detected by eye checking. Compared with the single-band arcfinder, this multi-band filtering returns a sample complete to 83% and a contamination reduced by a factor of ~6.5. New gravitational arc candidates are also proposed.

  12. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  13. Plasma ARC keyhole welding of aluminum

    Science.gov (United States)

    Fostervoll, H.

    1993-02-01

    An increasing and more advanced use of aluminum as a construction material make higher demands to the effectiveness and quality in aluminum joining. Furthermore, if the advantages of aluminum shall be exploited in the best possible way, it is necessary to use the best processes available for the certain application. Today, the most widely used processes of aluminum welding are gas metal arc welding (GMAW) and gas tungsten arc welding (GTAW). Plasma arc welding (PAW) is another interesting process, which is rather newly adopted for aluminum welding. However, up to now the use is limited and most of the users are within the space industry in USA (NASA); also the new space industry in Europe has adopted the process. The reason for the great interest for PAW in the space industry is, according to NASA, higher weld quality and less repair costs, less heat distortion, and less groove preparations costs. Of these reasons, PAW should also be of interest for the aluminum industry in Scandinavia. The aim of the project is to focus on the possibilities and to some extent testing the PAW process.

  14. Longitudinal development of a substorm brightening arc

    Directory of Open Access Journals (Sweden)

    K. Shiokawa

    2009-05-01

    Full Text Available We present simultaneous THEMIS-ground observations of longitudinal (eastward extension of a substorm initial-brightening arc at Gillam (magnetic latitude: 65.6° at 08:13 UT on 10 January 2008. The speed of the eastward arc extension was ~2.7 km/s. The extension took place very close to the footprints of the longitudinally separated THEMIS E and D satellites at ~12 RE. The THEMIS satellites observed field dipolarization, weak earthward flow, and pressure increase, which propagated eastward from E to D at a speed of ~50 km/s. The THEMIS A satellite, located at 1.6 RE earthward of THEMIS E, observed fluctuating magnetic field during and after the dipolarization. The THEMIS E/D observations suggest that the longitudinal extension of the brightening arc at substorm onset is caused by earthward flow braking processes which produce field dipolarization and pressure increase propagating in longitude in the near-earth plasma sheet.

  15. Arc melter demonstration baseline test results

    Energy Technology Data Exchange (ETDEWEB)

    Soelberg, N.R.; Chambers, A.G.; Anderson, G.L.; Oden, L.L.; O`Connor, W.K.; Turner, P.C.

    1994-07-01

    This report describes the test results and evaluation for the Phase 1 (baseline) arc melter vitrification test series conducted for the Buried Waste Integrated Demonstration program (BWID). Phase 1 tests were conducted on surrogate mixtures of as-incinerated wastes and soil. Some buried wastes, soils, and stored wastes at the INEL and other DOE sites, are contaminated with transuranic (TRU) radionuclides and hazardous organics and metals. The high temperature environment in an electric arc furnace may be used to process these wastes to produce materials suitable for final disposal. An electric arc furnace system can treat heterogeneous wastes and contaminated soils by (a) dissolving and retaining TRU elements and selected toxic metals as oxides in the slag phase, (b) destroying organic materials by dissociation, pyrolyzation, and combustion, and (c) capturing separated volatilized metals in the offgas system for further treatment. Structural metals in the waste may be melted and tapped separately for recycle or disposal, or these metals may be oxidized and dissolved into the slag. The molten slag, after cooling, will provide a glass/ceramic final waste form that is homogeneous, highly nonleachable, and extremely durable. These features make this waste form suitable for immobilization of TRU radionuclides and toxic metals for geologic timeframes. Further, the volume of contaminated wastes and soils will be substantially reduced in the process.

  16. Spiraling Fermi arcs in Weyl materials

    Science.gov (United States)

    Li, Songci; Andreev, Anton

    In Weyl materials the valence and conduction electron bands touch at an even number of isolated points in the Brillouin zone. In the vicinity of these points the electron dispersion is linear and may be described by the massless Dirac equation. This results in nontrivial topology of Berry connection curvature. One of its consequences is the existence of peculiar surface electron states whose Fermi surfaces form arcs connecting projections of the Weyl points onto the surface plane. Band bending near the boundary of the crystal also produces surface states. We show that in Weyl materials band bending near the crystal surface gives rise to spiral structure of energy surfaces of arc states. The corresponding Fermi surface has the shape of a spiral that winds about the projection of the Weyl point onto the surface plane. The direction of the winding is determined by the helicity of the Weyl point and the sign of the band bending potential. For close valleys arc state morphology may be understood in terms of avoided crossing of oppositely winding spirals. This work is supported by the U.S. Department of Energy Office of Science, Basic Energy Sciences under Award Number DE-FG02-07ER46452.

  17. GlidArc-assisted processing of biogas

    Energy Technology Data Exchange (ETDEWEB)

    Czernichowski, A.; Wesolowska, K. (ECP, La Ferte St Aubin (France)), Email: echph@wanadoo.fr

    2009-07-01

    Power generation or chemical applications of biogas can be difficult when CH{sub 4} content is too low and / or in the presence of sulphur compounds. We therefore propose two reformers based on electric discharges (GlidArc) that strike directly either in a poor biogas or in waste CO{sub 2} + H{sub 2}S mixture generated during biogas cleaning. Direct application of GlidArc discharges to the poor biogas enhances its flammability through a partial conversion of CH{sub 4} + CO{sub 2} into hydrogen and carbon monoxide (synthesis gas). Any level of sulphur (and other impurities) is accepted. Roughly 40 % of injected electric power is transferred into upgraded biogas as its additional chemical enthalpy. A few percent of resultant H{sub 2} and CO inside the biogas makes it more flammable, and therefore better to fuel an engine or gas turbine. As a result of biogas purification via amines-washing technologies, one gets concentrated pollutants in CO{sub 2} matrix. Instead of classical neutralisation, we propose H{sub 2}Svalorisation through the SulfArc process converting all H{sub 2}S into additional amounts of synthesis gas, while neutral elemental sulphur is removed from the system. Generated syngas can be injected into the main biogas flow to enhance its flammability. (orig.)

  18. Arc-Induced Long Period Fiber Gratings

    Directory of Open Access Journals (Sweden)

    Gaspar Rego

    2016-01-01

    Full Text Available Long period fiber gratings produced by the electric arc technique have found an increasing interest by the scientific community due to their ease to fabricate, virtually enabling the inscription in any kind of fiber, low cost, and flexibility. In 2005 we have presented the first review on this subject. Since then, important achievements have been reached such as the identification of the mechanisms responsible for gratings formation, the type of symmetry, the conditions to increase fabrication reproducibility, and their inscription in the turning points with grating periods below 200 μm. Several interesting applications in the sensing area, including those sensors working in reflection, have been demonstrated and others are expected, namely, related to the monitoring of extreme temperatures, cryogenic and high temperatures, and high sensitivity refractometric sensors resulting from combining arc-induced gratings in the turning points and the deposition of thin films in the transition region. Therefore, due to its pertinence, in this paper we review the main achievements obtained concerning arc-induced long period fiber gratings, with special focus on the past ten years.

  19. Stud arc welding in a magnetic field - Investigation of the influences on the arc motion

    Science.gov (United States)

    Hartz-Behrend, K.; Marqués, J. L.; Forster, G.; Jenicek, A.; Müller, M.; Cramer, H.; Jilg, A.; Soyer, H.; Schein, J.

    2014-11-01

    Stud arc welding is widely used in the construction industry. For welding of studs with a diameter larger than 14 mm a ceramic ferrule is usually necessary in order to protect the weld pool. Disadvantages of using such a ferrule are that more metal is molten than necessary for a high quality welded joint and that the ferrule is a consumable generally thrown away after the welding operation. Investigations show that the ferrule can be omitted when the welding is carried out in a radially symmetric magnetic field within a shielding gas atmosphere. Due to the Lorentz force the arc is laterally shifted so that a very uniform and controlled melting of the stud contact surface as well as of the work piece can be achieved. In this paper a simplified physical model is presented describing how the parameters welding current, flux density of the magnetic field, radius of the arc and mass density of the shielding gas influence the velocity of the arc motion. The resulting equation is subsequently verified by comparing it to optical measurements of the arc motion. The proposed model can be used to optimize the required field distribution for the magnetic field stud welding process.

  20. AC susceptibilities of grain-textured superconductors

    Science.gov (United States)

    Sakamoto, N.; Fukuda, Y.; Koga, M.; Akune, T.; Khan, H. R.; Lüders, K.

    2008-09-01

    In-phase χ n‧ and out-phase χ n″ components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field Bdc, an amplitude Ba and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low- Tc metallic superconductors, χ1‧ shows smooth transition and χ1″ does single peak. High- Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in χ1″ and shoulders in χ1‧ appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  1. Spatiotemporally resolved characteristics of a gliding arc discharge in a turbulent air flow at atmospheric pressure

    Science.gov (United States)

    Zhu, Jiajian; Gao, Jinlong; Ehn, Andreas; Aldén, Marcus; Larsson, Anders; Kusano, Yukihiro; Li, Zhongshan

    2017-01-01

    A gliding arc discharge was generated in a turbulent air flow at atmospheric pressure driven by a 35 kHz alternating current (AC) electric power. The spatiotemporally resolved characteristics of the gliding arc discharge, including glow-type discharges, spark-type discharges, short-cutting events and transitions among the different types of discharges, were investigated using simultaneously optical and electrical diagnostics. The glow-type discharge shows sinusoidal-like voltage and current waveforms with a peak current of hundreds of milliamperes. The frequency of the emission intensity variation of the glow-type discharge is the same as that of the electronic power dissipated in the plasma column. The glow-type discharge can transfer into a spark discharge characterized by a sharp peak current of several amperes and a sudden increase of the brightness in the plasma column. Transitions can also be found to take place from spark-type discharges to glow-type discharges. Short-cutting events were often observed as the intermediate states formed during the spark-glow transition. Three different types of short-cutting events have been observed to generate new current paths between two plasma channel segments, and between two electrodes, as well as between the channel segment and the electrodes, respectively. The short-cut upper part of the plasma column that was found to have no current passing through can be detected several hundreds of microseconds after the short-cutting event. The voltage recovery rate, the period of AC voltage-driving signal, the flow rates and the rated input powers were found to play an important role in affecting the transitions among the different types of discharges.

  2. Arc Facilities Manager (ArcFM)-ARC/INFO的功能强大的公用事业应用程序%Arc Facilities Manager(ArcFM)-A Powerful ARC/INFO-Based Application for

    Institute of Scientific and Technical Information of China (English)

    陆朝晖; 赵小红; 朱晓岷

    2000-01-01

    市场经济条件下公用事业面临新的挑战,地理信息系统(GIS)有助于公用事业有效管理公用设施,从而在竞争中获得优势.围绕ESRI公司的ArcFM软件,从它的结构、性能和功能等几方面,阐述了公用事业管理系统的一种解决方案.

  3. Characteristics of Atmospheric Pressure Rotating Gliding Arc Plasmas

    Institute of Scientific and Technical Information of China (English)

    ZHANG Hao; ZHU Fengsen; TU Xin; BO Zheng; CEN Kefa; LI Xiaodong

    2016-01-01

    In this work,a novel direct current (DC) atmospheric pressure rotating gliding arc (RGA) plasma reactor has been developed for plasma-assisted chemical reactions.The influence of the gas composition and the gas flow rate on the arc dynamic behaviour and the formation of reactive species in the N2 and air gliding arc plasmas has been investigated by means of electrical signals,high speed photography,and optical emission spectroscopic diagnostics.Compared to conventional gliding arc reactors with knife-shaped electrodes which generally require a high flow rate (e.g.,10-20 L/min) to maintain a long arc length and reasonable plasma discharge zone,in this RGA system,a lower gas flow rate (e.g.,2 L/min) can also generate a larger effective plasma reaction zone with a longer arc length for chemical reactions.Two different motion patterns can be clearly observed in the N2 and air RGA plasmas.The time-resolved arc voltage signals show that three different arc dynamic modes,the arc restrike mode,takeover mode,and combined modes,can be clearly identified in the RGA plasmas.The occurrence of different motion and arc dynamic modes is strongly dependent on the composition of the working gas and gas flow rate.

  4. ArcB: El sensor del estado redox en bacterias

    Directory of Open Access Journals (Sweden)

    Luis Alberto Núñez-Oreza

    2014-01-01

    Full Text Available El sistema de dos componentes Arc está compuesto por la cinasa sensora ArcB y por el regulador de respuesta ArcA. En Escherichia coli, este sistema regula la red transcripcional implicada en el metabolismo energético, acorde a las condiciones de óxido-reducción del medio. En condiciones anóxicas de crecimiento, ArcB se autofosforila y transfosforila a ArcA, el cual reprime o activa la expresión de sus operones blanco. En condiciones aeróbicas, ArcB actúa como una fosfatasa, catalizando la defosforilación de ArcA-P e inactivándolo como regulador transcripcional. Esta revisión describe las principales propiedades estructurales de ArcB y los eventos trascendentales que ocurren en la señalización por Arc, incluyendo la percepción de la señal y la regulación de la actividad cinasa. Además, compara la secuencia de ArcB de E. coli con la de homólogos en otras bacterias, revelando similitudes y diferencias que pueden ser de gran importancia en la regulación de esta proteína sensora.

  5. Arc Jet Facility Test Condition Predictions Using the ADSI Code

    Science.gov (United States)

    Palmer, Grant; Prabhu, Dinesh; Terrazas-Salinas, Imelda

    2015-01-01

    The Aerothermal Design Space Interpolation (ADSI) tool is used to interpolate databases of previously computed computational fluid dynamic solutions for test articles in a NASA Ames arc jet facility. The arc jet databases are generated using an Navier-Stokes flow solver using previously determined best practices. The arc jet mass flow rates and arc currents used to discretize the database are chosen to span the operating conditions possible in the arc jet, and are based on previous arc jet experimental conditions where possible. The ADSI code is a database interpolation, manipulation, and examination tool that can be used to estimate the stagnation point pressure and heating rate for user-specified values of arc jet mass flow rate and arc current. The interpolation is performed in the other direction (predicting mass flow and current to achieve a desired stagnation point pressure and heating rate). ADSI is also used to generate 2-D response surfaces of stagnation point pressure and heating rate as a function of mass flow rate and arc current (or vice versa). Arc jet test data is used to assess the predictive capability of the ADSI code.

  6. Characteristics of Atmospheric Pressure Rotating Gliding Arc Plasmas

    Science.gov (United States)

    Zhang, Hao; Zhu, Fengsen; Tu, Xin; Bo, Zheng; Cen, Kefa; Li, Xiaodong

    2016-05-01

    In this work, a novel direct current (DC) atmospheric pressure rotating gliding arc (RGA) plasma reactor has been developed for plasma-assisted chemical reactions. The influence of the gas composition and the gas flow rate on the arc dynamic behaviour and the formation of reactive species in the N2 and air gliding arc plasmas has been investigated by means of electrical signals, high speed photography, and optical emission spectroscopic diagnostics. Compared to conventional gliding arc reactors with knife-shaped electrodes which generally require a high flow rate (e.g., 10-20 L/min) to maintain a long arc length and reasonable plasma discharge zone, in this RGA system, a lower gas flow rate (e.g., 2 L/min) can also generate a larger effective plasma reaction zone with a longer arc length for chemical reactions. Two different motion patterns can be clearly observed in the N2 and air RGA plasmas. The time-resolved arc voltage signals show that three different arc dynamic modes, the arc restrike mode, takeover mode, and combined modes, can be clearly identified in the RGA plasmas. The occurrence of different motion and arc dynamic modes is strongly dependent on the composition of the working gas and gas flow rate. supported by National Natural Science Foundation of China (No. 51576174), the Specialized Research Fund for the Doctoral Program of Higher Education of China (No. 20120101110099) and the Fundamental Research Funds for the Central Universities (No. 2015FZA4011)

  7. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  8. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  9. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  10. AC optik - visuaalisen identiteetin suunnittelu optikkoliikkeelle

    OpenAIRE

    Valén, Wilma

    2017-01-01

    Toteutin opinnäytetyöni yhdessä pienen loviisalaisen optikkoliikkeen, AC optikin kanssa. Opinnäytetyössäni suunnittelen AC optikille uuden visuaalisen ilmeen ja brändätyn pakkauksen, jossa silmälasit ja oheistavara on helppo luovuttaa asiakkaalle. Taustoitan aihettani yksityisyrittäjälle tärkeistä näkökulmista eli keskittymällä positiivisen asiakaskokemuksen tärkeyteen brändin rakentamisessa. Sen lisäksi käyn läpi visuaalisen identiteetin suunnittelun elementtejä ja pakkauksen asemaa brän...

  11. AC410 Unit 2 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

      AC410 Unit 2 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-2-homework-assignment/   3-31 Ron Barber, CPA, is auditing the financial statements of DGF, Inc., a publicly held company. During the course of the audit, Barber discovered that DGF has been making illegal bribes to foreign government officials to obtain business, and he reported the matter to senior management and the board of directors of DGF. Required: If management a...

