ELF Magnetic Fields, Transients and TWA Metrics (invited paper)
International Nuclear Information System (INIS)
Kavet, R.
1999-01-01
Residential measurements of ambient power frequency magnetic fields may serve as surrogates for personal exposures. There are few data available, however, to determine how far back in time this surrogacy holds. A limited amount of research on residential transients suggests that, all other factors being equivalent, larger transients may propagate within VHCC neighbourhoods than within LCC neighbourhoods. However, the presence of a conductive residential ground pathway also appears to be a potentially important factor associated with residential transient activity. The use of the TWA metric was prompted by the need for an exposure score simple enough to summarise an individual's exposure over a prior interval, yet specific to the agent of concern, namely the power frequency magnetic field. To the extent that the TWA exposure is associated with health outcomes in the absence of bias, including confounding, the TWA metric is important. (author)
ELF Magnetic Fields, Transients and TWA Metrics (invited paper)
Energy Technology Data Exchange (ETDEWEB)
Kavet, R
1999-07-01
Residential measurements of ambient power frequency magnetic fields may serve as surrogates for personal exposures. There are few data available, however, to determine how far back in time this surrogacy holds. A limited amount of research on residential transients suggests that, all other factors being equivalent, larger transients may propagate within VHCC neighbourhoods than within LCC neighbourhoods. However, the presence of a conductive residential ground pathway also appears to be a potentially important factor associated with residential transient activity. The use of the TWA metric was prompted by the need for an exposure score simple enough to summarise an individual's exposure over a prior interval, yet specific to the agent of concern, namely the power frequency magnetic field. To the extent that the TWA exposure is associated with health outcomes in the absence of bias, including confounding, the TWA metric is important. (author)
Directory of Open Access Journals (Sweden)
Jing Ma
2009-01-01
Full Text Available Perchloroethylene (PERC is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994–2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.
International Nuclear Information System (INIS)
Ma, J.; Lessner, L.; Lessner, L.; Carpenter, D.O.; Schreiber, J.
2010-01-01
Perchloroethylene (PERC) is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994-2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.
The TWA 3 Young Triple System: Orbits, Disks, Evolution
Energy Technology Data Exchange (ETDEWEB)
Kellogg, Kendra [Department of Physics and Astronomy, The University of Western Ontario, London, ON N6A 3K7 (Canada); Prato, L.; Avilez, I.; Wasserman, L. H.; Levine, S. E.; Bosh, A. S. [Lowell Observatory, 1400 West Mars Hill Road, Flagstaff, AZ 86001 (United States); Torres, Guillermo [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Schaefer, G. H. [The CHARA Array of Georgia State University, Mount Wilson Observatory, Mount Wilson, CA 91023 (United States); Ruíz-Rodríguez, D. [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 2611 (Australia); Bonanos, Alceste Z. [IAASARS, National Observatory of Athens, 15236 Penteli (Greece); Guenther, E. W. [Thüringer Landessternwarte Tautenburg, D-07778 Tautenburg (Germany); Neuhäuser, R. [Astrophysikalisches Institut und Universitäts-Sternwarte, FSU Jena, Schillergäßchen 2-3, D-07745 Jena (Germany); Morzinski, Katie M.; Close, Laird; Hinz, Phil; Males, Jared R. [Steward Observatory, University of Arizona, 933 N. Cherry Ave, Tucson, AZ 85721 (United States); Bailey, Vanessa, E-mail: kkellogg@uwo.ca, E-mail: lprato@lowell.edu [Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics, Stanford University, Stanford, CA, 94305 (United States)
2017-08-01
We have characterized the spectroscopic orbit of the TWA 3A binary and provide preliminary families of probable solutions for the TWA 3A visual orbit, as well as for the wide TWA 3A–B orbit. TWA 3 is a hierarchical triple located at 34 pc in the ∼10 Myr old TW Hya association. The wide component separation is 1.″55; the close pair was first identified as a possible binary almost 20 years ago. We initially identified the 35-day period orbital solution using high-resolution infrared spectroscopy that angularly resolved the A and B components. We then refined the preliminary orbit by combining the infrared data with a reanalysis of our high-resolution optical spectroscopy. The orbital period from the combined spectroscopic solution is ∼35 days, the eccentricity is ∼0.63, and the mass ratio is ∼0.84; although this high mass ratio would suggest that optical spectroscopy alone should be sufficient to identify the orbital solution, the presence of the tertiary B component likely introduced confusion in the blended optical spectra. Using millimeter imaging from the literature, we also estimate the inclinations of the stellar orbital planes with respect to the TWA 3A circumbinary disk inclination and find that all three planes are likely misaligned by at least ∼30°. The TWA 3A spectroscopic binary components have spectral types of M4.0 and M4.5; TWA 3B is an M3. We speculate that the system formed as a triple, is bound, and that its properties were shaped by dynamical interactions between the inclined orbits and disk.
THE COOLEST ISOLATED BROWN DWARF CANDIDATE MEMBER OF TWA
Energy Technology Data Exchange (ETDEWEB)
Gagné, Jonathan; Lafrenière, David; Doyon, René; Malo, Lison; Artigau, Étienne [Département de Physique and Observatoire du Mont-Mégantic, Université de Montréal, C.P. 6128 Succ. Centre-ville, Montréal, Qc H3C 3J7 (Canada); Faherty, Jacqueline K. [Department of Terrestrial Magnetism, Carnegie Institution of Washington, Washington, DC 20015 (United States); Cruz, Kelle, E-mail: jonathan.gagne@astro.umontreal.ca, E-mail: jfaherty17@gmail.com [Department of Astrophysics, American Museum of Natural History, Central Park West at 79th Street, New York, NY 10034 (United States)
2014-04-10
We present two new late-type brown dwarf candidate members of the TW Hydrae association (TWA): 2MASS J12074836-3900043 and 2MASS J12474428-3816464, which were found as part of the BANYAN all-sky survey (BASS) for brown dwarf members of nearby young associations. We obtained near-infrared (NIR) spectroscopy for both objects (NIR spectral types are respectively L1 and M9), as well as optical spectroscopy for J1207-3900 (optical spectral type is L0γ), and show that both display clear signs of low gravity, and thus youth. We use the BANYAN II Bayesian inference tool to show that both objects are candidate members to TWA with a very low probability of being field contaminants, although the kinematics of J1247-3816 seem slightly at odds with that of other TWA members. J1207-3900 is currently the latest-type and the only isolated L-type candidate member of TWA. Measuring the distance and radial velocity of both objects is still required to claim them as bona fide members. Such late-type objects are predicted to have masses down to 11-15 M {sub Jup} at the age of TWA, which makes them compelling targets to study atmospheric properties in a regime similar to that of currently known imaged extrasolar planets.
Neutron Decay with PERC: a Progress Report
International Nuclear Information System (INIS)
Konrad, G; Abele, H; Erhart, J; Fillunger, H; Gösselsberger, C; Horvath, M; Jericha, E; Klauser, C; Maix, R K; Nowak, S; Sauerzopf, C; Beck, M; Heil, W; Drescher, C; Dubbers, D; Märkisch, B; Mest, H; Rebrova, N; Roick, C; Klenke, J
2012-01-01
The PERC collaboration will perform high-precision measurements of angular correlations in neutron beta decay at the beam facility MEPHISTO of the Forschungs-Neutronenquelle Heinz Maier-Leibnitz in Munich, Germany. The new beam station PERC, a clean, bright, and versatile source of neutron decay products, is designed to improve the sensitivity of neutron decay studies by one order of magnitude. The charged decay products are collected by a strong longitudinal magnetic field directly from inside a neutron guide. This combination provides the highest phase space density of decay products. A magnetic mirror serves to perform precise cuts in phase space, reducing related systematic errors. The new instrument PERC is under development by an international collaboration. The physics motivation, sensitivity, and applications of PERC as well as the status of the design and preliminary results on uncertainties in proton spectroscopy are presented in this paper.
Nez Perce Tribal Hatchery Program : Draft Environmental Impact Statement Summary.
Energy Technology Data Exchange (ETDEWEB)
United States. Bonneville Power Administration; Nez Perce Tribal Hatchery (Idaho)
1996-06-01
This summary gives the major points of the Draft Environmental Impact Statement (EIS) prepared for the Nez Perce Tribal Hatchery by the Nez Perce Tribe (NPT), the Bonneville Power Administration (BPA), the Bureau of Indian Affairs (BIA), and other interested parties. The Nez Perce once were one of the largest Plateau tribes in the Northwest and occupied a territory that included north central Idaho, southeastern Washington and northeastern Oregon. Salmon and other migratory fish species are an invaluable food resource and an integral part of the Nez Perce Tribe`s culture. Anadromous fish have always made up the bulk of the Nez Perce tribal diet and this dependence on salmon was recognized in the treaties made with the Tribe by the US. The historic economic, social, and religious significance of the fish to the Nez Perce Tribe continues to this day, which makes the decline of fish populations in the Columbia River Basin a substantial detrimental impact to the Nez Perce way of life. The Nez Perce Tribal Hatchery is a supplementation program that would rear and release spring, summer, and fall chinook (Oncorhynchus tshawytscha), biologically similar to wild fish, to reproduce in the Clearwater River Subbasin. Program managers propose techniques that are compatible with existing aquatic and riparian ecosystems and would integrate hatchery-produced salmon into the stream and river environments needed to complete their life cycle.
Nez Perce Tribal Hatchery Program: Draft environmental impact statement. Summary
International Nuclear Information System (INIS)
1996-06-01
This summary gives the major points of the Draft Environmental Impact Statement (EIS) prepared for the Nez Perce Tribal Hatchery by the Nez Perce Tribe (NPT), the Bonneville Power Administration (BPA), the Bureau of Indian Affairs (BIA), and other interested parties. The Nez Perce once were one of the largest Plateau tribes in the Northwest and occupied a territory that included north central Idaho, southeastern Washington and northeastern Oregon. Salmon and other migratory fish species are an invaluable food resource and an integral part of the Nez Perce Tribe's culture. Anadromous fish have always made up the bulk of the Nez Perce tribal diet and this dependence on salmon was recognized in the treaties made with the Tribe by the US. The historic economic, social, and religious significance of the fish to the Nez Perce Tribe continues to this day, which makes the decline of fish populations in the Columbia River Basin a substantial detrimental impact to the Nez Perce way of life. The Nez Perce Tribal Hatchery is a supplementation program that would rear and release spring, summer, and fall chinook (Oncorhynchus tshawytscha), biologically similar to wild fish, to reproduce in the Clearwater River Subbasin. Program managers propose techniques that are compatible with existing aquatic and riparian ecosystems and would integrate hatchery-produced salmon into the stream and river environments needed to complete their life cycle
Impact of repeated exposure on toxicity of perchloroethylene in Swiss Webster mice
International Nuclear Information System (INIS)
Philip, Binu K.; Mumtaz, Moiz M.; Latendresse, John R.; Mehendale, Harihara M.
2007-01-01
The aim was to study the subchronic toxicity of perchloroethylene (Perc) by measuring injury and repair in liver and kidney in relation to disposition of Perc and its major metabolites. Male SW mice (25-29 g) were given three dose levels of Perc (150, 500, and 1000 mg/kg day) via aqueous gavage for 30 days. Tissue injury was measured during the dosing regimen (0, 1, 7, 14, and 30 days) and over a time course of 24-96 h after the last dose (30 days). Perc produced significant liver injury (ALT) after single day exposure to all three doses. Liver injury was mild to moderate and regressed following repeated exposure for 30 days. Subchronic Perc exposure induced neither kidney injury nor dysfunction during the entire time course as evidenced by normal renal histology and BUN. TCA was the major metabolite detected in blood, liver, and kidney. Traces of DCA were also detected in blood at initial time points after single day exposure. With single day exposure, metabolism of Perc to TCA was saturated with all three doses. AUC/dose ratio for TCA was significantly decreased with a concomitant increase in AUC/dose of Perc levels in liver and kidney after 30 days as compared to 1 day exposures, indicating inhibition of metabolism upon repeated exposure to Perc. Hepatic CYP2E1 expression and activity were unchanged indicating that CYP2E1 is not the critical enzyme inhibited. Hepatic CYP4A expression, measured as a marker of peroxisome proliferation was increased transiently only on day 7 with the high dose, but was unchanged at later time points. Liver tissue repair peaked at 7 days, with all three doses and was sustained after medium and high dose exposure for 14 days. These data indicate that subchronic Perc exposure via aqueous gavage does not induce nephrotoxicity and sustained hepatotoxicity suggesting adaptive hepatic repair mechanisms. Enzymes other than CYP2E1, involved in the metabolism of Perc may play a critical role in the metabolism of Perc upon subchronic exposure
Pulsed Accretion in the T Tauri Binary TWA 3A
Energy Technology Data Exchange (ETDEWEB)
Tofflemire, Benjamin M.; Mathieu, Robert D. [Department of Astronomy, University of Wisconsin–Madison, 475 North Charter Street, Madison, WI 53706 (United States); Herczeg, Gregory J. [The Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); Akeson, Rachel L.; Ciardi, David R. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States)
2017-06-20
TWA 3A is the most recent addition to a small group of young binary systems that both actively accrete from a circumbinary disk and have spectroscopic orbital solutions. As such, it provides a unique opportunity to test binary accretion theory in a well-constrained setting. To examine TWA 3A’s time-variable accretion behavior, we have conducted a two-year, optical photometric monitoring campaign, obtaining dense orbital phase coverage (∼20 observations per orbit) for ∼15 orbital periods. From U -band measurements we derive the time-dependent binary mass accretion rate, finding bursts of accretion near each periastron passage. On average, these enhanced accretion events evolve over orbital phases 0.85 to 1.05, reaching their peak at periastron. The specific accretion rate increases above the quiescent value by a factor of ∼4 on average but the peak can be as high as an order of magnitude in a given orbit. The phase dependence and amplitude of TWA 3A accretion is in good agreement with numerical simulations of binary accretion with similar orbital parameters. In these simulations, periastron accretion bursts are fueled by periodic streams of material from the circumbinary disk that are driven by the binary orbit. We find that TWA 3A’s average accretion behavior is remarkably similar to DQ Tau, another T Tauri binary with similar orbital parameters, but with significantly less variability from orbit to orbit. This is only the second clear case of orbital-phase-dependent accretion in a T Tauri binary.
National Research Council Canada - National Science Library
Pfau, Scott E
2006-01-01
... Cavalry pursuit of the Nez Perce. Many of the tactics, techniques, and procedures used by the modern day warriors often derive from lessons learned in early US military confrontations, such as the Nez Perce, and are applicable...
Council of Energy Resources Tribes 1993 summer internship report: Nez Perce Tribe
Energy Technology Data Exchange (ETDEWEB)
Crow, J.S.
1993-08-01
This paper is designed to be a working part of a larger project which would deal with the topic of Tribal interests affected by the DOE Environmental Restoration and Waste Management program and the approaches by which those Tribal interests can be advanced. Topics discussed in this paper include: background history of the Nez Perce Tribe`s relations with the US government; a Nez Perce view of tribal interests affected by DOE activities at Hanford; and a Nez Perce framework for private/governmental/tribal interest.
Monitoring and evaluation plan for the Nez Perce Tribal Hatchery
Energy Technology Data Exchange (ETDEWEB)
Steward, C.R.
1996-08-01
The Nez Perce Tribe has proposed to build and operate the Nez Perce Tribal Hatchery (NPTH) in the Clearwater River subbasin of Idaho for the purpose of restoring self-sustaining populations of spring, summer, and fall chinook salmon to their native habitats. The project comprises a combination of incubation and rearing facilities, satellite rearing facilities, juvenile and adult collection sites, and associated production and harvest management activities. As currently conceived, the NPTH program will produce approximately 768,000 spring chinook parr, 800,000 summer chinook fry, and 2,000,000 fall chinook fry on an annual basis. Hatchery fish would be spawned, reared, and released under conditions that promote wild-type characteristics, minimize genetic changes in both hatchery and wild chinook populations, and minimize undesirable ecological interactions. The primary objective is to enable hatchery-produced fish to return to reproduce naturally in the streams in which they are released. These and other characteristics of the project are described in further detail in the Nez Perce Tribal Hatchery Master Plan, the 1995 Supplement to the Master Plan, and the Nez Perce Tribal Hatchery Program Environmental Impact Statement. The report in hand is referred to in project literature as the NPTH Monitoring and Evaluation (M&E) Plan. This report describes monitoring and evaluation activities that will help NPTH managers determine whether they were successful in restoring chinook salmon populations and avoiding adverse ecological impacts.
Nez Perce Tribal Hatchery Program : Draft Environmental Impact Statement.
Energy Technology Data Exchange (ETDEWEB)
United States. Bonneville Power Administration; Nez Perce Tribal Hatchery (Idaho).
1996-06-01
Bonneville Power Administration, the Bureau of Indian Affairs, the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Spring, summer and fall chinook salmon would be reared and acclimated to different areas in the Subbasin and released at the hatchery and satellite sites or in other watercourses throughout the Subbasin. The supplementation program differs from other hatchery programs because the fish would be released at different sizes and would return to reproduce naturally in the areas where they are released. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia River juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increase competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management.
Nez Perce Tribal Hatchery Program: Draft environmental impact statement
International Nuclear Information System (INIS)
1996-06-01
Bonneville Power Administration, the Bureau of Indian Affairs, the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Spring, summer and fall chinook salmon would be reared and acclimated to different areas in the Subbasin and released at the hatchery and satellite sites or in other watercourses throughout the Subbasin. The supplementation program differs from other hatchery programs because the fish would be released at different sizes and would return to reproduce naturally in the areas where they are released. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia River juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increase competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management
Formaldehyde exposure in U.S. industries from OSHA air sampling data.
Lavoue, Jerome; Vincent, Raymond; Gerin, Michel
2008-09-01
National occupational exposure databanks have been cited as sources of exposure data for exposure surveillance and exposure assessment for occupational epidemiology. Formaldehyde exposure data recorded in the U.S Integrated Management Information System (IMIS) between 1979 and 2001 were collected to elaborate a multi-industry retrospective picture of formaldehyde exposures and to identify exposure determinants. Due to the database design, only detected personal measurement results (n = 5228) were analyzed with linear mixed-effect models, which explained 29% of the total variance. Short-term measurement results were higher than time-weighted average (TWA) data and decreased 18% per year until 1987 (TWA data 5% per year) and 5% per year (TWA data 4% per year) after that. Exposure varied across industries with maximal estimated TWA geometric means (GM) for 2001 in the reconstituted wood products, structural wood members, and wood dimension and flooring industries (GM = 0.20 mg/m(3). Highest short-term GMs estimated for 2001 were in the funeral service and crematory and reconstituted wood products industries (GM = 0.35 mg/m(3). Exposure levels in IMIS were marginally higher during nonprogrammed inspections compared with programmed inspections. An increasing exterior temperature tended to cause a decrease in exposure levels for cold temperatures (-5% per 5 degrees C for T 15 degrees C). Concentrations measured during the same inspection were correlated and varied differently across industries and sample type (TWA, short term). Sensitivity analyses using TOBIT regression suggested that the average bias caused by excluding non-detects is approximately 30%, being potentially higher for short-term data if many non-detects were actually short-term measurements. Although limited by availability of relevant exposure determinants and potential selection biases in IMIS, these results provide useful insight on formaldehyde occupational exposure in the United States in the last
High precision neutron polarization for PERC
International Nuclear Information System (INIS)
Klauser, C.
2013-01-01
The decay of the free neutron into a proton, an electron and an anti-electron neutrino offers a simple system to study the semi-leptonic weak decay. High precision measurements of angular correlation coefficients of this decay provide the opportunity to test the standard model on the low energy frontier. The Proton Electron Radiation Channel PERC is part of a new generation of expriments pushing the accuracy of such an angular correlation coefficient measurement towards 10 -4 . Past experiments have been limited to an accuracy of 10 -3 with uncertainties on the neutron polarization as one of the leading systematic errors. This thesis focuses on the development of a stable, highly precise neutron polarization for a large, divergent cold neutron beam. A diagnostic tool that provides polarization higher than 99.99 % and analyzes with an accuracy of 10 -4 , the Opaque Test Bench, is presented and validated. It consists of two highly opaque polarized helium cells. The Opaque Test Bench reveals depolarizing effects in polarizing supermirrors commonly used for polarization in neutron decay experiments. These effects are investigated in detail. They are due to imperfect lateral magnetization in supermirror layers and can be minimized by significantly increased magnetizing fields and low incidence angle and supermirror factor m. A subsequent test in the crossed (X-SM) geometry demonstrated polarizations up to 99.97% from supermirrors only, improving neutron polarization with supermirrors by an order of magnitude. The thesis also discusses other neutron optical components of the PERC beamline: Monte-Carlo simulations of the beamline under consideration of the primary guide are carried out. In addition, calculation shows that PERC would statistically profit from an installation at the European Spallation source. Furthermore, beamline components were tested. A radio-frequency spin flipper was confirmed to work with an efficiency higher than 0.9999. (author) [de
Directory of Open Access Journals (Sweden)
Don-Roger Parkinson
2016-02-01
Full Text Available Water samples were collected and analyzed for conductivity, pH, temperature and trihalomethanes (THMs during the fall of 2014 at two monitored municipal drinking water source ponds. Both spot (or grab and time weighted average (TWA sampling methods were assessed over the same two day sampling time period. For spot sampling, replicate samples were taken at each site and analyzed within 12 h of sampling by both Headspace (HS- and direct (DI- solid phase microextraction (SPME sampling/extraction methods followed by Gas Chromatography/Mass Spectrometry (GC/MS. For TWA, a two day passive on-site TWA sampling was carried out at the same sampling points in the ponds. All SPME sampling methods undertaken used a 65-µm PDMS/DVB SPME fiber, which was found optimal for THM sampling. Sampling conditions were optimized in the laboratory using calibration standards of chloroform, bromoform, bromodichloromethane, dibromochloromethane, 1,2-dibromoethane and 1,2-dichloroethane, prepared in aqueous solutions from analytical grade samples. Calibration curves for all methods with R2 values ranging from 0.985–0.998 (N = 5 over the quantitation linear range of 3–800 ppb were achieved. The different sampling methods were compared for quantification of the water samples, and results showed that DI- and TWA- sampling methods gave better data and analytical metrics. Addition of 10% wt./vol. of (NH42SO4 salt to the sampling vial was found to aid extraction of THMs by increasing GC peaks areas by about 10%, which resulted in lower detection limits for all techniques studied. However, for on-site TWA analysis of THMs in natural waters, the calibration standard(s ionic strength conditions, must be carefully matched to natural water conditions to properly quantitate THM concentrations. The data obtained from the TWA method may better reflect actual natural water conditions.
Nez Perce Tribal Hatchery Program. Draft environmental impact statement
International Nuclear Information System (INIS)
1996-06-01
Bonneville Power Administration, the Bureau of Indian Affairs, and the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia river juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increased competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management. Impacts to cultural resources can be avoided so impacts would be low. Soil impacts would be localized and their effects would be local and temporary during construction. Impacts to water quality would be low. Mitigation would be used if impacts to groundwater or surface water are greater than anticipated. No impacts to floodplains are expected. Impacts to all categories of fish range from no to high impacts
Innovative manufacturing technologies for low-cost, high efficiency PERC-based PV modules
Energy Technology Data Exchange (ETDEWEB)
Yelundur, Vijay [Suniva Inc., Norcross, GA (United States)
2017-04-19
The goal this project was to accelerate the deployment of innovative solar cell and module technologies that reduce the cost of PERC-based modules to best-in-class. New module integration technology was to be used to reduce the cost and reliance on conventional silver bus bar pastes and enhance cell efficiency. On the cell manufacturing front, the cost of PERC solar cells was to be reduced by introducing advanced metallization approaches to increase cell efficiency. These advancements will be combined with process optimization to target cell efficiencies in the range of 21 to 21.5%. This project will also explore the viability of a bifacial PERC solar cell design to enable cost savings through the use of thin silicon wafers. This project was terminated on 4/30/17 after four months of activity due financial challenges facing the recipient.
Energy Technology Data Exchange (ETDEWEB)
Sintov, Nicole; Orosz, Michael; Schultz, P. Wesley
2015-01-01
The mission of the Personalized Energy Reduction Cyber-physical System (PERCS) is to create new possibilities for improving building operating efficiency, enhancing grid reliability, avoiding costly power interruptions, and mitigating greenhouse gas emissions. PERCS proposes to achieve these outcomes by engaging building occupants as partners in a user-centered smart service platform. Using a non-intrusive load monitoring approach, PERCS uses a single sensing point in each home to capture smart electric meter data in real time. The household energy signal is disaggregated into individual load signatures of common appliances (e.g., air conditioners), yielding near real-time appliance-level energy information. Users interact with PERCS via a mobile phone platform that provides household- and appliance-level energy feedback, tailored recommendations, and a competitive game tied to energy use and behavioral changes. PERCS challenges traditional energy management approaches by directly engaging occupant as key elements in a technological system.
Energy Technology Data Exchange (ETDEWEB)
Harty, Harold R.; Lundberg, Jeffrey H.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)
2005-02-01
The Nez Perce Tribal Hatchery (NPTH) responds directly to a need to mitigate for naturally-reproducing salmon in the Clearwater River subbasin. The overall goal is to produce and release fish that will survive to adulthood, spawn in the Clearwater River subbasin and produce viable offspring that will support future natural production and genetic integrity. Several underlying purposes of fisheries management will be maintained through this program: (1) Protect, mitigate, and enhance Columbia River subbasin anadromous fish resources. (2) Develop, reintroduce, and increase natural spawning populations of salmon within the Clearwater River subbasin. (3) Provide long-term harvest opportunities for Tribal and non-Tribal anglers within Nez Perce Treaty lands within four generations (20 years) following project completion. (4) Sustain long-term fitness and genetic integrity of targeted fish populations. (5) Keep ecological and genetic impacts to non-target populations within acceptable limits. (6) Promote Nez Perce Tribal Management of Nez Perce Tribal hatchery Facilities and production areas within Nez Perce Treaty lands. Nez Perce Tribal Hatchery is a supplementation program that will rear and release spring, fall, and early-fall stocks of chinook salmon. Two life stages of spring chinook salmon will be released: parr and presmolts. Fall and early-fall chinook salmon will be released as subyearling smolts. The intent of NPTHC is to use conventional hatchery and Natural Rearing Enhancement Systems (NATURES) techniques to develop, increase and restore natural populations of spring and fall chinook salmon in the Clearwater River subbasin.
Kapellusch, Jay M; Bao, Stephen S; Silverstein, Barbara A; Merryweather, Andrew S; Thiese, Mathew S; Hegmann, Kurt T; Garg, Arun
2017-12-01
The Strain Index (SI) and the American Conference of Governmental Industrial Hygienists (ACGIH) Threshold Limit Value for Hand Activity Level (TLV for HAL) use different constituent variables to quantify task physical exposures. Similarly, time-weighted-average (TWA), Peak, and Typical exposure techniques to quantify physical exposure from multi-task jobs make different assumptions about each task's contribution to the whole job exposure. Thus, task and job physical exposure classifications differ depending upon which model and technique are used for quantification. This study examines exposure classification agreement, disagreement, correlation, and magnitude of classification differences between these models and techniques. Data from 710 multi-task job workers performing 3,647 tasks were analyzed using the SI and TLV for HAL models, as well as with the TWA, Typical and Peak job exposure techniques. Physical exposures were classified as low, medium, and high using each model's recommended, or a priori limits. Exposure classification agreement and disagreement between models (SI, TLV for HAL) and between job exposure techniques (TWA, Typical, Peak) were described and analyzed. Regardless of technique, the SI classified more tasks as high exposure than the TLV for HAL, and the TLV for HAL classified more tasks as low exposure. The models agreed on 48.5% of task classifications (kappa = 0.28) with 15.5% of disagreement between low and high exposure categories. Between-technique (i.e., TWA, Typical, Peak) agreement ranged from 61-93% (kappa: 0.16-0.92) depending on whether the SI or TLV for HAL was used. There was disagreement between the SI and TLV for HAL and between the TWA, Typical and Peak techniques. Disagreement creates uncertainty for job design, job analysis, risk assessments, and developing interventions. Task exposure classifications from the SI and TLV for HAL might complement each other. However, TWA, Typical, and Peak job exposure techniques all have
Directory of Open Access Journals (Sweden)
Peisheng Liu
2014-01-01
Full Text Available Crystalline silicon PERCs with dot or line openings on rear surface were studied here. By measuring the minor carrier lifetimes of the PERCs with dot and line openings, passivation effects of rear surface with dot and line openings were discussed. The performance affected by dot and line openings was analyzed in detail by testing the open-circuit voltages, short-circuit current densities, fill factors, and conversion efficiencies of the PERCs. The results show that the wider space resulted in better minor carrier lifetimes on the rear surface. And the cells with a line opening space of 0.5 mm had an average of 0.22% improvement of conversion efficiency, compared with the cells with full-area Al-BSF. On the other hand, the dot opening PERCs exhibited only a conversion efficiency of 17.4%, although there had been good rear surface reflectivity. The bad Al-Si alloy layer and large hollow densities in dot Al-contacts resulted in bad performance of the PERCs with dot openings.
Forest resources of the Nez Perce National Forest
Michele Disney
2010-01-01
As part of a National Forest System cooperative inventory, the Interior West Forest Inventory and Analysis (IWFIA) Program of the USDA Forest Service conducted a forest resource inventory on the Nez Perce National Forest using a nationally standardized mapped-plot design (for more details see the section "Inventory methods"). This report presents highlights...
Investigation on the optimal magnetic field of a cusp electron gun for a W-band gyro-TWA
Zhang, Liang; He, Wenlong; Donaldson, Craig R.; Cross, Adrian W.
2018-05-01
High efficiency and broadband operation of a gyrotron traveling wave amplifier (gyro-TWA) require a high-quality electron beam with low-velocity spreads. The beam velocity spreads are mainly due to the differences of the electric and magnetic fields that the electrons withstand the electron gun. This paper investigates the possibility to decouple the design of electron gun geometry and the magnet system while still achieving optimal results, through a case study of designing a cusp electron gun for a W-band gyro-TWA. A global multiple-objective optimization routing was used to optimize the electron gun geometry for different predefined magnetic field profiles individually. Their results were compared and the properties of the required magnetic field profile are summarized.
Monitoring and Evaluation Plan for the Nez Perce Tribal Hatchery, 1996 Technical Report.
Energy Technology Data Exchange (ETDEWEB)
Steward, Cleveland R.
1996-08-01
The Nez Perce Tribe has proposed to build and operate the Nez Perce Tribal Hatchery (NPTH) in the Clearwater River subbasin of Idaho for the purpose of restoring self-sustaining populations of spring, summer, and fall chinook salmon to their native habitats. The project comprises a combination of incubation and rearing facilities, satellite rearing facilities, juvenile and adult collection sites, and associated production and harvest management activities. As currently conceived, the NPTH program will produce approximately 768,000 spring chinook parr, 800,000 summer chinook fry, and 2,000,000 fall chinook fry on an annual basis. Hatchery fish would be spawned, reared, and released under conditions that promote wild-type characteristics, minimize genetic changes in both hatchery and wild chinook populations, and minimize undesirable ecological interactions. The primary objective is to enable hatchery-produced fish to return to reproduce naturally in the streams in which they are released. These and other characteristics of the project are described in further detail in the Nez Perce Tribal Hatchery Master Plan (Larson and Mobrand 1992), the 1995 Supplement to the Master Plan (Johnson et al. 1995), and the Nez Perce Tribal Hatchery Program Environmental Impact Statement (Bonneville Power Administration et al. 1996). The report in hand is referred to in project literature as the NPTH Monitoring and Evaluation (M&E) Plan. This report describes monitoring and evaluation activities that will help NPTH managers determine. whether they were successful in restoring chinook salmon populations and avoiding adverse ecological impacts. Program success will be gauged primarily by changes in the abundance and distribution of supplemented chinook populations. The evaluation of project-related impacts will focus on the biological effects of constructing and operating NPTH hatchery facilities, introducing hatchery fish into the natural environment, and removing or displacing wild
International Nuclear Information System (INIS)
Baris, D.; Linet, M.; Auvinen, A.; Kaune, W.T.; Wacholder, S.; Kleinerman, R.; Hatch, E.; Robison, L.; Niwa, S.; Haines, C.; Tarone, R.E.
1999-01-01
Case-control studies have used a variety of measurements to evaluate the relationship of children's exposure to magnetic fields (50 or 60 Hz) with childhood leukaemia and other childhood cancers. In the absence of knowledge about which exposure metrics may be biologically meaningful, studies during the past 10 years have often used time-weighted average (TWA) summaries of home measurements. Recently, other exposure metrics have been suggested, usually based on theoretical considerations or limited laboratory data. In this paper, the rationale and associated preliminary studies undertaken are described as well as feasibility and validity issues governing the choice of the primary magnetic field exposure assessment methods and summary metric used to estimate children's exposure in the National Cancer Institute/Children's Cancer Group (NCI/CCG) case-control study. Also provided are definitions and discussion of the strengths and weaknesses of the various exposure metrics used in exploratory analyses of the NCI/CCG measurement data. Exposure metrics evaluated include measures of central tendency (mean, median, 30th to 70th percentiles), peak exposures (90th and higher percentiles, peak values of the 24 h measurements), and measurements of short-term temporal variability (rate of change). This report describes correlations of the various metrics with the time-weighted average for the 24 h period (TWA-24-h). Most of the metrics were found to be positively and highly correlated with TWA-24-h, but lower correlations of TWA-24-h with peak exposure and with rate of change were observed. To examine further the relation between TWA and alternative metrics, similar exploratory analysis should be considered for existing data sets and for forthcoming measurement investigations of residential magnetic fields and childhood leukaemia. (author)
Park, Sungeun; Park, Hyomin; Kim, Dongseop; Yang, JungYup; Lee, Dongho; Kim, Young-Su; Kim, Hyun-Jong; Suh, Dongchul; Min, Byoung Koun; Kim, Kyung Nam; Park, Se Jin; Kim, Donghwan; Lee, Hae-Seok; Nam, Junggyu; Kang, Yoonmook
2018-05-01
Passivated emitter and rear contact (PERC) is a promising technology owing to high efficiency can be achieved with p-type wafer and their easily applicable to existing lines. In case of using p-type mono wafer, 0.5-1% efficiency increase is expected with PERC technologies compared to existing Al BSF solar cells, while for multi-wafer solar cells it is 0.5-0.8%. We addressed the optimization of PERC solar cells using the Al paste. The paste was prepared from the aluminum-silicon alloy with eutectic composition to avoid the formation of voids that degrade the open-circuit voltage. The glass frit of the paste was changed to improve adhesion. Scanning electron microscopy revealed voids and local back surface field between the aluminum electrode and silicon base. We confirmed the conditions on the SiNx passivation layer for achieving higher efficiency and better adhesion for long-term stability. The cell characteristics were compared across cells containing different pastes. PERC solar cells with the Al/Si eutectic paste exhibited the efficiency of 19.6%.
Exposure to MRI-related magnetic fields and vertigo in MRI workers.
Schaap, Kristel; Portengen, Lützen; Kromhout, Hans
2016-03-01
Vertigo has been reported by people working around magnetic resonance imaging (MRI) scanners and was found to increase with increasing strength of scanner magnets. This suggests an association with exposure to static magnetic fields (SMF) and/or motion-induced time-varying magnetic fields (TVMF). This study assessed the association between various metrics of shift-long exposure to SMF and TVMF and self-reported vertigo among MRI workers. We analysed 358 shifts from 234 employees at 14 MRI facilities in the Netherlands. Participants used logbooks to report vertigo experienced during the work day at the MRI facility. In addition, personal exposure to SMF and TVMF was measured during the same shifts, using portable magnetic field dosimeters. Vertigo was reported during 22 shifts by 20 participants and was significantly associated with peak and time-weighted average (TWA) metrics of SMF as well as TVMF exposure. Associations were most evident with full-shift TWA TVMF exposure. The probability of vertigo occurrence during a work shift exceeded 5% at peak exposure levels of 409 mT and 477 mT/s and at full-shift TWA levels of 3 mT and 0.6 mT/s. These results confirm the hypothesis that vertigo is associated with exposure to MRI-related SMF and TVMF. Strong correlations between various metrics of shift-long exposure make it difficult to disentangle the effects of SMF and TVMF exposure, or identify the most relevant exposure metric. On the other hand, this also implies that several metrics of shift-long exposure to SMF and TVMF should perform similarly in epidemiological studies on MRI-related vertigo. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
Energy Technology Data Exchange (ETDEWEB)
Baris, D.; Linet, M.; Auvinen, A.; Kaune, W.T.; Wacholder, S.; Kleinerman, R.; Hatch, E.; Robison, L.; Niwa, S.; Haines, C.; Tarone, R.E
1999-07-01
Case-control studies have used a variety of measurements to evaluate the relationship of children's exposure to magnetic fields (50 or 60 Hz) with childhood leukaemia and other childhood cancers. In the absence of knowledge about which exposure metrics may be biologically meaningful, studies during the past 10 years have often used time-weighted average (TWA) summaries of home measurements. Recently, other exposure metrics have been suggested, usually based on theoretical considerations or limited laboratory data. In this paper, the rationale and associated preliminary studies undertaken are described as well as feasibility andvalidity issues governing the choice of the primary magnetic field exposure assessment methods and summary metric used to estimate children's exposure in the National Cancer Institute/Children's Cancer Group (NCI/CCG) case-control study. Also provided are definitions and discussion of the strengths and weaknesses of the various exposure metrics used in exploratory analyses of the NCI/CCG measurement data. Exposure metrics evaluated include measures of central tendency (mean, median, 30th to 70th percentiles), peak exposures (90th and higher percentiles, peak values of the 24 h measurements), and measurements of short-term temporal variability (rate of change). This report describes correlations of the various metrics with the time-weighted average for the 24 h period (TWA-24-h). Most of the metrics were found to be positively and highly correlated with TWA-24-h, but lower correlations of TWA-24-h with peak exposure and with rate of change were observed. To examine further the relation between TWA and alternative metrics, similar exploratory analysis should be considered for existing data sets and for forthcoming measurement investigations of residential magnetic fields and childhood leukaemia. (author)
A estratégia de pricing do Modelo Continente Hipermercados : perceção do consumidor
Sousa, Vasco Monteiro Carvalho de
2016-01-01
O objetivo da presente investigação é estudar a perceção dos consumidores sobre as estratégias de pricing do Modelo Continente Hipermercados, e surge no formato de uma tese de dissertação. O tema desta investigação abrange objetos predominantes da área de Marketing, nomeadamente o pricing, a distribuição e a perceção do consumidor. No estudo foi aplicado o método de estudo de caso incluindo a observação, análise e discussão. A investigação foi dividida por um lado na abordag...
International Nuclear Information System (INIS)
Gobba, Fabriziomaria; Bargellini, Annalisa; Scaringi, Meri; Bravo, Giulia; Borella, Paola
2009-01-01
Extremely Low Frequency-Magnetic Fields (ELF-MF) are possible carcinogens to humans and some data suggest that they can act as promoters or progressors. Since NK cells play a major role in the control of cancer development, an adverse effect on ELF-MF on NK function has been hypothesized. We examined NK activity in 52 workers exposed to different levels of ELF-MF in various activities. Individual exposure was monitored during 3 complete work-shifts using personal dosimeters. Environmental exposure was also monitored. ELF-MF levels in the workers were expressed as Time-Weighted Average (TWA) values. NK activity was measured in peripheral blood lymphocytes (PBL). In the whole group the median occupational TWA was 0.21 μT. According to the TWA levels, workers were classified as low exposed (26 subjects, TWA ≤ 0.2 μT) and higher exposed workers (26 subjects; TWA > 0.2 μT). In higher exposed workers, we observed a trend to reduce NK activity compared to low exposed, but the difference was not significant. Then we selected a subgroup of highest exposed workers (12 subjects; TWA > 1 μT); no difference was observed between low and highest exposed subjects in the main personal variables. Considering both E:T ratios from 12:1 to 50:1 and Lytic Units, a significant reduction in NK activity was observed in the highest exposed workers compared to the low exposed. Multivariate analysis showed a significant negative correlation between exposure and LU, while no correlation was evidenced with other personal characteristics. ELF-MF are considered possible carcinogens, and existing data suggest that they can act as promoters. Due to the role of NK activity in host defence against cancer, the results obtained in this study in workers exposed to ELF-MF levels exceeding 1 μT are in agreement with this hypothesis, and support the need for further investigation in this field
International Nuclear Information System (INIS)
Spinazzè, Andrea; Cattaneo, Andrea; Limonta, Marina; Bollati, Valentina; Bertazzi, Pier Alberto; Cavallo, Domenico M.
2016-01-01
Limited data are available regarding occupational exposure assessment to nano-sized titanium dioxide (nano-TiO_2). The objective of this study is to assess the occupational exposure of workers engaged in the application of nano-TiO_2 onto concrete building materials, by means of a multi-metric approach (mean diameter, number, mass and surface area concentrations). The measurement design consists of the combined use of (i) direct-reading instruments to evaluate the total particle number concentrations relative to the background concentration and the mean size-dependent characteristics of particles (mean diameter and surface area concentration) and to estimate the 8-h time-weighted average (8-h TWA) exposure to nano-TiO_2 for workers involved in different working tasks; and (ii) filter-based air sampling, used for the determination of size-resolved particle mass concentrations. A further estimation was performed to obtain the mean 8-h TWA exposure values expressed as mass concentrations (µg nano-TiO_2/m"3). The multi-metric characterization of occupational exposure to nano-TiO_2 was significantly different both for different work environments and for each work task. Generally, workers were exposed to engineered nanoparticles (ENPs; <100 nm) mean levels lower than the recommended reference values and proposed occupational exposure limits (40,000 particle/cm"3; 300 µg/m"3) and relevant exposures to peak concentration were not likely to be expected. The estimated 8-h TWA exposure showed differences between the unexposed and exposed subjects. For these last, further differences were defined between operators involved in different work tasks. This study provides information on nano-TiO_2 number and mass concentration, size distribution, particles diameter and surface area concentrations, which were used to obtain work shift-averaged exposures.
Energy Technology Data Exchange (ETDEWEB)
Spinazzè, Andrea, E-mail: andrea.spinazze@uninsubria.it; Cattaneo, Andrea; Limonta, Marina [Università degli studi dell’Insubria, Dipartimento di Scienza e Alta Tecnologia (Italy); Bollati, Valentina; Bertazzi, Pier Alberto [Università degli Studi di Milano, EPIGET-Epidemiology, Epigenetics and Toxicology Lab, Dipartimento di Scienze Cliniche e di Comunità (Italy); Cavallo, Domenico M. [Università degli studi dell’Insubria, Dipartimento di Scienza e Alta Tecnologia (Italy)
2016-06-15
Limited data are available regarding occupational exposure assessment to nano-sized titanium dioxide (nano-TiO{sub 2}). The objective of this study is to assess the occupational exposure of workers engaged in the application of nano-TiO{sub 2} onto concrete building materials, by means of a multi-metric approach (mean diameter, number, mass and surface area concentrations). The measurement design consists of the combined use of (i) direct-reading instruments to evaluate the total particle number concentrations relative to the background concentration and the mean size-dependent characteristics of particles (mean diameter and surface area concentration) and to estimate the 8-h time-weighted average (8-h TWA) exposure to nano-TiO{sub 2} for workers involved in different working tasks; and (ii) filter-based air sampling, used for the determination of size-resolved particle mass concentrations. A further estimation was performed to obtain the mean 8-h TWA exposure values expressed as mass concentrations (µg nano-TiO{sub 2}/m{sup 3}). The multi-metric characterization of occupational exposure to nano-TiO{sub 2} was significantly different both for different work environments and for each work task. Generally, workers were exposed to engineered nanoparticles (ENPs; <100 nm) mean levels lower than the recommended reference values and proposed occupational exposure limits (40,000 particle/cm{sup 3}; 300 µg/m{sup 3}) and relevant exposures to peak concentration were not likely to be expected. The estimated 8-h TWA exposure showed differences between the unexposed and exposed subjects. For these last, further differences were defined between operators involved in different work tasks. This study provides information on nano-TiO{sub 2} number and mass concentration, size distribution, particles diameter and surface area concentrations, which were used to obtain work shift-averaged exposures.
PERC 2 High-End Computer System Performance: Scalable Science and Engineering
Energy Technology Data Exchange (ETDEWEB)
Daniel Reed
2006-10-15
During two years of SciDAC PERC-2, our activities had centered largely on development of new performance analysis techniques to enable efficient use on systems containing thousands or tens of thousands of processors. In addition, we continued our application engagement efforts and utilized our tools to study the performance of various SciDAC applications on a variety of HPC platforms.
Assessment of Human Exposure to Magnetic Fields Produced by Domestic Appliances (invited paper)
International Nuclear Information System (INIS)
Preece, A.W.; Kaune, W.T.; Grainger, P.; Golding, J.
1999-01-01
A study of 50 homes and their appliances examined whether a detailed appliance-use questionnaire and survey would yield data comparable with direct personal monitoring. This was coupled with direct measurement of the appliances in use to determine the field at 50 cm and 1 m. The findings were that individual time-weighted average (TWA) exposures calculated from questionnaire and activity diaries in conjunction with the appliance magnetic field were unrelated to actual personal exposure measurement. It was concluded that questionnaires are of little or no value for TWA estimation. However, peak exposure and short-term temporal variability could be modelled in subjects spending at least 15 min per day within 1 m of an operating microwave cooker or conventional cooker. This method could be extended to other appliances. (author)
Characterization of airborne BTEX exposures during use of lawnmowers and trimmers.
Avens, Heather J; Maskrey, Joshua R; Insley, Allison L; Unice, Kenneth M; Reid, Rachel C D; Sahmel, Jennifer
2018-02-08
Few studies have evaluated airborne exposures to benzene, toluene, ethylbenzene, and xylenes (BTEX) during operation of two-stroke and four-stroke small engines, such as those in lawn maintenance equipment. Full-shift, 8-hour personal samples were collected during a simulation study to characterize yard maintenance activities including mowing, trimming, and fueling. Short-term, 15-minute personal samples were collected to separately evaluate mowing and trimming exposures. Mean 8-hour time weighted average (TWA) BTEX concentrations were 2.3, 5.8, 0.91, and 4.6 ppb, respectively (n = 2). Mean 15-minute TWA BTEX concentrations were 1.6, 1.8, 0.22, and 1.3 ppb, respectively, during mowing and 1.2, 3.6, 0.68, and 3.3 ppb, respectively, during trimming (n = 3 per task). Measured BTEX concentrations during fueling were 20-110, 61-310, 8-41, and 40-203 ppb, respectively (n = 2, duration 2-3 minutes). These exposure concentrations were well below applicable US occupational exposure limits.
Zafar, M.I.; Wijngaarden, van R.; Roessink, I.; Brink, van den P.J.
2011-01-01
The present study compared the effects of different time-variable exposure regimes having the same time-weighted average (TWA) concentration of the organophosphate insecticide chlorpyrifos on freshwater invertebrate communities to enable extrapolation of effects across exposure regimes. The
Richter, Richard O; Finley, Brent L; Paustenbach, Dennis J; Williams, Pamela R D; Sheehan, Patrick J
2009-07-01
Historically, the greatest contributions to airborne asbestos concentrations during brake repair work were likely due to specific, short-duration, dust-generating activities. In this paper, the available short-term asbestos air sampling data for mechanics collected during the cleaning and machining of vehicle brakes are evaluated to determine their impact on both short-term and daily exposures. The high degree of variability and lack of transparency for most of the short-term samples limit their use in reconstructing past asbestos exposures for brake mechanics. However, the data are useful in evaluating how reducing short-term, dust-generating activities reduced long-term exposures, especially for auto brake mechanics. Using the short-term dose data for grinding brake linings from these same studies, in combination with existing time-weighted average (TWA) data collected in decades after grinding was commonplace in rebuilding brake shoes, an average 8-h TWA of approximately 0.10 f/cc was estimated for auto brake mechanics that performed arc grinding of linings during automobile brake repair (in the 1960s or earlier). In the 1970s and early 1980s, a decline in machining activities led to a decrease in the 8-h TWA to approximately 0.063 f/cc. Improved cleaning methods in the late 1980s further reduced the 8-h TWA for most brake mechanics to about 0.0021 f/cc. It is noteworthy that when compared with the original OSHA excursion level, only 15 of the more than 300 short-term concentrations for brake mechanics measured during the 1970s and 1980s possibly exceeded the standard. Considering exposure duration, none of the short-term exposures were above the current OSHA excursion level.
Assessment of Occupational Noise Exposure among Groundskeepers in North Carolina Public Universities
Directory of Open Access Journals (Sweden)
Jo Anne G. Balanay
2016-01-01
Full Text Available Groundskeepers may have increased risk to noise-induced hearing loss due to the performance of excessively noisy tasks. This study assessed the exposure of groundskeepers to noise in multiple universities and determined the association between noise exposure and variables (ie, university, month, tool used. Personal noise exposures were monitored during the work shift using noise dosimetry. A sound level meter was used to measure the maximum sound pressure levels from groundskeeping equipment. The mean Occupational Safety and Health Administration (OSHA and National Institute for Occupational Safety and Health (NIOSH time-weighted average (TWA noise exposures were 83.0 ± 9.6 and 88.0 ± 6.7 dBA, respectively. About 52% of the OSHA TWAs and 77% of the NIOSH TWAs exceeded 85 dBA. Riding mower use was associated with high TWA noise exposures and with having OSHA TWAs exceeding 85 and 90 dBA. The maximum sound pressure levels of equipment and tools measured ranged from 76 to 109 dBA, 82% of which were >85 dBA. These findings support that groundskeepers have excessive noise exposures, which may be effectively reduced through careful scheduling of the use of noisy equipment/tools.
Benzene exposure in a Japanese petroleum refinery.
Kawai, T; Yamaoka, K; Uchida, Y; Ikeda, M
1990-07-01
Time-weighted average (TWA) intensity of exposure of workers to benzene vapor during a shift was monitored by diffusive sampling technique in a Japanese petroleum refinery. The subjects monitored (83 in total) included refinery operators, laboratory personnel and tanker-loading workers. The results showed that the time-weighted average exposures are well below 1 ppm in most cases. The highest exposure was recorded in 1 case involved in bulk loading of tanker ships, in which exposure of over 1 ppm might take place depending on operational conditions. The observation was generally in agreement with levels previously reported.
2006-06-16
Battle in which US Regimental Commander, Captain David Perry, appeared in a US court of inquiry to explain his devastating loss to the Nez Perce. He...changed, however, with the massacre of a detachment of eighty men under the command of Captain William J. Fetterman on the morning of 21 December...University, Homepage; available from http://www.howard.edu; Internet; accessed on 26 April 2006. 14John H Eicher, and David J. Eicher, Civil War High
Energy Technology Data Exchange (ETDEWEB)
Backman, Thomas; Sprague, Sherman; Bretz, Justin [Nez Perce Tribe
2009-06-10
The Nez Perce Tribal Hatchery (NPTH) program has the following goals (BPA, et al., 1997): (1) Protect, mitigate, and enhance Clearwater Subbasin anadromous fish resources; (2) Develop, reintroduce, and increase natural spawning populations of salmon within the Clearwater Subbasin; (3) Provide long-term harvest opportunities for Tribal and non-Tribal anglers within Nez Perce Treaty lands within four generations (20 years) following project initiation; (4) Sustain long-term fitness and genetic integrity of targeted fish populations; (5) Keep ecological and genetic impacts to non-target populations within acceptable limits; and (6) Promote Nez Perce Tribal management of Nez Perce Tribal Hatchery Facilities and production areas within Nez Perce Treaty lands. The NPTH program was designed to rear and release 1.4 million fall and 625,000 spring Chinook salmon. Construction of the central incubation and rearing facility NPTH and spring Chinook salmon acclimation facilities were completed in 2003 and the first full term NPTH releases occurred in 2004 (Brood Year 03). Monitoring and evaluation plans (Steward, 1996; Hesse and Cramer, 2000) were established to determine whether the Nez Perce Tribal Hatchery program is achieving its stated goals. The monitoring and evaluation action plan identifies the need for annual data collection and annual reporting. In addition, recurring 5-year program reviews will evaluate emerging trends and aid in the determination of the effectiveness of the NPTH program with recommendations to improve the program's implementation. This report covers the Migratory Year (MY) 2007 period of the NPTH Monitoring & Evaluation (M&E) program. There are three NPTH spring Chinook salmon treatment streams: Lolo Creek, Newsome Creek, and Meadow Creek. In 2007, Lolo Creek received 140,284 Brood Year (BY) 2006 acclimated pre-smolts at an average weight of 34.9 grams per fish, Newsome Creek received 77,317 BY 2006 acclimated pre-smolts at an average of 24
P1-11: Visual Function and Neurotoxic Symptoms Related to Exposure to Organic Solvents
Directory of Open Access Journals (Sweden)
Ingrid Jimenez Barbosa
2012-10-01
Full Text Available Aim: Exposure to Perchloroethylene (PERC, a solvent used in dry-cleaning, is associated with neurotoxicity and changes in colour vision (CV and contrast sensitivity (CS. However, PERCs' impact on other aspects of visual function (VF such as chromatic contrast sensitivity (CCS, glass pattern detection (GPP, visual search (VS, and global motion sensitivity (GMS remains unclear. This study compared VF and neurotoxicity in two populations at risk, dry-cleaners (cases from Colombia and Australia. Control groups of people with community levels of exposure to PERC were also assessed. Methods: A case-control study of VF in people who are working in the dry-cleaning industry for at least 1 year (n = 40 Colombia; n= 34 Australia with controls (n = 35 each site. VF measures assessed were CSF, CCS, the FM Hue 100 test, VS, GPP, and GMS. Neurotoxic symptoms were assessed using the Q16 modified version questionnaire. Results: Cases had poorer CCS, hue discrimination, GPP, GMS, and higher Q16 scores than controls (p < .05. There was no effect of country. CS function was poorer than controls (p < .05 for spatial frequencies≥0.50 cpd for Australian cases but for ≥1.0 cpd for Colombian cases. There were no significant differences between cases and controls for serial and parallel VS. Conclusion: Our CSF and CV findings indicate that the CS deficit extends to lower spatial frequencies. Furthermore we report a reduction in the detection of form, motion, and CCS. These deficits were associated with neurotoxic symptoms. Because VS was unaffected, it suggests that PERC affects lower order visual functions more severely than higher level cognition.
Current man-made mineral fibers (MMMF) exposures among ontario construction workers.
Verma, Dave K; Sahai, Dru; Kurtz, Lawrence A; Finkelstein, Murray M
2004-05-01
Current occupational exposures to man-made mineral fibers (MMMF), including refractory ceramic fibers (RCF), were measured as part of an exposure assessment program for an epidemiological study pertaining to cancer and mortality patterns of Ontario construction workers. The assessments were carried out at commercial and residential sites. A total of 130 MMMF samples (104 personal and 26 area) was collected and included 21 RCF (16 personal and 5 area). The samples were analyzed by the World Health Organization method in which both respirable and nonrespirable airborne fibers are counted. The results show that Ontario construction workers' full-shift exposure to MMMF (excluding RCF) is generally lower than the American Conference of Governmental Industrial Hygienists' (ACGIH) recommended threshold limit value-time-weighted average (TLV-TWA) of 1 fibers/cc and thus should not present any significant hazard. However, approximately 40% of the occupational exposures to RCF are higher than ACGIH's TLV-TWA of 0.2 fibers/cc and present a significant potential hazard. Workers generally wore adequate approved respiratory protection, especially while performing particularly dusty tasks such as blowing, spraying, and cutting, so the actual exposure received by workers was lower than the reported values. Adequate control measures such as ventilation and respiratory protection should always be used when work involves RCF.
[Study of the effect of occupational exposure to glyphosate on hepatorenal function].
Zhang, F; Pan, L P; Ding, E M; Ge, Q J; Zhang, Z H; Xu, J N; Zhang, L; Zhu, B L
2017-07-06
Objective: To explore the effect of occupational exposure to glyphosate on hepatorenal function. Methods: 526 workers who were occupationally exposed to glyphosate from 5 glyphosate-producing factories were selected as cases; and another 442 administrative staffs who were not exposed to glyphosate were selected as controls from April to November, 2014. All the subjects accepted occupational health examination. The concentration level of glyphosate in the air of workshop was detected and the time weighted average concentration (TWA) was calculated. And analyze the difference of hepatorenal fuction between case group and control group. Result: The age of the subjects in the case and control groups were separately (35.6±10.3), (34.3±9.7) years old, with the length of working for (6.5±5.7), (7.7±6.8) years. The TWA of glyphosate in the case group was between Glyphosate can affect the hepatic and renal function among occupational exposure population, and there was an association between the effect and the exposure dose.
Earnest, G Scott; Ewers, Lynda M; Ruder, Avima M; Petersen, Martin R; Kovein, Ronald J
2002-02-01
Real-time monitoring was used to evaluate the ability of engineering control devices retrofitted on two existing dry-cleaning machines to reduce worker exposures to perchloroethylene. In one dry-cleaning shop, a refrigerated condenser was installed on a machine that had a water-cooled condenser to reduce the air temperature, improve vapor recovery, and lower exposures. In a second shop, a carbon adsorber was retrofitted on a machine to adsorb residual perchloroethylene not collected by the existing refrigerated condenser to improve vapor recovery and reduce exposures. Both controls were successful at reducing the perchloroethylene exposures of the dry-cleaning machine operator. Real-time monitoring was performed to evaluate how the engineering controls affected exposures during loading and unloading the dry-cleaning machine, a task generally considered to account for the highest exposures. The real-time monitoring showed that dramatic reductions occurred in exposures during loading and unloading of the dry-cleaning machine due to the engineering controls. Peak operator exposures during loading and unloading were reduced by 60 percent in the shop that had a refrigerated condenser installed on the dry-cleaning machine and 92 percent in the shop that had a carbon adsorber installed. Although loading and unloading exposures were dramatically reduced, drops in full-shift time-weighted average (TWA) exposures were less dramatic. TWA exposures to perchloroethylene, as measured by conventional air sampling, showed smaller reductions in operator exposures of 28 percent or less. Differences between exposure results from real-time and conventional air sampling very likely resulted from other uncontrolled sources of exposure, differences in shop general ventilation before and after the control was installed, relatively small sample sizes, and experimental variability inherent in field research. Although there were some difficulties and complications with installation and
International Nuclear Information System (INIS)
Sung, Yon Mi; Choo, Sung Wook; Jeon, Seong Soo; Shin, Sung Wook; Park, Kwang Bo; Do, Young Soo
2006-01-01
To assess the efficacy and safety of a 'mini-perc' technique of percutaneous nephrolithotomy using a 14-Fr peel-away sheath for the removal of pyelocaliceal stones, and to determine appropriate inclusion criteria. Form July 1999 to June 2002, the medical records and radiographic images of 72 patients who underwent the 'mini-perc' technique of percutaneous nephrolithotomy with a 14-Fr peel-away sheath, were reviewed to determine clinical history, stone characteristics, immediate stone free rate, final stone free rate after additional procedures, complications, and hospital stay. We also analyzed the effect of the longest stone diameter, the cumulative longest diameter of stones, the cumulative stone burden, and the stone density on the immediate stone free rate using a Fisher exact test. The only major complication, arterial bleeding, occurred in a patient with Child A liver cirrhosis and was successfully treated by embolization with coils and a gelatin sponge. The immediate stone free rate was 80.6%, which was significantly influenced by stone diameter but not stone density. The mean hospital stay after the procedure was 3.97 days. The 'mini-perc' technique of percutaneous nephrolithotomy, which uses the 14-Fr peel-away sheath, is a safe and effective modality for treating renal calculi
Directory of Open Access Journals (Sweden)
Elisa Kern de Castro
2015-07-01
Full Text Available ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70 e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C e de perceção da doença – “Revised Illness Perception Questionnaire for Healthy People” (IPQ-RH.ResultadosA presença de sintomas de TEPT variade 9,2% a 18,5% na amostra, e a perceção da doença esteve correlacionada com os sintomas deste transtorno. As subescalas Representação Emocional e Coerência da Doença (IPQ-RH, foram preditoras dos sintomas de Reexperiência (β = 0,0370; p < 0,01; β = 0,261; p < 0,05, respetivamente. A subescala Representação Emocional (IPQ-RH também foi preditora de sintomas de Esquiva (β = 0,330; p < 0,001.ConclusãoConcluiu-se que a perceção da doença deve ser investigada para prevenir os sintomas de TEPT em sobreviventes de câncer infantil.
Task-based exposure assessment of nanoparticles in the workplace
International Nuclear Information System (INIS)
Ham, Seunghon; Yoon, Chungsik; Lee, Euiseung; Lee, Kiyoung; Park, Donguk; Chung, Eunkyo; Kim, Pilje; Lee, Byoungcheun
2012-01-01
Although task-based sampling is, theoretically, a plausible approach to the assessment of nanoparticle exposure, few studies using this type of sampling have been published. This study characterized and compared task-based nanoparticle exposure profiles for engineered nanoparticle manufacturing workplaces (ENMW) and workplaces that generated welding fumes containing incidental nanoparticles. Two ENMW and two welding workplaces were selected for exposure assessments. Real-time devices were utilized to characterize the concentration profiles and size distributions of airborne nanoparticles. Filter-based sampling was performed to measure time-weighted average (TWA) concentrations, and off-line analysis was performed using an electron microscope. Workplace tasks were recorded by researchers to determine the concentration profiles associated with particular tasks/events. This study demonstrated that exposure profiles differ greatly in terms of concentrations and size distributions according to the task performed. The size distributions recorded during tasks were different from both those recorded during periods with no activity and from the background. The airborne concentration profiles of the nanoparticles varied according to not only the type of workplace but also the concentration metrics. The concentrations measured by surface area and the number concentrations measured by condensation particle counter, particulate matter 1.0, and TWA mass concentrations all showed a similar pattern, whereas the number concentrations measured by scanning mobility particle sizer indicated that the welding fume concentrations at one of the welding workplaces were unexpectedly higher than were those at workplaces that were engineering nanoparticles. This study suggests that a task-based exposure assessment can provide useful information regarding the exposure profiles of nanoparticles and can therefore be used as an exposure assessment tool.
Elisa Kern de Castro; Renata Klein Zancan; Lauro José Gregianin
2015-01-01
ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT) e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70) e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C) e de perceçã...
Directory of Open Access Journals (Sweden)
Diego Augusto Santos Silva
2012-06-01
Full Text Available Objetivou-se verificar o impacto da escolaridade materna e paterna na perceção da imagem corporal em acadêmicos de Educação Física. Participaram do estudo 217 acadêmicos, com média de 20.6 anos de idade (DP = 0.6, sendo 54.8% do sexo masculino. Coletaram-se informações sobre perceção da imagem corporal por meio da escala de silhuetas de Stunkard et al. (1983. O nível de escolaridade dos pais e dados sociodemográficos foram coletados por questionário autoadministrado. Empregaram-se a estatística descritiva e a regressão logística multinomial, adotando-se nível de significância de 5%. Em relação à perceção da imagem corporal, 41% dos alunos estavam insatisfeitos por magreza e 28.1% por excesso de peso. As chances de insatisfação por excesso de peso foram de sete a oito vezes maiores nos acadêmicos com escolaridade materna superiores a quatro anos de escolaridade, independentemente de sexo, idade, situação conjugal, nível econômico e curso. Não houve associação entre escolaridade paterna e imagem corporal. Conclui-se que há necessidade de uma educação básica e superior de qualidade com assuntos vinculados à perceção corporal e hábitos saudáveis, pois muitos acadêmicos apresentaram insatisfação com a imagem corporal e tal probabilidade foi maior em estudantes filhos de mães com mais de cinco anos de escolaridade.
International Nuclear Information System (INIS)
Blutke, A.S.; Vavruska, J.S.; Serino, J.F.
1996-01-01
Plasma Technology, Inc. (PTI), a Santa Fe, New Mexico corporation has developed the Plasma Energy Recycle and Conversion (PERC)trademark treatment process as a safe and environmentally clean alternative to conventional thermal destruction technologies. The PERC trademark treatment process uses as its heat source an advanced Induction Coupled Plasma (ICP) torch connected to a reaction chamber system with an additional emission control system. For example, organic-based gas, liquid, slurry, and/or solid waste streams can be converted into usable or even salable products while residual emissions are reduced to an absolute minimum. In applications for treatment of hazardous and radioactive waste streams, the PERC system could be used for destruction of the hazardous organic constituents and/or significant waste volume reduction while capturing the radioactive fraction in a non-leachable form. Like Direct Current (DC) and Alternating Current (AC) arc plasma systems, ICP torches offer sufficient energy to decompose, melt and/or vitrify any waste stream. The decision for an arc plasma or an IC plasma system has to be made on a case by case evaluation and is highly dependent on the specific waste stream's form and composition. Induction coupled plasma technology offers one simple, but significant difference compared to DC or AC arc plasma systems: the ICP torch is electrodeless. To date, enormous research effort has been spent to improve the lifetime of electrodes and the effectiveness of related cooling systems. Arc plasma systems are established in research laboratories worldwide and are approaching a broad use in commercial applications. ICP technology has been improved relatively recently, but nowadays offers complete new and beneficial approaches in the field of waste conversion and treatment
Directory of Open Access Journals (Sweden)
Nele Van Ransbeeck
2014-09-01
Full Text Available The main objective of the study was to assess particulate matter (PM exposure levels for both the farmer and the veterinarian during different operational tasks in pig-fattening houses, and to estimate their exposure levels on a daily working basis (time-weighted average (TWA. The measured PM fractions were: inhalable and respirable PM, PM10, PM2.5 and PM1. The effects of pig age, pen floor type (conventional or low emission surface and cleaning of the pens on the personal PM exposure were also investigated. Indoor concentrations of NH[sub]3[/sub], CH[sub]4[/sub], and CO[sub]2[/sub] were additionally measured during some operational tasks. The results showed that personal exposure levels can become extremely high during some operational tasks performed by the farmer or veterinarian. The highest concentration levels were observed during feed shovelling and blood sampling, the lowest during the weighing of the pigs. For the farmer, the estimated TWA exposure levels of inhalable and respirable PM were 6.0 and 0.29 mg m[sup] -3[/sup] , respectively. These exposure levels for the veterinarian were, respectively, 10.6 and 0.74 mg m[sup] -3[/sup] . The PM concentration levels were mainly determined by the performed operational tasks. There was no significant effect of pig age, pen floor type, nor cleaning of the pens on the personal exposure levels.