  12. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  13. Large seismic faults in the Hellenic arc

    Directory of Open Access Journals (Sweden)

    B. S. Papazachos

    1996-06-01

    Full Text Available Using information concerning reliable fault plane solutions, spatial distribution of strong earthquakes (Ms³ 6.0 as well as sea bottom and coastal topography, properties of the seismic faults (orientation, dimension, type of faulting were determined in seven shallow (h < 40 km seismogenic regions along the convex part of thc Hellenic arc (Hellenic trench and in four seismogenic regions of intermediate depth earthquakes (h = 40-100 km along the concave part of this arc. Except for the northwesternmost part of the Hellenic trench, where the strike-slip Cephalonia transform fault dominates, all other faults along this trench are low angle thrust faults. III thc western part of the trench (Zante-west Crete faults strike NW-SE and dip NE, while in its eastern part (east Crete-Rhodos faults strike WNW-ESE and dip NNE. Such system of faulting can be attributed to an overthrust of the Aegean lithosphere on the eastern Mediterranean lithosphere. The longest of these faults (L = 300 km is that which produced the largest known shallow earthquake in the Mediterranean area (21 July 365, Ms = 8.3 which is located near the southwestern coast of Crete. The second longest such fault (L = l 70 km is that which produced a large earthquake (December 1303, Ms = 8.0 in the easternmost part of the trench (east of Rhodos island. Both earthquakes were associated with gigantic tsunamis which caused extensive damage in the coast of many Eastern Mediterranean countries. Seismic faults of the intermediate depth earthquakes in the shallow part of the Benioff zone (h = 40- 100 km are of strike-slip type, with a thrust component. The orientations of these faults vary along the concave part of the arc in accordance with a subduction of remnants of all old lithospheric slab from the convex side (Mediterranean to the concave side (Aegean of thc Hellenic arc. The longest of these faults (L = 220 km is that which produced the largest known intermediate depth earthquake in the

  14. Cascaded Buck-Boost AC/AC converter%级联式Buck-Boost AC/AC变换器

    Institute of Scientific and Technical Information of China (English)

    张友军; 丁明昌; 任永保; 王阿敏; 翁振明

    2010-01-01

    详细分析了Buck型和Boost型AC/AC变换器的工作原理及其控制方法,在此基础上提出了一种新型级联式Buck-Boost AC/AC变换器及其三模式控制策略.三模式控制策略是比较输入电压与基准输出电压的大小,使得变换器只有3种工作模式:Buck模式、Boost模式和滤波模式.该电路虽然由Buck型和Boost型AC/AC变换器2级变换器级联而成,并采用2级占空比调制,但实际上最多只存在一级功率变换,具有控制简单、变换效率高、开关管电压应力低等优点.仿真结果证明了级联式Buck-Boost AC/AC变换器及其控制策略的可行性和理论分析的正确性.

  15. Numerical modeling of volcanic arc development

    Science.gov (United States)

    Gerya, T.; Gorczyk, W.; Nikolaeva, K.

    2007-05-01

    We have created a new coupled geochemical-petrological-thermomechanical numerical model of subduction associated with volcanic arc development. The model includes spontaneous slab bending, subducted crust dehydration, aqueous fluid transport, mantle wedge melting and melt extraction resulting in crustal growth. Two major volcanic arc settings are modeled so far: active continental margins, and intraoceanic subduction. In case of Pacific-type continental margin two fundamentally different regimes of melt productivity are observed in numerical experiments which are in line with natural observations: (1) During continuous convergence with coupled plates highest amounts of melts are formed immediately after the initiation of subduction and then decrease rapidly with time due to the steepening of the slab inclination angle precluding formation of partially molten mantle wedge plumes; (2) During subduction associated with slab delamination and trench retreat resulting in the formation of a pronounced back arc basin with a spreading center in the middle melt production increases with time due to shallowing/stabilization of slab inclination associated with upward asthenospheric mantle flow toward the extension region facilitating propagation of hydrous partially molten plumes from the slab. In case of spontaneous nucleation of retreating oceanic subduction two scenarios of tecono-magmatic evolution are distinguished: (1) decay and, ultimately, the cessation of subduction and related magmatic activity, (2) increase in subduction rate (to up to ~12 cm/yr) and stabilization of subduction and magmatic arc growth. In the first case the duration of subduction correlates positively with the intensity of melt extraction: the period of continued subduction increases from 15,4 Myrs to 47,6 Myrs with the increase of melt extraction threshold from 1% to 9%. In scenario (1) the magmatic arc crust includes large amounts of rocks formed by melting of subducted crust atop the thermally

  16. Recombination Kinetics in the Afterglow of a High-Pressure Arc

    Science.gov (United States)

    Gleizes, Alain

    2000-10-01

    Modern high-voltage circuit-breakers are filled up with SF6 gas at a pressure of several atmospheres. AC current interruption occurs after current zero during a short phase of a few microseconds characterized by a fast cooling of the arc plasma due to convection and turbulence produced by overpressure effects. During this quenching phase the electrical conductance of the plasma and thus the electron number density must decrease rapidly in order to create a dielectric medium between the contacts capable to withstand the recovery voltage. We present first a kinetics study based on thermal equilibrium and on the previous knowledge of the temperature evolution, showing that the electrons disappear mainly by three mechanisms: three-body recombination at high temperature; dissociative recombination and dissociative attachment at intermediate and low temperature. A second study, coupling chemical kinetics and a two-dimension hydrodynamic modeling, has been performed in two conditions: thermal equilibrium and two-temperature plasma. The results show that departures from equilibrium remain weak, because in particular of the recombination of the electrons with S2+ ions. Finally, we will present the study of an SF6 and SF6-N2 arc plasma recombination in the presence of impurities. The theoretical prediction of the by-product formation has been compared with some experimental results obtained by gas chromatography, demonstrating the role of oxygen and carbon in the recombining plasma.

  17. Formation of Ultrananocrystalline Diamond/Amorphous Carbon Composite Films in Vacuum Using Coaxial Arc Plasma Gun

    Science.gov (United States)

    Hanada, Kenji; Yoshida, Tomohiro; Nakagawa, You; Yoshitake, Tsuyoshi

    2010-12-01

    Ultrananocrystalline diamond (UNCD)/nonhydrogenated amorphous carbon (a-C) composite films were grown in vacuum using a coaxial arc plasma gun. From the X-ray diffraction measurement, the UNCD crystallite size was estimated to be 1.6 nm. This size is dramatically reduced from that (2.3 nm) of UNCD/hydrogenated amorphous carbon (a-C:H) composite films grown in a hydrogen atmosphere. The sp3/(sp3 + sp2) value, which was estimated from the X-ray photoemission spectrum, was also reduced to be 41%. A reason for it might be the reduction in the UNCD crystallite size. From the near-edge X-ray absorption fine-structure (NEXAFS) spectrum, it was found that the π*C=C and π*C≡C bonds are preferentially formed instead of the σ*C-H bonds in the UNCD/a-C:H films. Since the extremely small UNCD crystallites (1.6 nm) correspond to the nuclei of diamond, we consider that UNCD crystallite formation should be due predominantly to nucleation. The supersaturated condition required for nucleation is expected to be realized in the deposition using the coaxial arc plasma gun.

  18. Application of Python in ArcGIS%Python在ArcGIS中的应用

    Institute of Scientific and Technical Information of China (English)

    朱道强; 关海涛

    2013-01-01

    通过简要介绍利用Python语言编写脚本在ArcGIS中进行数据批处理的基础方法,提出了一种减轻现今数据生产中作业人员进行数据处理强度的方法.%Through a brief introduction on the use of Python language data batch processing based method for script in ArcGIS,thus put forward the method to reduce the data in the production operation personnel data processing strength.

  19. Fluid Flow Modeling of Arc Plasma and Bath Circulation in DC Electric Arc Furnace

    Institute of Scientific and Technical Information of China (English)

    WANG Feng-hua; JIN Zhi-jian; ZHU Zi-shu

    2006-01-01

    A mathematical model describing the flow field, heat transfer and the electromagnetic phenomenon in a DC electric arc furnace has been developed. First the governing equations in the arc plasma region are solved and the calculated results of heat transfer, current density and shear stresses on the anode surface are used as boundary conditions in a model of molten bath. Then a two-dimensional time-dependent model is used to describe the flow field and electromagnetic phenomenon in the molten bath. Moreover, the effect of bottom electrode diameter on the circulation of molten bath is studied.

  20. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  1. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  2. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  3. Optical arc sensor using energy harvesting power source

    Science.gov (United States)

    Choi, Kyoo Nam; Rho, Hee Hyuk

    2016-06-01

    Wireless sensors without external power supply gained considerable attention due to convenience both in installation and operation. Optical arc detecting sensor equipping with self sustaining power supply using energy harvesting method was investigated. Continuous energy harvesting method was attempted using thermoelectric generator to supply standby power in micro ampere scale and operating power in mA scale. Peltier module with heat-sink was used for high efficiency electricity generator. Optical arc detecting sensor with hybrid filter showed insensitivity to fluorescent and incandescent lamps under simulated distribution panel condition. Signal processing using integrating function showed selective arc discharge detection capability to different arc energy levels, with a resolution below 17J energy difference, unaffected by bursting arc waveform. The sensor showed possibility for application to arc discharge detecting sensor in power distribution panel. Also experiment with proposed continuous energy harvesting method using thermoelectric power showed possibility as a self sustainable power source of remote sensor.

  4. Computational Modeling of Arc-Slag Interaction in DC Furnaces

    Science.gov (United States)

    Reynolds, Quinn G.

    2016-11-01

    The plasma arc is central to the operation of the direct-current arc furnace, a unit operation commonly used in high-temperature processing of both primary ores and recycled metals. The arc is a high-velocity, high-temperature jet of ionized gas created and sustained by interactions among the thermal, momentum, and electromagnetic fields resulting from the passage of electric current. In addition to being the primary source of thermal energy, the arc jet also couples mechanically with the bath of molten process material within the furnace, causing substantial splashing and stirring in the region in which it impinges. The arc's interaction with the molten bath inside the furnace is studied through use of a multiphase, multiphysics computational magnetohydrodynamic model developed in the OpenFOAM® framework. Results from the computational solver are compared with empirical correlations that account for arc-slag interaction effects.

  5. Improving Weld Quality by Arc-Excited Ultrasonic Treatment

    Institute of Scientific and Technical Information of China (English)

    张春雷; 吴敏生; 杜敬磊

    2001-01-01

    Ultrasonic treatment of the solidifying metal is a promising method for improving the quality of fusion welding. A method to combine the ultrasonic waves to the welding process using arc-excited ultrasonic emission, called arc-ultrasonic, was high frequency modulation of the arc-plasma. The effects of arc-ultrasonic on the weld including the fusion zone, the partially melted zone and the heat-affected zone are described. The arc-ultrasonic energy changes the weld microstructure. In the fusion zone, the primary dendrite arm spacing decreases significantly and more acicular ferrite appears. In the partially melted zone, a large amount of fine grains appear. In the heat-affected zone, the width of the tempered zone increases with increasing modulation frequency and the microstructure is refined. The results show that arc-ultrasonic is a new and effective way for improving weld quality.

  6. Optical arc sensor using energy harvesting power source

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Kyoo Nam, E-mail: knchoi@inu.ac.kr; Rho, Hee Hyuk, E-mail: rdoubleh0902@inu.ac.kr [Dept. of Information and Telecommunication Engineering Incheon National University Incheon 22012 (Korea, Republic of)

    2016-06-03

    Wireless sensors without external power supply gained considerable attention due to convenience both in installation and operation. Optical arc detecting sensor equipping with self sustaining power supply using energy harvesting method was investigated. Continuous energy harvesting method was attempted using thermoelectric generator to supply standby power in micro ampere scale and operating power in mA scale. Peltier module with heat-sink was used for high efficiency electricity generator. Optical arc detecting sensor with hybrid filter showed insensitivity to fluorescent and incandescent lamps under simulated distribution panel condition. Signal processing using integrating function showed selective arc discharge detection capability to different arc energy levels, with a resolution below 17 J energy difference, unaffected by bursting arc waveform. The sensor showed possibility for application to arc discharge detecting sensor in power distribution panel. Also experiment with proposed continuous energy harvesting method using thermoelectric power showed possibility as a self sustainable power source of remote sensor.

  7. Computational Modeling of Arc-Slag Interaction in DC Furnaces

    Science.gov (United States)

    Reynolds, Quinn G.

    2017-02-01

    The plasma arc is central to the operation of the direct-current arc furnace, a unit operation commonly used in high-temperature processing of both primary ores and recycled metals. The arc is a high-velocity, high-temperature jet of ionized gas created and sustained by interactions among the thermal, momentum, and electromagnetic fields resulting from the passage of electric current. In addition to being the primary source of thermal energy, the arc jet also couples mechanically with the bath of molten process material within the furnace, causing substantial splashing and stirring in the region in which it impinges. The arc's interaction with the molten bath inside the furnace is studied through use of a multiphase, multiphysics computational magnetohydrodynamic model developed in the OpenFOAM® framework. Results from the computational solver are compared with empirical correlations that account for arc-slag interaction effects.

  8. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  9. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  10. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  11. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  12. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  13. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  14. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  15. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  16. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  17. Aging, Counterfeiting Configuration Control (AC3)

    Science.gov (United States)

    2010-01-31

    relabeled fake microcircuit chips from overseas - threaten the reliability, safety, and performance of DoD systems. These systems are vulnerable... NASA , Raytheon internal, etc. Aging, Counterfeiting Configuration Control (AC3) Page 13 of 28 are important in determining the alert’s priority

  18. THE DETECTION AND STATISTICS OF GIANT ARCS BEHIND CLASH CLUSTERS

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Bingxiao; Zheng, Wei [Department of Physics and Astronomy, The Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); Postman, Marc; Bradley, Larry [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21208 (United States); Meneghetti, Massimo; Koekemoer, Anton [INAF, Osservatorio Astronomico di Bologna, and INFN, Sezione di Bologna, Via Ranzani 1, I-40127 Bologna (Italy); Seitz, Stella [Universitaets-Sternwarte, Fakultaet fuer Physik, Ludwig-Maximilians Universitaet Muenchen, Scheinerstr. 1, D-81679 Muenchen (Germany); Zitrin, Adi [California Institute of Technology, MC 249-17, Pasadena, CA 91125 (United States); Merten, Julian [University of Oxford, Department of Physics, Denys Wilkinson Building, Keble Road, Oxford, OX1 3RH (United Kingdom); Maoz, Dani [School of Physics and Astronomy, Tel Aviv University, Tel-Aviv 69978 (Israel); Frye, Brenda [Steward Observatory/Department of Astronomy, University of Arizona, 933 N. Cherry Ave., Tucson, AZ 85721 (United States); Umetsu, Keiichi [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 10617, Taiwan (China); Vega, Jesus, E-mail: bxu6@jhu.edu [Universidad Autonoma de Madrid, Ciudad Universitaria de Cantoblanco, E-28049 Madrid (Spain)

    2016-02-01

    We developed an algorithm to find and characterize gravitationally lensed galaxies (arcs) to perform a comparison of the observed and simulated arc abundance. Observations are from the Cluster Lensing And Supernova survey with Hubble (CLASH). Simulated CLASH images are created using the MOKA package and also clusters selected from the high-resolution, hydrodynamical simulations, MUSIC, over the same mass and redshift range as the CLASH sample. The algorithm's arc elongation accuracy, completeness, and false positive rate are determined and used to compute an estimate of the true arc abundance. We derive a lensing efficiency of 4 ± 1 arcs (with length ≥6″ and length-to-width ratio ≥7) per cluster for the X-ray-selected CLASH sample, 4 ± 1 arcs per cluster for the MOKA-simulated sample, and 3 ± 1 arcs per cluster for the MUSIC-simulated sample. The observed and simulated arc statistics are in full agreement. We measure the photometric redshifts of all detected arcs and find a median redshift z{sub s} = 1.9 with 33% of the detected arcs having z{sub s} > 3. We find that the arc abundance does not depend strongly on the source redshift distribution but is sensitive to the mass distribution of the dark matter halos (e.g., the c–M relation). Our results show that consistency between the observed and simulated distributions of lensed arc sizes and axial ratios can be achieved by using cluster-lensing simulations that are carefully matched to the selection criteria used in the observations.

  19. Overview of arc design options: Deliverable D2.1

    CERN Document Server

    Chance, Antoine

    2016-01-01

    This document describes the collider layouts to be taken into account for further detailed studies. The optimization of the arc cell lattice and the choice made on the dispersion suppressor are explained. The arc lattice is detailed with the procedures to tune the collider ring and to correct the chromaticity. The correction schemes of the orbit, of the dynamic aperture and of the spurious dispersion are detailed. Finally, the properties of the arc design at the injection energy are shown.