Sanders, Barbara P; Oakes, Isabel de los Rios; van Hoek, Vladimir; Liu, Ying; Marissen, Wilfred; Minor, Philip D; Wimmer, Eckard; Schuitemaker, Hanneke; Custers, Jerome H H V; Macadam, Andrew; Cello, Jeronimo; Edo-Matas, Diana
2015-11-27
As poliovirus eradication draws closer, alternative Inactivated Poliovirus Vaccines (IPV) are needed to overcome the risks associated with continued use of the Oral Poliovirus Vaccine and of neurovirulent strains used during manufacture of conventional (c) IPV. We have previously demonstrated the susceptibility of the PER.C6(®) cell line to cIPV strains; here we investigated the suspension cell culture platform for growth of attenuated poliovirus strains. We examined attenuated Sabin strain productivity on the PER.C6(®) cell platform compared to the conventional Vero cell platform. The suitability of the suspension cell platform for propagation of rationally-attenuated poliovirus strains (stabilized Sabin type 3 S19 derivatives and genetically attenuated and stabilized MonoCre(X) strains), was also assessed. Yields were quantified by infectious titer determination and D-antigen ELISA using either serotype-specific polyclonal rabbit sera for Sabin strains or monoclonal cIPV-strain-specific antibodies for cIPV, S19 and MonoCre(X) strains. PER.C6(®) cells supported the replication of Sabin strains to yields of infectious titers that were in the range of cIPV strains at 32.5°C. Sabin strains achieved 30-fold higher yields (pSabin strain productivity on the PER.C6(®) cell platform was maintained at 10l scale. Yields of infectious titers of S19 and MonoCre(X) strains were 0.5-1 log10 lower than seen for cIPV strains, whereas D-antigen yield and productivities in doses/ml using rationally-attenuated strains were in line with yields reported for cIPV strains. Sabin and rationally-attenuated polioviruses can be grown to high infectious titers and D-antigen yields. Sabin strain infection shows increased productivity on the PER.C6(®) cell platform as compared to the conventional Vero cell platform. Novel cell platforms with the potential for higher yields could contribute to increased affordability of a next generation of IPV vaccines needed for achieving and
Carbon Nanotube and Nanofiber Exposure Assessments: An Analysis of 14 Site Visits
Dahm, Matthew M.; Schubauer-Berigan, Mary K.; Evans, Douglas E.; Birch, M. Eileen; Fernback, Joseph E.; Deddens, James A.
2015-01-01
Recent evidence has suggested the potential for wide-ranging health effects that could result from exposure to carbon nanotubes (CNT) and carbon nanofibers (CNF). In response, the National Institute for Occupational Safety and Health (NIOSH) set a recommended exposure limit (REL) for CNT and CNF: 1 µg m−3 as an 8-h time weighted average (TWA) of elemental carbon (EC) for the respirable size fraction. The purpose of this study was to conduct an industrywide exposure assessment among US CNT and CNF manufacturers and users. Fourteen total sites were visited to assess exposures to CNT (13 sites) and CNF (1 site). Personal breathing zone (PBZ) and area samples were collected for both the inhalable and respirable mass concentration of EC, using NIOSH Method 5040. Inhalable PBZ samples were collected at nine sites while at the remaining five sites both respirable and inhalable PBZ samples were collected side-by-side. Transmission electron microscopy (TEM) PBZ and area samples were also collected at the inhalable size fraction and analyzed to quantify and size CNT and CNF agglomerate and fibrous exposures. Respirable EC PBZ concentrations ranged from 0.02 to 2.94 µg m−3 with a geometric mean (GM) of 0.34 µg m−3 and an 8-h TWA of 0.16 µg m−3. PBZ samples at the inhalable size fraction for EC ranged from 0.01 to 79.57 µg m−3 with a GM of 1.21 µg m−3. PBZ samples analyzed by TEM showed concentrations ranging from 0.0001 to 1.613 CNT or CNF-structures per cm3 with a GM of 0.008 and an 8-h TWA concentration of 0.003. The most common CNT structure sizes were found to be larger agglomerates in the 2–5 µm range as well as agglomerates >5 µm. A statistically significant correlation was observed between the inhalable samples for the mass of EC and structure counts by TEM (Spearman ρ = 0.39, P 1 μg m−3. Until more information is known about health effects associated with larger agglomerates, it seems prudent to assess worker exposure to airborne CNT and CNF
Lichtenberg, Shelly; Rahamimov, Ruth; Green, Hefziba; Fox, Benjamin D; Mor, Eytan; Gafter, Uzi; Chagnac, Avry; Rozen-Zvi, Benaya
2017-07-01
Immunosuppressive therapy plays a major role in the development of post-transplant cancer. In this nested case-control study of kidney transplant recipients (KTRs), we investigated whether the incidence of post-transplant cancer is associated with the level of tacrolimus exposure over time. We screened the Rabin Medical Center database for adults who received kidney transplants between 2001 and 2014 and developed post-transplant cancer (excluding basal and squamous cell skin cancers). They were matched against KTRs without cancer. All patients received a maintenance immunosuppressive treatment with tacrolimus, mycophenolate mofetil and corticosteroids. The degree of exposure to tacrolimus was estimated as the time-weighted average (tTWA) value of tacrolimus blood levels. The tTWA was calculated as the area under the curve divided by time at 1, 6, and 12 months after transplantation and at time of cancer diagnosis. Thirty-two cases were matched against 64 controls. tTWA values above 11 ng/mL at 6 and 12 months after transplantation were associated with odds ratio (OR) of 3.1 (95% CI 1.1-9) and 11.7 (95% CI = 1.3-106), respectively, for post-transplant cancer; and with OR of 5.2 (95% CI 1.3-20.5) and 14.1 (95% CI = 1.5-134.3), respectively, for cancer diagnosed more than 3 years after transplantation. Exposure to a tacrolimus time-weighted average level above 11 ng/mL at 6 or 12 months after kidney transplantation is associated with an increased risk of developing cancer.
Sanders, Barbara P; Edo-Matas, Diana; Papic, Natasa; Schuitemaker, Hanneke; Custers, Jerome H H V
2015-10-13
Safety of vaccines can be compromised by contamination with adventitious agents. One potential source of adventitious agents is a vaccine seed, typically derived from historic clinical isolates with poorly defined origins. Here we generated synthetic poliovirus seeds derived from chemically synthesized DNA plasmids encoding the sequence of wild-type poliovirus strains used in marketed inactivated poliovirus vaccines. The synthetic strains were phenotypically identical to wild-type polioviruses as shown by equivalent infectious titers in culture supernatant and antigenic content, even when infection cultures are scaled up to 10-25L bioreactors. Moreover, the synthetic seeds were genetically stable upon extended passaging on the PER.C6 cell culture platform. Use of synthetic seeds produced on the serum-free PER.C6 cell platform ensures a perfectly documented seed history and maximum control over starting materials. It provides an opportunity to maximize vaccine safety which increases the prospect of a vaccine end product that is free from adventitious agents. Copyright © 2015 Elsevier Ltd. All rights reserved.
Hanley, Kevin W; Andrews, Ronnee; Bertke, Steven; Ashley, Kevin
2015-01-01
The National Institute for Occupational Safety and Health has conducted an occupational exposure assessment study of manganese (Mn) in welding fume of construction workers rebuilding tanks, piping, and process equipment at two oil refineries. The objective of this study was to evaluate exposures to different Mn fractions using a sequential extraction procedure. Seventy-two worker-days were monitored for either total or respirable Mn during stick welding and associated activities both within and outside of confined spaces. The samples were analyzed using an experimental method to separate different Mn fractions by valence states based on selective chemical solubility. The full-shift total particulate Mn time-weighted average (TWA) breathing zone concentrations ranged from 0.013-29 for soluble Mn in a mild ammonium acetate solution; from 0.26-250 for Mn(0,2+) in acetic acid; from non-detectable (ND) - 350 for Mn(3+,4+) in hydroxylamine-hydrochloride; and from ND - 39 micrograms per cubic meter (μg/m(3)) for insoluble Mn fractions in hydrochloric and nitric acid. The summation of all Mn fractions in total particulate TWA ranged from 0.52-470 μg/m(3). The range of respirable particulate Mn TWA concentrations were from 0.20-28 for soluble Mn; from 1.4-270 for Mn(0,2+); from 0.49-150 for Mn(3+,4+); from ND - 100 for insoluble Mn; and from 2.0-490 μg/m(3) for Mn (sum of fractions). For all jobs combined, total particulate TWA GM concentrations of the Mn(sum) were 99 (GSD = 3.35) and 8.7 (GSD = 3.54) μg/m(3) for workers inside and outside of confined spaces; respirable Mn also showed much higher levels for welders within confined spaces. Regardless of particle size and confined space work status, Mn(0,2+) fraction was the most abundant followed by Mn(3+,4+) fraction, typically >50% and ∼30-40% of Mn(sum), respectively. Eighteen welders' exposures exceeded the ACGIH Threshold Limit Values for total Mn (100 μg/m(3)) and 25 exceeded the recently adopted respirable
Occupational Noise Exposure of Employees at Locally-Owned Restaurants in a College Town.
Green, Deirdre R; Anthony, T Renée
2015-01-01
While many restaurant employees work in loud environments, in both dining and food preparation areas, little is known about worker exposures to noise. The risk of hearing loss to millions of food service workers around the country is unknown. This study evaluated full-shift noise exposure to workers at six locally-owned restaurants to examine risk factors associated with noise exposures during the day shift. Participants included cooks, counter attendants, bartenders, and waiters at full-service restaurants with bar service and at limited-service restaurants that provided counter service only. Assessments were made on weekdays and weekends, both during the summer and the fall (with a local university in session) to examine whether the time of week or year affects noise exposures to this population in a college town. In addition, the relationships between noise exposures and the type of restaurant and job classification were assessed. One-hundred eighty full-shift time-weighted average (TWA) exposures were assessed, using both Occupational Safety and Health Administration (OSHA) and National Institute for Occupational Safety and Health (NIOSH) criteria. No TWA measurements exceeded the 90 dBA OSHA 8 hr permissible exposure limit, although six projected TWAs exceeded the 85 dBA OSHA hearing conservation action limit. Using NIOSH criteria, TWAs ranged from 69-90 dBA with a mean of 80 dBA (SD = 4 dBA). Nearly 8% (14) of the exposures exceeded the NIOSH 8-hr 85 dBA. Full-shift exposures were larger for all workers in full-service restaurants (p restaurant type. The fall semester (p = 0.003) and weekend (p = 0.048) exposures were louder than summer and weekdays. Multiple linear regression analysis suggested that the combination of restaurant type, job classification, and season had a significant effect on restaurant worker noise exposures (p restaurant type, job classification, time of week, and season significantly affected the noise exposures for day
Biological exposure assessment to tetrachloroethylene for workers in the dry cleaning industry
Directory of Open Access Journals (Sweden)
Ashley David L
2008-04-01
Full Text Available Abstract Background The purpose of this study was to assess the feasibility of conducting biological tetrachloroethylene (perchloroethylene, PCE exposure assessments of dry cleaning employees in conjunction with evaluation of possible PCE health effects. Methods Eighteen women from four dry cleaning facilities in southwestern Ohio were monitored in a pilot study of workers with PCE exposure. Personal breathing zone samples were collected from each employee on two consecutive work days. Biological monitoring included a single measurement of PCE in blood and multiple measurements of pre- and post-shift PCE in exhaled breath and trichloroacetic acid (TCA in urine. Results Post-shift PCE in exhaled breath gradually increased throughout the work week. Statistically significant correlations were observed among the exposure indices. Decreases in PCE in exhaled breath and TCA in urine were observed after two days without exposure to PCE. A mixed-effects model identified statistically significant associations between PCE in exhaled breath and airborne PCE time weighted average (TWA after adjusting for a random participant effect and fixed effects of time and body mass index. Conclusion Although comprehensive, our sampling strategy was challenging to implement due to fluctuating work schedules and the number (pre- and post-shift on three consecutive days and multiplicity (air, blood, exhaled breath, and urine of samples collected. PCE in blood is the preferred biological index to monitor exposures, but may make recruitment difficult. PCE TWA sampling is an appropriate surrogate, although more field intensive. Repeated measures of exposure and mixed-effects modeling may be required for future studies due to high within-subject variability. Workers should be monitored over a long enough period of time to allow the use of a lag term.
Assessment of dust exposure in a steel plant in the eastern coast of peninsular Malaysia.
Nurul, Ainun Hamzah; Shamsul, Bahri Mohd Tamrin; Noor Hassim, Ismail
2016-11-22
Steel manufacturing produces dust, fumes, and pollutant gases that may give adverse health effects to the respiratory function of workers. Improper occupational hygiene practice in the workplace will affect both workers wellbeing and productivity. To assess the level of particulate matter [(PM2.5, PM10, and Total Particulate Matter (TPM)], and trace metal dust concentrations in different sections of a steel plant and compare with the occupational exposure values. The work environmental parameters of the particulate matters were evaluated using Indoor Air Quality, while metal dust concentrations were measured using portable personal air sampler. A total of 184 personal samples were randomly collected from workers in three major sections; steel making plant, direct reduced plant, and support group. Trace metal dust concentrations were subjected to wet mineral acid mixture digestion and analysed by atomic absorption spectrophotometer (AAS). The overall average PM2.5 concentration observed was varied according to the section: steel making plant was 0.18 mg/m3, direct reduced iron plant was 0.05 mg/m3, and support plant was 0.05 mg/m3. Average PM 10 concentration in steel making shop (SMS) plant, direct reduced (DR) plant, and support plant were 0.70 mg/m3, 0.84 mg/m3, and 0.58 mg/m3, respectively. The average TWA8 of trace metal dusts (cobalt and chromium) in all the sections exceeded 1 to 3 times the ACGIH prescribed values, OSHA PELs, NIOSH RELs as well as USECHH OSHA, whereas TWA8 concentration of nickel for each section did not exceed the occupational exposure values. The average PM2.5, PM10 and TPM did not exceed the prescribed values, while average trace metal dust concentration TWA8 for cobalt and chromium in all plants exceeded occupational exposure prescribed values. However, the nickel found did not exceed the prescribed values in all the plants except for NIOSH RELs.
Lucas y Hernandez, J; Golanó, P; Roshan-Zamir, S; Darcel, V; Chauveaux, D; Laffenêtre, O
2016-03-01
The aim of this study was to report a single surgeon series of consecutive patients with moderate hallux valgus managed with a percutaneous extra-articular reverse-L chevron (PERC) osteotomy. A total of 38 patients underwent 45 procedures. There were 35 women and three men. The mean age of the patients was 48 years (17 to 69). An additional percutaneous Akin osteotomy was performed in 37 feet and percutaneous lateral capsular release was performed in 22 feet. Clinical and radiological assessments included the type of forefoot, range of movement, the American Orthopedic Foot and Ankle (AOFAS) score, a subjective rating and radiological parameters. The mean follow-up was 59.1 months (45.9 to 75.2). No patients were lost to follow-up. The mean AOFAS score increased from 62.5 (30 to 80) pre-operatively to 97.1 (75 to 100) post-operatively. A total of 37 patients (97%) were satisfied. At the last follow up there was a statistically significant decrease in the hallux valgus angle, the intermetatarsal angle and the proximal articular set angle. The range of movement of the first metatarsophalangeal joint improved significantly.. There was more improvement in the range of movement in patients who had fixation of the osteotomy of the proximal phalanx. Preliminary results of this percutaneous approach are promising. This technique is reliable and reproducible. Its main asset is that it maintains an excellent range of movement. The PERC osteotomy procedure is an effective approach for surgical management of moderate hallux valgus which combines the benefits of percutaneous surgery with the versatility of the chevron osteotomy whilst maintaining excellent first MTPJ range of motion. ©2016 The British Editorial Society of Bone & Joint Surgery.
Dennis E. Ferguson; John C. Byrne; William R. Wykoff; Brian Kummet; Ted Hensold
2011-01-01
Stands of dense, natural ponderosa pine (Pinus ponderosa var. ponderosa) regeneration were operationally, precommercially thinned at seven sites - four on Nez Perce Tribal lands in northern Idaho and three on Spokane Tribal lands in eastern Washington. Five spacing treatments were studied - control (no thinning), 5x5 ft, 7x7 ft, 10x10 ft, and 14x14 ft. Sample trees...
Metal Dust Exposure and Respiratory Health of Male Steel Work¬ers in Terengganu, Malaysia
Nurul Ainun HAMZAH; Shamsul Bahri MOHD TAMRIN; Noor Hassim ISMAIL
2015-01-01
Background: This cross sectional study was carried out to determine the relationship between metal dust exposure and respiratory health in male steel workers in Terengganu, Malaysia.Methods: Subjects were interviewed using a structured questionnaire from British Medical Research Council (BMRC) Questionnaire regarding respiratory symptoms and were examined their lung function using spirometer.Results: The mean trace metal dusts concentration TWA8 for cobalt and chromium in most of work unit ex...
Energy Technology Data Exchange (ETDEWEB)
Larson, Roy Edward; Walker, Grant W.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)
2006-03-01
This report fulfills the contract obligations based on the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration (BPA). Nez Perce Tribal Hatchery (NPTH) Year-2001 annual report combines information from two contracts with a combined value of $2,336,491. They are identified by Bonneville Power Administration as follows: (1) Operations and Maintenance--Project No. 1983-350-00, Contract No. 4504, and (2) Planning and Design--Project No. 1983-350-00, Contract No. 4035. The Operations and Maintenance (O&M) budget of $2,166,110 was divided as follows: Facility Development and Fish Production Costs--$860,463; and Equipment Purchases as capital cost--$1,305,647 for equipment and subcontracts. The Planning and Design (P&D) budget of $170,381 was allocated to development of a Coho master planning document in conjunction with Nez Perce Tribal Hatchery. The O&M budget expenditures represent personnel and fish production expenses; e.g., administration, management, coordination, facility development, personnel training and fish production costs for spring Chinook and Coho salmon. Under Objective 1: Fish Culture Training and Education, tribal staff worked at Clearwater Anadromous Hatchery (CAFH) an Idaho Department of Fish and Game (IDFG) facility to produce spring Chinook smolt and parr for release that are intended to provide future broodstock for NPTH. As a training exercise, BPA allowed tribal staff to rear Coho salmon at Dworshak National Fish Hatchery, a U.S. Fish and Wildlife Service (USFWS) facility. This statement of work allows this type of training to prepare tribal staff to later rear salmon at Nez Perce Tribal Hatchery under Task 1.6. As a subset of the O&M budget, the equipment purchase budget of $1,305,647 less $82,080 for subcontracts provides operational and portable equipment necessary for NPTH facilities after construction. The equipment budget for the year was $1,223,567; this year's purchases amounted $287,364.48 (see
INHIBITORY EFFECTS OF PERCHLOROETHYLENE ON HUMAN NEURONAL NICOTINIC ACETYLCHOLINE RECEPTORS.
Perchloroethylene (PERC) is a volatile organic solvent with a variety of industrial uses. PERC exposure has been shown to cause adverse neurological effects including deficits in vision and memory in exposed individuals. Despite knowledge of these effects, the mechanisms by whi...
Drescher, Michael J; Fried, Jeremy; Brass, Ryan; Medoro, Amanda; Murphy, Timothy; Delgado, João
2017-10-01
Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA) for pulmonary embolism (PE) ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC) rule, multi-modal education using principles of knowledge translation (KT), and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9-11.2]) to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3-9.4]) pPatient characteristics were similar for both periods. Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.
Evaluation of occupational exposure to static magnetic field in a chloralkali plant
Directory of Open Access Journals (Sweden)
AR Coobineh
2005-10-01
Full Text Available Background and Aims: An observational cross sectional study was conducted to determine iflong term exposure to static magnetic fields could be related to findings of medical examinations.Method: Health data were obtained for 20 workers who spent a major portion of their workdaysin the magnetic fields produced by the direct current through large electrolytic cells. These datawere compared to those of a control group of 21 workers. Intensity of magnetic fields weremeasured in the cell room and the Time weighted Average (TWA exposure to magnetic field wascalculated for each job classification.Results: Maximum and minimum intensities in mTwere found to be 16.99 and 0.46, respectively,which were well below the permissible level. Maximum TWAexposure to magnetic field wasfound to be 47.59 mTWhich were observed. Comparing the ECG, EEG, blood Pressure and pulseratesbetween the two groups showed no statistically significant differences. Clinical findingshowed that fatigue and nervousness complain were be higher in the case group and weresignificantly different between the two groups.Conclusion: We did not see statistical significant differences between case and control groups inECG, EEG, blood pressure and pulse-rates. We have seen statistically differences in the fatigue(P<0.01 and nervousness (P<0.01 complain of these two groups. We suggest that it may benecessary to choose a value of than 60 mT (TLV-TWA, so that the complains of fatigue andnervousness will be reduce.
[Occupational exposure to hexavalent chromium during aircraft painting].
Gherardi, M; Gatto, M P; Gordiani, A; Paci, E; Proietto, A
2007-01-01
Hygienists are interested in hexavalent chromium due to its genotoxic and carcinogenic effect on humans. The use of products containing hexavalent chromium is decreasing in many industrial fields because of the substitution with less-toxic compounds. In the aeronautical industry, however, the chromate are added to primer paint as a corrosion inhibitor of aircrafts surfaces: so hexavalent chromium compounds are available in many primers with a composition ranging from 10% to 13%. The application of these primers by using electrostatic guns potentially exposes painting and coating workers at high concentrations of aerosols containing Cr(VI). The aim of the present study is the evaluation of professional exposure to hexavalent chromium during aircraft painting, by adopting both environmental personal sampling and biological monitoring. To valuate workers exposure levels the personal measurements results have been compared with the exposure limit values (TLV-TWA) and the urinary chromium contents with the biological exposure indices (IBE). Moreover the strategy of coupling environmental sampling with biological monitoring seems to be a useful instrument to measure the validity of the individual protection devices.
Effectiveness evaluation of existing noise controls in a deep shaft underground mine.
Lutz, Eric A; Reed, Rustin J; Turner, Dylan; Littau, Sally R; Lee, Vivien; Hu, Chengcheng
2015-01-01
Noise exposures and hearing loss in the mining industry continue to be a major problem, despite advances in noise control technologies. This study evaluated the effectiveness of engineering, administrative, and personal noise controls using both traditional and in-ear dosimetry by job task, work shift, and five types of earplug. The noise exposures of 22 miners performing deep shaft-sinking tasks were evaluated during 56 rotating shifts in an underground mine. Miners were earplug-insertion trained, earplug fit-tested, and monitored utilizing traditional and in-ear dosimetry. The mean TWA8 noise exposure via traditional dosimetry was 90.1 ± 8.2 dBA, while the mean in-ear TWA8 was 79.6 ± 13.8 dBA. The latter was significantly lower (p < 0.05) than the Mine Safety and Health Administration (MSHA) personal exposure limit (PEL) of 90 dBA. Dosimetry mean TWA8 noise exposures for bench blowing (103.5 ± 0.9 dBA), jumbo drill operation (103.0 ± 0.8 dBA), and mucking tasks (99.6 ± 4.7 dBA) were significantly higher (p < 0.05) than other tasks. For bench blowing, cable pulling, grinding, and jumbo drill operation tasks, the mean in-ear TWA8 was greater than 85 dBA. Those working swing shift had a significantly higher (p < 0.001) mean TWA8 noise exposure (95.4 ± 7.3 dBA) than those working day shift. For percent difference between traditional vs. in-ear dosimetry, there was no significant difference among types of earplug used. Reflective of occupational hearing loss rate trends across the mining industry, this study found that, despite existing engineering and administrative controls, noise exposure levels exceeded regulatory limits, while the addition of personal hearing protection limited excessive exposures.
Kapellusch, Jay M; Silverstein, Barbara A; Bao, Stephen S; Thiese, Mathew S; Merryweather, Andrew S; Hegmann, Kurt T; Garg, Arun
2018-02-01
The Strain Index (SI) and the American Conference of Governmental Industrial Hygienists (ACGIH) threshold limit value for hand activity level (TLV for HAL) have been shown to be associated with prevalence of distal upper-limb musculoskeletal disorders such as carpal tunnel syndrome (CTS). The SI and TLV for HAL disagree on more than half of task exposure classifications. Similarly, time-weighted average (TWA), peak, and typical exposure techniques used to quantity physical exposure from multi-task jobs have shown between-technique agreement ranging from 61% to 93%, depending upon whether the SI or TLV for HAL model was used. This study compared exposure-response relationships between each model-technique combination and prevalence of CTS. Physical exposure data from 1,834 workers (710 with multi-task jobs) were analyzed using the SI and TLV for HAL and the TWA, typical, and peak multi-task job exposure techniques. Additionally, exposure classifications from the SI and TLV for HAL were combined into a single measure and evaluated. Prevalent CTS cases were identified using symptoms and nerve-conduction studies. Mixed effects logistic regression was used to quantify exposure-response relationships between categorized (i.e., low, medium, and high) physical exposure and CTS prevalence for all model-technique combinations, and for multi-task workers, mono-task workers, and all workers combined. Except for TWA TLV for HAL, all model-technique combinations showed monotonic increases in risk of CTS with increased physical exposure. The combined-models approach showed stronger association than the SI or TLV for HAL for multi-task workers. Despite differences in exposure classifications, nearly all model-technique combinations showed exposure-response relationships with prevalence of CTS for the combined sample of mono-task and multi-task workers. Both the TLV for HAL and the SI, with the TWA or typical techniques, appear useful for epidemiological studies and surveillance
Zhang, Lijun; Guo, Changyi; Jia, Xiaodong; Xu, Huihui; Pan, Meizhu; Xu, Dong; Shen, Xianbiao; Zhang, Jianghua; Tan, Jianguo; Qian, Hailei; Dong, Chunyang; Shi, Yewen; Zhou, Xiaodan; Wu, Chen
2018-01-01
The aim of this study was to perform an exposure assessment of PM2.5 (particulate matter less than 2.5μm in aerodynamic diameter) among children and to explore the potential sources of exposure from both indoor and outdoor environments. In terms of real-time exposure measurements of PM2.5, we collected data from 57 children aged 8-12 years (9.64 ± 0.93 years) in two schools in Shanghai, China. Simultaneously, questionnaire surveys and time-activity diaries were used to estimate the environment at home and daily time-activity patterns in order to estimate the exposure dose of PM2.5 in these children. Principle component regression analysis was used to explore the influence of potential sources of PM2.5 exposure. All the median personal exposure and microenvironment PM2.5 concentrations greatly exceeded the daily 24-h PM2.5 Ambient Air Quality Standards of China, the USA, and the World Health Organization (WHO). The median Etotal (the sum of the PM2.5 exposure levels in different microenvironment and fractional time) of all students was 3014.13 (μg.h)/m3. The concentration of time-weighted average (TWA) exposure of all students was 137.01 μg/m3. The median TWA exposure level during the on-campus period (135.81 μg/m3) was significantly higher than the off-campus period (115.50 μg/m3, P = 0.013 < 0.05). Besides ambient air pollution and meteorological conditions, storey height of the classroom and mode of transportation to school were significantly correlated with children's daily PM2.5 exposure. Children in the two selected schools were exposed to high concentrations of PM2.5 in winter of 2013 in Shanghai. Their personal PM2.5 exposure was mainly associated with ambient air conditions, storey height of the classroom, and children's transportation mode to school.
Occupational exposure to ethylene oxide--OSHA. Final rule: supplemental statement of reasons.
1985-01-02
On June 22, 1984, the Occupational Safety and Health Administration (OSHA) published a final standard for ethylene oxide (EtO) that established a permissible exposure limit of 1 part EtO per million parts of air determined as an 8-hour time--weighted average (TWA) concentration (29 CFR 1910.1047, 49 FR 25734). The standard also includes provisions for methods of exposure control, personal protective equipment, measurement of employee exposure, training, signs, and labels, medical surveillance, regulated areas, emergencies and recordkeeping. The basis for this action was a determination by OSHA, based on human and animal data, that exposure to EtO presents a carcinogenic, mutagenic, genotoxic, reproductive, neurologic, and sensitization hazard to workers. During the rulemaking proceedings that led to the establishment of the 1 ppm TWA, the issue of whether there was a need for a short-term exposure limit (STEL) for workers protection from EtO was raised. OSHA reserved decision on the adoption of a STEL at the conclusion of the rulemaking in order to permit peer review of the available evidence and to review more fully the arguments and pertinent data regarding the STEL issue. Upon receipt of the analyses from most of the peer reviewers, OSHA published a notice to that effect on September 19, 1984 (49 FR 36659) and invited public comment on the pertinent issues addressed in the peer reviews. Based on the entire rulemaking record, including the peer reviews and public comments received since June 22, the Assistant Secretary has determined that adoption of a STEL for EtO is not warranted by the available health evidence, and that a STEL is not reasonably necessary or appropriate for inclusion in the final EtO standard. OSHA has also asked that NIOSH fund certain additional studies related to whether a dose-rate relationship can be established for EtO, and OSHA will review the results of those studies when they become available.
Perceções de carreira e de sucesso em função do género
Tocalino, Renata Leone Pio Galveia
2013-01-01
Tese de mestrado, Psicologia (Secção de Psicologia da Educação e da Orientação), Universidade de Lisboa, Faculdade de Psicologia, 2013 A presente investigação visa explorar o efeito do fator género no desenvolvimento da carreira das mulheres e dos homens, analisando a distribuição das formações e das profissões, as perceções de género e de sucesso profissional, os modelos, as crenças de autoeficácia, as motivações no trabalho e as experiências profissionais significativas. A fundamentação ...
International Nuclear Information System (INIS)
Larson, Roy Edward; Walker, Grant
2002-01-01
Nez Perce Tribal Hatchery (NPTH) Year-2000 Combined Maintenance and Operations (O and M) and Planning and Design (P and D) contract is hereby completed based on this annual report patterned after the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration. Primary project activities focused on completion of the Northwest Power Planning Council Step-3 process that: (1) Accepted final design, (2) Authorized a capital construction amount of $16,050,000, and (3) Authorized contractor selection, and (4) Provided construction site dedication, and (5) Implemented construction activities over an anticipated 2-year period of July 2000 through October 2002
An analysis of collegiate band directors' exposure to sound pressure levels
Roebuck, Nikole Moore
Noise-induced hearing loss (NIHL) is a significant but unfortunate common occupational hazard. The purpose of the current study was to measure the magnitude of sound pressure levels generated within a collegiate band room and determine if those sound pressure levels are of a magnitude that exceeds the policy standards and recommendations of the Occupational Safety and Health Administration (OSHA), and the National Institute of Occupational Safety and Health (NIOSH). In addition, reverberation times were measured and analyzed in order to determine the appropriateness of acoustical conditions for the band rehearsal environment. Sound pressure measurements were taken from the rehearsal of seven collegiate marching bands. Single sample t test were conducted to compare the sound pressure levels of all bands to the noise exposure standards of OSHA and NIOSH. Multiple regression analysis were conducted and analyzed in order to determine the effect of the band room's conditions on the sound pressure levels and reverberation times. Time weighted averages (TWA), noise percentage doses, and peak levels were also collected. The mean Leq for all band directors was 90.5 dBA. The total accumulated noise percentage dose for all band directors was 77.6% of the maximum allowable daily noise dose under the OSHA standard. The total calculated TWA for all band directors was 88.2% of the maximum allowable daily noise dose under the OSHA standard. The total accumulated noise percentage dose for all band directors was 152.1% of the maximum allowable daily noise dose under the NIOSH standards, and the total calculated TWA for all band directors was 93dBA of the maximum allowable daily noise dose under the NIOSH standard. Multiple regression analysis revealed that the room volume, the level of acoustical treatment and the mean room reverberation time predicted 80% of the variance in sound pressure levels in this study.
CERT tribal internship program. Final intern report: D`Lisa Penney, 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-09-01
The purpose of this intern`s project was to: education the Nez Perce people of the Hanford situation; begin researching into past and present health effects from the Hanford site; and inform and educate the Nez Perce people of the Hanford site and past exposures. The specific objectives were to begin researching the history of Nez Perce people and Hanford; create an understanding for the importance of this research; define the radiation and risks and how they occur; inform the Nez Perce people of the issue; and write the paper so it is easy to understand. This intern report contains a copy of the final paper written for the Nez Perce people. Because the dose reconstruction for Hanford is not complete, the health effects section is informative, but not definitive.
Hart, Julie F; Ward, Tony J; Spear, Terry M; Crispen, Kelly; Zolnikov, Tara R
2007-11-01
Research was conducted in order to assess potential exposure to asbestos while harvesting firewood from amphibole-contaminated trees near Libby, MT, USA. Three firewood-harvesting simulations took place in the summer and fall of 2006 in the Kootenai Forest inside the US Environmental Protection Agency (EPA) restricted zone surrounding the former W.R. Grace vermiculite mine. Another simulation was conducted near Missoula, MT, USA, which served as the control. The work practices following each simulation were consistent throughout each trial. Personal breathing zone (PBZ) asbestos concentrations were measured by phase contrast microscopy (PCM) and transmission electron microscopy (TEM). Surface wipe samples of personal protective clothing were measured by TEM. The mean (n = 12) PBZ PCM sample time-weighted average (TWA) concentration was 0.29 fibers per milliliter, standard deviation (SD = 0.54). A substantial portion (more than five fibers per sample) of non-asbestos fibers (cellulose) was reported on all PBZ samples (excluding field blanks) when analyzed by TEM. The mean (n = 12) PBZ TEM sample TWA concentration for amphibole fibers 5-microm long was 0.07 fibers per milliliter (SD = 0.08). Substantial amphibole fiber concentrations were revealed on Tyvek clothing wipe samples. The mean concentration (n = 12) was 29 826 fibers per square centimeter (SD = 37 555), with 91% (27 192 fibers per square centimeter) comprised fibers firewood-harvesting activities in asbestos-contaminated areas and that the potential for exposure exists during such activities.
Asbestos exposures of mechanics performing clutch service on motor vehicles.
Cohen, Howard J; Van Orden, Drew R
2008-03-01
and frequency of this task, the incremental contribution of this task to mechanics' 8-hr time-weighted average (TWA) asbestos exposures was 0.0016 flcc. Using the range of data inputs that were obtained, the authors calculated a range of TWA exposures of 3.75 x 10(-5) flcc to 0.03 flcc. The mean value of 0.0016 flcc is below background levels of asbestos that have been reported in garages during this time and below the current OSHA PEL of 0.1 flcc.
Pechacek, Nathan; Osorio, Magdalena; Caudill, Jeff; Peterson, Bridget
2015-02-17
Peracetic acid (PAA) is a peroxide-based chemistry that is highly reactive and can produce strong local effects upon direct contact with the eyes, skin and respiratory tract. Given its increasing prominence in industry, attention has focused on health hazards and associated risks for PAA in the workplace. Occupational exposure limits (OEL) are one means to mitigate risks associated with chemical hazards in the workplace. A mini-review of the toxicity data for PAA was conducted in order to determine if the data were sufficient to derive health-based OELs. The available data for PAA frequently come from unpublished studies that lack sufficient study details, suffer from gaps in available information and often follow unconventional testing methodology. Despite these limitations, animal and human data suggest sensory irritation as the most sensitive endpoint associated with inhalation of PAA. Rodent RD50 data (the concentration estimated to cause a 50% depression in respiratory rate) were selected as the critical studies in deriving OELs. Based on these data, a range of 0.36-0.51mg/m(3) (0.1-0.2ppm) was calculated for a time-weighted average (TWA), and 1.2-1.7mg/m(3) (0.4-0.5ppm) as a range for a short-term exposure limit (STEL). These ranges compare favorably to other published OELs for PAA. Considering the applicable health hazards for this chemistry, a joint TWA/STEL OEL approach for PAA is deemed the most appropriate in assessing workplace exposures to PAA, and the selection of specific values within these proposed ranges represents a risk management decision. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Thompson, Drew; Chen, Sheng-Chieh; Wang, Jing; Pui, David Y H
2015-11-01
Recent animal studies have shown that carbon nanotubes (CNTs) may pose a significant health risk to those exposed in the workplace. To further understand this potential risk, effort must be taken to measure the occupational exposure to CNTs. Results from an assessment of potential exposure to multi-walled carbon nanotubes (MWCNTs) conducted at an industrial facility where polymer nanocomposites were manufactured by an extrusion process are presented. Exposure to MWCNTs was quantified by the thermal-optical analysis for elemental carbon (EC) of respirable dust collected by personal sampling. All personal respirable samples collected (n = 8) had estimated 8-h time weighted average (TWA) EC concentrations below the limit of detection for the analysis which was about one-half of the recommended exposure limit for CNTs, 1 µg EC/m(3) as an 8-h TWA respirable mass concentration. Potential exposure sources were identified and characterized by direct-reading instruments and area sampling. Area samples analyzed for EC yielded quantifiable mass concentrations inside an enclosure where unbound MWCNTs were handled and near a pelletizer where nanocomposite was cut, while those analyzed by electron microscopy detected the presence of MWCNTs at six locations throughout the facility. Through size selective area sampling it was identified that the airborne MWCNTs present in the workplace were in the form of large agglomerates. This was confirmed by electron microscopy where most of the MWCNT structures observed were in the form of micrometer-sized ropey agglomerates. However, a small fraction of single, free MWCNTs was also observed. It was found that the high number concentrations of nanoparticles, ~200000 particles/cm(3), present in the manufacturing facility were likely attributable to polymer fumes produced in the extrusion process. © The Author 2015. Published by Oxford University Press on behalf of the British Occupational Hygiene Society.
Energy Technology Data Exchange (ETDEWEB)
Larson, Roy Edward; Walker, Grant W.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)
2005-12-01
This report fulfills the contract obligations based on the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration (BPA). Nez Perce Tribal Hatchery (NPTH) Year-2002 annual report combines information from two contracts with a combined value of $3,036,014. Bonneville Power Administration identifies them as follows; (1) Part I--Operations and Maintenance--Project No. 1983-350-00, Contract No. 4504, and $2,682,635 which includes--Equipment costs of $1,807,105. (2) Part II--Planning and Design--Project No. 1983-35-04, Contract No. 4035, $352,379 for Clearwater Coho Restoration Master Plan development Based on NPPC authorization for construction and operation of NPTH, the annual contracts were negotiated for the amounts shown above under (1) and (2). Construction contracts were handled by BPA until all facilities are completed and accepted.
Directory of Open Access Journals (Sweden)
Michael J. Drescher
2017-09-01
Full Text Available Introduction: Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA for pulmonary embolism (PE ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC rule, multi-modal education using principles of knowledge translation (KT, and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. Methods: We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. Results: CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9–11.2] to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3–9.4] p<0.001. The absolute reduction in PACT ordered was 1.72 per 1,000 visits (a 16% reduction. Patient characteristics were similar for both periods. Conclusion: Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.
Nanosilver – Occupational exposure limits
Directory of Open Access Journals (Sweden)
Anna Maria Świdwińska-Gajewska
2015-07-01
Full Text Available Historically, nanosilver has been known as colloidal silver composed of particles with a size below 100 nm. Silver nanoparticles are used in many technologies, creating a wide range of products. Due to antibacterial properties nanosilver is used, among others, in medical devices (wound dressings, textiles (sport clothes, socks, plastics and building materials (paints. Colloidal silver is considered by many as an ideal agent in the fight against pathogenic microorganisms, unlike antibiotics, without side effects. However, in light of toxicological research, nanosilver is not inert to the body. The inhalation of silver nanoparticles have an adverse effect mainly on the liver and lung of rats. The oxidative stress caused by reactive oxygen species is responsible for the toxicity of nanoparticles, contributing to cytotoxic and genotoxic effects. The activity of the readily oxidized nanosilver surface underlies the molecular mechanism of toxicity. This leads to the release of silver ions, a known harmful agent. Occupational exposure to silver nanoparticles may occur in the process of its manufacture, formulation and also usage during spraying, in particular. In Poland, as well as in other countries of the world, there is no separate hygiene standards applicable to nanomaterials. The present study attempts to estimate the value of MAC-TWA (maximum admissible concentration – the time-weighted average for silver – a nano-objects fraction, which amounted to 0.01 mg/m3. The authors are of the opinion that the current value of the MAC-TWA for silver metallic – inhalable fraction (0.05 mg/m3 does not provide sufficient protection against the harmful effects of silver in the form of nano-objects. Med Pr 2015;66(3:429–442
Directory of Open Access Journals (Sweden)
Elisabete Matos Freitas
2015-05-01
Full Text Available http://dx.doi.org/10.5902/1984686X15273O papel dos pais no processo de inclusão de crianças com necessidades educativas especiais é fundamental, seja no apoio familiar, desmontando mitos e criando um contexto favorável à experiência e à proximidade. O objetivo deste trabalho é, assim, conhecer as perceções dos pais relativamente à inclusão, assim como os factores que as influenciam. Para isso, foi aplicado um inquérito a 300 pais, com e sem filhos com necessidades educativas especiais. Os resultados permitiram perceber atitudes genericamente positivas, sem diferenças relativamente ao género e ao fato de serem pais de crianças com necessidades educativas especiais. Contudo as variáveis idade, escolaridade e proximidade / contato pareceram influenciar a perceção em relação a inclusão de crianças NEE. Assim, os pais com atitudes mais favoráveis à inclusão tendem a ser os mais novos, que tiveram proximidade / contato com criança NEE. Os resultados são discutidos em função da literatura.
[Nanosilver--Occupational exposure limits].
Świdwińska-Gajewska, Anna Maria; Czerczak, Sławomir
2015-01-01
Historically, nanosilver has been known as colloidal silver composed of particles with a size below 100 nm. Silver nanoparticles are used in many technologies, creating a wide range of products. Due to antibacterial properties nanosilver is used, among others, in medical devices (wound dressings), textiles (sport clothes, socks), plastics and building materials (paints). Colloidal silver is considered by many as an ideal agent in the fight against pathogenic microorganisms, unlike antibiotics, without side effects. However, in light of toxicological research, nanosilver is not inert to the body. The inhalation of silver nanoparticles have an adverse effect mainly on the liver and lung of rats. The oxidative stress caused by reactive oxygen species is responsible for the toxicity of nanoparticles, contributing to cytotoxic and genotoxic effects. The activity of the readily oxidized nanosilver surface underlies the molecular mechanism of toxicity. This leads to the release of silver ions, a known harmful agent. Occupational exposure to silver nanoparticles may occur in the process of its manufacture, formulation and also usage during spraying, in particular. In Poland, as well as in other countries of the world, there is no separate hygiene standards applicable to nanomaterials. The present study attempts to estimate the value of MAC-TWA (maximum admissible concentration--the time-weighted average) for silver--a nano-objects fraction, which amounted to 0.01 mg/m3. The authors are of the opinion that the current value of the MAC-TWA for silver metallic--inhalable fraction (0.05 mg/m3) does not provide sufficient protection against the harmful effects of silver in the form of nano-objects. This work is available in Open Access model and licensed under a CC BY-NC 3.0 PL license.
A Comparison of "Total Dust" and Inhalable Personal Sampling for Beryllium Exposure
Energy Technology Data Exchange (ETDEWEB)
Carter, Colleen M. [Tulane Univ., New Orleans, LA (United States). School of Public Health and Tropical Medicine
2012-05-09
In 2009, the American Conference of Governmental Industrial Hygienists (ACGIH) reduced the Beryllium (Be) 8-hr Time Weighted Average Threshold Limit Value (TLV-TWA) from 2.0 μg/m3 to 0.05 μg/m3 with an inhalable 'I' designation in accordance with ACGIH's particle size-selective criterion for inhalable mass. Currently, per the Department of Energy (DOE) requirements, the Lawrence Livermore National Laboratory (LLNL) is following the Occupational Health and Safety Administration (OSHA) Permissible Exposure Limit (PEL) of 2.0 μg/m3 as an 8-hr TWA, which is also the 2005 ACGIH TLV-TWA, and an Action Level (AL) of 0.2 μg/m3 and sampling is performed using the 37mm (total dust) sampling method. Since DOE is considering adopting the newer 2009 TLV guidelines, the goal of this study was to determine if the current method of sampling using the 37mm (total dust) sampler would produce results that are comparable to what would be measured using the IOM (inhalable) sampler specific to the application of high energy explosive work at LLNL's remote experimental test facility at Site 300. Side-by-side personal sampling using the two samplers was performed over an approximately two-week period during chamber re-entry and cleanup procedures following detonation of an explosive assembly containing Beryllium (Be). The average ratio of personal sampling results for the IOM (inhalable) vs. 37-mm (total dust) sampler was 1.1:1 with a P-value of 0.62, indicating that there was no statistically significant difference in the performance of the two samplers. Therefore, for the type of activity monitored during this study, the 37-mm sampling cassette would be considered a suitable alternative to the IOM sampler for collecting inhalable particulate matter, which is important given the many practical and economic advantages that it presents. However, similar comparison studies would be necessary for this conclusion to be
Directory of Open Access Journals (Sweden)
Imam Sujoko
2017-12-01
Full Text Available This study entitled:HujjiyahNazariyahSaddiaz-Żarāiʻfī al-Fiqh al-IslāmywatatbīquhāfīQadāyāal- Maʹkȗlātwa al-Mashrȗbātwa al-Malbȗsāt, deal with the theory ofSaddiaz-Żarāi. The study tries to explore its meaning, concept, and its legality in Islamic jurisprudence, and how it could be implemented in the cases of food, drink and clothing. Food, drink and clothing are the primary need of human, but there are some cases faced by Muslim related to the food, drink and clothing. For example a Muslim will consume a product of food or drink or clothingthat produced from the non Muslim country which they do not mind about the material; halal or haram. Should Muslim stops from using those product, based on the theory of Saddiaz-Żarāiʻ?. The study found that the theory of Saddiaz-Żarāiʻ,is a one of the Islamic resources regarding to the majority of Muslim scholar, event there are some differences among them related to its implementation. And some Muslim scholar does not recognize Saddiaz-Żarāiʻ as Islamic resources. But for those who agree with the theory ofSaddiaz-Żarāiʻ,they should understand the regulation of Saddiaz-Żarāiʻ. The methodology of study is library study which is referring to the Islamic references such as texts of Qur’an and hadis and its exegesis, Islamic jurisprudence books both classic and modern book, and fatwa of modern Muslim scholarsDOI: 10.15408/insaniyat.v2i1.6591
Exposure of miners to diesel exhaust particulates in underground nonmetal mines.
Cohen, H J; Borak, J; Hall, T; Sirianni, G; Chemerynski, S
2002-01-01
A study was initiated to examine worker exposures in seven underground nonmetal mines and to examine the precision of the National Institute for Occupational Safety and Health (NIOSH) 5040 sampling and analytical method for diesel exhaust that has recently been adopted for compliance monitoring by the Mine Safety and Health Administration (MSHA). Approximately 1000 air samples using cyclones were taken on workers and in areas throughout the mines. Results indicated that worker exposures were consistently above the MSHA final limit of 160 micrograms/m3 (time-weighted average; TWA) for total carbon as determined by the NIOSH 5040 method and greater than the proposed American Conference of Governmental Industrial Hygienists TLV limit of 20 micrograms/m3 (TWA) for elemental carbon. A number of difficulties were documented when sampling for diesel exhaust using organic carbon: high and variable blank values from filters, a high variability (+/- 20%) from duplicate punches from the same sampling filter, a consistent positive interference (+26%) when open-faced monitors were sampled side-by-side with cyclones, poor correlation (r 2 = 0.38) to elemental carbon levels, and an interference from limestone that could not be adequately corrected by acid-washing of filters. The sampling and analytical precision (relative standard deviation) was approximately 11% for elemental carbon, 17% for organic carbon, and 11% for total carbon. An hypothesis is presented and supported with data that gaseous organic carbon constituents of diesel exhaust adsorb onto not only the submicron elemental carbon particles found in diesel exhaust, but also mining ore dusts. Such mining dusts are mostly nonrespirable and should not be considered equivalent to submicron diesel particulates in their potential for adverse pulmonary effects. It is recommended that size-selective sampling be employed, rather than open-faced monitoring, when using the NIOSH 5040 method.
An assessment of occupational exposure to polycyclic aromatic hydrocarbons in the UK.
Unwin, John; Cocker, John; Scobbie, Emma; Chambers, Helen
2006-06-01
A cross-industry occupational hygiene survey was commissioned by the Health and Safety Executive (HSE) to determine the levels of polycyclic aromatic hydrocarbon (PAH) exposure in UK industry and to determine if one or more target analytes were suitable as markers for assessing total exposure to PAHs. There were no broadly applicable UK exposure standards for assessing total exposure to PAHs. Until 1993 a guidance value for assessing exposure in coke ovens only, where PAH exposure is known to be the highest, was based on gravimetric analysis of cyclohexane-soluble material. Biological monitoring based on urinary 1-hydroxypyrene (1-OHP) is widely reported to be an effective indicator of exposure by both dermal and inhalation routes but there was no UK guidance value. The survey involved an occupational hygiene study of 25 sites using both airborne monitoring of a total of 17 individual PAHs and biological monitoring. The results showed 8 h TWA levels of total PAH in air ranged from 0.4 to 1912.6 microg m(-3) with a GM of 15.8 microg m(-3). The profile of PAHs was dominated by naphthalene, the most volatile 2-ring PAH. Airborne benzo(a)pyrene (BaP) correlated well (r(2) = 0.971) with levels of carcinogenic 4-6 ring PAHs and was an effective marker of exposure for all industries where significant particle bound PAH levels were found and, in particular, for CTPV exposure. The 8 h TWA levels of BaP ranged from <0.01 to 6.21 microg m(-3) with a GM of 0.036 microg m(-3); 90% were <0.75 microg m(-3) and 95% were <2.0 microg m(-3). Two hundred and eighteen urine samples collected from different workers at the end of shift and 213 samples collected pre-shift next day were analysed for 1-OHP. Levels of 1-OHP in end-of-shift samples were generally higher than those in pre-shift-next-day samples and showed a good correlation (r(2) = 0.768) to airborne BaP levels if samples from workers using respiratory protection or with significant dermal exposure were excluded. Urinary 1-OHP
[Expression of heat shock protein 70 and its mRNA in career exposure to manganese].
Chen, Wenwen; Shao, Hua; Chi, Mingfeng; Zhang, Zhihu; Shan, Yongle; Zou, Wei
2015-10-01
To analyze the expression levels of heat shock protein70 (HSPs70) and HSPs70 mRNA in different exposure to manganese, and research the neuroprotective effect on the career exposure to manganese. From 2008 to 2009, with cross-sectional study design, and in a locomotive and rolling stock works, by stratified random sampling method, the exposed sample consisted of 180 welders from different welding shops and 100 unexposed in the last three years, non-welder controls with age-matched workers of similar socioeconomic status from the same industry. The control workers had not been exposed to neurotoxic chemicals. The mRNA expressions of four different metabolic enzyme were detected by SYBR Green I quantitative real-time polymerase chain reaction. The expression levels of the two enzymes mRNA in different exposure to manganese were analyzed. The expressions of HSPs70 were detected by Western blot. The concentration of air manganese was determined by GFAAS. The average concentration of 8 h time (8h-TWA) was used to express the level of individual exposure to manganese, according to the air manganese workplace occupational exposure limit (8h-TWA=0.15 mg/m3), the exposed group is divided into high exposed group (>0.15 mg/m3) and low exposure group (<0.15 mg/m3). The individuals exposed to manganese dose of exposed group ((0.25±0.31) mg/m3) was higher than the control group ((0.06±0.02) mg/m3) (t=6.15, P=0.001); individuals exposed to manganese dose of high exposure group for (0.42±0.34) mg/m3, which was higher than low exposure group (0.09±0.07) mg/m3 (t=9.80, P=0.001). HSPs70 mRNA and protein of exposure group (5.65±0.21, 3.26±0.15) were higher than the reference group (0.41±0.03, 1.32±0.12) (t=18.91, t=8.68, P=0.001). HSP70 mRNA and protein of high exposure group (6.48±0.37, 3.67±0.26) were higher than the low exposure group (5.15±0.23, 3.02±0.19) (t=3.24, t=2.01, P=0.003, P=0.043). The expression of peripheral blood lymphocytes HSPs70 level and HSPs70 m
Perceção de falhas de memória, ansiedade e depressão em pacientes com dor crónica
Lobato, Filipa
2012-01-01
Dissertação apresentada à Universidade Fernando Pessoa como parte dos requisitos para a obtenção do grau de Mestre em Psicologia, ramo de Psicologia Clínica e da Saúde Diversos estudos têm mostrado que as alterações cognitivas e os estados de humor fazem parte dos quadros com pacientes com dor, o que acaba por limitar, ainda mais, a sua autonomia em termos funcionais das atividades do dia-a-dia. O principal objetivo do presente estudo foi analisar a perceção de falhas de memóri...
Noise exposure levels for musicians during rehearsal and performance times.
McIlvaine, Devon; Stewart, Michael; Anderson, Robert
2012-03-01
The purpose of this study was to determine daily noise doses and 8-hour time weighted averages for rock band musicians, crew members, and spectators during a typical rehearsal and performance using both Occupational Safety and Health Administration (OSHA) and National Institute of Occupational Safety and Health (NIOSH) measurement criteria. Personal noise dosimetry was completed on five members of a rock band during one 2-hr rehearsal and one 4-hr performance. Time-weighted averages (TWA) and daily dose values were calculated using both OSHA and NIOSH criteria and compared to industry guidelines for enrollment in hearing conservation programs and the use of hearing protection devices. TWA values ranged from 84.3 to 90.4 dBA (OSHA) and from 90.0 to 96.4 dBA (NIOSH) during the rehearsal. The same values ranged from 91.0 to 99.7 dBA (OSHA) and 94.0 to 102.8 dBA (NIOSH) for the performance. During the rehearsal, daily noise doses ranged from 45.54% to 106.7% (OSHA) and from 317.74% to 1396.07% (NIOSH). During the performance, doses ranged from 114.66% to 382.49% (OSHA) and from 793.31% to 5970.15% (NIOSH). The musicians in this study were exposed to dangerously high levels of noise and should be enrolled in a hearing conservation programs. Hearing protection devices should be worn, especially during performances. The OSHA measurement criteria yielded values significantly more conservative than those produced by NIOSH criteria. Audiologists should counsel musician-patients about the hazards of excessive noise (music) exposure and how to protect their hearing.
International Nuclear Information System (INIS)
Liebow, E.B.; Younger, C.A.; Broyles, J.A.
1987-11-01
For the purposes of the Nuclear Waste Policy Act, the Confederated Tribes and Bands of the Yakima Indian Nation, the Confederated Tribes of the Umatilla Indian Reservation, and the Nez Perce Tribe have been accorded the status of ''Affected Indian Tribe'' and have become party to the proceedings to determine a suitable location for the nation's first commercial waste repository. Each of the Tribes has expressed concerns about the suitability of the Hanford Site in eastern Washington. These concerns, in general, address the proposed repository's effects on traditional spiritual beliefs and cultural practices, on tribal sovereignty and the Tribes' right to self-government, on the natural resources under tribal management jurisdiction, and on the health and socioeconomic characteristics of the Tribes' reservation communities. The Yakima, Umatilla, and Nez Perce have distinctive cultural traditions that may be adversely affected by activities related to the Basalt Waste Isolation Project (BWIP). Further, the Tribes enjoy a unique relationship with the federal government. Because of their distinctive cultures and governmental status, particular attention will be paid to expressed interests of the Tribes, and to ways in which these interests may be affected by the repository program. Monitoring is needed to describe current conditions among the Affected Tribes' populations, to describe BWIP site characterization activities affecting the Tribes, and to measure any changes in these conditions that may occur as a direct result of site characterization. This paper reports our first efforts at gathering historical information. It summarizes materials contained in two sources: the reports of field agents to the Commissioner of Indian Affairs (1854-1936), and the dockets of the Indian Claims Commission. 24 refs., 3 figs
T-wave alternans, air pollution and traffic in high-risk subjects.
Zanobetti, Antonella; Stone, Peter H; Speizer, Frank E; Schwartz, Joel D; Coull, Brent A; Suh, Helen H; Nearing, Bruce D; Mittleman, Murray A; Verrier, Richard L; Gold, Diane R
2009-09-01
Particulate pollution has been linked to risk for cardiac death; possible mechanisms include pollution-related increases in cardiac electrical instability. T-wave alternans (TWA) is a marker of cardiac electrical instability measured as differences in the magnitude between adjacent T waves. In a repeated-measures study of 48 patients aged 43 to 75 years, associations of ambient and home indoor particulate pollution, including black carbon (BC) and reports of traffic exposure, with changes in 0.5-hourly maximum TWA (TWA-MAX), measured by 24-hour Holter electrocardiographic monitoring, were investigated. Each patient was observed up to 4 times within 1 year after percutaneous intervention for myocardial infarction, acute coronary syndromes without infarction, or stable coronary artery disease, for a total of 5,830 0.5-hour observations. Diary data for each 0.5-hour period defined whether a patient was home or not home, or in traffic. Increases in TWA-MAX were independently associated with the previous 2-hour mean ambient BC (2.1%, 95% confidence interval 0.9% to 3.3%) and with being in traffic in the previous 2 hours (6.1%, 95% confidence interval 3.4% to 8.8%). When subjects were home, indoor home BC effects were largest and most precise; when subjects were away from home, ambient central site BC effects were strongest. Increases in pollution increased the odds of TWA-MAX > or =75th percentile (odds ratio 1.4, 95% confidence interval 1.2 to 1.6 for a 1 microg/m(3) increase in 6-hour mean BC). In conclusion, after hospitalization for coronary artery disease, being in traffic and short-term ambient or indoor BC exposure increased TWA, a marker of cardiac electrical instability.
A prática de formação da câmara municipal de Setúbal: a perceção dos
Claré, Lúcia Sofia Balagueira
2013-01-01
Dissertação de Mestrado em Gestão Estratégica de Recursos Humanos O objetivo global desta investigação assenta na prática de formação da Câmara Municipal de Setúbal, a partir da perceção dos dirigentes entrevistados. Na Administração Pública e ao nível da Gestão de Recursos Humanos, a formação tem vindo a ser encarada como um elemento chave para a melhoria da performance organizacional, através da aquisição de novas qualificações dos seus trabalhadores, refletindo-se no aum...
Directory of Open Access Journals (Sweden)
Hsin-I Hsu
2014-09-01
Full Text Available An integrated approach was developed to assess exposure and health-risk from polycyclic aromatic hydrocarbons (PAHs contained in oil mists in a fastener manufacturing industry. One previously developed model and one new model were adopted for predicting oil mist exposure concentrations emitted from metal work fluid (MWF and PAHs contained in MWF by using the fastener production rate (Pr and cumulative fastener production rate (CPr as predictors, respectively. By applying the annual Pr and CPr records to the above two models, long-term workplace PAH exposure concentrations were predicted. In addition, true exposure data was also collected from the field. The predicted and measured concentrations respectively served as the prior and likelihood distributions in the Bayesian decision analysis (BDA, and the resultant posterior distributions were used to determine the long-term exposure and health-risks posed on workers. Results show that long term exposures to PAHs would result in a 3.1%, 96.7%, and 73.4% chance of exceeding the PEL-TWA (0.2 mg/m3, action level (0.1 mg/m3, and acceptable health risk (10−3, respectively. In conclusion, preventive measures should be taken immediately to reduce workers’ PAH exposures.
Modeled occupational exposures to gas-phase medical laser-generated air contaminants.
Lippert, Julia F; Lacey, Steven E; Jones, Rachael M
2014-01-01
Exposure monitoring data indicate the potential for substantive exposure to laser-generated air contaminants (LGAC); however the diversity of medical lasers and their applications limit generalization from direct workplace monitoring. Emission rates of seven previously reported gas-phase constituents of medical laser-generated air contaminants (LGAC) were determined experimentally and used in a semi-empirical two-zone model to estimate a range of plausible occupational exposures to health care staff. Single-source emission rates were generated in an emission chamber as a one-compartment mass balance model at steady-state. Clinical facility parameters such as room size and ventilation rate were based on standard ventilation and environmental conditions required for a laser surgical facility in compliance with regulatory agencies. All input variables in the model including point source emission rates were varied over an appropriate distribution in a Monte Carlo simulation to generate a range of time-weighted average (TWA) concentrations in the near and far field zones of the room in a conservative approach inclusive of all contributing factors to inform future predictive models. The concentrations were assessed for risk and the highest values were shown to be at least three orders of magnitude lower than the relevant occupational exposure limits (OELs). Estimated values do not appear to present a significant exposure hazard within the conditions of our emission rate estimates.
Donnay, Karsten
2015-03-01
The past several years have seen a rapidly growing interest in the use of advanced quantitative methodologies and formalisms adapted from the natural sciences to study a broad range of social phenomena. The research field of computational social science [1,2], for example, uses digital artifacts of human online activity to cast a new light on social dynamics. Similarly, the studies reviewed by D'Orsogna and Perc showcase a diverse set of advanced quantitative techniques to study the dynamics of crime. Methods used range from partial differential equations and self-exciting point processes to agent-based models, evolutionary game theory and network science [3].
Associations between Bisphenol A Exposure and Reproductive Hormones among Female Workers.
Miao, Maohua; Yuan, Wei; Yang, Fen; Liang, Hong; Zhou, Zhijun; Li, Runsheng; Gao, Ersheng; Li, De-Kun
2015-10-22
The associations between Bisphenol-A (BPA) exposure and reproductive hormone levels among women are unclear. A cross-sectional study was conducted among female workers from BPA-exposed and unexposed factories in China. Women's blood samples were collected for assay of follicle-stimulating hormone (FSH), luteinizing hormone (LH), 17β-Estradiol (E2), prolactin (PRL), and progesterone (PROG). Their urine samples were collected for BPA measurement. In the exposed group, time weighted average exposure to BPA for an 8-h shift (TWA8), a measure incorporating historic exposure level, was generated based on personal air sampling. Multiple linear regression analyses were used to examine linear associations between urine BPA concentration and reproductive hormones after controlling for potential confounders. A total of 106 exposed and 250 unexposed female workers were included in this study. A significant positive association between increased urine BPA concentration and higher PRL and PROG levels were observed. Similar associations were observed after the analysis was carried out separately among the exposed and unexposed workers. In addition, a positive association between urine BPA and E2 was observed among exposed workers with borderline significance, while a statistically significant inverse association between urine BPA and FSH was observed among unexposed group. The results suggest that BPA exposure may lead to alterations in female reproductive hormone levels.
Associations between Bisphenol A Exposure and Reproductive Hormones among Female Workers
Directory of Open Access Journals (Sweden)
Maohua Miao
2015-10-01
Full Text Available The associations between Bisphenol-A (BPA exposure and reproductive hormone levels among women are unclear. A cross-sectional study was conducted among female workers from BPA-exposed and unexposed factories in China. Women’s blood samples were collected for assay of follicle-stimulating hormone (FSH, luteinizing hormone (LH, 17β-Estradiol (E2, prolactin (PRL, and progesterone (PROG. Their urine samples were collected for BPA measurement. In the exposed group, time weighted average exposure to BPA for an 8-h shift (TWA8, a measure incorporating historic exposure level, was generated based on personal air sampling. Multiple linear regression analyses were used to examine linear associations between urine BPA concentration and reproductive hormones after controlling for potential confounders. A total of 106 exposed and 250 unexposed female workers were included in this study. A significant positive association between increased urine BPA concentration and higher PRL and PROG levels were observed. Similar associations were observed after the analysis was carried out separately among the exposed and unexposed workers. In addition, a positive association between urine BPA and E2 was observed among exposed workers with borderline significance, while a statistically significant inverse association between urine BPA and FSH was observed among unexposed group. The results suggest that BPA exposure may lead to alterations in female reproductive hormone levels.