  20. Fluctuation Phenomenon Analysis of an Arc Plasma Spraying Jet

    Institute of Scientific and Technical Information of China (English)

    赵文华; 田阔; 刘笛; 张冠忠

    2001-01-01

    The effects of three factors, including the power supply, the arc behaviour in the arc channel and the fluid dynamic process of the jet, on a plasma spraying jet have been experimentally detected by means of spectroscopic diagnostic techniques. The fast Fourier transform method has been applied to the analysis of the arc voltage and spectral line intensity of the jet. The three factors have been studied and distinguished from each other.

  1. Unusual Cathode Erosion Patterns Observed for Steered Arc Sources

    CERN Document Server

    Kolbeck, Jonathan

    2014-01-01

    A cathodic arc source with a magnetron-type magnetic field was investigated for stability, erosion, and compatibility with a linear macroparticle filter. Here we report about unusual arc spot erosion patterns, which were narrow (~ 2 mm) with periodic pits when operating in argon, and broad (~ 10 mm) with periodic groves and ridges when operating in an argon and oxygen mixtures. These observations can be correlated with the ignition probability for type 2 and type 1 arc spots, respectively.

  2. Liquid-Arc/Spark-Excitation Atomic-Emission Spectroscopy

    Science.gov (United States)

    Schlagen, Kenneth J.

    1992-01-01

    Constituents of solutions identified in situ. Liquid-arc/spark-excitation atomic-emission spectroscopy (LAES) is experimental variant of atomic-emission spectroscopy in which electric arc or spark established in liquid and spectrum of light from arc or spark analyzed to identify chemical elements in liquid. Observations encourage development of LAES equipment for online monitoring of process streams in such industries as metal plating, electronics, and steel, and for online monitoring of streams affecting environment.

  3. Process characteristics of fibre-laser-assisted plasma arc welding

    OpenAIRE

    Mahrle, A; SCHNICK, M; Rose, S; Demuth, C; Beyer, E.; Füssel, U

    2011-01-01

    Abstract Experimental and theoretical investigations on fibre-laser assisted plasma arc welding (LAPW) have been performed. Welding experiments were carried out on aluminium and steel sheets. In case of a highly focused laser beam and a separate arrangement of plasma torch and laser beam, high-speed video recordings of the plasma arc and corresponding measurements of the time-dependent arc voltage revealed differences in the process behaviour for both materials. In case of aluminium weldin...

  4. Programming ArcGIS 10.1 with Python cookbook

    CERN Document Server

    Pimpler, Eric

    2013-01-01

    This book is written in a helpful, practical style with numerous hands-on recipes and chapters to help you save time and effort by using Python to power ArcGIS to create shortcuts, scripts, tools, and customizations.""Programming ArcGIS 10.1 with Python Cookbook"" is written for GIS professionals who wish to revolutionize their ArcGIS workflow with Python. Basic Python or programming knowledge is essential(?).

  5. A note on the arc elacticity of demand

    OpenAIRE

    Andrés Vázquez

    1995-01-01

    This note presents a simple alternative measure for the arc elasticity of demand which comes naturally and does retain the salient characteristics of the point demand elasticity. A remarkable feature is that it equals the point demand elasticity at some point inside the interval, thus leading to the exact estimation of the point demand elasticity when this is constant. It also ensures that the relationships between the arc demand elasticity and the arc revenue elasticities keep exact formal a...

  6. Incidence Angle Effect of Energetic Carbon Ions on Deposition Rate, Topography, and Structure of Ultrathin Amorphous Carbon Films Deposited by Filtered Cathodic Vacuum Arc

    KAUST Repository

    Wang, N.

    2012-07-01

    The effect of the incidence angle of energetic carbon ions on the thickness, topography, and structure of ultrathin amorphous carbon (a-C) films synthesized by filtered cathodic vacuum arc (FCVA) was examined in the context of numerical and experimental results. The thickness of a-C films deposited at different incidence angles was investigated in the light of Monte Carlo simulations, and the calculated depth profiles were compared with those obtained from high-resolution transmission electron microscopy (TEM). The topography and structure of the a-C films were studied by atomic force microscopy (AFM) and X-ray photoelectron spectroscopy (XPS), respectively. The film thickness decreased with the increase of the incidence angle, while the surface roughness increased and the content of tetrahedral carbon hybridization (sp 3) decreased significantly with the increase of the incidence angle above 45° , measured from the surface normal. TEM, AFM, and XPS results indicate that the smoothest and thinnest a-C films with the highest content of sp 3 carbon bonding were produced for an incidence angle of 45°. The findings of this study have direct implications in ultrahigh-density magnetic recording, where ultrathin and smooth a-C films with high sp 3 contents are of critical importance. © 2012 IEEE.

  7. Developmental DSP4 effects on cortical Arc expression.

    Science.gov (United States)

    Sanders, Jeff

    2016-04-08

    Activity Regulated Cytoskeleton Associated Protein (Arc) is an immediate early gene that is critical to brain plasticity. In this study, norepinephrine's regulation of Arc expression was examined during different stages of postnatal development. Rats were injected with N-(2-chloroethyl)-N-ethyl-2-bromobenzylamine hydrochloride (DSP-4), a selective noradrenergic neurotoxin, during preadolescence (PND 0 or 13), adolescence (PND 23 or 48) or adulthood (PND 60). After each DSP4 treatment, brains were harvested later in development and Arc mRNA levels analyzed with in situ hybridization. Rats lesioned with DSP4 during preadolescence showed no differences in Arc level compared to saline treated controls. In contrast, adolescence was a time of changing Arc mRNA response to DSP4. Rats lesioned during early adolescence showed Arc expression increases, while rats lesioned during late adolescence showed dramatic Arc expression decreases. Decreases in Arc level caused by late adolescent DSP4 were similar to those found in lesioned adults. These findings highlight a qualitatively different regulation of Arc expression by norepinephrine according to developmental stage, and indicate that mature regulation is not intact until late adolescence. These data point to important developmental differences in norepinephrine's regulation of brain plasticity. These differences may underlie contrasting psychotropic responses in children and adolescents compared to adults.

  8. The arc characteristic of ultrasonic assisted TIG welding

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Many applications of ultrasonic-assisted methods were used during metal solidification, but they could not be introduced into weld pool. In this paper, a way of ultrasonic assisted TIG welding is introduced. By directly imposed ultrasonic vibration on welding arc, the vibration interacts with arc plasma and passes to the weld pool. Measurement results show that arc pressure is significantly increased with the ultrasonic vibration and the arc pressure distribution models are changed. Bead-on-plate welding tests on SUS304 confirm that this technology can influence the style of metal melting and increase weld penetration depth.

  9. The Detection and Statistics of Giant Arcs Behind CLASH Clusters

    CERN Document Server

    Xu, Bingxiao; Meneghetti, Massimo; Seitz, Stella; Zitrin, Adi; Merten, Julian; Maoz, Dani; Frye, Brenda; Umetsu, Keiichi; Zheng, Wei; Bradley, Larry; Vega, Jesus; Koekemoer, Anton

    2015-01-01

    We developed an algorithm to find and characterize gravitationally lensed galaxies (arcs) to perform a comparison of the observed and simulated arc abundance. Observations are from the Cluster Lensing And Supernova survey with Hubble (CLASH). Simulated CLASH images are created using the MOKA package and also clusters selected from the high resolution, hydrodynamical simulations, MUSIC, over the same mass and redshift range as the CLASH sample. The algorithm' s arc elongation accuracy, completeness and false positive rate are determined and used to compute an estimate of the true arc abundance. We derive a lensing efficiency of $4 \\pm 1$ arcs (with length $\\ge 6"$ and length-to-width ratio $\\ge 7$) per cluster for the X-ray selected CLASH sample, $4 \\pm 1$ arcs per cluster for the MOKA simulated sample and $3 \\pm 1$ arcs per cluster for the MUSIC simulated sample. The observed and simulated arc statistics are in full agreement. We measure the photometric redshifts of all detected arcs and find a median redshif...

  10. RESEARCH ON ELECTRIC ARC REDUCTION OF CARBON DIOXIDE,

    Science.gov (United States)

    CARBON DIOXIDE , REDUCTION(CHEMISTRY), ELECTRIC ARCS, CHEMICAL REACTIONS, HEAT OF REACTION, GAS FLOW, OXYGEN, CARBON COMPOUNDS, MONOXIDES, ELECTRODES, LABORATORY EQUIPMENT, HIGH TEMPERATURE, PLASMAS(PHYSICS), ENERGY.

  11. 基于ArcGIS的土方量计算

    Institute of Scientific and Technical Information of China (English)

    张金荣

    2016-01-01

    本文阐述了ArcGIS计算土方量的原理、方法及实现步骤,并以某工程为实例,对比了ArcGIS法和南方Cass栅格法的土方量计算结果,说明了ArcGIS在计算土方量方面的优越性,并对ArcGIS土方量计算法的实际应用提出独特的见解.

  12. ArcGIS的演进路径研究

    Institute of Scientific and Technical Information of China (English)

    朱紫焱; 伊雪琴

    2005-01-01

    ESRI公司的ArcGIS系列是一个全面、完善、可伸缩的GIS软件平台,无论是单用户还是多用户,无论是在桌面端、服务器端、互连网还是野外操作,都可以通过ArcGIS构建地理信息系统。分别介绍了ArcGIS 8与ArcGIS 9系列软件的演进路径,从中可以看出 ESRI对自我的不断超越。

  13. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  14. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  15. A New Survey for Giant Arcs

    Energy Technology Data Exchange (ETDEWEB)

    Hennawi, Joseph F.; Gladders, Michael D.; Oguri, Masamune; Dalal, Neal; Koester, Benjamin; Natarajan, Priyamvada; Strauss, Michael A.; Inada, Naohisa; Kayo, Issha; Lin,; Lampeitl, Hubert; Annis, James; Bahcall, Neta A.; Schneider, Donald P.

    2006-11-15

    We report on the first results of an imaging survey to detect strong gravitational lensing targeting the richest clusters selected from the photometric data of the Sloan Digital Sky Survey (SDSS) with follow-up deep imaging observations from the Wisconsin Indiana Yale NOAO (WIYN) 3.5m telescope and the University of Hawaii 88-inch telescope (UH88). The clusters are selected from an area of 8000 deg{sup 2} using the Red Cluster Sequence technique and span the redshift range 0.1 {approx}< z {approx}< 0.6, corresponding to a comoving cosmological volume of {approx} 2Gpc{sup 3}. Our imaging survey thus targets a volume more than an order of magnitude larger than any previous search. A total of 240 clusters were imaged of which 141 had sub-arcsecond image quality. Our survey has uncovered 16 new lensing clusters with definite giant arcs, an additional 12 systems for which the lensing interpretation is very likely, and 9 possible lenses which contain shorter arclets or candidate arcs which are less certain and will require further observations to confirm their lensing origin. The number of new cluster lenses detected in this survey is likely > 30. Among these new systems are several of the most dramatic examples of strong gravitational lensing ever discovered with multiple bright arcs at large angular separation. These will likely become 'poster-child' gravitational lenses similar to Abell 1689 and CL0024+1654. The new lenses discovered in this survey will enable future systematic studies of the statistics of strong lensing and its implications for cosmology and our structure formation paradigm.

  16. Exposure assessment of aluminum arc welding radiation.

    Science.gov (United States)

    Peng, Chiung-yu; Lan, Cheng-hang; Juang, Yow-jer; Tsao, Ta-ho; Dai, Yu-tung; Liu, Hung-hsin; Chen, Chiou-jong

    2007-10-01

    The purpose of this study is to evaluate the non-ionizing radiation (NIR) exposure, especially optical radiation levels, and potential health hazard from aluminum arc welding processes based on the American Conference of Governmental Industrial Hygienists (ACGIH) method. The irradiance from the optical radiation emissions can be calculated with various biological effective parameters [i.e., S(lambda), B(lambda), R(lambda)] for NIR hazard assessments. The aluminum arc welding processing scatters bright light with NIR emission including ultraviolet radiation (UVR), visible, and infrared spectra. The UVR effective irradiance (Eeff) has a mean value of 1,100 microW cm at 100 cm distance from the arc spot. The maximum allowance time (tmax) is 2.79 s according to the ACGIH guideline. Blue-light hazard effective irradiance (EBlue) has a mean value of 1840 microW cm (300-700 nm) at 100 cm with a tmax of 5.45 s exposure allowance. Retinal thermal hazard effective calculation shows mean values of 320 mW cm(-2) sr(-1) and 25.4 mW (cm-2) (380-875 nm) for LRetina (spectral radiance) and ERetina (spectral irradiance), respectively. From this study, the NIR measurement from welding optical radiation emissions has been established to evaluate separate types of hazards to the eye and skin simultaneously. The NIR exposure assessment can be applied to other optical emissions from industrial sources. The data from welding assessment strongly suggest employees involved in aluminum welding processing must be fitted with appropriate personal protection devices such as masks and gloves to prevent serious injuries of the skin and eyes upon intense optical exposure.

  17. Treatment planning for volumetric modulated arc therapy

    Energy Technology Data Exchange (ETDEWEB)

    Bedford, James L. [Joint Department of Physics, Institute of Cancer Research and The Royal Marsden NHS Foundation Trust, Downs Road, Sutton, Surrey SM2 5PT (United Kingdom)

    2009-11-15

    Purpose: Volumetric modulated arc therapy (VMAT) is a specific type of intensity-modulated radiation therapy (IMRT) in which the gantry speed, multileaf collimator (MLC) leaf position, and dose rate vary continuously during delivery. A treatment planning system for VMAT is presented. Methods: Arc control points are created uniformly throughout one or more arcs. An iterative least-squares algorithm is used to generate a fluence profile at every control point. The control points are then grouped and all of the control points in a given group are used to approximate the fluence profiles. A direct-aperture optimization is then used to improve the solution, taking into account the allowed range of leaf motion of the MLC. Dose is calculated using a fast convolution algorithm and the motion between control points is approximated by 100 interpolated dose calculation points. The method has been applied to five cases, consisting of lung, rectum, prostate and seminal vesicles, prostate and pelvic lymph nodes, and head and neck. The resulting plans have been compared with segmental (step-and-shoot) IMRT and delivered and verified on an Elekta Synergy to ensure practicality. Results: For the lung, prostate and seminal vesicles, and rectum cases, VMAT provides a plan of similar quality to segmental IMRT but with faster delivery by up to a factor of 4. For the prostate and pelvic nodes and head-and-neck cases, the critical structure doses are reduced with VMAT, both of these cases having a longer delivery time than IMRT. The plans in general verify successfully, although the agreement between planned and measured doses is not very close for the more complex cases, particularly the head-and-neck case. Conclusions: Depending upon the emphasis in the treatment planning, VMAT provides treatment plans which are higher in quality and/or faster to deliver than IMRT. The scheme described has been successfully introduced into clinical use.

  18. The ATLAS ARC backend to HPC

    CERN Document Server

    Haug, Sigve; The ATLAS collaboration; Sciacca, Francesco Giovanni; Weber, Michele

    2015-01-01

    The current distributed computing resources used for simulating and processing collision data collected by the LHC experiments are largely based on dedicated x86 Linux clusters. Access to resources, job control and software provisioning mechanisms are quite different from the common concept of self-contained HPC applications run by particular users on specific HPC systems. We report on the development and the usage of a SSH back-end to the Advanced Resource Connector (ARC) middleware to enable HPC compliant access and on the corresponding software provisioning mechanisms.

  19. The ATLAS ARC backend to HPC

    CERN Document Server

    Haug, Sigve; The ATLAS collaboration; Sciacca, Francesco Giovanni; Weber, Michele

    2015-01-01

    The current distributed computing resources used for simulating and processing collision data collected by the LHC experiments are largely based on dedicated x86 Linux clusters. Access to resources, job control and software provisioning mechanisms are quite different from the common concept of self-contained HPC applications run by particular users on specific HPC systems. We report on the development and the usage of a ssh back-end to the Advanced Resource Connector (ARC) middleware to enable HPC compliant access and on the corresponding software provisioning mechanisms.