Garg, Arun; Kapellusch, Jay M
2016-08-01
The objectives were to: (a) develop a continuous frequency multiplier (FM) for the Revised NIOSH Lifting Equation (RNLE) as a function of lifting frequency and duration of a lifting task, and (b) describe the Cumulative Lifting Index (CULI), a methodology for estimating physical exposure to workers with job rotation. The existing FM for the RNLE (FME) does not differentiate between task duration >2 hr and <8 hr, which makes quantifying physical exposure to workers with job rotation difficult and presents challenges to job designers. Using the existing FMs for 1, 2, and 8 hr of task durations, we developed a continuous FM (FMP) that extends to 12 hr per day. We simulated 157,500 jobs consisting of two tasks each and, using different combinations of Frequency Independent Lifting Index, lifting frequency and duration of lifting. Biomechanical stresses were estimated using the CULI, time-weighted average (TWA), and peak exposure. The median difference between FME and FMP was ±1% (range: 0%-15%). Compared to CULI, TWA underestimated risk of low-back pain (LBP) for 18% to 30% of jobs, and peak exposure for an assumed 8-hr work shift overestimated risk of LBP for 20% to 25% of jobs. Peak task exposure showed 90% agreement with CULI but ignored one of two tasks. The CULI partially addressed the underestimation of physical exposure using the TWA approach and overestimation of exposure using the peak-exposure approach. The proposed FM and CULI may provide more accurate physical exposure estimates, and therefore estimated risk of LBP, for workers with job rotation. © 2016, Human Factors and Ergonomics Society.
Holland, Nicholas Vedder, III
Exposure to loud sounds is one of the leading causes of hearing loss in the United States. The purpose of the current research was to measure the sound pressure levels generated within a university concert band and determine if those levels exceeded permissible sound limits for exposure according to criteria set by the Occupational Safety and Health Administration (OSHA) and the National Institute of Occupational Safety and Health (NIOSH). Time-weighted averages (TWA) were obtained via a dosimeter during six rehearsals for nine members of the ensemble (plus the conductor), who were seated in frontal proximity to "instruments of power" (trumpets, trombones, and percussion; (Backus, 1977). Subjects received audiometer tests prior to and after each rehearsal to determine any temporary threshold shifts (TTS). Single sample t tests were calculated to compare TWA means and the maximum sound intensity exposures set by OSHA and NIOSH. Correlations were calculated between TWAs and TTSs, as well as TTSs and the number of semesters subjects reported being seated in proximity to instruments of power. The TWA-OSHA mean of 90.2 dBA was not significantly greater than the specified OSHA maximum standard of 90.0 dBA (p > .05). The TWA-NIOSH mean of 93.1 dBA was, however, significantly greater than the NIOSH specified maximum standard of 85.0 dBA (p OSHA, r = .20 for NIOSH); the correlation between TTSs and semesters of proximity to instruments of power was also considered weak (r = .13). TWAs cumulatively exceeded both association's sound exposure limits at 11 specified locations (nine subjects and both ears of the conductor) throughout the concert band's rehearsals. In addition, hearing acuity, as determined by TTSs, was substantially affected negatively by the intensities produced in the concert band. The researcher concluded that conductors, as well as their performers, must be aware of possible damaging sound intensities in rehearsals or performances.
Sensor-triggered sampling to determine instantaneous airborne vapor exposure concentrations.
Smith, Philip A; Simmons, Michael K; Toone, Phillip
2018-06-01
It is difficult to measure transient airborne exposure peaks by means of integrated sampling for organic chemical vapors, even with very short-duration sampling. Selection of an appropriate time to measure an exposure peak through integrated sampling is problematic, and short-duration time-weighted average (TWA) values obtained with integrated sampling are not likely to accurately determine actual peak concentrations attained when concentrations fluctuate rapidly. Laboratory analysis for integrated exposure samples is preferred from a certainty standpoint over results derived in the field from a sensor, as a sensor user typically must overcome specificity issues and a number of potential interfering factors to obtain similarly reliable data. However, sensors are currently needed to measure intra-exposure period concentration variations (i.e., exposure peaks). In this article, the digitized signal from a photoionization detector (PID) sensor triggered collection of whole-air samples when toluene or trichloroethylene vapors attained pre-determined levels in a laboratory atmosphere generation system. Analysis by gas chromatography-mass spectrometry of whole-air samples (with both 37 and 80% relative humidity) collected using the triggering mechanism with rapidly increasing vapor concentrations showed good agreement with the triggering set point values. Whole-air samples (80% relative humidity) in canisters demonstrated acceptable 17-day storage recoveries, and acceptable precision and bias were obtained. The ability to determine exceedance of a ceiling or peak exposure standard by laboratory analysis of an instantaneously collected sample, and to simultaneously provide a calibration point to verify the correct operation of a sensor was demonstrated. This latter detail may increase the confidence in reliability of sensor data obtained across an entire exposure period.
Garg, Arun; Moore, J Steven; Kapellusch, Jay M
2017-08-01
The Composite Strain Index (COSI) quantifies biomechanical stressors for complex tasks consisting of exertions at different force levels and/or with different exertion times. The Cumulative Strain Index (CUSI) further integrates biomechanical stressors from different tasks to quantify exposure for the entire work shift. The paper provides methodologies to compute COSI and CUSI along with examples. Complex task simulation produced 169,214 distinct tasks. Use of average, time-weighted average (TWA) and peak force and COSI classified 66.9, 28.2, 100 and 38.9% of tasks as hazardous, respectively. For job rotation the simulation produced 10,920 distinct jobs. TWA COSI, peak task COSI and CUSI classified 36.5, 78.1 and 66.6% jobs as hazardous, respectively. The results suggest that the TWA approach systematically underestimates the biomechanical stressors and peak approach overestimates biomechanical stressors, both at the task and job level. It is believed that the COSI and CUSI partially address these underestimations and overestimations of biomechanical stressors. Practitioner Summary: COSI quantifies exposure when applied hand force and/or duration of that force changes during a task cycle. CUSI integrates physical exposures from job rotation. These should be valuable tools for designing and analysing tasks and job rotation to determine risk of musculoskeletal injuries.
Distribution of exposure concentrations and doses for constituents of environmental tobacco smoke
Energy Technology Data Exchange (ETDEWEB)
LaKind, J.S. [LaKind Associates (United States); Ginevan, M.E. [M.E. Ginevan and Associates (United States); Naiman, D.Q. [Johns Hopkins Univ., Baltimore, MD (United States). Dept. of Mathematical Sciences; James, A.C. [A.C. James and Associates (United States); Jenkins, R.A. [Oak Ridge National Lab., TN (United States); Dourson, M.L.; Felter, S.P. [TERA (United States); Graves, C.G.; Tardiff, R.G. [Sapphire Group, Inc., Bethesda, MD (United States)
1999-06-01
The ultimate goal of the research reported in this series of three articles is to derive distributions of doses of selected environmental tobacco smoke (ETS)-related chemicals for nonsmoking workers. This analysis uses data from the 16-City Study collected with personal monitors over the course of one workday in workplaces where smoking occurred. In this article, the authors describe distributions of ETS chemical concentrations and the characteristics of those distributions for the workplace exposure. Next, they present population parameters relevant for estimating dose distributions and the methods used for estimating those dose distributions. Finally, they derive distributions of doses of selected ETS-related constituents obtained in the workplace for people in smoking work environments. Estimating dose distributions provided information beyond the usual point estimate of dose and showed that the preponderance of individuals exposed to ETS in the workplace were exposed at the low end of the dose distribution curve. The results of this analysis include estimations of hourly maxima and time-weighted average (TWA) doses of nicotine from workplace exposures to ETS and doses derived from modeled lung burdens of ultraviolet-absorbing particulate matter (UVPM) and solanesol resulting from workplace exposures to ETS (extrapolated from 1 day to 1 year).
International Nuclear Information System (INIS)
Walsh, P T; Forth, A R; Clark, R D R; Dowker, K P; Thorpe, A
2009-01-01
Real-time, photometric, portable dust monitors have been employed for video exposure monitoring (VEM) to measure and highlight dust levels generated by work activities, illustrate dust control techniques, and demonstrate good practice. Two workplaces, presenting different challenges for measurement, were used to illustrate the capabilities of VEM: (a) poultry farming activities and (b) powder transfer operations in a pharmaceutical company. For the poultry farm work, the real-time monitors were calibrated with respect to the respirable and inhalable dust concentrations using cyclone and IOM reference samplers respectively. Different rankings of exposure for typical activities were found on the small farm studied here compared to previous exposure measurements at larger poultry farms: these were mainly attributed to the different scales of operation. Large variations in the ratios of respirable, inhalable and real-time monitor TWA concentrations of poultry farm dust for various activities were found. This has implications for the calibration of light-scattering dust monitors with respect to inhalable dust concentration. In the pharmaceutical application, the effectiveness of a curtain barrier for dust control when dispensing powder in a downflow booth was rapidly demonstrated.
Chung, Eun-Kyo; Shin, Jung-Ah; Lee, Byung-Kyu; Kwon, Jiwoon; Lee, Naroo; Chung, Kwang-Jae; Lee, Jong-Han; Lee, In-Seop; Kang, Seong-Kyu; Jang, Jae-Kil
2010-09-01
The level of benzene exposure in the petrochemical industry during regular operation has been well established, but not in turnaround (TA), where high exposure may occur. In this study, the characteristics of occupational exposure to benzene during TA in the petrochemical companies were investigated in order to determine the best management strategies and improve the working environment. This was accomplished by evaluating the exposure level for the workers working in environments where benzene was being produced or used as an ingredient during the unit process. From 2003 to 2008, a total of 705 workers in three petrochemical companies in Korea were studied. Long- and short-term (< 1 hr) samples were taken during TAs. TA was classified into three stages: shut-down, maintenance and start-up. All works were classified into 12 occupation categories. The long-term geometric mean (GM) benzene exposure level was 0.025 (5.82) ppm (0.005-42.120 ppm) and the short-term exposure concentration during TA was 0.020 (17.42) ppm (0.005-61.855 ppm). The proportions of TA samples exceeding the time-weighted average, occupational exposure level (TWA-OEL in Korea, 1 ppm) and the short-term exposure limit (STEL-OEL, 5 ppm) were 4.1% (20 samples of 488) and 6.0% (13 samples of 217), respectively. The results for the benzene exposure levels and the rates of exceeding the OEL were both statistically significant (p < 0.05). Among the 12 job categories of petrochemical workers, mechanical engineers, plumbers, welders, fieldman and scaffolding workers exhibited long-term samples that exceeded the OEL of benzene, and the rate of exceeding the OEL was statistically significant for the first two occupations (p < 0.05). These findings suggest that the periodic work environment must be assessed during non-routine works such as TA.
Directory of Open Access Journals (Sweden)
E. Nadi
2010-04-01
Full Text Available Introduction & Objective: Methyl methacrylate (MMA, as a monomer of acrylic resin that has a wide variety of usages in denture fabrication, is considered as an air pollution indicator in the laboratories. Occupational exposure to these compound vapors can cause respiratory hypersensitivity, occupational asthma, eye and skin irritation and Allergic Contact Dermatitis (ACD. Therefore control of MMA exposure may promote the personnel’s health. The aim of this study was to determine the relationship between spirometric disorders and methyl methacrylate in dental laboratories personnel.. Materials & Methods: In this case control study, exposure of time-weighted average (TWA and short-term exposure level (STEL were measured with MMA vapors in 39 randomly selected male employee (case group in 25 denture fabrication laboratories in Hamadan city. The air samples were collected by sorbent tubes containing chromosorb (XAD2( and analyzed by gas chromatograph equipped with FID detector based on NIOSH method. In addition 30 men whitout occupational exposure to air pollutants (control group were selected to compare the variation of spirometric parameters. Spirometric parameters of the case and control groups such as FVC, FEV1, FEV1/FVC and FEF25-75 were measured by Vitalograph spirometer (model: 2120 on ATS method, after the standard questionnaire of respiratory diseases had been completed during an interview and medical examination..Results: The mean of MMA concentration was 132.87 ± 220.67 ppm for STEL and 1.95 ± 3.59 ppm for TWA.The relationship between MMA concentration in the STEL and TWA exposures was significant (P<0.05 and the relationship between MMA concentration and ventilation was significant just for STEL. In this study no relationship between MMA concentration and spirometric parameters in both STEL and TWA exposures was found. Also there was no significant difference between spirometric parameters of the case group and normal values of the
Exposures to asbestos arising from bandsawing gasket material.
Fowler, D P
2000-05-01
A simulation of bandsawing sheet asbestos gasket material was performed as part of a retrospective exposure evaluation undertaken to assist in determining causation of a case of mesothelioma. The work was performed by bandsawing a chrysotile asbestos (80%)/neoprene gasket sheet with a conventional 16-inch woodworking bandsaw inside a chamber. Measurements of airborne asbestos were made using conventional area and personal sampling methods, with analysis of collected samples by transmission electron microscopy (TEM) and phase contrast microscopy (PCM). These were supplemented by qualitative scanning electron microscopy (SEM) examinations of some of the airborne particles collected on the filters. In contrast with findings from studies examining manual handling (installation and removal) of gaskets, airborne asbestos concentrations from this operation were found to be well above current Occupational Safety and Health Administration (OSHA) permissible exposure limit (PEL) (eight-hour time-weighted average [TWA]) and excursion limit (30-minute) standards. Although some "encapsulation" effect of the neoprene matrix was seen on the particles in the airborne dust, unencapsulated individual fiber bundles were also seen. Suggestions for the implications of the work are given. In summary, the airborne asbestos concentrations arising from this work were quite high, and point to the need for careful observation of common sense precautions when manipulation of asbestos-containing materials (even those believed to have limited emissions potential) may involved machining operations.
Valeeva, E. R.; Stepanova, N. V.; Ismagilova, G. A.; Ziyatdinova, A. I.; Semanov, D. A.
2018-01-01
Results of the non-carcinogenic risk assessment on ingestion of chemical substances with drinking water showed that the risk value corresponded to the allowable level of the non-carcinogenic risk (HQ systems were identified: blood, CNS, kidneys, endocrine system, cardiovascular system, skeletal system and teeth. The total hazard indices in the 1st and the 4th zones deserve particular attention. The following elements: oil products (29.7% - 54.0%), nitrates (in NO3), chloroform and fluorides make a major contribution to the value of risk. In all other zones, irrespective of the value of exposure factors, total hazard quotients indicate alarming and unacceptable risk levels at HIMe = from 4 to 8.67; and at HI 95th Perc = from 8.7 to 16.8.
Risk of Lung Cancer and Indoor Radon Exposure in France
International Nuclear Information System (INIS)
Baysson, H.; Tirmarche, M.; Tymen, G.; Ducloy, F.; Laurier, D.
2004-01-01
It is well established that radon exposure increases risks of lung cancer among underground miners. to estimate the lung cancer risk linked to indoor radon exposure, a hospital based case-control study was carried out in France, With a focus on precise reconstruction of past indoor radon exposure over the 30 years preceding the lung cancer diagnosis. The investigation rook place from 1992 to 1998 in four regions of France: Auvergne, Brittany, Languedoc and Limousin. During face-to-face interviews a standardized questionnaire was used to ascertain demographic characteristics, information on active and passive smoking, occupational exposure, medical history as well as extensive details on residential history. Radon concentrations were measured in the dwellings where subjects had lived at least one year during the 5-30 year period before interview. Measurements of radon concentrations were performed during a 6-month period, using two Kodalpha LR 115 detectors, one in the living room and one in the bedroom. The time-weighted average (TWA) radon concentration for a subject during the 5-30 year period before interview was based on radon concentrations over all addresses occupied by the subject weighted by the number of years spent at each address. For the time intervals without available measurements, we imputed the region-specific arithmetic average of radon concentrations for measured addresses of control subjects. Lung cancer risk was examined in relation to indoor radon exposure after adjustment for age, sex, region, cigarette smoking and occupational exposure. The estimated relative a risk per 100 Bq/m''3 was 1.04, at the borderline of statistical significance (95 percent Confidence Interval: 0.99, 1..1). These results are in agreement with results from other indoor radon case-control studies and with extrapolations from underground miners studies. (Author) 31 refs
Exposures to jet fuel and benzene during aircraft fuel tank repair in the U.S. Air Force.
Carlton, G N; Smith, L B
2000-06-01
Jet fuel and benzene vapor exposures were measured during aircraft fuel tank entry and repair at twelve U.S. Air Force bases. Breathing zone samples were collected on the fuel workers who performed the repair. In addition, instantaneous samples were taken at various points during the procedures with SUMMA canisters and subsequent analysis by mass spectrometry. The highest eight-hour time-weighted average (TWA) fuel exposure found was 1304 mg/m3; the highest 15-minute short-term exposure was 10,295 mg/m3. The results indicate workers who repair fuel tanks containing explosion suppression foam have a significantly higher exposure to jet fuel as compared to workers who repair tanks without foam (p fuel, absorbed by the foam, to volatilize during the foam removal process. Fuel tanks that allow flow-through ventilation during repair resulted in lower exposures compared to those tanks that have only one access port and, as a result, cannot be ventilated efficiently. The instantaneous sampling results confirm that benzene exposures occur during fuel tank repair; levels up to 49.1 mg/m3 were found inside the tanks during the repairs. As with jet fuel, these elevated benzene concentrations were more likely to occur in foamed tanks. The high temperatures associated with fuel tank repair, along with the requirement to wear vapor-permeable cotton coveralls for fire reasons, could result in an increase in the benzene body burden of tank entrants.
Energy Technology Data Exchange (ETDEWEB)
Apte, Michael G. [Univ. of California, Berkeley, CA (United States)
1997-09-01
Two devices, an occupational carbon monoxide (CO) dosimeter (LOCD), and an indoor air quality (IAQ) passive sampler were developed for use in population-based CO exposure assessment studies. CO exposure is a serious public health problem in the U.S., causing both morbidity and mortality (lifetime mortality risk approximately 10{sup -4}). Sparse data from population-based CO exposure assessments indicate that approximately 10% of the U.S. population is exposed to CO above the national ambient air quality standard. No CO exposure measurement technology is presently available for affordable population-based CO exposure assessment studies. The LOCD and IAQ Passive Sampler were tested in the laboratory and field. The palladium-molybdenum based CO sensor was designed into a compact diffusion tube sampler that can be worn. Time-weighted-average (TWA) CO exposure of the device is quantified by a simple spectrophotometric measurement. The LOCD and IAQ Passive Sampler were tested over an exposure range of 40 to 700 ppm-hours and 200 to 4200 ppm-hours, respectively. Both devices were capable of measuring precisely (relative standard deviation <20%), with low bias (<10%). The LOCD was screened for interferences by temperature, humidity, and organic and inorganic gases. Temperature effects were small in the range of 10°C to 30°C. Humidity effects were low between 20% and 90% RH. Ethylene (200 ppm) caused a positive interference and nitric oxide (50 ppm) caused a negative response without the presence of CO but not with CO.
Figueira, Maria Margarida Góis
2016-01-01
Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz Introdução: Esta investigação pretende explorar, estudar e descrever a perceção individual e adaptativa, relativamente ao tratamento com aparelhos funcionais removíveis, da população jovem a ser seguida na consulta assistencial de Ortodontia da Clínica Universitária Egas Moniz, percebendo-se um envolvimento positivo dos pacientes predispõe ao sucesso do seu tratamento. Materiais e Métodos: ...
Exposure to fuel-oil ash and welding emissions during the overhaul of an oil-fired boiler.
Liu, Youcheng; Woodin, Mark A; Smith, Thomas J; Herrick, Robert F; Williams, Paige L; Hauser, Russ; Christiani, David C
2005-09-01
The health effects of exposure to vanadium in fuel-oil ash are not well described at levels ranging from 10 to 500 microg/m(3). As part of a larger occupational epidemiologic study that assessed these effects during the overhaul of a large oil-fired boiler, this study was designed to quantify boilermakers' exposures to fuel-oil ash particles, metals, and welding gases, and to identify determinants of these exposures. Personal exposure measurements were conducted on 18 boilermakers and 11 utility workers (referents) before and during a 3-week overhaul. Ash particles < 10 microm in diameter (PM(10), mg/m(3)) were sampled over full work shifts using a one-stage personal size selective sampler containing a polytetrafluoroethylene filter. Filters were digested using the Parr bomb method and analyzed for the metals vanadium (V), nickel (Ni), iron (Fe), chromium (Cr), cadmium (Cd), lead (Pb), manganese (Mn), and arsenic (As) by inductively coupled plasma mass spectrometry. Nitrogen dioxide (NO(2)) was measured with an Ogawa passive badge-type sampler and ozone (O(3)) with a personal active pump sampler.Time-weighted average (TWA) exposures were significantly higher (p < 0.05) for boilermakers than for utility workers for PM(10) (geometric mean: 0.47 vs. 0.13 mg/m(3)), V (8.9 vs. 1.4 microg/m(3)), Ni (7.4 vs. 1.8 microg/m(3)) and Fe (56.2 vs. 11.2 microg/m(3)). Exposures were affected by overhaul time periods, tasks, and work locations. No significant increases were found for O(3) or NO(2) for boilermakers or utility workers regardless of overhaul period or task group. Fuel-oil ash was a major contributor to boilermakers' exposure to PM(10) and metals. Vanadium concentrations sometimes exceeded the 2003 American Conference of Governmental Industrial Hygienists (ACGIH) threshold limit value.
Hanley, Kevin W.; Petersen, Martin R.; Cheever, Kenneth L.; Luo, Lian
2009-01-01
1-Bromopropane (1-BP) has been marketed as an alternative for ozone depleting and other solvents; it is used in aerosol products, adhesives, metal, precision, and electronics cleaning solvents. Mechanisms of toxicity of 1-BP are not fully understood, but it may be a neurological and reproductive toxicant. Sparse exposure information prompted this study using 1-BP air sampling and urinary metabolites. Mercapturic acid conjugates are excreted in urine from 1-BP metabolism involving debromination. Research objectives were to evaluate the utility of urinary N-acetyl-S-(n-propyl)-L-cysteine (AcPrCys) for assessing exposure to 1-BP and compare it to urinary bromide [Br(−)] previously reported for these workers. Forty-eight-hour urine specimens were obtained from 30 workers at two factories where 1-BP spray adhesives were used to construct polyurethane foam seat cushions. Urine specimens were also obtained from 21 unexposed control subjects. All the workers' urine was collected into composite samples representing three time intervals: at work, after work but before bedtime, and upon awakening. Time-weighted average (TWA) geometric mean breathing zone concentrations were 92.4 and 10.5 p.p.m. for spraying and non-spraying jobs, respectively. Urinary AcPrCys showed the same trend as TWA exposures to 1-BP: higher levels were observed for sprayers. Associations of AcPrCys concentrations, adjusted for creatinine, with 1-BP TWA exposure were statistically significant for both sprayers (P < 0.05) and non-sprayers (P < 0.01). Spearman correlation coefficients for AcPrCys and Br(−) analyses determined from the same urine specimens were highly correlated (P < 0.0001). This study confirms that urinary AcPrCys is an important 1-BP metabolite and an effective biomarker for highly exposed foam cushion workers. PMID:19706636
Blake, Charles L; Dotson, G Scott; Harbison, Raymond D
2006-07-01
Five test sessions were conducted to assess asbestos exposure during the removal or installation of asbestos-containing gaskets on vehicles. All testing took place within an operative automotive repair facility involving passenger cars and a pickup truck ranging in vintage from late 1960s through 1970s. A professional mechanic performed all shop work including engine disassembly and reassembly, gasket manipulation and parts cleaning. Bulk sample analysis of removed gaskets through polarized light microscopy (PLM) revealed asbestos fiber concentrations ranging between 0 and 75%. Personal and area air samples were collected and analyzed using National Institute of Occupational Safety Health (NIOSH) methods 7400 [phase contrast microscopy (PCM)] and 7402 [transmission electron microscopy (TEM)]. Among all air samples collected, approximately 21% (n = 11) contained chrysotile fibers. The mean PCM and phase contrast microscopy equivalent (PCME) 8-h time weighted average (TWA) concentrations for these samples were 0.0031 fibers/cubic centimeters (f/cc) and 0.0017 f/cc, respectively. Based on these findings, automobile mechanics who worked with asbestos-containing gaskets may have been exposed to concentrations of airborne asbestos concentrations approximately 100 times lower than the current Occupational Safety and Health Administration (OSHA) Permissible Exposure Limit (PEL) of 0.1 f/cc.
Assessment of noise in the airplane cabin environment.
Zevitas, Christopher D; Spengler, John D; Jones, Byron; McNeely, Eileen; Coull, Brent; Cao, Xiaodong; Loo, Sin Ming; Hard, Anna-Kate; Allen, Joseph G
2018-03-15
To measure sound levels in the aircraft cabin during different phases of flight. Sound level was measured on 200 flights, representing six aircraft groups using continuous monitors. A linear mixed-effects model with random intercept was used to test for significant differences in mean sound level by aircraft model and across each flight phase as well as by flight phase, airplane type, measurement location and proximity to engine noise. Mean sound levels across all flight phases and aircraft groups ranged from 37.6 to >110 dB(A) with a median of 83.5 dB(A). Significant differences in noise levels were also observed based on proximity to the engines and between aircraft with fuselage- and wing mounted engines. Nine flights (4.5%) exceeded the recommended 8-h TWA exposure limit of 85 dB(A) by the NIOSH and ACGIH approach, three flights (1.5%) exceeded the 8-h TWA action level of 85 dB(A) by the OSHA approach, and none of the flights exceeded the 8-h TWA action level of 90 dB(A) by the OSHA PEL approach. Additional characterization studies, including personal noise dosimetry, are necessary to document accurate occupational exposures in the aircraft cabin environment and identify appropriate response actions. FAA should consider applying the more health-protective NIOSH/ACGIH occupational noise recommendations to the aircraft cabin environment.
Madl, Amy K; Hollins, Dana M; Devlin, Kathryn D; Donovan, Ellen P; Dopart, Pamela J; Scott, Paul K; Perez, Angela L
2014-08-01
Exposures to airborne asbestos during the removal and installation of internal gaskets and packing associated with a valve overhaul were characterized and compared to published data according to different variables (e.g., product, equipment, task, tool, setting, duration). Personal breathing zone and area samples were collected during twelve events simulating gasket and packing replacement, clean-up and clothing handling. These samples were analyzed using PCM and TEM methods and PCM-equivalent (PCME) airborne asbestos concentrations were calculated. A meta-analysis was performed to compare these data with airborne asbestos concentrations measured in other studies involving gaskets and packing. Short-term mechanic and assistant airborne asbestos concentrations during valve work averaged 0.013f/cc and 0.008f/cc (PCME), respectively. Area samples averaged 0.008f/cc, 0.005f/cc, and 0.003f/cc (PCME) for center, bystander, and remote background, respectively. Assuming a tradesman conservatively performs 1-3 gasket and/or packing replacements daily, an average 8-h TWA was estimated to be 0.002-0.010f/cc (PCME). Combining these results in a meta-analysis of the published exposure data showed that the majority of airborne asbestos exposures during work with gaskets and packing fall within a consistent and low range. Significant differences in airborne concentrations were observed between power versus manual tools and removal versus installation tasks. Airborne asbestos concentrations resulting from gasket and packing work during a valve overhaul are consistent with historical exposure data on replacement of asbestos-containing gasket and packing materials involving multiple variables and, in nearly all plausible scenarios, result in average airborne asbestos concentrations below contemporaneous occupational exposure limits for asbestos. Copyright © 2014 Elsevier Inc. All rights reserved.
Gallastegi, Mara; Huss, Anke; Santa-Marina, Loreto; Aurrekoetxea, Juan J; Guxens, Mònica; Birks, Laura Ellen; Ibarluzea, Jesús; Guerra, David; Röösli, Martin; Jiménez-Zabala, Ana
2018-05-24
providing higher exposure estimates. Nevertheless, there were no systematic differences between those methodologies when classifying subjects into exposure categories. Personal measurements of total RF exposure showed low to moderate agreement with home and bedroom spot measurements and agreed better, though moderately, with TWA based on spot measurements in the main settings where children spend time (homes, schools and parks; Kappa = 0.46). Exposure assessment based on spot measurements could be a feasible proxy to rank personal RF exposure in children population, providing that all relevant locations are being measured. Copyright © 2018. Published by Elsevier Ltd.
Personal exposures to asbestos fibers during brake maintenance of passenger vehicles.
Cely-García, María Fernanda; Sánchez, Mauricio; Breysse, Patrick N; Ramos-Bonilla, Juan P
2012-11-01
Brake linings and brake pads are among the asbestos-containing products that are readily available in Colombia. When sold separated from their support, brake linings require extensive manipulation involving several steps that include drilling, countersinking, riveting, bonding, cutting, beveling, and grinding. Without this manipulation, brake linings cannot be installed in a vehicle. The manipulation process may release asbestos fibers, which may expose brake mechanics to the fibers. Three brake repair shops located in Bogotá (Colombia) were sampled for 3 or 4 consecutive days using US National Institute for Occupational Safety and Health (NIOSH) methods 7400 and 7402. Standard procedures for quality control were followed during the sampling process, and asbestos samples were analyzed by an American Industrial Hygiene Association accredited laboratory. Personal samples were collected to assess full-shift and short-term exposures. Area samples were also collected close to the brake-lining manipulation equipment and within office facilities. Activities were documented during the sampling process. Using Phase Contrast Microscopy Equivalent counts to estimate air asbestos concentrations, all personal samples [i.e. 8-h time-weighted averages (TWAs) and 30-min personal samples] were in compliance with the US Occupational Safety and Health Administration standards. Personal asbestos concentrations based on transmission electron microscopy counts were extremely high, ranging from 0.006 to 3.493 f cm(-3) for 8-h TWA and from 0.015 to 8.835 f cm(-3) for 30-min samples. All asbestos fibers detected were chrysotile. Cleaning facilities and grinding linings resulted in the highest asbestos exposures based on transmission electron microscopy counts. There were also some samples that did not comply with the NIOSH's recommended exposure limits. The results indicate that the brake mechanics sampled are exposed to extremely high asbestos concentrations (i.e. based on transmission
Janusek, D; Kania, M; Zaczek, R; Zavala-Fernandez, H; Maniewski, R
2014-04-01
The presence of T wave alternans (TWA) in the surface ECG signals has been recognized as a marker of electrical instability, and is hypothesized to be related to patients at increased risk for ventricular arrhythmias. In this paper we present a TWA simulation study. The TWA phenomenon was simulated by changing the duration of the ventricular heart cells action potential. The magnitude was calculated in the surface ECG with the use of the time domain method. The spatially concordant TWA, where during one heart beat all ventricular cells display a short-duration action potential and during the next beat they exhibit a long-duration action potential, as well as the discordant TWA, where at least one region is out of phase, was simulated. The vectocardiographic representation was employed. The obtained results showed a high level of T-loop pattern and location disturbances connected to the discordant TWA simulation in contrast to the concordant one. This result may be explained by the spatial heterogeneity of the ventricular repolarization process, which could be higher for the discordant TWA than for the concordant TWA. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Indian Academy of Sciences (India)
. TWA2 Surface chemical analysis Wide ranging reference materials, metallic UK and non-metallic. TWA3 Ceramics Alumina, zirconia-alumina USA. TWA4 Polymer blends Polycarbonate/polyethylene blend, Canada. Orgalloy R-6000 ...
New Parallaxes and a Convergence Analysis for the TW Hya Association
Donaldson, J. K.; Weinberger, A. J.; Gagné, J.; Faherty, J. K.; Boss, A. P.; Keiser, S. A.
2016-12-01
The TW Hya Association (TWA) is a nearby stellar association with an age of ˜5-10 Myr. This is an important age for studying the late stages of star and planet formation. We measure the parallaxes of 14 candidate members of TWA. That brings to 38 the total number of individual stars with fully measured kinematics, I.e., proper motion, radial velocity, and parallax, to describe their motions through the Galaxy. We analyze these kinematics to search for convergence to a smaller volume in the past, but we find that the association is never much more compact than it is at present. We show that it is difficult to measure traceback ages for associations such as TWA that have expected velocity dispersions of 1-2 km s-1 with typical measurement uncertainties. We also use our stellar distances and pre-main-sequence evolutionary tracks to find the average age of the association of 7.9 ± 1.0 Myr. Additionally, our parallax measurement of TWA 32 indicates that it should be considered a bona fide member of TWA. Two new candidate members have high membership probabilities, and we assign them TWA numbers: TWA 45 for 2MASS J11592786-4510192 and TWA 46 for 2MASS J12354615-4115531.
1983-07-01
distances using TLV on these models requires conversion from concentration to dosage. The TWA (time weighted averae) for healthy adult humans exposed to oil...diseases. Chronic industrial exposures of oils and oil mists have been implicated in causing dermatosis (SGF No. 1) and dermatosis plus tumors of skin...mg/I No. 2 2-Day LCo Is Quahaug larvae fuel oil dissolved in water Exposure to 0.53 mg/l No. 10-Day LCo0 2 fuel oil dissolved in water Young adult
Effects of exposure to ethylene glycol ethers on shipyard painters: II. Male reproduction.