  20. A slab expression in the Gibraltar arc?

    Science.gov (United States)

    Nijholt, Nicolai; Govers, Rob; Wortel, Rinus

    2017-04-01

    The present-day geodynamic setting of the Gibraltar arc region results from several Myrs of subduction rollback in the overall (oblique) convergence of Africa and Iberia. As for most rollback settings in a convergence zone, the interaction of these two components is complex and distinctly non-stationary. Gibraltar slab rollback is considered to have stalled, or at least diminished largely in magnitude, since the late Miocene/early Pliocene, suggesting that the effect of the slab on present-day surface motions is negligible. However, GPS measurements indicate that the Gibraltar arc region has an anomalous motion with respect to both Iberia and Africa, i.e., the Gibraltar arc region does not move as part of the rigid Iberian, or the rigid African plate. A key question is whether this surface motion is an expression of the Gibraltar slab. Seismic activity in the Gibraltar region is diffuse and considerable in magnitude, making it a region of high seismic risk. Unlike the North African margin to the east, where thrust earthquakes dominate the focal mechanism tables, a complex pattern is observed with thrust, normal and strike-slip earthquakes in a region stretching between the northern Moroccan Atlas across the Gibraltar arc and Alboran Sea (with the Trans-Alboran Shear Zone) to the Betics of southern Spain. Even though no large mega-thrust earthquakes have been observed in recent history, slab rollback may not have completely ceased. However, since no activity has been observed in the accretionary wedge, probably since the Pliocene, it is likely that the subduction interface is locked. In this study, we perform a series of numerical models in which we combine the relative plate convergence, variable magnitude of friction on fault segments, regional variations in gravitational potential energy and slab pull of the Gibraltar slab. We seek to reproduce the GPS velocities and slip sense on regional faults and thereby determine whether the Gibraltar slab has an effect on

  1. The ATLAS ARC backend to HPC

    Science.gov (United States)

    Haug, S.; Hostettler, M.; Sciacca, F. G.; Weber, M.

    2015-12-01

    The current distributed computing resources used for simulating and processing collision data collected by ATLAS and the other LHC experiments are largely based on dedicated x86 Linux clusters. Access to resources, job control and software provisioning mechanisms are quite different from the common concept of self-contained HPC applications run by particular users on specific HPC systems. We report on the development and the usage in ATLAS of a SSH backend to the Advanced Resource Connector (ARC) middleware to enable HPC compliant access and on the corresponding software provisioning mechanisms.

  2. Pulmonary siderosis (pneumoconiosis) in an arc welder

    Energy Technology Data Exchange (ETDEWEB)

    Triebel, H.J.; Spielmann, R.P.; Jessel, A.

    1988-02-01

    An arc welder of 32 years of age is presented with a random finding of miliar reticulonodular shadows in the plain film of the thorax. Subjectively and objectively the patient appears healthy. The presence of a pneumoconiosis is confirmed by biopsy. Differential diagnosis had to consider sarcoidosis and pulmonary siderosis in view of the known professional anamnesis. This case report underlines the repeated demand to assess X-ray films of the thoracic organs only if the clinical findings and anamnesis are thoroughly known.

  3. Partial Arc Curvilinear Direct Drive Servomotor

    Science.gov (United States)

    Sun, Xiuhong (Inventor)

    2014-01-01

    A partial arc servomotor assembly having a curvilinear U-channel with two parallel rare earth permanent magnet plates facing each other and a pivoted ironless three phase coil armature winding moves between the plates. An encoder read head is fixed to a mounting plate above the coil armature winding and a curvilinear encoder scale is curved to be co-axis with the curvilinear U-channel permanent magnet track formed by the permanent magnet plates. Driven by a set of miniaturized power electronics devices closely looped with a positioning feedback encoder, the angular position and velocity of the pivoted payload is programmable and precisely controlled.

  4. Plasma transferred arc deposition of beryllium

    Science.gov (United States)

    Hollis, K.; Bartram, B.; Withers, J.; Storm, R.; Massarello, J.

    2006-12-01

    The exceptional properties of beryllium (Be), including low density and high elastic modulus, make it the material of choice in many defense and aerospace applications. However, health hazards associated with Be material handling limit the applications that are suited for its use. Innovative solutions that enable continued use of Be in critical applications while addressing worker health concerns are highly desirable. Plasma transferred arc solid free-form fabrication is being evaluated as a Be fabrication technique for civilian and military space-based components. Initial experiments producing Be deposits are reported here. Deposit shape, microstructure, and mechanical properties are reported.

  5. Uranium arc fission reactor for space propulsion

    Science.gov (United States)

    Watanabe, Yoichi; Maya, Isaac; Vitali, Juan; Appelbaum, Jacob; Schneider, Richard T.

    1991-01-01

    Combining the proven technology of solid core reactors with uranium arc confinement and non-equilibrium ionization by fission fragments can lead to an attractive propulsion system which has a higher specific impulse than a solid core propulsion system and higher thrust than an electric propulsion systems. A preliminary study indicates that a system with 300 MW of fission power can achieve a gas exhaust velocity of 18,000 m/sec and a thrust of 10,000 Newtons utilizing a magnetohydrodynamic generator and accelerator. An experimental program is underway to examine the major mass and energy transfer issues.

  6. Plasma Arc Surface Hardening Robot Technology

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    In national economy and national defense, a lot of ma chine components become worthless early because of wear and tear and corrode. It leads to huge loss of resource and material. Surface hardening of the steel cou ld form a hard, wearable, corrode-resisting layer on the surface to enhance the mechanical property of the machine component. From 1980s, there is a new method of surface hardening that is heating with plasma arc. It overcomes the shortage of old methods and is adopted in automotive product ...

  7. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  8. Community Structure Comparisons of Hydrothermal Vent Microbial Mats Along the Mariana Arc and Back-arc

    Science.gov (United States)

    Hager, K. W.; Fullerton, H.; Moyer, C. L.

    2015-12-01

    Hydrothermal vents along the Mariana Arc and back-arc represent a hotspot of microbial diversity that has not yet been fully recognized. The Mariana Arc and back-arc contain hydrothermal vents with varied vent effluent chemistry and temperature, which translates to diverse community composition. We have focused on iron-rich sites where the dominant primary producers are iron oxidizing bacteria. Because microbes from these environments have proven elusive in culturing efforts, we performed culture independent analysis among different microbial communities found at these hydrothermal vents. Terminal-restriction fragment length polymorphism (T-RFLP) and Illumina sequencing of small subunit ribosomal gene amplicons were used to characterize community members and identify samples for shotgun metagenomics. Used in combination, these methods will better elucidate the composition and characteristics of the bacterial communities at these hydrothermal vent systems. The overarching goal of this study is to evaluate and compare taxonomic and metabolic diversity among different communities of microbial mats. We compared communities collected on a fine scale to analyze the bacterial community based on gross mat morphology, geography, and nearby vent effluent chemistry. Taxa richness and evenness are compared with rarefaction curves to visualize diversity. As well as providing a survey of diversity this study also presents a juxtaposition of three methods in which ribosomal small subunit diversity is compared with T-RFLP, next generation amplicon sequencing, and metagenomic shotgun sequencing.

  9. Dicty_cDB: FCL-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC21 (Link to dictyBase) - - - Contig-U15479-1 FCL-AC21E ...(Link to Original site) - - - - - - FCL-AC21E 632 Show FCL-AC21 Library FCL (Link to library) Clone ID FCL-AC2... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC21Q.Seq.d/ Representative seq. ID FCL-AC2...1E (Link to Original site) Representative DNA sequence >FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC2...M/SL/SLG7-D/SLG773Q.Seq.d/ 1205 0.0 FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC21

  10. Arc segmentation and seismicity in the Solomon Islands arc, SW Pacific

    Science.gov (United States)

    Chen, Ming-Chu; Frohlich, Cliff; Taylor, Frederick W.; Burr, George; van Ufford, Andrew Quarles

    2011-07-01

    This paper evaluates neotectonic segmentation in the Solomon Islands forearc, and considers how it relates to regional tectonic evolution and the extent of ruptures of large megathrust earthquakes. We first consider regional geomorphology and Quaternary vertical displacements, especially uplifted coral reef terraces. Then we consider geographic seismicity patterns, aftershock areas and vertical displacements for large earthquakes, focal mechanisms, and along-arc variations in seismic moment release to evaluate the relationship between neotectonically defined segments and seismicity. Notably, one major limitation of using seismicity to evaluate arc segmentation is the matter of accurately defining earthquake rupture zones. For example, shoreline uplifts associated with the 1 April 2007 M w 8.1 Western Solomons earthquake indicate that the along-arc extent of rupture was about 50 km smaller than the aftershock area. Thus if we had relied on aftershocks alone to identify the 2007 rupture zone, as we do for most historical earthquakes, we would have missed the rupture's relationship to a major morphologic feature. In many cases, the imprecision of defining rupture zones without surface deformation data may be largely responsible for the poor mismatches to neotectonic boundaries. However, when a precise paleoseismic vertical deformation history is absent, aftershocks are often the best available tool for inferring rupture geometries. Altogether we identify 16 segments in the Solomon Islands. These comprise three major tectonic regimes or supersegments that correspond respectively to the forearc areas of Guadalcanal-Makira, the New Georgia island group, and Bougainville Islands. Subduction of the young and relatively shallow and buoyant Woodlark Basin and spreading system distinguishes the central New Georgia supersegment from the two neighboring supersegments. The physiographic expression of the San Cristobal trench is largely absent, but bathymetric mapping of the

  11. Effects of shielding gas composition on arc profile and molten pool dynamics in gas metal arc welding of steels

    Science.gov (United States)

    Wang, L. L.; Lu, F. G.; Wang, H. P.; Murphy, A. B.; Tang, X. H.

    2014-11-01

    In gas metal arc welding, gases of different compositions are used to produce an arc plasma, which heats and melts the workpiece. They also protect the workpiece from the influence of the air during the welding process. This paper models gas metal arc welding (GMAW) processes using an in-house simulation code. It investigates the effects of the gas composition on the temperature distribution in the arc and on the molten pool dynamics in gas metal arc welding of steels. Pure argon, pure CO2 and different mixtures of argon and CO2 are considered in the study. The model is validated by comparing the calculated weld profiles with physical weld measurements. The numerical calculations reveal that gas composition greatly affects the arc temperature profile, heat transfer to the workpiece, and consequently the weld dimension. As the CO2 content in the shielding gas increases, a more constricted arc plasma with higher energy density is generated as a result of the increased current density in the arc centre and increased Lorentz force. The calculation also shows that the heat transferred from the arc to the workpiece increases with increasing CO2 content, resulting in a wider and deeper weld pool and decreased reinforcement height.

  12. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  13. Commissioning and first clinical application of mARC treatment

    Energy Technology Data Exchange (ETDEWEB)

    Dzierma, Yvonne; Nuesken, Frank G.; Kremp, Stephanie; Palm, Jan; Licht, Norbert P.; Ruebe, Christian [Universitaetsklinikum des Saarlandes, Klinik fuer Strahlentherapie und Radioonkologie, Homburg, Saarland (Germany)

    2014-11-15

    The modulated arc (mARC) technique has recently been introduced for Siemens ARTISTE linear accelerators. We present the first experiences with the commissioning of the system and first patient treatments. Treatment planning and delivery are presented for the Prowess Panther treatment planning system or, alternatively, an in-house code. Dosimetric verification is performed both by point dose measurements and in 3D dose distribution. Depending on the target volume, one or two arcs can be used to create highly conformal plans. Dosimetric verification of the converted mARC plans with step-and-shoot plans shows deviations below 1 % in absolute point dose; in the 3D dose distribution, over 95 % of the points pass the 3D gamma criteria (3 % deviation in local dose and 3 mm distance to agreement for doses > 20 % of the maximum). Patient specific verification of the mARC dose distribution with the calculations has a similar pass rate. Treatment times range between 2 and 5 min for a single arc. To our knowledge, this is the first report of clinical application of the mARC technique. The mARC offers the possibility to save significant amounts of time, with single-arc treatments of only a few minutes achieving comparable dose distribution to IMRT plans taking up to twice as long. (orig.) [German] Die mARC (modulated arc) Technik wurde vor kurzen fuer Siemens ARTISTE Linearbeschleuniger eingefuehrt. Wir zeigen die ersten Erfahrungen mit der Kommissionierung des Systems sowie die ersten Patientenbestrahlungen. Bestrahlungsplanung und Behandlung werden fuer das Prowess Panther Bestrahlungsplanungssystem oder alternativ in einer in-house-Loesung praesentiert. Die dosimetrische Verifikation wurde sowohl mit Punktmessungen als auch fuer die 3D-Dosisverteilung durchgefuehrt. Je nach Zielvolumen koennen mit einem oder zwei Boegen hochkonformale Plaene erzeugt werden. Die dosimetrische Verifikation konvertierter mARC-Plaene gegen step-and-shoot-Plaene weicht in absoluter Dosis um

  14. Development of circuit model for arcing on solar panels

    Energy Technology Data Exchange (ETDEWEB)

    Mehta, Bhoomi K; Deshpande, S P; Mukherjee, S; Gupta, S B; Ranjan, M; Rane, R; Vaghela, N; Acharya, V [FCIPT, Institute for Plasma Research, Bhat, Gandhinagar 382428 (India); Sudhakar, M; Sankaran, M; Suresh, E P, E-mail: bhoomi@ipr.res.i [ISRO Satellite Centre (ISAC), Bangalore 560017 (India)

    2010-02-01

    The increased requirements of payload capacity of the satellites have resulted in much higher power requirements of the satellites. In order to minimize the energy loss during power transmission due to cable loss, use of high voltage solar panels becomes necessary. When a satellite encounters space plasma it floats negatively with respect to the surrounding space plasma environment. At high voltage, charging and discharging on solar panels causes the power system breakdown. Once a solar panel surface is charged and potential difference between surface insulator and conductor exceeds certain value, electrostatic discharge (ESD) may occur. This ESD may trigger a secondary arc that can destroy the solar panel circuit. ESD is also called as primary or minor arc and secondary is called major arc. The energy of minor arc is supplied by the charge stored in the coverglass of solar array and is a pulse of typically several 100 ns to several 100 {mu}s duration. The damage caused by minor arc is less compared to major arcs, but it is observed that the minor arc is cause of major arc. Therefore it is important to develop an understanding of minor arc and mitigation techniques. In this paper we present a linear circuit analysis for minor arcs on solar panels. To study arcing event, a ground experimental facility to simulate space plasma environment has been developed at Facilitation Centre for Industrial Plasma Technologies (Institute for Plasma Research) in collaboration with Indian Space Research Organization's ISRO Satellite Technology Centre (ISAC). A linear circuit model has been developed to explain the experimental results by representing the coverglass, solar cell interconnect and wiring by an LCR circuit and the primary arc by an equivalent LR circuit. The aim of the circuit analysis is to predict the arc current which flows through the arc plasma. It is established from the model that the current depends on various parameters like potential difference between

  15. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  16. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  17. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  18. Cathodic ARC surface cleaning prior to brazing

    Energy Technology Data Exchange (ETDEWEB)

    Dave, V. R. (Vivek R.); Hollis, K. J. (Kendall J.); Castro, R. G. (Richard G.); Smith, F. M. (Frank M.); Javernick, D. A. (Daniel A.)

    2002-01-01

    Surface cleanliness is one the critical process variables in vacuum furnace brazing operations. For a large number of metallic components, cleaning is usually accomplished either by water-based alkali cleaning, but may also involve acid etching or solvent cleaning / rinsing. Nickel plating may also be necessary to ensure proper wetting. All of these cleaning or plating technologies have associated waste disposal issues, and this article explores an alternative cleaning process that generates minimal waste. Cathodic arc, or reserve polarity, is well known for welding of materials with tenacious oxide layers such as aluminum alloys. In this work the reverse polarity effect is used to clean austenitic stainless steel substrates prior to brazing with Ag-28%Cu. This cleaning process is compared to acid pickling and is shown to produce similar wetting behavior as measured by dynamic contact angle experiments. Additionally, dynamic contact angle measurements with water drops are conducted to show that cathodic arc cleaning can remove organic contaminants as well. The process does have its limitations however, and alloys with high titanium and aluminum content such as nickel-based superalloys may still require plating to ensure adequate wetting.

  19. Low arc drop hybrid mode thermionic converter

    Science.gov (United States)

    Shimada, K.

    1977-01-01

    The hybrid mode operation for the reduction of plasma drops is being investigated. This report discusses the results obtained from two molybdenum emitter converters. One converter had a molybdenum collector and the other a nickel collector. The molybdenum collector converter was operated in a hybrid mode (at an interelectrode distance of 1.7 mm) and produced a minimum barrier index of 1.96 eV at an emitter temperature of 1500 K. The arc drop was calculated to be 0.14 eV, using the published results for a molybdenum collector. On the other hand, the nickel collector converter was operated in a conventional ignited mode (at an interelectrode distance of 0.5 mm) and produced a minimum barrier index of 2.1 eV at an emitter temperature of 1700 K. It is tentatively concluded that a large-gap operation of the hybrid mode converter permits the diffusion of cesium ions to a distance in the order of one millimeter for an effective neutralization of electron space charge. By employing a low work function collector (1.55 eV) in a hybrid mode converter with an arc drop of 0.14 eV, it appears that a barrier index as low as 1.69 eV could be achieved.