Welch, L S; Schrader, S M; Turner, T W; Cullen, M R
1988-01-01
To determine whether 2-ethoxyethanol (2-EE) and 2-methoxyethanol (2-ME) affected the reproductive potential of exposed men, we examined the semen of 73 painters and 40 controls who work in a large shipyard. An industrial hygiene survey was performed to characterize the work environment. The men supplied information on demographic characteristics, medical conditions, personal habits, and reproductive history; underwent a physical examination; and provided a semen sample. Semen samples were analyzed for pH, volume, turbidity, liquidity, viability by stain exclusion and hypo-osmotic stress, sperm density and count per ejaculate, motility using a videotape technique, morphology, and morphometry. Serum was analyzed for testosterone, FSH, and LH. The industrial hygiene survey revealed that the painters were exposed to 2-EE at a time-weighted average (TWA) of 0-80.5 mg/m3 with a mean of 9.9 mg/m3, and to 2-ME at a TWA of 0-17.7 mg/m3 with a mean of 2.6 mg/m3. Painters had an increased prevalence of oligospermia and azoospermia and an increased odds ratio for a lower sperm count per ejaculate, while smoking was controlled. This finding is consistent with prior animal studies and with one human study. Potential biases and confounding of the data are discussed.
Energy Technology Data Exchange (ETDEWEB)
Kucera, Paul A.; Johnson, David B. (Nez Perce Tribe, Lapwai, ID)
1986-08-01
A biological and physical inventory of selected tributaries in the lower Clearwater River basin was conducted to collect information for the development of alternatives and recommendations for the enhancement of the anadromous fish resources in streams on the Nez Perce Reservation. Five streams within the Reservation were selected for study: Bedrock and Cottonwood Creeks were investigated over a two year period (1983 to 1984) and Big Canyon, Jacks and Mission Creeks were studied for one year (1983). Biological information was collected and analyzed on the density, biomass, production and outmigration of juvenile summer steelhead trout. Physical habitat information was collected on available instream cover, stream discharge, stream velocity, water temperature, bottom substrate, embeddedness and stream width and depth. The report focuses on the relationships between physical stream habitat and juvenile steelhead trout abundance.
Directory of Open Access Journals (Sweden)
Lúcia Macedo
2012-03-01
Full Text Available Objetivo: avaliar as perceções parentais sobre estado nutricional, imagem corporal e saúde nas crianças que frequentam o 1º ciclo do ensino básico. Material e métodos: foi avaliado o IMC e a perceção dos pais sobre a imagem corporal e saúde dos seus filhos, por questionários enviados a todos os pais das crianças matriculadas nas escolas pertencentes aos Agrupamentos Vertical de Anes de Cernache e de Vila d’Este, do Concelho de Vila Nova de Gaia, no início do ano letivo 2008/2009 (n=936 e incluídas 532 crianças e pais que aderiram (57% da população amostral. As perceções parentais foram comparadas com o percentil de IMC da criança para avaliar eventuais discrepâncias. Trata-se de um estudo descritivo-correlacional. Resultados: verificou-se que 49.9% dos pais apresentaram uma distorção da perceção relativamente ao estado nutricional e 37.9% relativamente à imagem corporal. Constatou-se que apenas a idade da criança tinha relação com a perceção parental sobre a imagem corporal. Os pais referiram ter “boa” perceção de saúde. Conclusão: estes resultados são congruentes com outros na área e alertam os profissionais para a necessidade de uma intervenção mais efetiva na educação para a saúde para prevenir e detetar precocemente casos de crianças em risco de se tornarem obesas.Objetivo: evaluar las percepciones de los padres sobre el estado nutricional, la imagen corporal, la salud de los niños que asisten al 1 º ciclo de la educación básica. Métodos: se evaluaron el IMC y la percepción de los padres sobre la imagen corporal y la salud de sus hijos por medio de cuestionarios, enviados a todos los padres de los niños matriculados en las escuelas pertenecientes a los “Agrupamentos Vertical” de Anes de Cernache y de Vila d’Este, del municipio de Vila Nova de Gaia, al inicio del curso 2008/2009 (n = 936 e incluyó a 532 niños y padres que a él adhirieron (57% de la población de muestreo. Las
Indoor tetrachloroethylene levels and determinants in Paris dwellings.
Roda, Célina; Kousignian, Isabelle; Ramond, Anna; Momas, Isabelle
2013-01-01
There is growing public health concern about indoor air quality. Tetrachloroethylene (PERC), a chlorinated volatile organic compound widely used as a solvent in dry cleaning facilities, can be a residential indoor air pollutant. As part of an environmental investigation included in the PARIS (Pollution and asthma Risk: an Infant Study) birth cohort, this study firstly aimed to document domestic PERC levels, and then to identify the factors influencing these levels using standardized questionnaires about housing characteristics and living conditions. Air samples were collected in the child's bedroom over one week using passive devices when infants were 1, 6, 9, and 12 months. PERC was identified and quantified by gas chromatography/mass spectrometry. PERC annual domestic level was calculated by averaging seasonal levels. PERC was omnipresent indoors, annual levels ranged from 0.6 to 124.2 μg/m3. Multivariate linear and logistic regression models showed that proximity to dry cleaning facilities, do-it-yourself activities (e.g.: photographic development, silverware), presence of air vents, and building construction date (<1945) were responsible for higher domestic levels of PERC. This study, conducted in an urban context, provides helpful information on PERC contamination in dwellings, and identifies parameters influencing this contamination. Copyright © 2012 Elsevier Inc. All rights reserved.
Chronic psychological effects of exposure to mercury vapour among chlorine-alkali plant workers.
Pranjić, N; Sinanović, O; Jakubović, R
2003-01-01
Quantitative assessment of nervous system function is essential in characterising the nature and extent of impairment in individuals experiencing symptoms following work-place mercury vapour exposure. The purpose of this study was the application of standardised tests of behavioural, psychomotor and memory function to understand the neuropsychological effects of mercury in occupationally exposed chlorine-alkali plant workers. The study comprised 45 workers at a chlorine-alkali plant with the mean age of 39.36 +/- 5.94 years, who had been exposed to daily inhalation of mercury vapour over long-term employment of 16.06 +/- 4.29 years. The cumulative mercury index was 155.32 +/- 95.02 micrograms/g creatinine, the mean of urinary mercury concentrations on the first day of the study was 119.50 +/- 157.24 micrograms/g creatinine, and the mean of urinary mercury concentrations 120 days after cessation of exposure was 21.70 +/- 26.07 micrograms/g creatinine. The analysis included tests of behavioural, psychomotor and memory function. The behavioural test battery consisted of: Environmental Worry Scale (EWS), Minnesota Modified Personal Inventory (MMPI-2), Purdue standard 25 minute test, and adapted, 10 minutes test, Bender's Visual-Motor Gestalt test (BGT), and Eysenck Personality Inventory (EPQ). The data were compared to a control group of 32 not directly exposed workers. In the mercury vapour exposed workers with relatively high level exposure to inorganic mercury vapour (TWA/TLV = 0.12 mg/m3/0.025 mg/m3) we identified somatic depression-hypochondria symptoms with higher scores for scales: hysteria (P introvert behaviour (EPQ, MMPI-2). The cognitive disturbances in mercury-exposed workers were identified as: concentration difficulty, psychomotor, perceptual and motor coordination disturbances, and brain effects. We identified fine tremor of the hands in 34 out of 45 mercury-exposed workers (BGT). The results point to a relationship between the duration of mercury
Cunha, Catarina Gradíssimo Dias da
2012-01-01
Dissertação de mestrado integrado em Psicologia (área de especialização em Psicologia Clínica) Esta dissertação constitui-se como um estudo exploratório e descritivo da perceção que os/as psicoterapeutas, com experiência de acompanhamento de casos de Disfunção Erétil, têm acerca do impacto que os estereótipos de género e o funcionamento das relações íntimas têm nas vivências desta disfunção. Para tal, realizaram-se entrevistas semiestruturadas a 9 psicoterapeutas (psicólogos/as...
Freund, Yonathan; Cachanado, Marine; Aubry, Adeline; Orsini, Charlotte; Raynal, Pierre-Alexis; Féral-Pierssens, Anne-Laure; Charpentier, Sandrine; Dumas, Florence; Baarir, Nacera; Truchot, Jennifer; Desmettre, Thibaut; Tazarourte, Karim; Beaune, Sebastien; Leleu, Agathe; Khellaf, Mehdi; Wargon, Mathias; Bloom, Ben; Rousseau, Alexandra; Simon, Tabassome; Riou, Bruno
2018-02-13
The safety of the pulmonary embolism rule-out criteria (PERC), an 8-item block of clinical criteria aimed at ruling out pulmonary embolism (PE), has not been assessed in a randomized clinical trial. To prospectively validate the safety of a PERC-based strategy to rule out PE. A crossover cluster-randomized clinical noninferiority trial in 14 emergency departments in France. Patients with a low gestalt clinical probability of PE were included from August 2015 to September 2016, and followed up until December 2016. Each center was randomized for the sequence of intervention periods. In the PERC period, the diagnosis of PE was excluded with no further testing if all 8 items of the PERC rule were negative. The primary end point was the occurrence of a thromboembolic event during the 3-month follow-up period that was not initially diagnosed. The noninferiority margin was set at 1.5%. Secondary end points included the rate of computed tomographic pulmonary angiography (CTPA), median length of stay in the emergency department, and rate of hospital admission. Among 1916 patients who were cluster-randomized (mean age 44 years, 980 [51%] women), 962 were assigned to the PERC group and 954 were assigned to the control group. A total of 1749 patients completed the trial. A PE was diagnosed at initial presentation in 26 patients in the control group (2.7%) vs 14 (1.5%) in the PERC group (difference, 1.3% [95% CI, -0.1% to 2.7%]; P = .052). One PE (0.1%) was diagnosed during follow-up in the PERC group vs none in the control group (difference, 0.1% [95% CI, -∞ to 0.8%]). The proportion of patients undergoing CTPA in the PERC group vs control group was 13% vs 23% (difference, -10% [95% CI, -13% to -6%]; P < .001). In the PERC group, rates were significantly reduced for the median length of emergency department stay (mean reduction, 36 minutes [95% CI, 4 to 68]) and hospital admission (difference, 3.3% [95% CI, 0.1% to 6.6%]). Among very low-risk patients with suspected
Benzene exposure in the shoemaking industry in China, a literature survey, 1978-2004.
Wang, Laiming; Zhou, Yimei; Liang, Youxin; Wong, Otto; Armstrong, Thomas; Schnatter, A Robert; Wu, Qiangen; Fang, Jinbin; Ye, Xibiao; Fu, Hua; Irons, Richard D
2006-11-01
This article presents a summary of benzene exposure levels in the shoemaking industry in China reported in the Chinese medical literature between 1978 and 2004. A comprehensive search identified 182 papers reporting such exposure data. These papers could be classified into two categories: benzene poisoning case reports and industrial hygiene surveys. From each paper, the following information was abstracted whenever available: location and year of occurrence, occupation and/or task involved, benzene content in adhesives/solvents, work environment, working conditions, working hours, diagnosis, and air monitoring data of benzene. A total of 333 benzene measurements (88 averages, 116 minimums, 129 maximums) in the shoemaking industry were reported in the 182 papers identified. The data were analyzed in terms of geographical location, time period, type of ownership (state, township, or foreign), type of report (benzene poisoning reports vs. industrial hygiene surveys), and job title (work activity) or process. The reported data covered a wide range; some measurements were in excess of 4500 mg/m(3). Thirty-five percent of the reported benzene concentrations were below 40 mg/m(3), which was the national occupational exposure limit (OEL) for benzene between 1979 and 2001. The remaining 65% measurements, which exceeded the national OEL in effect at the time, and were distributed as follows: 40-100 mg/m(3), 11%; 100-300 mg/m(3), 21%; 300-500 mg/m(3), 13%; and 500+ mg/m(3), 20%. However, only 24% of the reported measurements after 2002 were below 6 mg/m(3), i.e., Permissible Concentration-Time Weighted Average (PC-TWA) and 10 mg/m(3), i.e., Permissible Concentration-Short Term Exposure Limit (PC-STEL), the newly amended benzene OELs in effect after May 2002. The data demonstrated that the majority of the facilities in the shoemaking industry reported in the literature were not in compliance of the OEL for benzene in effect at the time. Overall, the data show a clear downward
Knudsen, Nikoline N; Schullehner, Jörg; Hansen, Birgitte; Jørgensen, Lisbeth F; Kristiansen, Søren M; Voutchkova, Denitza D; Gerds, Thomas A; Andersen, Per K; Bihrmann, Kristine; Grønbæk, Morten; Kessing, Lars V; Ersbøll, Annette K
2017-06-10
Suicide is a major public health concern. High-dose lithium is used to stabilize mood and prevent suicide in patients with affective disorders. Lithium occurs naturally in drinking water worldwide in much lower doses, but with large geographical variation. Several studies conducted at an aggregate level have suggested an association between lithium in drinking water and a reduced risk of suicide; however, a causal relation is uncertain. Individual-level register-based data on the entire Danish adult population (3.7 million individuals) from 1991 to 2012 were linked with a moving five-year time-weighted average (TWA) lithium exposure level from drinking water hypothesizing an inverse relationship. The mean lithium level was 11.6 μg/L ranging from 0.6 to 30.7 μg/L. The suicide rate decreased from 29.7 per 100,000 person-years at risk in 1991 to 18.4 per 100,000 person-years in 2012. We found no significant indication of an association between increasing five-year TWA lithium exposure level and decreasing suicide rate. The comprehensiveness of using individual-level data and spatial analyses with 22 years of follow-up makes a pronounced contribution to previous findings. Our findings demonstrate that there does not seem to be a protective effect of exposure to lithium on the incidence of suicide with levels below 31 μg/L in drinking water.
Series Resistance Analysis of Passivated Emitter Rear Contact Cells Patterned Using Inkjet Printing
Directory of Open Access Journals (Sweden)
Martha A. T. Lenio
2012-01-01
Full Text Available For higher-efficiency solar cell structures, such as the Passivated Emitter Rear Contact (PERC cells, to be fabricated in a manufacturing environment, potentially low-cost techniques such as inkjet printing and metal plating are desirable. A common problem that is experienced when fabricating PERC cells is low fill factors due to high series resistance. This paper identifies and attempts to quantify sources of series resistance in inkjet-patterned PERC cells that employ electroless or light-induced nickel-plating techniques followed by copper light-induced plating. Photoluminescence imaging is used to determine locations of series resistance losses in these inkjet-patterned and plated PERC cells.
Evaluation of occupational exposure to toxic metals released in the process of aluminum welding.
Matczak, Wanda; Gromiec, Jan
2002-04-01
The objective of this study was to evaluate occupational exposure to welding fumes and its elements on aluminum welders in Polish industry. The study included 52 MIG/Al fume samples and 18 TIG/Al samples in 3 plants. Air samples were collected in the breathing zone of welders (total and respirable dust). Dust concentration was determined gravimetrically, and the elements in the collected dust were determined by AAS. Mean time-weighted average (TWA) concentrations of the welding dusts/fumes and their components in the breathing zone obtained for different welding processes were, in mg/m3: MIG/Al fumes mean 6.0 (0.8-17.8), Al 2.1 (0.1-7.7), Mg 0.2 (TIG/Al fumes 0.7 (0.3-1.4), Al 0.17 (0.07-0.50). A correlation has been found between the concentration of the main components and the fume/dust concentrations in MIG/Al and TIG/Al fumes. Mean percentages of the individual components in MIG/Al fumes/dusts were Al: 30 (9-56) percent; Mg: 3 (1-5.6) percent; Mn: 0.2 (0.1-0.3) percent; Cu: 0.2 (welding methods, the nature of welding-related operations, and work environment conditions.
Suggestions To Evaluate Whether T-wave Alternans Is T-wave Amplitude Dependent
Directory of Open Access Journals (Sweden)
John E. Madias
2009-03-01
Full Text Available -wave alternans (TWA has been employed in the selection of patients considered for cardioverter/defibrillator (ICD implantation, and has been found to have an excellent negative predictive value for sudden death and malignant ventricular arrhythmias in patients with a variety of cardiac pathologies [1]. Although a qualitative approach in the characterization of patients with TWA positive or negative results has prevailed, based on a threshold of ≥1.9 μV, attained during exercise stress testing, employing the frequency domain analysis [2], some have advanced the argument that employment of TWA in quantitative terms may have advantages [3,4]. Indeed even the currently employed qualitative (yes or no spectral analysis method with the ≥1.9 μV threshold value has a quantitative underpinning, in the sense that non attainment of the threshold value of ≥1.9 μV renders the patient's test negative [2]. Intuitively the magnitude of TWA must be of importance not only because a particular threshold needs to be reached, before the patient is considered positive, but because pathophysiological derangements (e.g., ischemia, volume overload, or myocardial necrosis result in an increase of the magnitude of TWA or an association of the magnitude of the TWA and the severity of derangement [5-7], while therapeutic interventions (e.g. beta-blockers lead to a decrease in the magnitude of TWA [8].
Improving couples' quality of life through a Web-based prostate cancer education intervention.
Song, Lixin; Rini, Christine; Deal, Allison M; Nielsen, Matthew E; Chang, Hao; Kinneer, Patty; Teal, Randall; Johnson, David C; Dunn, Mary W; Mark, Barbara; Palmer, Mary H
2015-03-01
To evaluate the feasibility and acceptability of a newly developed web-based, couple-oriented intervention called Prostate Cancer Education and Resources for Couples (PERC). Quantitative, qualitative, mixed-methods approach. Oncology outpatient clinics at the University of North Carolina (UNC) Lineberger Comprehensive Cancer Center at UNC–Chapel Hill. 26 patients with localized prostate cancer (PCa) and their partners. Pre- and postpilot quantitative assessments and a postpilot qualitative interview were conducted. General and PCa-specific symptoms, quality of life, psychosocial factors, PERC’s ease of use, and web activities. Improvement was shown in some PCa-specific and general symptoms (small effect sizes for patients and small-to-medium effect sizes for partners), overall quality of life, and physical and social domains of quality of life for patients (small effect sizes). Web activity data indicated high PERC use. Qualitative and quantitative analyses indicated that participants found PERC easy to use and understand,as well as engaging, of high quality, and relevant. Overall, participants were satisfied with PERC and reported that PERC improved their knowledge about symptom management and communication as a couple. PERC was a feasible, acceptable method of reducing the side effects of PCa treatment–related symptoms and improving quality of life. PERC has the potential to reduce the negative impacts of symptoms and enhance quality of life for patients with localized PCa and their partners, particularly for those who live in rural areas and have limited access to post-treatment supportive care.
A Origem dos Maus-Tratos: Revisão Sobre a Evolução Histórica das Perceções de Criança e Maus-Tratos
Directory of Open Access Journals (Sweden)
Raquel V. Oliveira
2014-03-01
Full Text Available ObjetivoNeste trabalho elabora-se, com base em revisão bibliográfica, a evolução histórica das perceções acerca de maus-tratos e de criança. Começa-se por abordar o constructo de maus-tratos, passando seguidamente pela Antiguidade e Idade Média, onde as crianças eram sujeitas a constantes maus-tratos, sendo prevalentes os maus-tratos físicos, abuso sexual e o trabalho infantil, progredindo até à Idade Moderna, onde a criança passa a ser vista como um ser com características particulares e merecedor de cuidados especiais. Aborda-se de forma breve as tipologias de maus-tratos na atualidade e as variações culturais.ConclusãoTorna-se fulcral compreender o impacto que os maus-tratos têm vindo ao longo da histórico e que continuam a ter na atualidade, sendo fundamental a considerar estes aspetos nas intervenções a serem desenvolvidas nesta área, tendo em particular consideração o amplo leque de variações culturais cada vez mais presentes e evidentes.
T wave alternans threshold late after repair of tetralogy of Fallot
Cheung, Michael M H.; Weintraub, Robert G.; Cohen, Richard J.; Karl, Tom R.; Wilkinson, James L.; Davis, Andrew M.
2002-01-01
INTRODUCTION: Sustained microvolt-level T wave alternans (TWA) is a marker of increased risk for malignant ventricular arrhythmia. There is a significant risk of arrhythmia and sudden death after repair of congenital heart disease. The aim of this study was to determine the prevalence and characteristics of TWA after repair of tetralogy of Fallot (TOF). METHODS AND RESULTS: TWA was evaluated during bicycle exercise in 49 subjects who had consecutively undergone transatrial-transpulmonary repair. Median values for age, age at repair, and follow-up duration were 14.9 years (11.5-20.8), 1.6 years (0.2-4.9), and 11.6 years (9.4-17.2), respectively. All patients were in New York Heart Association functional class I and were asymptomatic. Median QRS duration was 120 msec (80-150). Sustained TWA was detected in 7 (23%) of 31 subjects with adequate tests. In these 7 subjects, median onset heart rate (HR) was 120 (98-155). Median HR threshold as a percentage of predicted maximum HR (220 - age) was 58% (48-77). Sustained TWA prevalence was not significantly different compared with normal subjects (7/31 vs 9/83; P = 0.1). Onset HR in the TOF group was significantly lower [mean (SD) of 122 (20) vs 139 (12), P < 0.05]. In the TOF group with sustained TWA, the TWA occurred in 4 of 7 at <60% predicted maximum HR versus 1 of 9 normal subjects (P < 0.05); 3 of 7 had onset HR <120 versus 0 of 9 normal subjects (P < 0.03). There was no significant difference in age, gender, transannular patch use, restrictive right ventricular physiology, QRS duration, QTc, QT/QRS dispersion, or nonsustained ventricular tachycardia in subjects with or those without sustained TWA. CONCLUSION: The onset HR for sustained TWA is significantly lower after repair of TOF. Further study is required to determine whether this represents an increased risk for arrhythmia in this patient group.
Shusterman, Vladimir; McTiernan, Charles F; Goldberg, Anna; Saba, Samir; Salama, Guy; London, Barry
2010-02-01
T-wave alternans (TWA) is a proarrhythmic repolarization instability that is common in congestive heart failure (CHF). Although transgenic mice are commonly used to study the mechanisms of arrhythmogenesis in CHF, little is known about the dynamics of TWA in these species. We hypothesized that TWA is present in a TNF-alpha model of CHF and can be further promoted by adrenergic stimulation. We studied 16 TNF-alpha mice and 12 FVB controls using 1) in vivo intracardiac electrophysiological testing and 2) ambulatory telemetry during 30 min before and after an intraperitoneal injection of isoproterenol. TWA was examined using both linear and nonlinear filtering applied in the time domain. In addition, changes in the mean amplitude of the T wave and area under the T wave were computed. During intracardiac electrophysiological testing, none of the animals had TWA or inducible arrhythmias before the injection of isoproterenol. After the injection, sustained TWA and inducible ventricular tachyarrhythmias were observed in TNF-alpha mice but not in FVB mice. In ambulatory telemetry, before the isoproterenol injection, the cardiac cycle length (CL) was longer in TNF-alpha mice than in FVB mice (98 +/- 9 and 88 +/- 3 ms, P = 0.04). After the injection of isoproterenol, the CL became 8% and 6% shorter in TNF-alpha and FVB mice (P mice, the magnitude of TWA was 1.5-2 times greater than in FVB mice both before and after the isoproterenol injection. The magnitude of TWA increased significantly after the isoproterenol injection compared with the baseline in TNF-alpha mice (P = 0.003) but not in FVB mice. The mean amplitude of the T wave and area under the T wave increased 60% and 80% in FVB mice (P = 0.006 and 0.009) but not in TNF-alpha mice. In conclusion, TWA is present in a TNF-alpha model of CHF and can be further promoted by adrenergic stimulation, along with the enhanced susceptibility for ventricular arrhythmias.
Compact Single-Layer Traveling-Wave Antenna DesignUsing Metamaterial Transmission Lines
Alibakhshikenari, Mohammad; Virdee, Bal Singh; Limiti, Ernesto
2017-12-01
This paper presents a single-layer traveling-wave antenna (TWA) that is based on composite right/left-handed (CRLH)-metamaterial (MTM) transmission line (TL) structure, which is implemented by using a combination of interdigital capacitors and dual-spiral inductive slots. By embedding dual-spiral inductive slots inside the CRLH MTM-TL results in a compact TWA. Dimensions of the proposed CRLH MTM-TL TWA is 21.5 × 30.0 mm2 or 0.372λ0 × 0.520λ0 at 5.2 GHz (center frequency). The fabricated TWA operates over 1.8-8.6 GHz with a fractional bandwidth greater than 120%, and it exhibits a peak gain and radiation efficiency of 4.2 dBi and 81%, respectively, at 5 GHz. By avoiding the use of lumped components, via-holes or defected ground structures, the proposed TWA design is economic for mass production as well as easy to integrate with wireless communication systems.
IDENTIFYING NEARBY, YOUNG, LATE-TYPE STARS BY MEANS OF THEIR CIRCUMSTELLAR DISKS
International Nuclear Information System (INIS)
Schneider, Adam; Song, Inseok; Melis, Carl; Zuckerman, B.; Bessell, Mike
2012-01-01
It has recently been shown that a significant fraction of late-type members of nearby, very young associations (age ∼<10 Myr) display excess emission at mid-IR wavelengths indicative of dusty circumstellar disks. We demonstrate that the detection of mid-IR excess emission can be utilized to identify new nearby, young, late-type stars including two definite new members ('TWA 33' and 'TWA 34') of the TW Hydrae Association (TWA). Both new TWA members display mid-IR excess emission in the Wide-field Infrared Survey Explorer catalog and they show proper motion and youthful spectroscopic characteristics—namely, Hα emission, strong lithium absorption, and low surface gravity features consistent with known TWA members. We also detect mid-IR excess—the first unambiguous evidence of a dusty circumstellar disk—around a previously identified UV-bright, young, accreting star (2M1337) that is a likely member of the Lower-Centaurus Crux region of the Scorpius-Centaurus Complex.
Verrier, Richard L; Nearing, Bruce D; Ghanem, Raja N; Olson, Rachel E; Garberich, Ross F; Katsiyiannis, William T; Gornick, Charles C; Tang, Chuen Y; Henry, Timothy D
2013-06-01
Successful reperfusion with primary percutaneous coronary intervention (PCI) can paradoxically elicit temporary vulnerability to ventricular arrhythmia. We examined whether T-wave alternans (TWA) level is correlated with nonsustained ventricular tachycardia (NSVT) incidence in association with PCI in patients with acute ST-segment elevation myocardial infarction (STEMI). We analyzed continuous 24-hour ambulatory electrocardiograms in 48 STEMI patients during and after successful primary PCI, achieving Thrombolysis in Myocardial Infarction (TIMI) grade 3 flow. TWA was measured using modified moving average method. Maximum TWA was elevated in patients with (N = 22) compared to without (N = 26) NSVT (75.1 ± 6.3 vs 49.9 ± 3.6 μV, P < 0.005) during the 22-hour monitoring period. TWA ≥ 60μV predicted NSVT with sensitivity of 77%; specificity, 73%; positive predictive value, 71%; and negative predictive value, 79%. Area under receiver operator characteristic curve (AUC) was 0.87 for maximum TWA in predicting NSVT. By comparison, ST-segment levels did not differ in patients with versus without NSVT and were not predictive (AUC = 0.52). TWA was elevated prior to PCI and remained elevated at 30 minutes after balloon inflation despite restoration of TIMI grade 3 flow in all patients, declining by 22 hours (P < 0.05). Maximum ST-segment levels decreased from before PCI to 30 minutes after balloon inflation. TWA is regionally specific, with higher values prior to PCI in precordial lead V5 than in V1 for left coronary lesions. TWA may be useful in identifying individuals at heightened risk for arrhythmia in association with primary PCI and can potentially signal time-dependent changes in arrhythmia vulnerability. © 2013 Wiley Periodicals, Inc.
A Gaia DR2 Confirmation that 2MASS J12074836–3900043 is a Member of the TW HYA Association
Gagné, Jonathan; Gonzales, Eileen C.; Faherty, Jacqueline K.
2018-05-01
We use new data from Gaia DR2 to confirm that the young L1 $\\gamma$ candidate member of the TW Hya association (TWA) is now a bona fide member with a model-dependent mass estimate of ~15 $M_{Jup}$. The ambiguous M9 $\\gamma$ candidate member 2MASS J12474428---3816464 also gets a higher Bayesian membership probability for TWA membership as a result of Gaia DR2 data and a new radial velocity measurement, but it remains unclear whether it is a true member of TWA or if it is an unrelated young interloper, because it is separated by 4.6 km/s from the locus of TWA members in UVW space.
Directory of Open Access Journals (Sweden)
Alexandra dos Anjos Cassado
Full Text Available The peritoneal cavity (PerC is a singular compartment where many cell populations reside and interact. Despite the widely adopted experimental approach of intraperitoneal (i.p. inoculation, little is known about the behavior of the different cell populations within the PerC. To evaluate the dynamics of peritoneal macrophage (MØ subsets, namely small peritoneal MØ (SPM and large peritoneal MØ (LPM, in response to infectious stimuli, C57BL/6 mice were injected i.p. with zymosan or Trypanosoma cruzi. These conditions resulted in the marked modification of the PerC myelo-monocytic compartment characterized by the disappearance of LPM and the accumulation of SPM and monocytes. In parallel, adherent cells isolated from stimulated PerC displayed reduced staining for β-galactosidase, a biomarker for senescence. Further, the adherent cells showed increased nitric oxide (NO and higher frequency of IL-12-producing cells in response to subsequent LPS and IFN-γ stimulation. Among myelo-monocytic cells, SPM rather than LPM or monocytes, appear to be the central effectors of the activated PerC; they display higher phagocytic activity and are the main source of IL-12. Thus, our data provide a first demonstration of the consequences of the dynamics between peritoneal MØ subpopulations by showing that substitution of LPM by a robust SPM and monocytes in response to infectious stimuli greatly improves PerC effector activity.
International Nuclear Information System (INIS)
Martín-Yebra, A; Caiani, E G; Pellegrini, A; Monasterio, V; Laguna, P; Martínez, J P
2015-01-01
It is well known that prolonged microgravity leads to cardiovascular deconditioning, inducing significant changes in autonomic control of the cardiovascular system. This may adversely influence cardiac repolarization, and provoke cardiac rhythm disturbances. T-wave alternans (TWA), reflecting temporal and spatial repolarization heterogeneity, could be affected. The aim of this work was to test the hypothesis that 5 d and 21 d head-down (−6°) bed rest (HDBR) increases TWA, thus suggesting a higher underlying electrical instability and related arrhythmogenic risk.Forty-four healthy male volunteers were enrolled in the experiments as part of the European Space Agency’s HDBR studies. High-fidelity ECG was recorded during orthostatic tolerance (OT) and aerobic power (AP) tests, before (PRE) and after HDBR (POST). A multilead scheme for TWA amplitude estimation was used, where non-normalized and T-wave amplitude normalized TWA indices were computed. In addition, spectral analysis of heart rate variability during OT was assessed.Both 5 d and 21 d HDBR induced a reduction in orthostatic tolerance time (OTT), as well as a decrease in maximal oxygen uptake and reserve capacity, thus suggesting cardiovascular deconditioning. However, TWA indices were found not to increase. Interestingly, subjects with lower OTT after 5 d HDBR also showed higher TWA during recovery after OT testing, associated with unbalanced sympathovagal response, even before the HDBR. In contrast with previous observations, augmented ventricular heterogeneity related to 5 d and 21 d HDBR was not sufficient to increase TWA under stress conditions. (paper)
Directory of Open Access Journals (Sweden)
Raquel Batista de Oliveira
2017-12-01
Full Text Available Data de submissão: 30-10-2017 Data de Aceitação: 22-12-2017Este estudo insere-se na temática da inclusão de alunos com Necessidades Educativas Especiais (NEE nas escolas da Região Centro em Portugal Continental, tendo como objetivo conhecer as perceções dos diferentes atores sobre as práticas inclusivas de alunos com Necessidades Educativas Especiais nas escolas portuguesas com base no Decreto-Lei 3/2008. Neste sentido, procedeu-se a entrevista semiestruturada direcionada para professores da Educação Especial, professores do Ensino Regular, equipa técnico pedagógica, utilizando a técnica análise de conteúdo para as análises dos dados onde pode-se obter alguns resultados. Os resultados desta investigação revelam que no que se refere as perceções dos diferentes atores educativos face à práticas de colaboração, que há alguma convergência nas respostas destes atores, no entanto, emergem algumas divergências nas respostas destes no que se refere a presença dos recursos humanos e materiais, bem como o seu reconhecimento face utilização destes recursos no espaço escolar. Os resultados também revelam que há diferentes respostas dos participantes face a perceção sobre as práticas de colaboração o que remete a necessidade de um maior fortalecimento entre as culturas de escola que visem o desenvolvimento coeso entre todos os agentes educativos no tocante às práticas de colaboração desenvolvidas neste espaço.Collaboration practices for inclusion of students with special educational needs in Portuguese schools: Teacher perceptions and pedagogical technical teamThis study expands upon the theme of inclusion of students with special needs educational (ENE in schools of the Região Centro in Portugal Continental. It aims to know different practitioners’ perceptions of inclusion practices of pupils with special needs educational in Portuguese schools based on the Decree-Law 3/2008. In this respect, semi
Review of health risks in acrylonitrile industry
Energy Technology Data Exchange (ETDEWEB)
Guirguis, S S; Cohen, M B; Rajhans, G S
1984-05-01
The Occupational Health Branch of the Ontario Ministry of Labour began a study in 1978 for the evaluation of health risks associated with acrylonitrile (AN) exposure. Detailed hygiene and medical investigations were conducted in fourteen plants for evaluating AN exposure in various industrial processes. For companies were also studied in relation to mixed chemical exposure representing acrylic fibres, nitrile rubber, ABS-resin, and acrylic emulsions production. The possible interaction between AN and other coexisting chemical exposures was reviewed since dimethyl formamide, styrene, and butadiene have similar pharmacokinetics and possible synergistic effects. Exposure in acrylic fibre production may be synergistic and carcinogenic. Results of air monitoring indicated exposure levels to AN below 2 ppm (TWA) in most cases. Exposure to other co-existing chemicals was evaluated. Results of medical tests indicated no significant abnormalities in chest x-rays or liver function tests in currently exposed workers.