  20. PSYCHOSOMATIC "ARC" IN THE PSYCHOTHERAPEUTIC PRACTICE

    Directory of Open Access Journals (Sweden)

    Ivanka Boncheva

    2012-11-01

    Full Text Available The psychoneuroimmunology, the new brain science and the endocrinology today show a lot of results, with which symptoms are better to understand. The psychotherapeutic practice shows the ways to influence them by encoding the levels of bounding between the physical symptom and the psychological condition. The aim of the study was to show the encoding of the psychosomatic arc within a real psychotherapeutic contact. 59 psychotherapeutic cases are followed. 33 of them were with somatoform disorders and 26 with chronic psychosomatic diseases. Every patient has minimum 12 psychotherapeutic sessions. The treatment is provided on the base of the 5 levels model of the positive psychotherapy.We ascertain the following:1. The most significant moment in the arise of such symptomatic is the gained past experience - "vital concepts"; "coping strategies";2. Unlocking moment for the arise of the affection is the fixed emotion - fear, aggression or depression, specific for the particular morbid pictures;3. Showing the connection between symptom and fixed emotion by the technique "positive interpretation", which unlocks the process of changingThis shows that the psychotherapeutic help is possible only if the patient rethink the psychosomatic arc. Showing the connections between the content of the unconscious, the fixed emotion in behavioral models and the symptom gives the impetus to change.

  1. Arc Deflection Length Affected by Transverse Rotating Magnetic Field with Lateral Gas

    Science.gov (United States)

    Shiino, Toru; Ishii, Yoko; Yamamoto, Shinji; Iwao, Toru; High Current Energy Laboratory (HiCEL) Team

    2016-10-01

    Gas metal arc welding using shielding gas is often used in the welding industry. However, the arc deflection affected by lateral gas is problem because of inappropriate heat transfer. Shielding gas is used in order to prevent the instability affected by the arc deflection. However, the shielding gas causes turbulence, then blowhole of weld defect occurs because the arc affected by the instability is contaminated by the air. Thus, the magnetic field is applied to the arc in order to stabilize the arc using low amount of shielding gas. The method of applying the transverse rotating magnetic field (RMF) to the arc is one of the methods to prevent the arc instability. The RMF drives the arc because of electromagnetic force. The driven arc is considered to be prevented to arc deflection of lateral gas because the arc is restrained by the magnetic field because of the driven arc. In addition, it is assume the RMF prevented to the arc deflection of lateral gas from the multiple directions. In this paper, the arc deflection length affected by the RMF with lateral gas was elucidated in order to know the effect of the RMF for arc stabilization. Specifically, the arc deflection length affected by the magnetic frequency and the magnetic flux density is measured by high speed video camera. As a result, the arc deflection length decreases with increasing magnetic frequency, and the arc deflection length increases with increasing the magnetic flux density.

  2. RHIC AC DIPOLE DESIGN AND CONSTRUCTION.

    Energy Technology Data Exchange (ETDEWEB)

    BAI,M.; METH,M.; PAI,C.; PARKER,B.; PEGGS,S.; ROSER,T.; SANDERS,R.; TRBOJEVIC,D.; ZALTSMAN,A.

    2001-06-18

    Two ac dipoles with vertical and horizontal magnetic field have been proposed at RHIC for applications in linear and non-linear beam dynamics and spin manipulations. A magnetic field amplitude of 380 Gm is required to produce a coherent oscillation of 5 times the rms beam size at the top energy. We take the ac dipole frequency to be 1.0% of the revolution frequency away from the betatron frequency. To achieve the strong magnetic field with minimum power loss, an air-core magnet with two seven turn winding of low loss Litz wire resonating at 64 kHz is designed. The system is also designed to allow one to connect the two magnet winding in series to resonate at 37 kHz for the spin manipulation. Measurements of a half length prototype magnet are also presented.

  3. Nanorod dynamics in ac electric fields

    Energy Technology Data Exchange (ETDEWEB)

    Ruda, H E; Shik, A [Centre for Advanced Nanotechnology, University of Toronto, Toronto, M5S 3E3 (Canada)

    2010-06-11

    Metal and semiconductor nanorods polarized by an external electric field tend to align parallel to this field. We derived the equation of motion for this alignment, taking into account electrostatic forces, thermal fluctuations and viscous resistance of the liquid the nanorods are suspended in. It was solved for a strong ac electric field, as well as for the combination of strong dc and weak ac fields. The results were used for calculations of the capacity of the nanorod solution, its frequency dispersion and dependence on the field strength. Modification of the nanorod absorption spectra under the influence of an electric field was also considered. It was shown that metal nanorods in laser radiation, with the frequency belonging to the interval between longitudinal and transverse plasmon modes, tend to align perpendicular, rather than parallel, to the optical electric field.

  4. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  5. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  6. Lazy AC-Pattern Matching for Rewriting

    OpenAIRE

    Walid Belkhir; Alain Giorgetti

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  7. Lazy AC-Pattern Matching for Rewriting

    Directory of Open Access Journals (Sweden)

    Walid Belkhir

    2012-04-01

    Full Text Available We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  8. The occurrence and damage of unipolar arcing on fuzzy tungsten

    NARCIS (Netherlands)

    Aussems, D. U. B.; Nishijima, D.; Brandt, C.; van der Meiden, H. J.; M. Vilémová,; J. Matějíček,; De Temmerman, G.; Doerner, R. P.; N.J. Lopes Cardozo,

    2015-01-01

    Abstract This research investigated whether unipolar arcing in the divertor of fusion reactors is a potential cause for enhanced wear of the divertor. It was found that 1 μm of nano-fuzz growth is sufficient to initiate arcing, mainly depending on the sheath potential drop and electron dens

  9. Variable-Polarity Plasma Arc Welding Of Alloy 2219

    Science.gov (United States)

    Walsh, Daniel W.; Nunes, Arthur C., Jr.

    1989-01-01

    Report presents results of study of variable-polarity plasma arc (VPPA) welding of aluminum alloy 2219. Consists of two parts: Examination of effects of microsegregation and transient weld stress on macrosegregation in weld pool and, electrical characterization of straight- and reverse-polarity portions of arc cycle.

  10. Using the ARCS Model To Design Multimedia College Engineering Courses.

    Science.gov (United States)

    Shellnut, Bonnie; Savage, Timothy; Knowlton, Allie

    This paper describes how a Wayne State University (Michigan) multimedia design team is applying Keller's ARCS (Attention, Relevance, Confidence, and Satisfaction) Model of Motivational Design to the entire process of design, development, and evaluation of multimedia courseware. The ARCS Model has been applied to the prototype module and is being…

  11. Anode heat transfer in a constricted tube arc.

    Science.gov (United States)

    Lukens, L. A.; Incropera, F. P.

    1971-01-01

    The complex energy exchange mechanisms occurring on the most severely heated component of an arc constrictor, the anode, have been investigated. Measurements performed to determine the anode heat flux for a cascade, atmospheric argon arc of the Maecker type are described. The results are used to check the validity of an existing anode heat transfer model.

  12. [Fatal electric arc accidents due to high voltage].

    Science.gov (United States)

    Strauch, Hansjürg; Wirth, Ingo

    2004-01-01

    The frequency of electric arc accidents has been successfully reduced owing to preventive measures taken by the professional association. However, the risk of accidents has continued to exist in private setting. Three fatal electric arc accidents caused by high voltage are reported with reference to the autopsy findings.

  13. Liquid Metal Oscillation and Arc Behaviour during Welding

    NARCIS (Netherlands)

    Yudodibroto, B.Y.B.

    2010-01-01

    The purpose of this research is to obtain insight into the oscillation behaviour of the liquid metal and the arc behaviour during GMA welding. Observations of the weld pool and the arc were undertaken by visual means using a high-speed video and by analysis of the voltage. To deal with the complex p

  14. Arc generation from sputtering plasma-dielectric inclusion interactions

    CERN Document Server

    Wickersham, C E J; Fan, J S

    2002-01-01

    Arcing during sputter deposition and etching is a significant cause of particle defect generation during device fabrication. In this article we report on the effect of aluminum oxide inclusion size, shape, and orientation on the propensity for arcing during sputtering of aluminum targets. The size, shape, and orientation of a dielectric inclusion plays a major role in determining the propensity for arcing and macroparticle emission. In previous studies we found that there is a critical inclusion size required for arcing to occur. In this article we used high-speed videos, electric arc detection, and measurements of particle defect density on wafers to study the effect of Al sub 2 O sub 3 inclusion size, shape, and orientation on arc rate, intensity, and silicon wafer particle defect density. We found that the cross-sectional area of the inclusion exposed to the sputtering plasma is the critical parameter that determines the arc rate and rate of macroparticle emission. Analysis of the arc rate, particle defect...

  15. Applying the ARCS Motivation Model in Technological and Vocational Education

    Science.gov (United States)

    Liao, Hung-Chang; Wang, Ya-huei

    2008-01-01

    This paper describes the incorporation of Keller's ARCS (Attention, Relevance, Confidence, and Satisfaction) motivation model into traditional classroom instruction-learning process. Viewing that technological and vocational students have low confidence and motivation in learning, the authors applied the ARCS motivation model not only in the…

  16. 29 CFR 1926.351 - Arc welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 8 2010-07-01 2010-07-01 false Arc welding and cutting. 1926.351 Section 1926.351 Labor... (CONTINUED) SAFETY AND HEALTH REGULATIONS FOR CONSTRUCTION Welding and Cutting § 1926.351 Arc welding and cutting. (a) Manual electrode holders. (1) Only manual electrode holders which are specifically...

  17. 29 CFR 1915.56 - Arc welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Arc welding and cutting. 1915.56 Section 1915.56 Labor... (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Welding, Cutting and Heating § 1915.56 Arc welding and cutting. The provisions of this section shall apply to ship...

  18. The complexity of finding arc-disjoint branching flows

    DEFF Research Database (Denmark)

    Bang-Jensen, J.; Havet, Frédéric; Yeo, Anders

    2016-01-01

    fixed integer k≥2 it is •an NP-complete problem to decide whether a network N=(V,A,u) where uij=k for every arc ij has two arc-disjoint branching flows rooted at s.•a polynomial problem to decide whether a network N=(V,A,u) on n vertices and uij=n-k for every arc ij has two arc-disjoint branching flows...... and for every k(n) with (log(n))1+ε(lunate)≤k(n)≤n2 (and for every large i we have k(n)=i for some n) there is no polynomial algorithm for deciding whether a given digraph contains two arc-disjoint branching flows from the same root so that no arc carries flow larger than n-k(n).......The concept of arc-disjoint flows in networks was recently introduced in Bang-Jensen and Bessy (2014). This is a very general framework within which many well-known and important problems can be formulated. In particular, the existence of arc-disjoint branching flows, that is, flows which send one...

  19. Arc Jet Testing of Thermal Protection Materials: 3 Case Studies

    Science.gov (United States)

    Johnson, Sylvia; Conley, Joe

    2015-01-01

    Arc jet testing is used to simulate entry to test thermal protection materials. This paper discusses the usefulness of arc jet testing for 3 cases. Case 1 is MSL and PICA, Case 2 is Advanced TUFROC, and Case 3 is conformable ablators.

  20. Ultraviolet radiation emitted by CO(2) arc welding.

    Science.gov (United States)

    Okuno, T; Ojima, J; Saito, H

    2001-10-01

    The arcs associated with arc welding emit high levels of ultraviolet radiation (UVR), and this often causes acute injuries in the workplace, particularly photokeratoconjunctivitis. It is important to know the level of UVR emitted by arc welding under various conditions, as this information will help in evaluating potential UVR hazards in welding workplaces and taking protective measures against it. In this study, the ACGIH effective irradiance for UVR was measured experimentally for CO(2) arc welding in order to evaluate its UVR hazards. A welding robot was used in the experiment in order to realize reproducible and consistent welding operations. The effective irradiance at 1 m from the arc was in the range 0.28-7.85 W/m(2) (28-785 microW/cm(2)) under the study conditions. The corresponding permissible exposure time per day is only 4-100 s, suggesting that UVR from CO(2) arc welding is actually hazardous for the eye and skin. It was found that the effective irradiance is inversely proportional to the square of the distance from the arc, is strongly dependent on the direction of emission from the arc with a maximum at 50-60 degrees from the plate surface, and tends to increase with welding current.

  1. Gas Tungsten Arc Welding. Welding Module 6. Instructor's Guide.

    Science.gov (United States)

    Missouri Univ., Columbia. Instructional Materials Lab.

    This guide is intended to assist vocational educators in teaching a three-unit module in gas tungsten arc welding. The module has been designed to be totally integrated with Missouri's Vocational Instruction Management System. The basic principles involved in gas tungsten arc welding, supplies, and applications are covered. The materials included…

  2. Water-vortex-stabilized electric arc: III. Radial energy transport, determination of water-vapour-boundary and arc performance

    Energy Technology Data Exchange (ETDEWEB)

    Jenista, Jiri [Institute of Plasma Physics ASCR, Za Slovankou 3, PO Box 17, Prague 8, 182 21 (Czech Republic)

    2003-12-07

    This paper is concerned with numerical modelling of an electric arc stabilized by a water vortex. The two-dimensional axisymmetric model presented includes the arc discharge area between the cathode and the outlet nozzle of the water plasma torch. The aims of the numerical simulations are: (1) to assess the influence of radial position of the water-vapour-boundary in the discharge chamber on arc performance and overall radial energy transport within the arc; (2) to determine the most probable mass flow rates and radii of the water-vapour-boundary in the discharge chamber for a prescribed current; (3) to demonstrate arc performance for two radiation models involved; and (4) to estimate validity of local thermodynamic equilibrium (LTE) conditions within the arc column. The rate of evaporation of water is calculated from the conduction and radiation heat fluxes at the water vapour surface for the specified mass flow rate. The behaviour of such an arc has been studied for a range of current 300-600 A. It is shown that changes of bulk magnitudes of different terms in the momentum and energy equations within the arc column as a function of arc radius enable us to reveal transitions of temperature and velocity fields from one steady state to a qualitatively different one. The best fit between experiment and numerical simulation for all currents exists for the mean arc radius {approx} 3.3 mm. Deviations from LTE within the arc column are estimated with the criteria for kinetic equilibrium and spatial temperature gradients.

  3. Cryocooled Josephson standards for AC voltage metrology

    Science.gov (United States)

    Durandetto, P.; Sosso, A.; Monticone, E.; Trinchera, B.; Fretto, M.; Lacquaniti, V.

    2017-05-01

    The Josephson effect is worldwide used as a basis for constant reference voltages in national metrological institutes and in calibration laboratories of industry. Research on Josephson voltage standards is aiming at a fundamental change also in the metrology of the volt for AC and arbitrary waveforms: programmable Josephson voltage standards converting a digital code into a quantum-accurate stepwise waveform are already available in primary laboratories and even more advanced standards for converting sub-nanosecond binary coded pulses into any arbitrary signal with quantum accuracy are now actively developed and tested. A new experimental setup based on a two-stage Gifford-McMahon cryocooler has been developed at INRiM for the operation of AC-Josephson voltage standards. Among its distinct features, the possibility of employing both the aforementioned techniques (programmable and pulsed Josephson voltage standards) is particularly interesting. Quantum-based AC voltage sine waves have been synthesized with both programmable and pulse-driven arrays, although their accuracy is still limited by thermal oscillations due to the cryocooler piston motion.

  4. The Hubble Legacy Archive ACS Grism Data

    CERN Document Server

    Kuemmel, M; Fosbury, R; Haase, J; Hook, R N; Kuntschner, H; Lombardi, M; Micol, A; Nilsson, K K; Stoehr, F; Walsh, J R

    2011-01-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 \\mu$m, with a dispersion of $40 \\ \\AA / pixel$ and a resolution of $\\sim 80\\ \\AA$ for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47,919 datasets (65% of the total number of extracted spect...