Yuan, Lu; LeBlanc, James
1998-01-01
This thesis investigates the effects of the High Power Amplifier (HPA) and the filters over a satellite or telemetry channel. The Volterra series expression is presented for the nonlinear channel with memory, and the algorithm is based on the finite-state machine model. A RAM-based algorithm operating on the receiver side, Pre-cursor Enhanced RAM-FSE Canceler (PERC) is developed. A high order modulation scheme , 16-QAM is used for simulation, the results show that PERC provides an efficient and reliable method to transmit data on the bandlimited nonlinear channel. The contribution of PERC algorithm is that it includes both pre-cursors and post-cursors as the RAM address lines, and suggests a new way to make decision on the pre-addresses. Compared with the RAM-DFE structure that only includes post- addresses, the BER versus Eb/NO performance of PERC is substantially enhanced. Experiments are performed for PERC algorithms with different parameters on AWGN channels, and the results are compared and analyzed. The investigation of this thesis includes software simulation and hardware verification. Hardware is setup to collect actual TWT data. Simulation on both the software-generated data and the real-world data are performed. Practical limitations are considered for the hardware collected data. Simulation results verified the reliability of the PERC algorithm. This work was conducted at NMSU in the Center for Space Telemetering and Telecommunications Systems in the Klipsch School of Electrical and Computer Engineering Department.
Advantages of traveling wave resonant antennas for fast wave heating systems
International Nuclear Information System (INIS)
Phelps, D.A.; Callis, R.W.; Grassie, J.S. de
1997-04-01
The resilience of a maximally flat externally coupled traveling wave antenna (TWA) is contrasted with the sensitivity of a simple directly driven resonant loop array to vacuum and plasma conditions in DIII-D. We find a unique synergy between standing and traveling wave resonant TWA components. This synergy extends TWA operation to several passbands between 60 and 120 MHZ, provides 60 degrees- 120 degrees tunability between elements within a 1-2 MHZ bandwidth and permits efficient and continuous operation during ELMing H-mode
A Non-Parametric Surrogate-based Test of Significance for T-Wave Alternans Detection
Nemati, Shamim; Abdala, Omar; Bazán, Violeta; Yim-Yeh, Susie; Malhotra, Atul; Clifford, Gari
2010-01-01
We present a non-parametric adaptive surrogate test that allows for the differentiation of statistically significant T-Wave Alternans (TWA) from alternating patterns that can be solely explained by the statistics of noise. The proposed test is based on estimating the distribution of noise induced alternating patterns in a beat sequence from a set of surrogate data derived from repeated reshuffling of the original beat sequence. Thus, in assessing the significance of the observed alternating patterns in the data no assumptions are made about the underlying noise distribution. In addition, since the distribution of noise-induced alternans magnitudes is calculated separately for each sequence of beats within the analysis window, the method is robust to data non-stationarities in both noise and TWA. The proposed surrogate method for rejecting noise was compared to the standard noise rejection methods used with the Spectral Method (SM) and the Modified Moving Average (MMA) techniques. Using a previously described realistic multi-lead model of TWA, and real physiological noise, we demonstrate the proposed approach reduces false TWA detections, while maintaining a lower missed TWA detection compared with all the other methods tested. A simple averaging-based TWA estimation algorithm was coupled with the surrogate significance testing and was evaluated on three public databases; the Normal Sinus Rhythm Database (NRSDB), the Chronic Heart Failure Database (CHFDB) and the Sudden Cardiac Death Database (SCDDB). Differences in TWA amplitudes between each database were evaluated at matched heart rate (HR) intervals from 40 to 120 beats per minute (BPM). Using the two-sample Kolmogorov-Smirnov test, we found that significant differences in TWA levels exist between each patient group at all decades of heart rates. The most marked difference was generally found at higher heart rates, and the new technique resulted in a larger margin of separability between patient populations than
Directory of Open Access Journals (Sweden)
Euler V. Garcia
2011-03-01
Full Text Available Reconhecer com precisão indivíduos com maior risco imediato de morte súbita cardíaca (MSC ainda é uma questão em aberto. A natureza fortuita dos eventos cardiovasculares agudos não parece se adequar ao conhecido modelo de indução de taquicardia/fibrilação ventricular por um gatilho em sincronia a um substrato arritmogênico estático. Quanto ao mecanismo da MSC, uma instabilidade elétrica dinâmica explicaria melhor a raridade da associação simultânea de um gatilho certo a um substrato cardíaco apropriado. Diversos estudos tentaram medir essa instabilidade elétrica cardíaca (ou um equivalente válido em uma sequência de batimentos cardíacos no ECG. Dentre os mecanismos possíveis podemos citar o prolongamento do QT, dispersão do QT, potenciais tardios, alternância de onda T ou T-wave alternans (TWA, e turbulência da frequência cardíaca. Este artigo se atém em particular ao papel da TWA no panorama atual da estratificação de risco cardíaco. Os achados sobre TWA ainda são heterogêneos, variando de um desempenho prognóstico muito bom até um quase nulo, dependendo da população clínica observada e protocolo clínico usado. Para preencher as atuais lacunas no conhecimento sobre TWA, profissionais médicos e pesquisadores devem explorar melhor as características técnicas das diversas tecnologias disponíveis para a avaliação de TWA e atentar ao fato de que os valores de TWA respondem a diversos outros fatores, além de medicamentos. Informações sobre mecanismos celulares e subcelulares da TWA estão fora do escopo deste artigo, mas são referenciados alguns dos principais trabalhos sobre este tópico, com o intuito de auxiliar no entendimento dos conceitos e fatos cobertos neste artigo.Reconocer con precisión individuos con mayor riesgo inmediato de muerte súbita cardíaca (MSC aun es una cuestión en abierto. La naturaleza fortuita de los eventos cardiovasculares agudos no parece adecuarse al conocido modelo
Directory of Open Access Journals (Sweden)
Andreia Pinto de Sousa
2015-07-01
Full Text Available A Interface é incontornável quando se estudam os sistemas de informação. Com este artigo, pretendemos contribuir para o aumento do conhecimento sobre os processos de apresentação de informação de saúde online e, sobre as relações do utilizador com a Interface. A proposta aqui apresentada consiste na divisão da interface em cinco dimensões (visual, arquitetura da informação, interação, presença social e experiência de utilização para um maior conhecimento da relevância de cada uma das dimensões e dos seus elementos no estudo da credibilidade e confiança online. Apresenta-se também um modelo de análise que serve como base de construção dos instrumentos de análise para a recolha de dados que caraterizam os utilizadores, e os seus comportamentos relativamente ao acesso e participação e avaliam a sua perceção de credibilidade e de confiança em websites partindo da análise de cada uma das dimensões da Interface.
Friar, John T.
Two factors of predicted learning disorders were investigated: (1) inability to maintain appropriate classroom behavior (BEH), (2) perceptual discrimination deficit (PERC). Three groups of first-graders (BEH, PERC, normal control) were administered measures of impulse control, distractability, auditory discrimination, and visual discrimination.…
2010-03-24
... Propane Education and Research Council's Operations, Market Changes and Federal Programs AGENCY... Education and Research Council (PERC), in conjunction with the cumulative effects of market changes and... requirements under the Propane Education and Research Act of 1996 that established PERC and requires the...
Directory of Open Access Journals (Sweden)
Almuth eSpröwitz
2013-10-01
Full Text Available In humans and animals cognitive training during childhood plays an important role in shaping neural circuits and thereby determines learning capacity later in life. Using a negative feedback learning paradigm, the two-way active avoidance (TWA learning, we aimed to investigate in mice (i the age-dependency of TWA learning, (ii the consequences of pretraining in childhood on adult learning capacity and (iii the impact of sex on the learning paradigm in mice. Taken together, we show here for the first time that the beneficial or detrimental outcome of pretraining in childhood depends on the age during which TWA training is encountered, indicating that different, age-dependent long-term memory traces might be formed, which are recruited during adult TWA training and thereby either facilitate or impair adult TWA learning. While pretraining during infancy results in learning impairment in adulthood, pretraining in late adolescence improved avoidance learning.The experiments revealed a clear sex difference in the group of late-adolescent mice: female mice showed better avoidance learning during late adolescence compared to males, and the beneficial impact of late-adolescent pretraining on adult learning was more pronounced in females compared to males.
Bayen, Stéphane; Segovia, Elvagris; Loh, Lay Leng; Burger, David F; Eikaas, Hans S; Kelly, Barry C
2014-06-01
Tools specifically validated for tropical environments are needed to accurately describe the behavior of chemical contaminants in tropical ecosystems. In the present study, sampling rates (Rs) were determined for the commercial pharmaceutical-type Polar Organic Chemical Integrative Sampler (POCIS) with a 45.8cm(2) exposure surface for 35 Pharmaceutically Active Compounds (PhACs) and Endocrine Disrupting Compounds (EDCs), of which eight compounds (albuterol, atorvastatin, diltiazem, dilantin, enalapril, norfluoxetine, risperidone and warfarin) were reported for the first time. These sampling rates were measured in an outdoor laboratory calibration setup to best capture diurnal tropical temperature variations (29±3°C). The effect of stirring and salinity was investigated. For all compounds, the sampling rates were higher under stirred conditions as compared to quiescent conditions. Calibration results in the presence of 30g sodium chloride support that the effects of salinity on POCIS sampling rates are compound-specific. Comparisons between Time-Weight Average (TWA) water concentrations using POCIS and spot sample levels in the field (2 lake and 1 mangrove estuary sites) are presented. Results showed that POCIS TWA concentrations were in agreement with spot sample concentrations for these aquatic systems. Results indicate that POCIS can be used to effectively measure the TWA concentration for a range of PhACs and EDCs in tropical waters. However, based on the results from mass balance and field deployments, POCIS did not appear suitable for compounds with a low mass balance recovery during calibration (e.g. triclosan and linuron in this study). Copyright © 2014 Elsevier B.V. All rights reserved.
Periprosthetic osteolysis after total wrist arthroplasty
DEFF Research Database (Denmark)
Boeckstyns, Michel E H; Herzberg, Guillaume
2014-01-01
Background and Literature Review Periprosthetic osteolysis (PPO) after second- or third-generation total wrist arthroplasty (TWA), with or without evident loosening of the implant components, has previously been reported in the literature, but rarely in a systematic way. Purpose The purpose...... of this study was to analyze the prevalence, location, and natural history of PPO following a TWA and to determine whether this was associated with prosthetic loosening. Patients and Methods We analyzed 44 consecutive cases in which a RE-MOTION TWA (Small Bone Innovations Inc., Morrisville, PA, USA) had been...
C:\\My Documents\\African Heath S
African Journals Online (AJOL)
African Health Sciences Vol 3 No 1 April 2003. 1. Editorial. Its now official: ... between students and parents increased the odds of condom use. ... of school health,. Wandera and Twa-Twa's study of oral health4 of ... and knowledge. Go for it!
The traveling-wave amplifier model of the cochlea adapted to dolphins
DEFF Research Database (Denmark)
Andersen, Lars Nonboe; Au, W.W.L.
1999-01-01
The traveling-wave amplifier (TWA) model of the cochlea [A. Hubbard, Science 259, 68–71 (1993)] has been shown to produce outputs that compare quite well with experimental data. A TWA model with parameters adjusted to fit the physiological properties of the dolphin cochlea was used as part...... of a sonar signal discrimination system. The system was tested on a cylinder wall thickness discrimination problem. Broadband echoes from cylinders with different wall thicknesses were aligned using a matched filter and envelope detection. The aligned signals were used as inputs to the TWA model and energy...
Gagné, Jonathan; Faherty, Jacqueline K.; Mamajek, Eric E.; Malo, Lison; Doyon, René; Filippazzo, Joseph C.; Weinberger, Alycia J.; Donaldson, Jessica K.; Lépine, Sébastien; Lafrenière, David; Artigau, Étienne; Burgasser, Adam J.; Looper, Dagny; Boucher, Anne; Beletsky, Yuri; Camnasio, Sara; Brunette, Charles; Arboit, Geneviève
2017-02-01
A determination of the initial mass function (IMF) of the current, incomplete census of the 10 Myr-old TW Hya association (TWA) is presented. This census is built from a literature compilation supplemented with new spectra and 17 new radial velocities from ongoing membership surveys, as well as a reanalysis of Hipparcos data that confirmed HR 4334 (A2 Vn) as a member. Although the dominant uncertainty in the IMF remains census incompleteness, a detailed statistical treatment is carried out to make the IMF determination independent of binning while accounting for small number statistics. The currently known high-likelihood members are fitted by a log-normal distribution with a central mass of {0.21}-0.06+0.11 M ⊙ and a characteristic width of {0.8}-0.1+0.2 dex in the 12 M Jup-2 M ⊙ range, whereas a Salpeter power law with α ={2.2}-0.5+1.1 best describes the IMF slope in the 0.1-2 M ⊙ range. This characteristic width is higher than other young associations, which may be due to incompleteness in the current census of low-mass TWA stars. A tentative overpopulation of isolated planetary-mass members similar to 2MASS J11472421-2040204 and 2MASS J11193254-1137466 is identified: this indicates that there might be as many as {10}-5+13 similar members of TWA with hot-start model-dependent masses estimated at ˜5-7 M Jup, most of which would be too faint to be detected in 2MASS. Our new radial velocity measurements corroborate the membership of 2MASS J11472421-2040204, and secure TWA 28 (M8.5 γ), TWA 29 (M9.5 γ), and TWA 33 (M4.5 e) as members. The discovery of 2MASS J09553336-0208403, a young L7-type interloper unrelated to TWA, is also presented.
A New Wavelet-Based ECG Delineator for the Evaluation of the Ventricular Innervation
DEFF Research Database (Denmark)
Cesari, Matteo; Mehlsen, Jesper; Mehlsen, Anne-Birgitte
2017-01-01
T-wave amplitude (TWA) has been proposed as a marker of the innervation of the myocardium. Until now, TWA has been calculated manually or with poor algorithms, thus making its use not efficient in a clinical environment. We introduce a new wavelet-based algorithm for the delineation QRS complexes...
Lifescience Database Archive (English)
Full Text Available some 3 SCAF14756, whole genome shot... 77 3e-13 tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste...|A8IF50_9PERC Intestinal peptide transporter OS=Sebastes nebulosus GN=SLC15A1 PE=2 SV=1 Length = 742 Score =
Lifescience Database Archive (English)
Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste
2014-11-19
were received dispersed in solution from Dr. Dan Goia’s laboratory at Clarkson University, Potsdam , NY. For these Ag NPs, the coating was continuous and...amount of Ag inhaled in a standard worker over an 8 h work day into a single administered dose, normalized by respiratory rate (20 000 mL/min...conversion) (TLV TWA) (exposure time) (particle lung deposition efficiency) = × × × × × −(20 000 mL/min) (1 10 m /mL) (0.01 mg/m ) (480 min / day ) 0.35 6
Kenttä, Tuomas; Tulppo, Mikko P; Nearing, Bruce D; Karjalainen, Jaana J; Hautala, Arto J; Kiviniemi, Antti M; Huikuri, Heikki V; Verrier, Richard L
2014-09-15
Effects of exercise rehabilitation on electrocardiographic markers of risk for sudden cardiac death have not been adequately studied. We examined effects of controlled exercise training on T-wave alternans (TWA) in 24-hour ambulatory electrocardiogram recordings in patients with stable coronary artery disease (CAD) without and with type 2 diabetes mellitus (DM). Consecutive patients with angiographically confirmed CAD were recruited to join the ARTEMIS (Innovation to Reduce Cardiovascular Complications of Diabetes at the Intersection) study. Exercise (n = 65) and control groups (n = 65) were matched on age, sex, DM, and previous myocardial infarction. Ambulatory electrocardiograms were recorded before and after a 2-year training period. TWA was assessed using time domain-modified moving average method by an investigator blinded to patients' clinical status. Average TWA values decreased in the rehabilitation group but not in control patients (rehabilitation [mean ± SEM]: 52.8 ± 1.7 μV vs 48.7 ± 1.5 μV, p exercise versus 10% (n = 2 of 20) of controls (p = 0.020). In CAD patients, 30% (n = 8 of 27) of positive TWA cases were converted with exercise versus 4% (n = 1 of 28) of controls (p = 0.012). In conclusion, this is the first report of the effectiveness of exercise rehabilitation to reduce TWA, a marker of sudden cardiac death risk, in patients with stable CAD. Copyright © 2014 Elsevier Inc. All rights reserved.
Youngest Brown Dwarf Yet in a Multiple Stellar System
2000-07-01
the need to avoid contamination from the strong light of the much brighter object, only 2 arcsec away. The nature of TWA-5 B ESO PR Photo 17b/00 ESO PR Photo 17b/00 [Preview - JPEG: 509 x 400 pix - 124k] [Normal - JPEG: 1017 x 800 pix - 264k] Caption : This optical spectrum (600 - 900 nm wavelength range) of TWA-5 B was obtained with the FORS-2 instrument at the 8.2-m VLT/KUEYEN telescope on 23 February 2000. A 30-min exposure was made through a 0.7 arcsec wide slit, positioned on the object in east-west direction, i.e., perpendicular to the direction to the much brighter TWA-5 A , only 2 arcsec to the south, see PR Photo 17a/00. Thanks to this, the obtained spectrum was very "clean". Also shown is the optical spectrum of a typical M9-type star. The spectra are very similar, with broad molecular absorption bands from TiO and VO. TWA-5 B also shows strong hydrogen emission (H-alpha) and weak sodium (Na) absorption, both indicative of its comparatively young age. ESO PR Photo 17c/00 ESO PR Photo 17c/00 [Preview - JPEG: 515 x 400 pix - 124k] [Normal - JPEG: 1030 x 800 pix - 284k] Caption : This infrared spectrum was obtained on 16 April 2000 with the ISAAC multi-mode instrument at the 8.2-m VLT/ANTU telescope in the 1.4 - 1.8 µm wavelength range (the H-band), with spectral resolution 500. It corresponds to a total exposure time of 20 min and was made through a 0.6 arcsec wide slit. Lines of Magnesium (Mg), Carbon Monoxide (CO), and the Hydroxyl radical (OH) are identified. The general shape of the spectrum is typical of that of a late M-type dwarf star. For comparison, the infrared spectrum of an M9-type star is shown. The spectra are indeed quite similar. The optical spectrum of TWA-5 B shows strong molecular absorption features (TiO and VO, cf. PR Photo 17b/00 ), typical for very cold stellar atmospheres and confirming it as a Brown Dwarf. Both the optical and the infrared ( PR Photo 17c/00 ) spectra indicate a late spectral type (about M9) of TWA-5 B that corresponds
The Interaction of Work Adjustment and Attachment Theory: Employment Counseling Implications
Renfro-Michel, Edina L.; Burlew, Larry D.; Robert, Tracey
2009-01-01
Career development is a lifelong process beginning with career choice. However, career choice alone does not guarantee career success. Rather than focus on choosing a career, the theory of work adjustment (TWA) focuses on the process of becoming an exemplary employee through each stage of an individual's career. Within TWA, employee relationships…
Hamilton, D; Aronsen, P; Løken, J H; Berg, I M; Skotheim, R; Hopper, D; Clarke, A; Briffa, N K
2006-01-01
Objective To examine in a cross sectional study the influence of femoral torsion (FT) and passive hip external rotation (PER) on turnout (TO). Starting age, years of classical ballet training, and current and past dance training intensity were assessed to determine their influence on FT, PER, and TO in pre‐professional female dancers. Methods Sixty four dancers (mean (SD) age 18.16 (1.80) years) were recruited from four different dance training programmes. They completed a dance history questionnaire. FT was measured using a clinical method. PER was measured with the subjects prone, and TO was measured with the subjects standing. Results Mean TO was 136°, mean unilateral PER was 49.4°, and mean FT was 18.4°. A positive correlation was observed between PER combined (PERC) and TO (r = 0.443, pballet training and FTC, PERC, or TO. Dancers who trained for six hours a week or more during the 11–14 year age range had less FT than those who trained less (mean difference 6°, 95% confidence interval 1.4 to 10.3). Students currently training for longer had higher levels of TO (p<0.001) but comparable PERC and FTC. Conclusion FT is significantly associated with PERC. Dancers who trained for six hours a week or more at 11–14 years of age had significantly less FT. FTC had a significant influence on PERC, but no influence on the execution of TO. PMID:16556782
Lyons, Heather Z.; O'Brien, Karen M.
2006-01-01
In light of speculation that the determinants of job satisfaction and tenure for African American employees may not be adequately captured by the theory of work adjustment (TWA; Dawis & Lofquist, 1984), in the present study the authors tested assumptions of the TWA with an African American sample by (a) examining the strength of fit-satisfaction…
DISTANCE AND KINEMATICS OF THE TW HYDRAE ASSOCIATION FROM PARALLAXES
Energy Technology Data Exchange (ETDEWEB)
Weinberger, Alycia J.; Boss, Alan P. [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5241 Broad Branch Road NW, Washington, DC 20015 (United States); Anglada-Escude, Guillem, E-mail: weinberger@dtm.ciw.edu [Institut fuer Astrophysik, Universitaet Goettingen, Friedrich-Hund-Platz 1, 37077 Goettingen (Germany)
2013-01-10
From common proper motion and signatures of youth, researchers have identified about 30 members of a putative TW Hydrae Association. Only four of these had parallactic distances from Hipparcos. We have measured parallaxes and proper motions for 14 primary members. We combine these with literature values of radial velocities to show that the Galactic space motions of the stars, with the exception of TWA 9 and 22, are parallel and do not indicate convergence at a common formation point sometime in the last few million years. The space motions of TWA 9 and 22 do not agree with the others and indicate that they are not TWA members. The median parallax is 18 mas or 56 pc. We further analyze the stars' absolute magnitudes on pre-main-sequence evolutionary tracks and find a range of ages with a median of 10.1 Myr and no correlation between age and Galactic location. The TWA stars may have formed from an extended and filamentary molecular cloud but are not necessarily precisely coeval.
Directory of Open Access Journals (Sweden)
Jennifer S. Pierce
2015-01-01
Full Text Available Diacetyl, a suspected cause of respiratory disorders in some food and flavorings manufacturing workers, is also a natural component of roasted coffee. We characterized diacetyl exposures that would plausibly occur in a small coffee shop during the preparation and consumption of unflavored coffee. Personal (long- and short-term and area (long-term samples were collected while a barista ground whole coffee beans, and brewed and poured coffee into cups. Simultaneously, long-term personal samples were collected as two participants, the customers, drank one cup of coffee each per h. Air sampling and analyses were conducted in accordance with OSHA Method 1012. Diacetyl was detected in all long-term samples. The long-term concentrations for the barista and area samples were similar, and ranged from 0.013–0.016 ppm; long-term concentrations for the customers were slightly lower and ranged from 0.010–0.014 ppm. Short-term concentrations ranged from below the limit of detection (<0.0047 ppm–0.016 ppm. Mean estimated 8 h time-weighted average (8 h TWA exposures for the barista ranged from 0.007–0.013 ppm; these values exceed recommended 8 h TWA occupational exposure limits (OELs for diacetyl and are comparable to long-term personal measurements collected in various food and beverage production facilities. The concentrations measured based on area sampling were comparable to those measured in the breathing zone of the barista, thus exceedances of the recommended OELs may also occur for coffee shop workers who do not personally prepare coffee (e.g., cashier, sanitation/maintenance. These findings suggest that the practicality and scientific basis of the recommended OELs for diacetyl merit further consideration.
A review of potential neurotoxic mechanisms among three chlorinated organic solvents
International Nuclear Information System (INIS)
Bale, Ambuja S.; Barone, Stan; Scott, Cheryl Siegel; Cooper, Glinda S.
2011-01-01
The potential for central nervous system depressant effects from three widely used chlorinated solvents, trichloroethylene (TCE), perchloroethylene (PERC), and dichloromethane (DCM), has been shown in human and animal studies. Commonalities of neurobehavioral and neurophysiological changes for the chlorinated solvents in in vivo studies suggest that there is a common mechanism(s) of action in producing resultant neurotoxicological consequences. The purpose of this review is to examine the mechanistic studies conducted with these chlorinated solvents and to propose potential mechanisms of action for the different neurological effects observed. Mechanistic studies indicate that this solvent class has several molecular targets in the brain. Additionally, there are several pieces of evidence from animal studies indicating this solvent class alters neurochemical functions in the brain. Although earlier evidence indicated that these three chlorinated solvents perturb the lipid bilayer, more recent data suggest an interaction between several specific neuronal receptors produces the resultant neurobehavioral effects. Collectively, TCE, PERC, and DCM have been reported to interact directly with several different classes of neuronal receptors by generally inhibiting excitatory receptors/channels and potentiating the function of inhibitory receptors/channels. Given this mechanistic information and available studies for TCE, DCM, and PERC, we provide hypotheses on primary targets (e.g. ion channel targets) that appear to be most influential in producing the resultant neurological effects. - Research highlights: → Comparison of neurological effects among TCE, PERC, and DCM. → Correlation of mechanistic findings to neurological effects. → Data support that TCE, PERC, and DCM interact with several ion channels to produce neurological changes.
Energy Technology Data Exchange (ETDEWEB)
Yager, J.W.; Hicks, J.B.; Fabianova, N. [EPRI, Palo Alto, CA (United States). Environment Group
1997-08-01
Little information is available on the relationship between occupational exposure to inorganic arsenic in coal fly ash and urinary excretion of arsenic metabolites. This study was undertaken in a coal-fired power plant in Slovakia during a routine maintenance outage. Arsenic was measured in the breathing zone of workers during 5 consecutive workdays, and urine samples were obtained for analysis of arsenic metabolites-inorganic arsenic (As), monomethylarsonic acid (MMA), and dimethylarsinic acid (DMA) prior to the start of each shift. Results from a small number of cascade impacter air samples indicated that approximately 90% of total particle mass and arsenic was present in particle size fractions {ge} 3.5 {mu}m. The 8-hr time-weighted average (TWA) mean arsenic air concentration was 48.3 {mu}g/m{sup 3} (range 0.17-375.2) and the mean sum of urinary arsenic (Sigma As) metabolites was 16.9 {mu}g As/g creatinine (range 2.6-50.8). For an 8-hr TWA of 10 {mu}g/m{sup 3} arsenic from coal fly ash, the predicted mean concentration f the Sigma As urinary metabolites was 13.2 {mu}g As/g creatinine. Comparisons with previously published studies of exposure to arsenic trioxide vapors and dusts in copper smelters suggest that bioavailability of arsenic from airborne coal fly ash (as indicated by urinary excretion) is about one-third that seen in smelters and similar settings. Arsenic compound characteristics, matrix composition, and particle size distribution probably play major roles in determining actual uptake of airborne arsenic.
He, W.; Donaldson, C. R.; Zhang, L.; Ronald, K.; Phelps, A. D. R.; Cross, A. W.
2017-11-01
Experimental results are presented of a broadband, high power, gyrotron traveling wave amplifier (gyro-TWA) operating in the (75-110)-GHz frequency band and based on a helically corrugated interaction region. The second harmonic cyclotron mode of a 55-keV, 1.5-A, axis-encircling electron beam is used to resonantly interact with a traveling TE21 -like eigenwave achieving broadband amplification. The gyro-TWA demonstrates a 3-dB gain bandwidth of at least 5.5 GHz in the experimental measurement with 9 GHz predicted for a wideband drive source with a measured unsaturated output power of 3.4 kW and gain of 36-38 dB. The approach may allow a gyro-TWA to operate at 1 THz.
Jiang, George C T; Madl, Amy K; Ingmundson, Kelsey J; Murbach, Dana M; Fehling, Kurt A; Paustenbach, Dennis J; Finley, Brent L
2008-06-01
concentrations at bystander locations ranged from 0.002+/-0.001 f/cc and 0.004+/-0.002 f/cc when 1 or 2 boxes of clutches were handled, respectively. Estimated 8-h TWA asbestos exposures for a worker handling 1 or 2 boxes of clutches over a workday ranged from 0.002 to 0.006 f/cc. The 30-min PCM adjusted average airborne asbestos concentration for a worker continuously stacking unopened boxes of clutches was 0.212+/-0.014 f/cc; the 8-h TWA was 0.013 f/cc. Additionally, 30-min PCM adjusted average airborne asbestos concentrations following cleanup and clothing handling were 0.002+/-0.001 f/cc and 0.002+/-0.002 f/cc, respectively, both resulting in estimated 8-h TWA asbestos exposures of 0.0001 f/cc. The results of this study indicate that the handling, unpacking, and repacking of clutches, and the subsequent cleanup and clothes handling by a worker within a short-term period or over the entire workday, result in exposures below the historical and current short-term and 8-h occupational exposure limits for asbestos.
Low-order-mode harmonic multiplying gyrotron traveling-wave amplifier in W band
International Nuclear Information System (INIS)
Yeh, Y. S.; Chen, C. H.; Yang, S. J.; Lai, C. H.; Lin, T. Y.; Lo, Y. C.; Hong, J. W.; Hung, C. L.; Chang, T. H.
2012-01-01
Harmonic multiplying gyrotron traveling-wave amplifiers (gyro-TWAs) allow for magnetic field reduction and frequency multiplication. To avoid absolute instabilities, this work proposes a W-band harmonic multiplying gyro-TWA operating at low-order modes. By amplifying a fundamental harmonic TE 11 drive wave, the second harmonic component of the beam current initiates a TE 21 wave to be amplified. Absolute instabilities in the gyro-TWA are suppressed by shortening the interaction circuit and increasing wall losses. Simulation results reveal that compared with Ka-band gyro-TWTs, the lower wall losses effectively suppress absolute instabilities in the W-band gyro-TWA. However, a global reflective oscillation occurs as the wall losses decrease. Increasing the length or resistivity of the lossy section can reduce the feedback of the oscillation to stabilize the amplifier. The W-band harmonic multiplying gyro-TWA is predicted to yield a peak output power of 111 kW at 98 GHz with an efficiency of 25%, a saturated gain of 26 dB, and a bandwidth of 1.6 GHz for a 60 kV, 7.5 A electron beam with an axial velocity spread of 8%.
Yamada, Shinya; Yoshihisa, Akiomi; Sato, Yu; Sato, Takamasa; Kamioka, Masashi; Kaneshiro, Takashi; Oikawa, Masayoshi; Kobayashi, Atsushi; Suzuki, Hitoshi; Ishida, Takafumi; Takeishi, Yasuchika
2018-05-18
Heart failure (HF) patients have a higher risk of recurrent HF and cardiac death, and electrical remodeling is considered to be an important factor for HF progression. The present study aimed to validate the utility of electrocardiogram and Holter monitoring for the risk stratification of HF patients. Our study comprised 215 patients (144 males, mean age 62 years) who had been hospitalized due to acute decompensated HF. Electrocardiogram (QRS duration and QTc interval) and 24-hour Holter monitoring (heart rate variability, heart rate turbulence and T-wave alternans [TWA]) were performed in stable condition before discharge. The clinical characteristics and outcomes were then investigated. During a median follow-up period of 2.7 years, there were 83 (38.6%) cardiac events (re-hospitalization due to worsening HF [n = 51] or cardiac death [n = 32]). The patients with cardiac events had a lower turbulence slope (TS) and higher TWA compared to those without cardiac events (TS, 3.0±5.5 ms/RR vs. 5.3±5.6 ms/RR, P = 0.001; TWA, 66.1±19.6 μV vs. 54.7±15.1 μV, P < 0.001). Univariable analysis showed that TS, TWA, QRS duration, and QTc interval were associated with cardiac events (P = 0.004, P < 0.001, P = 0.037 and P = 0.024, respectively), while the multivariable analysis after the adjustment of multiple confounders showed that TS and TWA were independent predictive factors of cardiac events with a hazard ratio of 0.936 and 1.015 (95% confidence interval [CI]: 0.860-0.974, P = 0.006; and 95% CI: 1.003-1.027, p = 0.016), respectively. The measurement of TS and TWA is useful for assessing risk for re-hospitalization and cardiac death in HF patients. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Protect and Restore Red River Watershed, 2007-2008 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Bransford, Stephanie [Nez Perce Tribe Fisheries/Watershed Program
2009-05-04
The Nez Perce Tribe Department of Fisheries Resource Management, Watershed Division approaches watershed restoration with a ridge-top to ridge-top approach. The Nez Perce Tribe (NPT) and the Nez Perce National Forest (NPNF) have formed a partnership in completing watershed restoration activities, and through this partnership more work is accomplished by sharing funding and resources in our effort. The Nez Perce Tribe began watershed restoration projects within the Red River Watershed of the South Fork Clearwater River in 2001. Progress has been made in restoring the watershed through road decommissioning and culvert replacement. From completing a watershed assessment to two NEPA efforts and a final stream restoration design, we will begin the effort of restoring the mainstem channel of Red River to provide spawning and rearing habitat for anadromous and resident fish species. Roads have been surveyed and prioritized for removal or improvement as well as culverts being prioritized for replacement to accommodate fish passage throughout the watershed. Another major, and extremely, important component of this project is the Red River Meadow Conservation Easement. We have begun the process of pursuing a conservation easement on approximately 270 acres of prime meadow habitat (Red River runs through this meadow and is prime spawning and rearing habitat).