  5. AC susceptibilities of grain-textured superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, N. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan)], E-mail: saka@te.kyusan-u.ac.jp; Fukuda, Y.; Koga, M.; Akune, T. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan); Khan, H.R. [Institut von Ionenstrahl und Vakuum Technologie, 73728 Esslingen (Germany); Lueders, K. [Freie Universitaet Berlin, Arnimallee, Fac.Physik, D-14195 Berlin (Germany)

    2008-09-15

    In-phase {chi}{sub n}' and out-phase {chi}{sub n}'' components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field B{sub dc}, an amplitude B{sub a} and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low-T{sub c} metallic superconductors, {chi}{sub 1}' shows smooth transition and {chi}{sub 1}'' does single peak. High-T{sub c} oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in {chi}{sub 1}'' and shoulders in {chi}{sub 1}' appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  6. A method to determine arc position in ICRF systems

    Energy Technology Data Exchange (ETDEWEB)

    D’Inca, R., E-mail: rodolphe.dinca@ipp.mpg.de [Max-Planck-Institut für Plasmaphysik, EURATOM Association, Garching (Germany); Polozhiy, K.; Eckert, B.; Siegel, G. [Max-Planck-Institut für Plasmaphysik, EURATOM Association, Garching (Germany); Noterdaeme, J.-M. [Max-Planck-Institut für Plasmaphysik, EURATOM Association, Garching (Germany); EESA Department, Gent University (Belgium)

    2013-10-15

    Highlights: ► We show that the voltage noise characteristic of an arc in an ICRF system is due to the propagation and reflections of an electromagnetic pulse emitted by this arc. ► A simplified RF model of an arc in a testbed representative of an ICRF system is developed to see the effect of its location on the voltage noise it emits. ► The model is compared with the results on the testbed for arcs occurring at two locations: one can be determined precisely, the other with a decreased accuracy. -- Abstract: The study of arcs on ICRF systems has mainly focused on the development of fast detectors to detect a breakdown, independently from its position, before they can damage the components [1]. However, the ability to localize an arc is also an important factor: arcs can be the sign of a defect and if they occur at the same location, they give a good indication of the position of this defect without having to use intrusive diagnostics like optical fibers. We present here a method to find the position of arcs based on the analysis of their high-frequency noise. Arcs are indeed fast transient which excite frequencies in the MHz range. The SHAD system reacts on the integral value of this noise signal to detect the development of arcs. But a further investigation of this signal shows detailed features like splittings and chirpings of the frequency peaks which give more information on the source of the breakdown: at its birth, the arc emits a short electromagnetic pulse of several nanoseconds that propagates inside the ICRF system; this pulse is reflected by components like the antenna, the stub tuners or the generators back to the arc thereby changing its boundary conditions. This resonance between the arc and the ICRF system can be measured and the time of propagation of the pulse gives useful data on the position of the breakdown. We have carried out tests on the Manipulator eXPeriment (a testbed to artificially create arcs in a representative ICRF system) and

  7. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  8. Relationship between large horizontal electric fields and auroral arc elements

    Energy Technology Data Exchange (ETDEWEB)

    Lanchester, B.S. [Univ. of Southampton (United Kingdom); Kaila, K. [Univ. of Oulu (Finland); McCrea, I.W. [Rutherford Appleton Laboratory, Chilton, Didcot (United Kingdom)

    1996-03-01

    The authors report on data which correlates high time resolution optical measurements of auroral features with EISCAT radar measurements of electron density, with 0.2 sec time resolution and horizontal electric field, with time resolution near 9 sec. The associations between such electric fields and auroral arc features have been a subject of interest for years. They report on one event where following an auroral breakup, an arc moved southward. During 30 seconds of this event a section of the arc was close to the radar beam, and better resolution was available for the electric field measurements. The results indicate that the electric field pointed towards the point of brightest emission in the arc, indicating that the fields might be associated with the charged-particle precipitation causing the bright features in the arc.

  9. Investigation on the stepping arc stud welding process

    Institute of Scientific and Technical Information of China (English)

    Chi Qiang; Zhang Jianxun; Fu Jifei; Zhang Youquan

    2005-01-01

    Through the investigation on traditional arc stud welding process, a new welding gun and its control system were developed in this paper. The stepping arc stud welding gun was mainly made by a stepping motor as actuating unit and a screw-driven device as moving unit. A control system with a MCS-51 single-chip microcomputer as main control component was used to realize the new stud welding procedure. This new welding process with stepping stud welding gun is named as stepping arc stud welding. In the new welding process, the stud action can be looked as constituted by some micro steps. The setting and adjusting of the stepping arc welding gun behavior parameters are accomplished independently. It is indicated from the results of process tests and bending test that the stepping arc stud welding process is practicable.

  10. Investigation of optimal control system for arc spraying

    Institute of Scientific and Technical Information of China (English)

    Li Heqi; Li Chunxu

    2005-01-01

    Arc-voltage feedback PID ( Proportional plus Integral plus Differential) controller and arc-current feedback PID controller are designed with an algorithm of discrete PID. In order to realize parameters optimization and adaptation of the arc-spraying process and to reduce blindness in selecting process parameters, a serial communication interface between PC and MCU (Micro Control Unit) is designed so that on-line modification of the PID control parameters is implemented. A genetic algorithm is adopted to optimize PID control parameters. Meanwhile, the error between the actual value and the setting value of spraying current is selected as the judgment criterion to determine the adaptability for the algorithm. The best optimal population of PID control parameters can be obtained, so that the optimal controlling in arc-spraying process is realized and an excellent coating of arc-spraying is obtained.

  11. Theory of Parabolic Arcs in Interstellar Scintillation Spectra

    CERN Document Server

    Cordes, J M; Stinebring, D R; Coles, W A; Cordes, James M.; Rickett, Barney J.; Stinebring, Daniel R.; Coles, William A.

    2004-01-01

    Our theory relates the secondary spectrum, the 2D power spectrum of the radio dynamic spectrum, to the scattered pulsar image in a thin scattering screen geometry. Recently discovered parabolic arcs in secondary spectra are generic features for media that scatter radiation at angles much larger than the rms scattering angle. Each point in the secondary spectrum maps particular values of differential arrival-time delay and fringe rate (or differential Doppler frequency) between pairs of components in the scattered image. Arcs correspond to a parabolic relation between these quantities through their common dependence on the angle of arrival of scattered components. Arcs appear even without consideration of the dispersive nature of the plasma. Arcs are more prominent in media with negligible inner scale and with shallow wavenumber spectra, such as the Kolmogorov spectrum, and when the scattered image is elongated along the velocity direction. The arc phenomenon can be used, therefore, to constrain the inner scal...

  12. Mathematical Modeling of Metal Active Gas (MAG) Arc Welding

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    In the present paper, a numerical model for MAG (metal active gas) arc welding of thin plate has been developed. In MAG arc welding, the electrode wire is melted and supplied into the molten pool intermittently. Accordingly, it is assumed on the modeling that the thermal energy enters the base-plates through two following mechanisms, i.e., direct heating from arc plasma and “indirect” heating from the deposited metal. In the second part of the paper, MAG arc welding process is numerically analyzed by using the model, and the calculated weld bead dimension and surface profile have been compared with the experimental MAG welds on steel plate. As the result, it is made clear that the model is capable of predicting the bead profile of thin-plate MAG arc welding , including weld bead with undercutting.

  13. Single Arc VMAT of H&N patients

    DEFF Research Database (Denmark)

    Bertelsen, Anders; Hansen, Christian Rønn; Johansen, Jørgen;

      Background: A few planning systems are currently able to plan volumetric modulated arc therapy (VMAT) which can be delivered on Elekta and Varian accelerators. Pinnacles version of a VMAT algorithm is called SmartArc. SmartArcs capability to modulate complicated treatment plans is to be tested...... recommendations. The patients were re-planned with VMAT by use of the SmartArc algorithm in Pinnacle (research version). The collapsed cone dose engine was used for final dose calculation. One constraint for the re-planning study was to use only one single arc to create deliverable plans. The objectives were...... to achieve similar or better target coverage and sparring of organs at risk (OAR) as achieved in the IMRT plan. The VMAT plans were compared to the original IMRT plans by evaluation of 1) treatment time, 2) monitor units (MU) 3) DVH for targets and OAR and 4) the dose measured with a Delta4 phantom from...

  14. Single Arc VMAT of H&N cancer

    DEFF Research Database (Denmark)

    Bertelsen, Anders

      Background: A few radiation treatment planning systems are currently able to plan volumetric modulated arc therapy (VMAT). The VMAT algorithm in Pinnacle3 TM is called SmartArc. The capability of SmartArc to generate complex treatment plans for the head and neck (H&N) region was tested...... Target Volumes (PTV). The patients were re-planned with VMAT using the SmartArc algorithm in Pinnacle3TM 8.9c (research version). A constraint for the re-planning was to use only one single arc to create deliverable plans. The objectives were to achieve identical or better target coverage and sparing...... of the organs at risk (OAR) using VMAT compared to IMRT. The comparison was made by evaluating of 1) dose-volume histograms (DVHs) of PTVs and OARs, 2) monitor units, 3) treatment time, and 4) treatment accuracy as delivered on Elekta Synergy accelerators   Results: Preliminary results based on 11 patients...

  15. Single Arc VMAT of H&N patients

    DEFF Research Database (Denmark)

    Bertelsen, Anders; Hansen, Christian Rønn; Johansen, Jørgen;

    2009-01-01

      Background: A few planning systems are currently able to plan volumetric modulated arc therapy (VMAT) which can be delivered on Elekta and Varian accelerators. Pinnacles version of a VMAT algorithm is called SmartArc. SmartArcs capability to modulate complicated treatment plans is to be tested...... recommendations. The patients were re-planned with VMAT by use of the SmartArc algorithm in Pinnacle (research version). The collapsed cone dose engine was used for final dose calculation. One constraint for the re-planning study was to use only one single arc to create deliverable plans. The objectives were...... to achieve similar or better target coverage and sparring of organs at risk (OAR) as achieved in the IMRT plan. The VMAT plans were compared to the original IMRT plans by evaluation of 1) treatment time, 2) monitor units (MU) 3) DVH for targets and OAR and 4) the dose measured with a Delta4 phantom from...

  16. Effect of Energetic Electrons on Quiet Auroral Arc Formation

    Science.gov (United States)

    Hasegawa, Hiroki; Ohno, Nobuaki; Sato, Tetsuya

    2010-11-01

    The theory of feedback instability between the magnetosphere and ionosphere is believed as one of the candidate to explain the formation of quiet auroral arc. Then, some magneto-hydro- dynamics simulations showed the arc formation by this macroscopic instability, while the effect of auroral energetic electrons on the arc formation was neglected or given as a macroscopic parameter in these simulations. On the other hand, because of the recent development of particle simulations, auroral energetic electrons are thought to be produced by the super ion-acoustic double layer that should be created by microscopic instability. To make close investigation of auroral arc formation, it is necessary to consider the interaction with microscopic instability. In this paper, we numerically study the effect of energetic electrons on quiet auroral arc formation by means of the Macro-Micro Interlocked simulation.

  17. The confinement of Neptune's ring arcs by the moon Galatea

    Science.gov (United States)

    Namouni, Fathi; Porco, Carolyn

    2002-05-01

    Neptune has five narrow ring arcs, spanning about 40 degrees in longitude, which are apparently confined against the rapid azimuthal and radial spreading that normally results from inter-particle collisions. A gravitational resonance based on the vertical motion of the nearby neptunian moon Galatea was proposed to explain the trapping of the ring particles into a sequence of arcs. But recent observations have indicated that the arcs are away from the resonance, leaving their stability again unexplained. Here we report that a resonance based on Galatea's eccentricity is responsible for the angular confinement of the arcs. The mass of the arcs affects the precession of Galatea's eccentric orbit, which will enable a mass estimate from future observations of Galatea's eccentricity.

  18. Improvement on Diamond Nucleation Treated by Pulsed Arc Discharge Plasma

    Institute of Scientific and Technical Information of China (English)

    马志斌; 万军; 汪建华; 张文文

    2004-01-01

    A technique of improvement on diamond nucleation based on pulsed arc discharge plasma at atmospheric pressure was developed. The pulsed arc discharge was induced respectively by nitrogen, argon and methanol gas. After the arc plasma pretreatment, a nucleation density higher than 1010 cm-2 may be obtained subsequently in chemical vapor deposition (CVD) on a mirror-polished silicon substrate without any other mechanical treatment. The effects of the arc discharge plasma on the diamond nucleation were investigated by scanning electron microscopy (SEM), X-ray photoelectron spectroscopy (XPS), infrared spectroscopy (IR) and Raman spectroscopy. The enhancement of nucleation is postulated to be a result of the formation of carbonlike phase materials or nitrogenation on the substrate surface without surface defect produced by arc discharge.

  19. Single Arc VMAT of H&N cancer

    DEFF Research Database (Denmark)

    Bertelsen, Anders

      Background: A few radiation treatment planning systems are currently able to plan volumetric modulated arc therapy (VMAT). The VMAT algorithm in Pinnacle3 TM is called SmartArc. The capability of SmartArc to generate complex treatment plans for the head and neck (H&N) region was tested...... - when corrected for offset in output - satisfied a gamma criterion of 3mm and 3% of 2Gy compared to 99.7±0.1% for IMRT.   Conclusion: SmartArc generated single arc VMAT plans with improved target coverage and sparing of OARs compared to IMRT. The conformity was increased by VMAT compared to IMRT...... reducing high dose volumes in normal tissues. The VMAT plans used fewer MUs compared to the IMRT plans and reduced the treatment time by approximately 40% compared to IMRT. Both IMRT and VMAT radiation treatment plans delivered on an Elekta Synergy accelerator produced clinically acceptable geometric dose...

  20. Assistant Anode in a Cathodic Arc Plasma Source

    Institute of Scientific and Technical Information of China (English)

    张涛; Paul K. Chu; 张荟星; Ian G. Brown

    2001-01-01

    The performance and characteristics of a cathodic arc plasma source, consisting of a titanium cathode, an anode with and without a tungsten mesh, and a coil producing a focusing magnetic field between the anode and cathode,are investigated. The high transparency and large area of the mesh allow a high plasma flux to penetrate the anode from the cathodic arc. The mesh helps to decrease the arc resistance and the ignition voltage of the cathodic arc in the focusing magnetic field, and to increase the life of the source, which means that the source makes the cathodic arc easily and greatly stabilized during the operation when a focusing magnetic field exists in the source.

  1. The ArcD1 and ArcD2 arginine/ornithine exchangers encoded in the arginine deiminase (ADI) pathway gene cluster of Lactococcus lactis

    NARCIS (Netherlands)

    Noens, Elke E E; Kaczmarek, Michał B; Żygo, Monika; Lolkema, Juke S

    2015-01-01

    The arginine deiminase pathway (ADI) gene cluster in Lactococcus lactis contains two copies of a gene encoding an L-arginine/L-ornithine exchanger, the arcD1 and arcD2 genes. The physiological function of ArcD1 and ArcD2 was studied by deleting the two genes. Deletion of arcD1 resulted in loss of th

  2. Volcano geodesy in the Cascade arc, USA

    Science.gov (United States)

    Poland, Michael P.; Lisowski, Michael; Dzurisin, Daniel; Kramer, Rebecca; McLay, Megan; Pauk, Ben

    2017-08-01

    Experience during historical time throughout the Cascade arc and the lack of deep-seated deformation prior to the two most recent eruptions of Mount St. Helens might lead one to infer that Cascade volcanoes are generally quiescent and, specifically, show no signs of geodetic change until they are about to erupt. Several decades of geodetic data, however, tell a different story. Ground- and space-based deformation studies have identified surface displacements at five of the 13 major Cascade arc volcanoes that lie in the USA (Mount Baker, Mount St. Helens, South Sister, Medicine Lake, and Lassen volcanic center). No deformation has been detected at five volcanoes (Mount Rainier, Mount Hood, Newberry Volcano, Crater Lake, and Mount Shasta), and there are not sufficient data at the remaining three (Glacier Peak, Mount Adams, and Mount Jefferson) for a rigorous assessment. In addition, gravity change has been measured at two of the three locations where surveys have been repeated (Mount St. Helens and Mount Baker show changes, while South Sister does not). Broad deformation patterns associated with heavily forested and ice-clad Cascade volcanoes are generally characterized by low displacement rates, in the range of millimeters to a few centimeters per year, and are overprinted by larger tectonic motions of several centimeters per year. Continuous GPS is therefore the best means of tracking temporal changes in deformation of Cascade volcanoes and also for characterizing tectonic signals so that they may be distinguished from volcanic sources. Better spatial resolution of volcano deformation can be obtained through the use of campaign GPS, semipermanent GPS, and interferometric synthetic aperture radar observations, which leverage the accumulation of displacements over time to improve signal to noise. Deformation source mechanisms in the Cascades are diverse and include magma accumulation and withdrawal, post-emplacement cooling of recent volcanic deposits, magmatic

  3. Volcano geodesy in the Cascade arc, USA

    Science.gov (United States)

    Poland, Michael; Lisowski, Michael; Dzurisin, Daniel; Kramer, Rebecca; McLay, Megan; Pauk, Benjamin

    2017-01-01

    Experience during historical time throughout the Cascade arc and the lack of deep-seated deformation prior to the two most recent eruptions of Mount St. Helens might lead one to infer that Cascade volcanoes are generally quiescent and, specifically, show no signs of geodetic change until they are about to erupt. Several decades of geodetic data, however, tell a different story. Ground- and space-based deformation studies have identified surface displacements at five of the 13 major Cascade arc volcanoes that lie in the USA (Mount Baker, Mount St. Helens, South Sister, Medicine Lake, and Lassen volcanic center). No deformation has been detected at five volcanoes (Mount Rainier, Mount Hood, Newberry Volcano, Crater Lake, and Mount Shasta), and there are not sufficient data at the remaining three (Glacier Peak, Mount Adams, and Mount Jefferson) for a rigorous assessment. In addition, gravity change has been measured at two of the three locations where surveys have been repeated (Mount St. Helens and Mount Baker show changes, while South Sister does not). Broad deformation patterns associated with heavily forested and ice-clad Cascade volcanoes are generally characterized by low displacement rates, in the range of millimeters to a few centimeters per year, and are overprinted by larger tectonic motions of several centimeters per year. Continuous GPS is therefore the best means of tracking temporal changes in deformation of Cascade volcanoes and also for characterizing tectonic signals so that they may be distinguished from volcanic sources. Better spatial resolution of volcano deformation can be obtained through the use of campaign GPS, semipermanent GPS, and interferometric synthetic aperture radar observations, which leverage the accumulation of displacements over time to improve signal to noise. Deformation source mechanisms in the Cascades are diverse and include magma accumulation and withdrawal, post-emplacement cooling of recent volcanic deposits, magmatic

  4. [Study on the arc spectral information for welding quality diagnosis].

    Science.gov (United States)

    Li, Zhi-Yong; Gu, Xiao-Yan; Li, Huan; Yang, Li-Jun

    2009-03-01

    Through collecting the spectral signals of TIG and MIG welding arc with spectrometer, the arc light radiations were analyzed based on the basic theory of plasma physics. The radiation of welding arc distributes over a broad range of frequency, from infrared to ultraviolet. The arc spectrum is composed of line spectra and continuous spectra. Due to the variation of metal density in the welding arc, there is great difference between the welding arc spectra of TIG and MIG in both their intensity and distribution. The MIG welding arc provides more line spectra of metal and the intensity of radiation is greater than TIG. The arc spectrum of TIG welding is stable during the welding process, disturbance factors that cause the spectral variations can be reflected by the spectral line related to the corresponding element entering the welding arc. The arc spectrum of MIG welding will fluctuate severely due to droplet transfer, which produces "noise" in the line spectrum aggregation zone. So for MIG welding, the spectral zone lacking spectral line is suitable for welding quality diagnosis. According to the characteristic of TIG and MIG, special spectral zones were selected for welding quality diagnosis. For TIG welding, the selected zone is in ultraviolet zone (230-300 nm). For MIG welding, the selected zone is in visible zone (570-590 nm). With the basic theory provided for welding quality diagnosis, the integral intensity of spectral signal in the selected zone of welding process with disturbing factor was studied to prove the theory. The results show that the welding quality and disturbance factors can be diagnosed with good signal to noise ratio in the selected spectral zone compared with signal in other spectral zone. The spectral signal can be used for real-time diagnosis of the welding quality.

  5. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  6. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  7. Analysis of low energy arc discharge characteristics based on dynamic V-A characteristics model

    Institute of Scientific and Technical Information of China (English)

    JING Li-nan; WANG Li-gong

    2006-01-01

    Low energy arc discharge characteristics was analyzed based on dynamic V-A characteristics model. It draws conclusions that discharge time relates to the source voltage and the product of inductance and stable current, discharge time will increase when the source voltage increases; current reduce rate is in inverse proportion to the value of inductance; arc resistance when the arc occurs is the ratio of minimum arcing voltage to stable current. It also gains the expressions of arc resistance and arc power, arc resistance and arc power both increase as the source voltage increases and decrease as the value of inductance increases. Conclusions above mentioned are helpful to design intrinsically safe circuits.

  8. Simulation of the Effects of Several Factors on Arc Plasma Behavior in Low Voltage Circuit Breaker

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Taking into account the properties of the arc plasma and the electromagnetic, heat and radiative phenomena, commercial computational fluid dynamics software PHOENICS has been adapted and modified to develop the three-dimensional magneto-hydrodynamic (MHD)model of arc in a low voltage circuit breaker. The effects of the arc ignition location, venting size and gassing material on arc behavior have been investigated. The analysis of the results show that the arc velocity accelerates with the increase in the distance between arc ignition location and of the venting size, and the existence of the gassing material is beneficial to improving the arc voltage and reducing the arc temperature.

  9. The modelling of an SF6 arc in a supersonic nozzle: II. Current zero behaviour of the nozzle arc

    Science.gov (United States)

    Zhang, Q.; Liu, J.; Yan, J. D.; Fang, M. T. C.

    2016-08-01

    The present work (part II) forms the second part of an investigation into the behaviour of SF6 nozzle arc. It is concerned with the aerodynamic and electrical behaviour of a transient nozzle arc under a current ramp specified by a rate of current decay (di/dt) before current zero and a voltage ramp (dV/dt) after current zero. The five flow models used in part I [1] for cold gas flow and DC nozzle arcs have been applied to study the transient arc at three stagnation pressures (P 0) and two values of di/dt for the current ramp, representing a wide range of arcing conditions. An analysis of the physical mechanisms encompassed in each flow model is given with an emphasis on the adequacy of a particular model in describing the rapidly varying arc around current zero. The critical rate of rise of recovery voltage (RRRV) is found computationally and compared with test results of Benenson et al [2]. For transient nozzle arcs, the RRRV is proportional to the square of P 0, rather than to the square root of P 0 for DC nozzle arcs. The physical mechanisms responsible for the strong dependence of RRRV on P 0 have been investigated. The relative merits of the flow models employed are discussed.

  10. Gas Tungsten Arc Welding and Plasma Arc Cutting. Teacher Edition [and] Student Edition [and] Student Workbook. Second Edition.

    Science.gov (United States)

    Harper, Eddie; Knapp, John

    This packet of instructional materials for a gas tungsten arc welding (GTAW) and plasma arc cutting course is comprised of a teacher edition, student edition, and student workbook. The teacher edition consists of introductory pages and teacher pages. Introductory pages include training and competency profile, state duty/task crosswalk,…

  11. Passive Visual Sensing in Automatic Arc Welding

    DEFF Research Database (Denmark)

    Liu, Jinchao

    the interference of the extremely strong arc light and controlling the exposure time of the camera on the y to capture dierent images for seam tracking and weld pool sensing. From the software side, we have designed a passive seam detection algorithm based on robust estimation techniques which can detect the seam...... industrial solutions for seam detection such as using laser scanners suer from several limitations. For instance, it must be positioned some distance ahead to the molten pool and may cause problem when dealing with shiny surfaces. Existing techniques for weld pool sensing mostly rely on auxiliary light......, interpreting the images captured in a passive way during welding is challenging and may heavily rely on sophisticated image analysis and machine learning techniques. This industrial PhD project has been founded to tackle this problem. For the last three years, we have explored dierent possibilities...

  12. Hydrothermal treatment of electric arc furnace dust.

    Science.gov (United States)

    Yu, Bing-Sheng; Wang, Yuh-Ruey; Chang, Tien-Chin

    2011-06-15

    In this study, ZnO crystals were fabricated from electric arc furnace dust (EAFD) after alkaline leaching, purification and hydrothermal treatment. The effects of temperature, duration, pH, and solid/liquid ratio on ZnO crystal morphology and size were investigated. Results show a high reaction temperature capable of accelerating the dissolution of ZnO precursor, expediting the growth of 1D ZnO, and increasing the L/D ratio in the temperature range of 100-200°C. ZnO crystals with high purity can also be obtained, using the one-step hydrothermal treatment with a baffle that depends on the different solubility of zincite and franklinite in the hydrothermal conditions.

  13. Electrical Arc Ignition Testing of Spacesuit Materials

    Science.gov (United States)

    Smith, Sarah; Gallus, Tim; Tapia, Susana; Ball, Elizabeth; Beeson, Harold

    2006-01-01

    A viewgraph presentation on electrical arc ignition testing of spacesuit materials is shown. The topics include: 1) Background; 2) Test Objectives; 3) Test Sample Materials; 4) Test Methods; 5) Scratch Test Objectives; 6) Cotton Scratch Test Video; 7) Scratch Test Results; 8) Entire Date Plot; 9) Closeup Data Plot; 10) Scratch Test Problems; 11) Poke Test Objectives; 12) Poke Test Results; 13) Poke Test Problems; 14) Wire-break Test Objectives; 15) Cotton Wire-Break Test Video; 16) High Speed Cotton Wire-break Test Video; 17) Typical Data Plot; 18) Closeup Data Plot; 19) Wire-break Test Results; 20) Wire-break Tests vs. Scratch Tests; 21) Urethane-coated Nylon; and 22) Moleskin.

  14. DOM database based on ArcSDE

    Science.gov (United States)

    Wu, Wen-bo; Bing, Yuan-yuan

    2009-10-01

    To solve the problems of massive, multi-source provincial image data management, storage, retrieval, and so on, ArcSDE spatial data engine architecture and data model are used to establish a provincial DOM database by combining Oracle 10g database management system. The establishment of the database of remote sensing images successfully solve some specific problems of the block image data processing, image pyramid building, data compression, etc. Meanwhile, the grid index structure and the method of retrieval based on contents are adopted. It has been proved by practice that the disposal of the images by level and block can store the images in a fast and efficient way. The combination of grid index accelerates the retrieval of the images, and the DOM data can be effectively organized, security storage and effectively used.

  15. The Application Developers Framework for .NET in ArcGIS%ArcGIS中的.NET应用开发框架

    Institute of Scientific and Technical Information of China (English)

    李建中

    2008-01-01

    本文介绍了ArcGIS中的.NET应用开发框架(.NET Application Developer Framework:.NET ADF或者ADF),这个框架的目的是为ArcGIS服务器开发Web应用程序,为Web用户提供网络上的地理信息系统服务.这个框架大体可分成3个部分:用于Microsoft Visual Studio .NET集成开发环境的模板;用于.NET ASP的ArcGIS Web控件;便捷类.ADF部署在ArcGIS服务器上,调用服务器上的ArcObjects完成有关GIS的Web服务.

  16. 3D cartography of the Alpine Arc

    Science.gov (United States)

    Vouillamoz, N.; Sue, C.; Champagnac, J. D.; Calcagno, P.

    2012-04-01

    We present a 3D cartography of the alpine arc, a highly non-cylindrical mountain belt, built using the 3D GeoModeller of the BRGM (French geological survey). The model allows to handle the large-scale 3D structure of seventeen major crustal units of the belt (from the lower crust to the sedimentary cover nappes), and two main discontinuities (the Insubric line and the Crustal Penninic Front). It provides a unique document to better understand their structural relationships and to produce new sections. The study area comprises the western alpine arc, from the Jura to the Northwest, up to the Bergell granite intrusion and the Lepontine Dome to the East, and is limited to the South by the Ligurian basin. The model is limited vertically 10 km above sea level at the top, and the moho interface at the bottom. We discarded the structural relationships between the Alps sensus stricto and the surrounding geodynamic systems such as the Rhine graben or the connection with the Apennines. The 3D-model is based on the global integration of various data such as the DEM of the Alps, the moho isobaths, the simplified geological and tectonic maps of the belt, the crustal cross-sections ECORS-CROP and NFP-20, and complementary cross-sections specifically built to precise local complexities. The database has first been integrated in a GIS-project to prepare their implementation in the GeoModeller, by homogenizing the different spatial referencing systems. The global model is finally interpolated from all these data, using the potential field method. The final document is a new tri-dimentional cartography that would be used as input for further alpine studies.

  17. ArcGeomorphometry: A toolbox for geomorphometric characterisation of DEMs in the ArcGIS environment

    Science.gov (United States)

    Rigol-Sanchez, Juan P.; Stuart, Neil; Pulido-Bosch, Antonio

    2015-12-01

    A software tool is described for the extraction of geomorphometric land surface variables and features from Digital Elevation Models (DEMs). The ArcGeomorphometry Toolbox consists of a series of Python/Numpy processing functions, presented through an easy-to-use graphical menu for the widely used ArcGIS package. Although many GIS provide some operations for analysing DEMs, the methods are often only partially implemented and can be difficult to find and used effectively. Since the results of automated characterisation of landscapes from DEMs are influenced by the extent being considered, the resolution of the source DEM and the size of the kernel (analysis window) used for processing, we have developed a tool to allow GIS users to flexibly apply several multi-scale analysis methods to parameterise and classify a DEM into discrete land surface units. Users can control the threshold values for land surface classifications. The size of the processing kernel can be used to identify land surface features across a range of landscape scales. The pattern of land surface units from each attempt at classification is displayed immediately and can then be processed in the GIS alongside additional data that can assist with a visual assessment and comparison of a series of results. The functionality of the ArcGeomorphometry toolbox is described using an example DEM.

  18. Numerical and experimental study of transferred arcs in argon

    Energy Technology Data Exchange (ETDEWEB)

    Bini, R [Department of Mechanical Engineering, Politecnico di Milano, Via Bonardi 9, 20133 Milan (Italy); Monno, M [Department of Mechanical Engineering, Politecnico di Milano, Via Bonardi 9, 20133 Milan (Italy); Boulos, M I [Centre de Recherche en Energie, Plasma et Electrochimie (CREPE), Department de Genie Chimique Universite de Sherbrooke, 2500 Boul. Universite, Sherbrooke, J1K1R2 (Canada)

    2006-08-07

    The bidimensional model of the electric arc is enhanced with the plasma-electrodes interaction to predict the properties and the energy distribution of an argon arc operating with current intensities between 100 and 200 A and electrode gaps of 10 and 20 mm. An adaptive numerical insulation is applied to the cathode, to properly simulate its thermionic emission mechanism and overcome the dependence on empirical distributions of the current density at its tip. The numerical results are quantitatively compared with the data obtained from calorimetric and spectroscopical measurements, performed on a device which generates a transferred arc between a water cooled copper anode and a thoriated tungsten cathode enclosed in a stainless steel chamber. The calculation of the heat fluxes towards the electrodes permits to determine the amount of power delivered to each component of the arc system (the anode, the cathode assembly and the chamber) and to evaluate the overall efficiency of the process for different configurations. The agreement between theory and data, over the range of parameters investigated, is sensible both in the temperature profiles and in the energy distributions. In such configurations, the conduction from the hot gas is the most relevant term in the overall heat transferred to the anode, but it is the electron transfer which rules the heat transfer in the arc attachment zone. The arc attachment radius is also dependent on the process parameters and increases with the arc current (from approximately 5 mm at 100 A to 7 mm at 200 A) and the arc length. However the maximum heat flux reached on the axis decreases increasing the gap between the electrodes, although more power is delivered to the anode due to the radial spreading of the plasma. A 10 mm 200 A argon arc releases to the anode about 2.6 kW, which corresponds to 75% of the total arc power available. If the arc is extended to 20 mm the power transferred rises by nearly 350 W, but the overall

  19. Carboniferous rifted arcs leading to an archipelago of multiple arcs in the Beishan-Tianshan orogenic collages (NW China)

    Science.gov (United States)

    Tian, Zhonghua; Xiao, Wenjiao; Windley, Brian F.; Zhang, Ji'en; Zhang, Zhiyong; Song, Dongfang

    2016-12-01

    The Beishan and East Tianshan Orogenic Collages in the southernmost Central Asian Orogenic Belt (CAOB) record the final stages of evolution of the Paleo-Asian Ocean. These collages and their constituent arcs have an important significance for resolving current controversies regarding their tectonic setting and age, consequent accretionary history of the southern CAOB, and the closure time of the Paleo-Asian Ocean. In this paper, we present our work on the southern Mazongshan arc and the northern Hongyanjing Basin in the Beishan Orogenic Collage (BOC), and our comparison with the Bogda arc and associated basins in the East Tianshan Orogenic Collage. Field relationships indicate that the Pochengshan fault defines the boundary between the arc and basin in the BOC. Volcanic rocks including basalts and rhyolites in the Mazongshan arc have bimodal calc-alkaline characteristics, an enrichment in large ion lithophile elements such as Rb, Ba, and Pb and depletion in high field-strength elements (e.g., Nb and Ta), which were probably developed in a subduction-related tectonic setting. We suggest that these bimodal calc-alkaline volcanic rocks formed in rifted arcs instead of post-orogenic rifts with mantle plume inputs. By making detailed geochemical comparisons between the Mazongshan arc and the Bogda arc to the west, we further propose that they are similar and both formed in arc rifts, and helped generate a Carboniferous archipelago of multiple arcs in the southern Paleo-Asian Ocean. These data and ideas enable us to postulate a new model for the tectonic evolution of the southern CAOB.

  20. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  1. INFLUENCE OF VACUUM ARC PLASMA EVAPORATOR CATHODE GEOMETRY OF ON VALUE OF ADMISSIBLE ARC DISCHARGE CURRENT

    Directory of Open Access Journals (Sweden)

    I. A. Ivanou

    2015-01-01

    Full Text Available An analysis of main design parameters that determine a level of droplet formation intensity at the generating stage of plasma flow has been given in the paper. The paper considers the most widely used designs of water cooled consumable cathodes. Ti or Ti–Si and Fe–Cr alloys have been taken as a material for cathodes. The following calculated data: average ionic charge Zi for titanium plasma +1.6; for «titanium–silicon plasma» +1.2, an electronic discharge 1.6022 ⋅ 10–19 C, an ion velocity vi = 2 ⋅ 104 m/s, an effective volt energy equivalent of heat flow diverted in the cathode Uк = 12 V, temperature of erosion cathode surface Тп = 550 К; temperature of the cooled cathode surface То = 350 К have been accepted in order to determine dependence of a maximum admissible arc discharge current on cathode height. The calculations have been carried out for various values of the cathode heights hк (from 0.02 to 0.05 m. Diameter of a target cathode is equal to 0.08 m for a majority of technological plasma devices, therefore, the area of the erosion surface is S = 0.005 m2.A thickness selection for a consumable target cathode part in the vacuum arc plasma source has been justified in the paper. The thickness ensures formation of minimum drop phase in the plasma flow during arc cathode material evaporation. It has been shown that a maximum admissible current of an arc discharge is practically equal to the minimum current of stable arcing when thickness of the consumable cathode part is equal to 0.05 m. The admissible discharge current can be rather significant and ensure high productivity during coating process with formation of relatively low amount of droplet phase in the coating at small values of hк.

  2. Interruption Phenomenon in Intermediate-Frequency Vacuum Arc

    Science.gov (United States)

    Jiang, Yuan; Wu, Jianwen

    2016-03-01

    In the condition of the 3 mm gap, experiments for 360 Hz intermediate-frequency vacuum arc are carried out in interrupters with the diameters being 41 mm and with the contact materials being CuCr50 and Cu-W-WC alloy respectively. The results indicate that the contacts material is closely related to the breaking capacity of the vacuum interrupters and characteristics of an intermediate-frequency vacuum arc. For contacts with the same diameter, the breaking capacity of CuCr50 is better than that of Cu-W-WC. When the current fails to be interrupted, the arcs overflow the gap and present irregular performances in the first half wave. Consequently a voltage spike appears. More macroscopic metal droplets can be seen in the arc column between CuCr50 contacts because of the lower melting point. It is observed that the droplet emission is much more severe during arc reignition than that in the first half wave. It is much more conspicuous that the high frequency arc voltage noises appear in Cu-W-WC contacts when the vacuum arcs reignite, for higher temperature and stronger electronic emission ability of Cu-W-WC contacts. supported by National Natural Science Foundation of China (No. 51377007), Specialized Research Fund for the Doctoral Program of Higher Education of China (No. 20131102130006), and Fundamental Research Funds for the Central Universities of China

  3. The occurrence and damage of unipolar arcing on fuzzy tungsten

    Energy Technology Data Exchange (ETDEWEB)

    Aussems, D.U.B., E-mail: d.aussems@differ.nl [FOM Institute DIFFER – Dutch Institute for Fundamental Energy Research, Nieuwegein, NL-3430 BE (Netherlands); Nishijima, D.; Brandt, C. [Center for Energy Research, University of California at San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0417 (United States); Meiden, H.J. van der [FOM Institute DIFFER – Dutch Institute for Fundamental Energy Research, Nieuwegein, NL-3430 BE (Netherlands); Vilémová, M.; Matějíček, J. [Institute of Plasma Physics, Association EURATOM-IPP, 182 00 Prague 8 (Czech Republic); De Temmerman, G. [FOM Institute DIFFER – Dutch Institute for Fundamental Energy Research, Nieuwegein, NL-3430 BE (Netherlands); Doerner, R.P. [Center for Energy Research, University of California at San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0417 (United States); Lopes Cardozo, N.J. [Science and Technology of Nuclear Fusion, Eindhoven University of Technology, Den Dolech 2, Eindhoven (Netherlands)

    2015-08-15

    This research investigated whether unipolar arcing in the divertor of fusion reactors is a potential cause for enhanced wear of the divertor. It was found that 1 μm of nano-fuzz growth is sufficient to initiate arcing, mainly depending on the sheath potential drop and electron density. The average mass loss rate induced by the arc was determined from mass loss measurements and found to be consistent with the value estimated from the arc current. The average arc track erosion depth was estimated by using the measured mass loss and damaged surface area and was found to be one tenth of the fuzzy layer thickness. Due to melting of the fuzzy structures the actual depth is larger and some arc tracks occasionally appeared to even reach the bulk beyond the fuzzy layer. The conclusion of this study is therefore that arcing in the divertor of future tokamaks (e.g. ITER) potentially is an important cause for surface damage and plasma pollution.

  4. Lidar arc scan uncertainty reduction through scanning geometry optimization

    Directory of Open Access Journals (Sweden)

    H. Wang

    2015-10-01

    Full Text Available Doppler lidars are frequently operated in a mode referred to as arc scans, wherein the lidar beam scans across a sector with a fixed elevation angle and the resulting measurements are used to derive an estimate of the n minute horizontal mean wind velocity (speed and direction. Previous studies have shown that the uncertainty in the measured wind speed originates from turbulent wind fluctuations and depends on the scan geometry (the arc span and the arc orientation. This paper is designed to provide guidance on optimal scan geometries for two key applications in the wind energy industry: wind turbine power performance analysis and annual energy production. We present a quantitative analysis of the retrieved wind speed uncertainty derived using a theoretical model with the assumption of isotropic and frozen turbulence, and observations from three sites that are onshore with flat terrain, onshore with complex terrain and offshore, respectively. The results from both the theoretical model and observations show that the uncertainty is scaled with the turbulence intensity such that the relative standard error on the 10 min mean wind speed is about 30 % of the turbulence intensity. The uncertainty in both retrieved wind speeds and derived wind energy production estimates can be reduced by aligning lidar beams with the dominant wind direction, increasing the arc span and lowering the number of beams per arc scan. Large arc spans should be used at sites with high turbulence intensity and/or large wind direction variation when arc scans are used for wind resource assessment.

  5. Petrology and tectonics of Phanerozoic continent formation: From island arcs to accretion and continental arc magmatism

    Science.gov (United States)

    Lee, C.-T.A.; Morton, D.M.; Kistler, R.W.; Baird, A.K.

    2007-01-01

    Mesozoic continental arcs in the North American Cordillera were examined here to establish a baseline model for Phanerozoic continent formation. We combine new trace-element data on lower crustal xenoliths from the Mesozoic Sierra Nevada Batholith with an extensive grid-based geochemical map of the Peninsular Ranges Batholith, the southern equivalent of the Sierras. Collectively, these observations give a three-dimensional view of the crust, which permits the petrogenesis and tectonics of Phanerozoic crust formation to be linked in space and time. Subduction of the Farallon plate beneath North America during the Triassic to early Cretaceous was characterized by trench retreat and slab rollback because old and cold oceanic lithosphere was being subducted. This generated an extensional subduction zone, which created fringing island arcs just off the Paleozoic continental margin. However, as the age of the Farallon plate at the time of subduction decreased, the extensional environment waned, allowing the fringing island arc to accrete onto the continental margin. With continued subduction, a continental arc was born and a progressively more compressional environment developed as the age of subducting slab continued to young. Refinement into a felsic crust occurred after accretion, that is, during the continental arc stage, wherein a thickened crustal and lithospheric column permitted a longer differentiation column. New basaltic arc magmas underplate and intrude the accreted terrane, suture, and former continental margin. Interaction of these basaltic magmas with pre-existing crust and lithospheric mantle created garnet pyroxenitic mafic cumulates by fractional crystallization at depth as well as gabbroic and garnet pyroxenitic restites at shallower levels by melting of pre-existing lower crust. The complementary felsic plutons formed by these deep-seated differentiation processes rose into the upper crust, stitching together the accreted terrane, suture and former

  6. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  7. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  8. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  9. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  10. Dependence of Arc Plasma Dispersion Capability on its Temperature

    Institute of Scientific and Technical Information of China (English)

    CHEN Yun-Yun; SONG Yang; HE An-Zhi; LI Zhen-Hua

    2008-01-01

    @@ The relationship between the dispersion capability and the temperature of argon arc plasma at Iatm is deduced in view of the plasma's refractive index equation.The results indicate that argon arc plasma has a normal dispersion and its dispersion capability is nonlinear to the plasma's temperature in a wide range of temperature and wavelength region.According to the results of numerical calculation, the preferred optical methods are believed to be suitable for the diagnosis of argon arc plasma in different temperature regions.

  11. Composition Gradient Hard Coatings by Arc Ion Plating

    Institute of Scientific and Technical Information of China (English)

    CHEN Jun; LIN Guo-qiang; WANG Fu-gang

    2004-01-01

    Arc Ion Plating can be used to synthesize multi-component composition gradient hard coatings by adjusting arc currents of metal targets. The present work aims at a comprehensive description of such a technique. The examples of TiAl multi-layer alloy coatings and (Ti, M) N composition-gradient films were taken (M representing Zr, Nb etc.) for the purpose of explaining the working process and evaluating practical effects. The results show that this technique has the advantages of easy manipulation, rapid deposition, and wide composition range.Key Words: Arc Ion plating, hard coating, composition gradient coatings

  12. Determination of secondary collimator shape in electron arc therapy

    Energy Technology Data Exchange (ETDEWEB)

    Pla, M.; Podgorsak, E.B.; Pla, C.; Freeman, C.R. (Montreal General Hospital, PQ (Canada))

    1993-07-01

    The characteristic angle-[beta] concept in electron arc therapy of non-cylindrical target volume is applied in determining the required shape of the arced electron field to yield a uniform dose distribution inside the target volume. The empirical relationships derived for this purpose from the angle-[beta] concept are valid for all field widths and thus offer an improvement over the currently known empirical relationships which were derived as small-field-width approximations. The validity of the determination of field shapes in electron arc therapy with the empirical relationships based on the angle-[beta] concept is confirmed by measurements of dose distributions in a spherical phantom. (Author).

  13. Plasma backflow phenomenon in high-current vacuum arc

    Energy Technology Data Exchange (ETDEWEB)

    Wang Lijun [State Key Laboratory of Electrical Insulation and Power Equipment, Xi' an Jiaotong University, Xi' an 710049 (China); Jia Shenli [State Key Laboratory of Electrical Insulation and Power Equipment, Xi' an Jiaotong University, Xi' an 710049 (China); Zhang Ling [State Key Laboratory of Electrical Insulation and Power Equipment, Xi' an Jiaotong University, Xi' an 710049 (China); Shi Zongqian [State Key Laboratory of Electrical Insulation and Power Equipment, Xi' an Jiaotong University, Xi' an 710049 (China); Yang Dingge [State Key Laboratory of Electrical Insulation and Power Equipment, Xi' an Jiaotong University, Xi' an 710049 (China); Gentils, Francois [Schneider Electric SAS, 37 quai Paul-Louis Merlin, 38050 Grenoble Cedex 9 (France); Jusselin, BenoIt [Schneider Electric SAS, 37 quai Paul-Louis Merlin, 38050 Grenoble Cedex 9 (France)

    2007-10-07

    Based on the two-temperature magnetohydrodynamic model, a high-current vacuum arc (HCVA) in vacuum interrupters is simulated and analysed. The phenomenon of plasma backflow in arc column is found, which is ultimately ascribed to the strong magnetic pinch effect of HCVA. Due to plasma backflow, the maximal value of ion density at the cathode side is not located at the centre of the cathode side, but at the paraxial region of the cathode side, that is to say, ion density appears to sag at the centre of the cathode side (arc column seems to be divided into two parts). The sag of light intensity is also found by experiments.

  14. Phenomenology of surface arcs on spacecraft dielectric materials

    Science.gov (United States)

    Balmain, K. G.; Gossland, M.; Reeves, R. D.; Kuller, W. G.

    1982-01-01

    For electron beam incidence on large specimens of Kapton thermal blanket material, surface arc discharges are shown to cause damage consisting of punchthrough holes which act as focal points for other types of damage, including subsurface tunnels, blowout holes and surface breakup. Under electron bombardment, dielectric sheet specimens separated by a gap are shown to discharge simultaneously. Teflon specimens which have been brushed or rubbed are shown to exhibit directional guidance of discharge arcs, and this phenomenon has been used to generate straight arcs whose velocities have been measured optically.

  15. SHORTEST PATH ARC LENGTH NETWORK USING TRIANGULAR INTUITIONISTIC FUZZY NUMBER

    Directory of Open Access Journals (Sweden)

    A.D.CHANDRASEKARAN

    2016-04-01

    Full Text Available In this paper, an intuitionistic fuzzy shortest path is presented to find the optimal path in a network which a fuzzy number, instead of a positive integer is assigned to each arc length. The algorithm is based on the idea that firstly from all the shortest paths from source to destination, an arc with shortest length is computed and then the Euclidean distance is computed for all the paths with the arc of minimum distance. Finally an illustrative numerical example is given to express the proposed work.

  16. Energy Balance in DC Arc Plasma Melting Furnace

    Institute of Scientific and Technical Information of China (English)

    ZHAO Peng; MENG Yuedong; YU Xinyao; CHEN Longwei; JIANG Yiman; NI Guohua; CHEN Mingzhou

    2009-01-01

    In order to treat hazardous municipal solid waste incinerator's (MSWI) fly ash, a new DC arc plasma furnace was developed. Taking an arc of 100 V/1000 A DC as an example,the heat transfer characteristics of the DC arc plasma, ablation of electrodes, heat properties of the fly ash during melting, heat transfer characteristics of the flue gas, and heat loss of the furnace were analyzed based on the energy conservation law, so as to achieve the total heat information and energy balance during plasma processing, and to provide a theoretical basis for an optimized design of the structure and to improve energy efficiency.

  17. Arc tracking energy balance for copper and aluminum aeronautic cables

    Science.gov (United States)

    André, T.; Valensi, F.; Teulet, P.; Cressault, Y.; Zink, T.; Caussé, R.

    2017-04-01

    Arc tracking tests have been carried out between two voluntarily damaged aeronautic cables. Copper or aluminum conductors have been exposed to short circuits under alternating current. Various data have been recorded (arc voltage and current, radiated power and ablated mass), enabling to determine a power balance, in which every contribution is estimated. The total power is mainly transferred to the cables (between 50 and 65%, depending on the current and the cable type), and causes the melting and partial vaporization of the metallic core and insulating material, or is conducted or radiated. The other part is deposited into the arc column, being either radiated, convected or conducted.

  18. 交流接触器的常见故障及处理方法%Common failures and processing method of AC contactor

    Institute of Scientific and Technical Information of China (English)

    吕俊霞

    2012-01-01

      AC contactor is the most common application of a kind of electrical appliances in power system. The AC contactor common faults, the fault cause and the specific methods removing the faults are analyzed, including contactor inadequate suction, coil overheat or burn out, interphase short circuit and abnormal arcing etc..%  交流接触器是电力系统应用最普遍的一种电器。分析了交流接触器的常见故障、产生故障的原因及排除故障的具体方法,主要涉及接触器吸力不足、线圈过热或烧坏、相间短路、灭弧装置不正常灭弧等。

  19. Arc reattachment driven by a turbulent boundary layer: implications for the sweeping of lightning arcs along aircraft

    Science.gov (United States)

    Guerra-Garcia, C.; Nguyen, N. C.; Peraire, J.; Martinez-Sanchez, M.

    2016-09-01

    A lightning channel attached to an aircraft in flight will be swept along the aircraft’s surface in response to the relative velocity between the arc’s root (attached to a moving electrode) and the bulk of the arc, which is stationary with respect to the air. During this process, the reattachment of the arc to new locations often occurs. The detailed description of this swept stroke is still at an early stage of research, and it entails the interaction between an electrical arc and the flow boundary layer. In this paper we examine the implications of the structure of the boundary layer for the arc sweeping and reattachment process by considering different velocity profiles, both for laminar and turbulent flow, as well as a high fidelity description, using large eddy simulation, of transitional flow over an airfoil. It is found that the local velocity fluctuations in a turbulent flow may be important contributors to the reattachment of the arc, through a combination of an increased potential drop along the arc and local approaches of the arc to the surface. Specific flow features, such as the presence of a laminar recirculation bubble, can also contribute to the possibility of reattachment.

  20. Transport of Trace Fe from the Mariana Arc and Hydrothermal Exploration of the Mariana Back Arc Basin

    Science.gov (United States)

    Resing, J. A.; Chadwick, W. W., Jr.

    2016-02-01

    We will report on exploration of the Mariana back-arc basin for hydrothermal activity during a cruise in November to December 2015 aboard the Schmidt Ocean Institute's RV Falkor. We intend to use CTD casts and tows and the AUV sentry to explore the ridge between 13° and 18.5°N, a section long enough to be representative of the back arc in general and short enough to be practical for a single cruise. Global patterns of the number of vent sites as a function of spreading rate suggest that there should be at least 5-10 undiscovered vent sites along this unexplored 600-km section of the Mariana back-arc. During CTD casts and AUV dives hydrothermal activity will be identified using temperature, optical back scatter, and oxidation reduction potential. Where practical, fine scale hydrothermal and mult-ibeam mapping will be conducted by Sentry. During CTD casts, samples will be collected for, carbonate system parameters, dissolved metals, particulate matter, hydrogen, methane, and helium isotopes. We will take advantage of the cruise track to collect water in the upper 1000m using a Geotraces style rosette package and will analyze samples onboard for dissolved iron. Physical models of this region indicate transport is to the south and west at these latitudes. The Marina Arc lies to the east of the back-arc and past exploration of the arc has revealed hydrothermal activity from the near surface to more than 1000m at various sites along the arc.