An Open-Source Standard T-Wave Alternans Detector for Benchmarking.
Khaustov, A; Nemati, S; Clifford, Gd
2008-09-14
We describe an open source algorithm suite for T-Wave Alternans (TWA) detection and quantification. The software consists of Matlab implementations of the widely used Spectral Method and Modified Moving Average with libraries to read both WFDB and ASCII data under windows and Linux. The software suite can run in both batch mode and with a provided graphical user interface to aid waveform exploration. Our software suite was calibrated using an open source TWA model, described in a partner paper [1] by Clifford and Sameni. For the PhysioNet/CinC Challenge 2008 we obtained a score of 0.881 for the Spectral Method and 0.400 for the MMA method. However, our objective was not to provide the best TWA detector, but rather a basis for detailed discussion of algorithms.
Hawley, Brie; Casey, Megan; Virji, Mohammed Abbas; Cummings, Kristin J; Johnson, Alyson; Cox-Ganser, Jean
2017-12-15
Cleaning and disinfecting products consisting of a mixture of hydrogen peroxide (HP), peracetic acid (PAA), and acetic acid (AA) are widely used as sporicidal agents in health care, childcare, agricultural, food service, and food production industries. HP and PAA are strong oxidants and their mixture is a recognized asthmagen. However, few exposure assessment studies to date have measured HP, PAA, and AA in a health care setting. In 2015, we performed a health and exposure assessment at a hospital where a new sporicidal product, consisting of HP, PAA, and AA was introduced 16 months prior. We collected 49 full-shift time-weighted average (TWA) air samples and analyzed samples for HP, AA, and PAA content. Study participants were observed while they performed cleaning duties, and duration and frequency of cleaning product use was recorded. Acute upper airway, eye, and lower airway symptoms were recorded in a post-shift survey (n = 50). A subset of 35 cleaning staff also completed an extended questionnaire that assessed symptoms reported by workers as regularly occurring or as having occurred in the previous 12 months. Air samples for HP (range: 5.5 to 511.4 ppb) and AA (range: 6.7 to 530.3 ppb) were all below established US occupational exposure limits (OEL). To date, no full-shift TWA OEL for PAA has been established in the United States, however an OEL of 0.2 ppm has been suggested by several research groups. Air samples for PAA ranged from 1.1 to 48.0 ppb and were well below the suggested OEL of 0.2 ppm. Hospital cleaning staff using a sporicidal product containing HP, PAA, and AA reported work-shift eye (44%), upper airway (58%), and lower airway (34%) symptoms. Acute nasal and eye irritation were significantly positively associated with increased exposure to the mixture of the two oxidants: HP and PAA, as well as the total mixture (TM)of HP, PAA, and AA. Shortness of breath when hurrying on level ground or walking up a slight hill was significantly associated
Hawley, Brie; Casey, Megan; Virji, Mohammed Abbas; Cummings, Kristin J.; Johnson, Alyson; Cox-Ganser, Jean
2017-01-01
Cleaning and disinfecting products consisting of a mixture of hydrogen peroxide (HP), peracetic acid (PAA), and acetic acid (AA) are widely used as sporicidal agents in health care, childcare, agricultural, food service, and food production industries. HP and PAA are strong oxidants and their mixture is a recognized asthmagen. However, few exposure assessment studies to date have measured HP, PAA, and AA in a health care setting. In 2015, we performed a health and exposure assessment at a hospital where a new sporicidal product, consisting of HP, PAA, and AA was introduced 16 months prior. We collected 49 full-shift time-weighted average (TWA) air samples and analyzed samples for HP, AA, and PAA content. Study participants were observed while they performed cleaning duties, and duration and frequency of cleaning product use was recorded. Acute upper airway, eye, and lower airway symptoms were recorded in a post-shift survey (n = 50). A subset of 35 cleaning staff also completed an extended questionnaire that assessed symptoms reported by workers as regularly occurring or as having occurred in the previous 12 months. Air samples for HP (range: 5.5 to 511.4 ppb) and AA (range: 6.7 to 530.3 ppb) were all below established US occupational exposure limits (OEL). To date, no full-shift TWA OEL for PAA has been established in the United States, however an OEL of 0.2 ppm has been suggested by several research groups. Air samples for PAA ranged from 1.1 to 48.0 ppb and were well below the suggested OEL of 0.2 ppm. Hospital cleaning staff using a sporicidal product containing HP, PAA, and AA reported work-shift eye (44%), upper airway (58%), and lower airway (34%) symptoms. Acute nasal and eye irritation were significantly positively associated with increased exposure to the mixture of the two oxidants: HP and PAA, as well as the total mixture (TM) of HP, PAA, and AA. Shortness of breath when hurrying on level ground or walking up a slight hill was significantly associated
Nonequilibrium dynamics of spin-boson models from phase-space methods
Piñeiro Orioli, Asier; Safavi-Naini, Arghavan; Wall, Michael L.; Rey, Ana Maria
2017-09-01
An accurate description of the nonequilibrium dynamics of systems with coupled spin and bosonic degrees of freedom remains theoretically challenging, especially for large system sizes and in higher than one dimension. Phase-space methods such as the truncated Wigner approximation (TWA) have the advantage of being easily scalable and applicable to arbitrary dimensions. In this work we adapt the TWA to generic spin-boson models by making use of recently developed algorithms for discrete phase spaces [J. Schachenmayer, A. Pikovski, and A. M. Rey, Phys. Rev. X 5, 011022 (2015), 10.1103/PhysRevX.5.011022]. Furthermore we go beyond the standard TWA approximation by applying a scheme based on the Bogoliubov-Born-Green-Kirkwood-Yvon (BBGKY) hierarchy of equations to our coupled spin-boson model. This allows us, in principle, to study how systematically adding higher-order corrections improves the convergence of the method. To test various levels of approximation we study an exactly solvable spin-boson model, which is particularly relevant for trapped-ion arrays. Using TWA and its BBGKY extension we accurately reproduce the time evolution of a number of one- and two-point correlation functions in several dimensions and for an arbitrary number of bosonic modes.
A study of the differences in respirator fit factor values between years and masks
Energy Technology Data Exchange (ETDEWEB)
Longo, Anastasia [Univ. of Minnesota, Minneapolis, MN (United States)
1995-08-15
The work described in this report was carried out at a national laboratory of the Department of Energy, during the time that the author was engaged in a Department of Energy Industrial Hygiene Graduate Fellowship. The national laboratory had a respiratory protection program with approximately 50 employees participating. The program was in place to protect employees from over-exposure to airborne contaminants while engineering and work practice controls were being installed and implemented. It was also in place to protect workers in situations where engineering and work control practices were not feasible, such as during maintenance and repair work, as well as in situations where engineering and work practice controls were not enough to lower the exposure to or below the Permissible Exposure Limit (PEL) as set by the Occupational Safety and Health Association (OSHA) as an eight-hour time weighted average (TWA) or an excursion limit. Respirators were also used for emergencies by the emergency response team.
A study of the differences in respirator fit factor values between years and masks
International Nuclear Information System (INIS)
Longo, A.
1995-01-01
The work described in this report was carried out at a national laboratory of the Department of Energy, during the time that the author was engaged in a Department of Energy Industrial Hygiene Graduate Fellowship. The national laboratory had a respiratory protection program with approximately 50 employees participating. The program was in place to protect employees from over-exposure to airborne contaminants while engineering and work practice controls were being installed and implemented. It was also in place to protect workers in situations where engineering and work control practices were not feasible, such as during maintenance and repair work, as well as in situations where engineering and work practice controls were not enough to lower the exposure to or below the Permissible Exposure Limit (PEL) as set by the Occupational Safety and Health Association (OSHA) as an eight-hour time weighted average (TWA) or an excursion limit. Respirators were also used for emergencies by the emergency response team
Ku-Band Traveling Wave Slot Array Using Simple Scanning Control
Host, Nicholas K.; Chen, Chi-Chih; Volakis, John L.; Miranda, Felix A.
2015-01-01
This paper introduces a feeding concept aimed at simplifying the backend (phase shifters) of traditional phased arrays. As an alternative to traditional phased arrays, we employ a traveling wave array (TWA) using a single feedline whose propagation constant is controlled via a single, small mechanical movement without a need for phase shifters to enable scanning. Specifically, a dielectric plunger is positioned within a parallel plate waveguide (PPW) transmission line (TL) that feeds the TWA. By adjusting the position of the dielectric plunger within the PPW feeding the TWA, beam steering is achieved. A 20 element array is designed at 13GHz shown to give stable realized gain across the angular range of -25 deg. less than or equal to theta less than or equal to 25 deg. A proof of concept array is fabricated and measured to demonstrate and validate the concept's operation.
Spatially correlated heterogeneous aspirations to enhance network reciprocity
Tanimoto, Jun; Nakata, Makoto; Hagishima, Aya; Ikegaya, Naoki
2012-02-01
Perc & Wang demonstrated that aspiring to be the fittest under conditions of pairwise strategy updating enhances network reciprocity in structured populations playing 2×2 Prisoner's Dilemma games (Z. Wang, M. Perc, Aspiring to the fittest and promoted of cooperation in the Prisoner's Dilemma game, Physical Review E 82 (2010) 021115; M. Perc, Z. Wang, Heterogeneous aspiration promotes cooperation in the Prisoner's Dilemma game, PLOS one 5 (12) (2010) e15117). Through numerical simulations, this paper shows that network reciprocity is even greater if heterogeneous aspirations are imposed. We also suggest why heterogeneous aspiration fosters network reciprocity. It distributes strategy updating speed among agents in a manner that fortifies the initially allocated cooperators' clusters against invasion. This finding prompted us to further enhance the usual heterogeneous aspiration cases for heterogeneous network topologies. We find that a negative correlation between degree and aspiration level does extend cooperation among heterogeneously structured agents.
Revisiting mouse peritoneal macrophages: heterogeneity, development and function
Directory of Open Access Journals (Sweden)
Alexandra Dos Anjos Cassado
2015-05-01
Full Text Available Tissue macrophages play a crucial role in the maintenance of tissue homeostasis and also contribute to inflammatory and reparatory responses during pathogenic infection and tissue injury. The high heterogeneity of these macrophages is consistent with their adaptation to distinct tissue environments and specialization to develop niche-specific functions. Although peritoneal macrophages are one of best-studied macrophage populations, only recently it was demonstrated the co-existence of two subsets in mouse PerC, which exhibit distinct phenotypes, functions and origins. These macrophage subsets have been classified according to their morphology as LPMs (large peritoneal macrophages and SPMs (small peritoneal macrophages. LPMs, the most abundant subset under steady-state conditions, express high levels of F4/80 and low levels of class II molecules of the major histocompatibility complex (MHC. LPMs appear to be originated from embriogenic precursors, and their maintenance in PerC is regulated by expression of specific transcription factors and tissue-derived signals. Conversely, SPMs, a minor subset in unstimulated PerC, have a F4/80lowMHC-IIhigh phenotype and are generated from bone-marrow-derived myeloid precursors. In response to infectious or inflammatory stimuli, the cellular composition of PerC is dramatically altered, where LPMs disappear and SPMs become the prevalent population together with their precursor, the inflammatory monocyte. SPMs appear to be the major source of inflammatory mediators in PerC during infection whereas LPMs contribute for gut-associated lymphoid tissue (GALT-independent and retinoic acid-dependent IgA production by peritoneal B-1 cells. In the last years, considerable efforts have been made to broaden our understanding of LPM and SPM origin, transcriptional regulation and functional profile. This review addresses these issues, focusing on the impact of tissue-derived signals and external stimulation in the complex
A statistical evaluation of asbestos air concentrations
International Nuclear Information System (INIS)
Lange, J.H.
1999-01-01
Both area and personal air samples collected during an asbestos abatement project were matched and statistically analysed. Among the many parameters studied were fibre concentrations and their variability. Mean values for area and personal samples were 0.005 and 0.024 f cm - - 3 of air, respectively. Summary values for area and personal samples suggest that exposures are low with no single exposure value exceeding the current OSHA TWA value of 0.1 f cm -3 of air. Within- and between-worker analysis suggests that these data are homogeneous. Comparison of within- and between-worker values suggests that the exposure source and variability for abatement are more related to the process than individual practices. This supports the importance of control measures for abatement. Study results also suggest that area and personal samples are not statistically related, that is, there is no association observed for these two sampling methods when data are analysed by correlation or regression analysis. Personal samples were statistically higher in concentration than area samples. Area sampling cannot be used as a surrogate exposure for asbestos abatement workers. (author)
PROTOPLANETARY DISK MASSES FROM STARS TO BROWN DWARFS
International Nuclear Information System (INIS)
Mohanty, Subhanjoy; Mortlock, Daniel; Greaves, Jane; Pascucci, Ilaria; Apai, Daniel; Scholz, Aleks; Thompson, Mark; Lodato, Giuseppe; Looper, Dagny
2013-01-01
We present SCUBA-2 850 μm observations of seven very low mass stars (VLMS) and brown dwarfs (BDs). Three are in Taurus and four in the TW Hydrae Association (TWA), and all are classical T Tauri (cTT) analogs. We detect two of the three Taurus disks (one only marginally), but none of the TWA ones. For standard grains in cTT disks, our 3σ limits correspond to a dust mass of 1.2 M ⊕ in Taurus and a mere 0.2 M ⊕ in the TWA (3-10× deeper than previous work). We combine our data with other submillimeter/millimeter (sub-mm/mm) surveys of Taurus, ρ Oph, and the TWA to investigate the trends in disk mass and grain growth during the cTT phase. Assuming a gas-to-dust mass ratio of 100:1 and fiducial surface density and temperature profiles guided by current data, we find the following. (1) The minimum disk outer radius required to explain the upper envelope of sub-mm/mm fluxes is ∼100 AU for intermediate-mass stars, solar types, and VLMS, and ∼20 AU for BDs. (2) While the upper envelope of apparent disk masses increases with M * from BDs to VLMS to solar-type stars, no such increase is observed from solar-type to intermediate-mass stars. We propose this is due to enhanced photoevaporation around intermediate stellar masses. (3) Many of the disks around Taurus and ρ Oph intermediate-mass and solar-type stars evince an opacity index of β ∼ 0-1, indicating significant grain growth. Of the only four VLMS/BDs in these regions with multi-wavelength measurements, three are consistent with considerable grain growth, though optically thick disks are not ruled out. (4) For the TWA VLMS (TWA 30A and B), combining our 850 μm fluxes with the known accretion rates and ages suggests substantial grain growth by 10 Myr, comparable to that in the previously studied TWA cTTs Hen 3-600A and TW Hya. The degree of grain growth in the TWA BDs (2M1207A and SSPM1102) remains largely unknown. (5) A Bayesian analysis shows that the apparent disk-to-stellar mass ratio has a roughly
From event analysis to global lessons: disaster forensics for building resilience
Keating, Adriana; Venkateswaran, Kanmani; Szoenyi, Michael; MacClune, Karen; Mechler, Reinhard
2016-07-01
With unprecedented growth in disaster risk, there is an urgent need for enhanced learning and understanding of disasters, particularly in relation to the trends in drivers of increasing risk. Building on the disaster forensics field, we introduce the post-event review capability (PERC) methodology for systematically and holistically analysing disaster events, and identifying actionable recommendations. PERC responds to a need for learning about the successes and failures in disaster risk management and resilience, and uncovers the underlying drivers of increasing risk. We draw generalisable insights identified from seven applications of the methodology to date, where we find that across the globe policy makers and practitioners in disaster risk management face strikingly similar challenges despite variations in context, indicating encouraging potential for mutual learning. These lessons highlight the importance of integrated risk reduction strategies. We invite others to utilise the freely available PERC approach and contribute to building a repository of learning on disaster risk management and resilience.
A Novel Role for C5a in B-1 Cell Homeostasis
Directory of Open Access Journals (Sweden)
Katharina Bröker
2018-02-01
Full Text Available B-1 cells constitute a unique subpopulation of lymphocytes residing mainly in body cavities like the peritoneal cavity (PerC but are also found in spleen and bone marrow (BM. As innate-like B cells, they mediate first line immune defense through low-affinity natural IgM (nIgM antibodies. PerC B-1 cells can egress to the spleen and differentiate into nIgM antibody-secreting plasma cells that recognize conserved exogenous and endogenous cellular structures. Homing to and homeostasis within the PerC are regulated by the chemokine CXCL13 released by PerC macrophages and stroma cells. However, the exact mechanisms underlying the regulation of CXCL13 and B-1 homeostasis are not fully explored. B-1 cells play important roles in the inflammatory response to infection, autoimmunity, ischemia/reperfusion injury, obesity, and atherosclerosis. Remarkably, this list of inflammatory entities has a strong overlap with diseases that are regulated by complement suggesting a link between B-1 cells and the complement system. Interestingly, up to now, no data exist regarding the role of complement in B-1 cell biology. Here, we demonstrate for the first time that C5a regulates B-1 cell steady-state dynamics within the peritoneum, the spleen, and the BM. We found decreased B-1a cell numbers in the peritoneum and the spleen of C5aR1−/− mice associated with increased B1-a and B1-b numbers in the spleen and high serum titers of nIgM antibodies directed against phosphorylcholine and several pneumococcal polysaccharides. Similarly, peritoneal B-1a cells were decreased in the peritoneum and splenic B-1a and B-1b cells were increased in C5aR2−/− mice. The decrease in peritoneal B-1 cell numbers was associated with decreased peritoneal CXCL13 levels in C5aR1−/− and C5aR2−/− mice. In search for mechanisms, we found that combined TLR2 and IL-10 receptor activation in PerC macrophages induced strong CXCL13 production, which was significantly reduced in cells
Miao, P P; Meng, T; Jia, Q; Niu, Y; Ye, M; Ji, Y Q; Ju, R; Chen, X L; Shao, H; Zheng, Y X; Dai, Y F
2016-05-01
To investigate the effect of occupational toluene diisocyanate(TDI) exposure on matrix metalloproteinases-9 (MMP-9) and tissue inhibitor of metalloproteinase-1(TIMP-1), and analysis of the correlation of MMP-9,TIMP-1,MMP-9/TIMP-1 and lung function. In October 2014, based on cluster sampling, we conducted a cross-sectional study in a TDI production factory located in China's western region. 61 exposed workers were recruited from workers engaged in packing, operating and checking. Based on different levels of the external exposure, the packers were classified as high exposed group, while operators and checkers as low exposed group. 58 factory managers, matching age and agent, were selected as controls, having same work intense and not contacting the TDI or other allergens. The questionnaire surveys were used to obtain the agent, age, work age, smoking and drinking, personal and family allergic history, occupational history, and the recent health conditions. The levels of MMP-9 and TIMP-1 in serum of subjects were determind by ELISA. The time weighted average concentrations (8h-TWA) were used to describe the levels of TDI air exposure in working environment. Spearman correlation assay was used to investigate the correlation of MMP-9, TIMP-1, MMP-9/TIMP-1 and lung function, exposure time. 8-hour TWA means of TDI air levels in exposed group, packers, operators and checkers were 0.39, 0.76, 0.25 mg/m(3), respectively . According to the external exposure concentration, the packers were classified as high exposed group, and the operators and checkers were classified as low exposed group. In controls, low exposed group and high exposed group, the levels of MMP-9, respectively, were (807.21±347.70),(586.91±317.50),(388.94±312.01) ng/ml (χ(2)=16.69, Pcorrelation analysis showed that levels of MMP-9 were positively associated with FEV1.0, and FEV1.0/FVC (r values were 0.27, 0.25, respectively, all Pcorrelated with exposure time(r=-0.26, P=0.040). The positive correlations
Innovative Technologies for a bio-based economy
International Nuclear Information System (INIS)
2008-01-01
This special edition of TWA Nieuws representatives of various Dutch embassies in the world pay attention to developments concerning the many-sided applications of biological products in the Netherlands, the European Union, the United Kingdom, France, Germany, Sweden, Finland, Italy, Singapore, Japan, Taiwan, China and the United States. The title of this edition refers to the conference with the same name that will be held by TWA-Netwerk on 8 April 2008 at the Dutch Wageningen University research Center. [mk] [nl
Lessons Learned from Creating the Public Earthquake Resource Center at CERI
Patterson, G. L.; Michelle, D.; Johnston, A.
2004-12-01
The Center for Earthquake Research and Information (CERI) at the University of Memphis opened the Public Earthquake Resource Center (PERC) in May 2004. The PERC is an interactive display area that was designed to increase awareness of seismology, Earth Science, earthquake hazards, and earthquake engineering among the general public and K-12 teachers and students. Funding for the PERC is provided by the US Geological Survey, The NSF-funded Mid America Earthquake Center, and the University of Memphis, with input from the Incorporated Research Institutions for Seismology. Additional space at the facility houses local offices of the US Geological Survey. PERC exhibits are housed in a remodeled residential structure at CERI that was donated by the University of Memphis and the State of Tennessee. Exhibits were designed and built by CERI and US Geological Survey staff and faculty with the help of experienced museum display subcontractors. The 600 square foot display area interactively introduces the basic concepts of seismology, real-time seismic information, seismic network operations, paleoseismology, building response, and historical earthquakes. Display components include three 22" flat screen monitors, a touch sensitive monitor, 3 helicorder elements, oscilloscope, AS-1 seismometer, life-sized liquefaction trench, liquefaction shake table, and building response shake table. All displays include custom graphics, text, and handouts. The PERC website at www.ceri.memphis.edu/perc also provides useful information such as tour scheduling, ask a geologist, links to other institutions, and will soon include a virtual tour of the facility. Special consideration was given to address State science standards for teaching and learning in the design of the displays and handouts. We feel this consideration is pivotal to the success of any grass roots Earth Science education and outreach program and represents a valuable lesson that has been learned at CERI over the last several
Lung structure and function relation in systemic sclerosis: Application of lung densitometry
Energy Technology Data Exchange (ETDEWEB)
Ninaber, Maarten K., E-mail: m.k.ninaber@lumc.nl [Department of Pulmonology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Stolk, Jan; Smit, Jasper; Le Roy, Ernest J. [Department of Pulmonology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Kroft, Lucia J.M. [Department of Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Els Bakker, M. [Division of Image Processing, Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Vries Bouwstra, Jeska K. de; Schouffoer, Anne A. [Department of Rheumatology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Staring, Marius; Stoel, Berend C. [Division of Image Processing, Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands)
2015-05-15
Highlights: • A quantitative CT parameter of lung parenchyma in systemic sclerosis is presented. • We examine the optimal percentage threshold for the percentile density. • The 85th percentile density threshold correlated significantly with lung function. • A lung structure–function relation is confirmed. • We report applicability of Perc85 in progression mapping of interstitial lung disease. - Abstract: Introduction: Interstitial lung disease occurs frequently in patients with systemic sclerosis (SSc). Quantitative computed tomography (CT) densitometry using the percentile density method may provide a sensitive assessment of lung structure for monitoring parenchymal damage. Therefore, we aimed to evaluate the optimal percentile density score in SSc by quantitative CT densitometry, against pulmonary function. Material and methods: We investigated 41 SSc patients by chest CT scan, spirometry and gas transfer tests. Lung volumes and the nth percentile density (between 1 and 99%) of the entire lungs were calculated from CT histograms. The nth percentile density is defined as the threshold value of densities expressed in Hounsfield units. A prerequisite for an optimal percentage was its correlation with baseline DLCO %predicted. Two patients showed distinct changes in lung function 2 years after baseline. We obtained CT scans from these patients and performed progression analysis. Results: Regression analysis for the relation between DLCO %predicted and the nth percentile density was optimal at 85% (Perc85). There was significant agreement between Perc85 and DLCO %predicted (R = −0.49, P = 0.001) and FVC %predicted (R = −0.64, P < 0.001). Two patients showed a marked change in Perc85 over a 2 year period, but the localization of change differed clearly. Conclusions: We identified Perc85 as optimal lung density parameter, which correlated significantly with DLCO and FVC, confirming a lung parenchymal structure–function relation in SSc. This provides
Lung structure and function relation in systemic sclerosis: Application of lung densitometry
International Nuclear Information System (INIS)
Ninaber, Maarten K.; Stolk, Jan; Smit, Jasper; Le Roy, Ernest J.; Kroft, Lucia J.M.; Els Bakker, M.; Vries Bouwstra, Jeska K. de; Schouffoer, Anne A.; Staring, Marius; Stoel, Berend C.
2015-01-01
Highlights: • A quantitative CT parameter of lung parenchyma in systemic sclerosis is presented. • We examine the optimal percentage threshold for the percentile density. • The 85th percentile density threshold correlated significantly with lung function. • A lung structure–function relation is confirmed. • We report applicability of Perc85 in progression mapping of interstitial lung disease. - Abstract: Introduction: Interstitial lung disease occurs frequently in patients with systemic sclerosis (SSc). Quantitative computed tomography (CT) densitometry using the percentile density method may provide a sensitive assessment of lung structure for monitoring parenchymal damage. Therefore, we aimed to evaluate the optimal percentile density score in SSc by quantitative CT densitometry, against pulmonary function. Material and methods: We investigated 41 SSc patients by chest CT scan, spirometry and gas transfer tests. Lung volumes and the nth percentile density (between 1 and 99%) of the entire lungs were calculated from CT histograms. The nth percentile density is defined as the threshold value of densities expressed in Hounsfield units. A prerequisite for an optimal percentage was its correlation with baseline DLCO %predicted. Two patients showed distinct changes in lung function 2 years after baseline. We obtained CT scans from these patients and performed progression analysis. Results: Regression analysis for the relation between DLCO %predicted and the nth percentile density was optimal at 85% (Perc85). There was significant agreement between Perc85 and DLCO %predicted (R = −0.49, P = 0.001) and FVC %predicted (R = −0.64, P < 0.001). Two patients showed a marked change in Perc85 over a 2 year period, but the localization of change differed clearly. Conclusions: We identified Perc85 as optimal lung density parameter, which correlated significantly with DLCO and FVC, confirming a lung parenchymal structure–function relation in SSc. This provides
Energy Technology Data Exchange (ETDEWEB)
Lin Kaili; Chang Jiang; Shen Ruxiang, E-mail: jchang@mail.sic.ac.c [State Key Laboratory of High Performance Ceramics and Superfine Microstructure, Shanghai Institute of Ceramics, Chinese Academy of Sciences, 1295 Dingxi Road, Shanghai 200050 (China)
2009-12-15
The effect of powder properties on sintering, microstructure, mechanical strength and degradability of beta-tricalcium phosphate/Calcium silicate (beta-Ca{sub 3}(PO{sub 4}){sub 2}/CaSiO{sub 3}, beta-TCP/CS) composite bioceramics was investigated. beta-TCP/CS composite powders with a weight ratio of 50:50 were prepared by three different methods: mechanical milling method (TW-A), two-step chemical precipitation method (TW-B) and in situ chemical co-precipitation method (TW-C), and then the three composite powders were uniaxially compacted at 30 MPa, followed by cold isostatic pressing into rectangular-prism-shaped specimens under a pressure of 200 MPa for 15 min, and then sintered at 1150 deg. C for 5 h. The TW-B powders with less agglomerative morphologies and uniform nano-size particles attained 96.14% relative density (RD). A uniform microstructure with about 120 nm grains was observed. Whereas, the samples obtained from TW-A and TW-C powders only reached a RD of 63.08% and 78.86%, respectively. The bending strength of the samples fabricated from TW-B reached 125 MPa, which was more than 3.7 and 1.5 times higher as compared with that of samples obtained from TW-A and TW-C powders, respectively. Furthermore, the degradability of the samples fabricated from TW-B powders was obviously lower than that of the samples fabricated from TW-A and TW-C powders.
Evaluation of available MHD seed-regeneration processes on the basis of energy considerations
International Nuclear Information System (INIS)
Sheth, A.C.; Johnson, T.R.
1978-09-01
Of the several processes described in the literature that are capable of separating sulfur from alkali-metal sulfates, seven processes were selected as candidates for regenerating seed material for reuse in open-cycle MHD. After a brief assessment of each process, two were selected for a detailed analysis, namely, a process developed by the Pittsburgh Energy Research Center (PERC) and a modified version of the Tampella process. The processes were compared on the bases of energy requirements and the amount of research work needed to develop a seed-regeneration process for MHD systems. The energy requirements given should be considered as rough values, because factors such as heat losses and component efficiency were not included in the analysis. On the basis of energy consumption, the PERC process has a slight advantage over the Tampella process; on the basis of the present state of development of various components, the Tampella process has a clear advantage. Accordingly, it was recommended that developmental programs be carried out for both the PERC and Tampella processes
A statistical evaluation of asbestos air concentrations
Energy Technology Data Exchange (ETDEWEB)
Lange, J.H. [Envirosafe Training and Consultants, Pittsburgh, PA (United States)
1999-07-01
Both area and personal air samples collected during an asbestos abatement project were matched and statistically analysed. Among the many parameters studied were fibre concentrations and their variability. Mean values for area and personal samples were 0.005 and 0.024 f cm{sup -}-{sup 3} of air, respectively. Summary values for area and personal samples suggest that exposures are low with no single exposure value exceeding the current OSHA TWA value of 0.1 f cm{sup -3} of air. Within- and between-worker analysis suggests that these data are homogeneous. Comparison of within- and between-worker values suggests that the exposure source and variability for abatement are more related to the process than individual practices. This supports the importance of control measures for abatement. Study results also suggest that area and personal samples are not statistically related, that is, there is no association observed for these two sampling methods when data are analysed by correlation or regression analysis. Personal samples were statistically higher in concentration than area samples. Area sampling cannot be used as a surrogate exposure for asbestos abatement workers. (author)
PERCEÇÕES SOBRE AS ABORDAGENS À APRENDIZAGEM – ESTUDO DE VARIÁVEIS PSICOLÓGICAS
Lourenço, Abílio Afonso; Nogueira, Carla Maria Leite
2014-01-01
Esta investigação, realizada numa escola básica no norte de Portugal, tem como objetivo analisar as perceções que os alunos apresentam sobre algumas variáveis relativas à forma como desenvolvem a sua aprendizagem, nomeadamente: a autorregulação para a aprendizagem; os processos de estudo utilizados; o controlo volitivo; a planificação da gestão do tempo; e a procrastinação. Outra finalidade deste estudo éverificar se existe uma relação significativa entre estas variáveis e a perceção de autoe...
Fragoso, Nuno Miguel do Rosário Mendes
2013-01-01
Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde - Núcleo de Psicologia Clínica Dinâmica), Universidade de Lisboa, Faculdade de Psicologia, 2013 O presente trabalho foca-se no estudo da influência da auto-perceção do envelhecimento e dos traços de personalidade na satisfação com a reforma, numa amostra de idosos oriundos da comunidade e sem psicopatologia diagnosticada. Tem como objetivos: (1) analisar a auto-perceção do envelhecimento, os traços de personalidade e a s...
International Nuclear Information System (INIS)
Umezu, Toyoshi; Shibata, Yasuyuki
2014-01-01
The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles
Energy Technology Data Exchange (ETDEWEB)
Umezu, Toyoshi, E-mail: umechan2@nies.go.jp; Shibata, Yasuyuki, E-mail: yshibata@nies.go.jp
2014-09-01
The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles.
Using Smart Devices to Measure Intermittent Noise in the Workplace
Directory of Open Access Journals (Sweden)
Benjamin Roberts
2017-01-01
Full Text Available Purpose: To determine the accuracy of smart devices (iPods to measure intermittent noise and integrate a noise dose in the workplace. Materials and Methods: In experiment 1, four iPods were each paired with a Larson Davis Spark dosimeter and exposed to randomly fluctuating pink noise in a reverberant sound chamber. Descriptive statistics and the mean difference between the iPod and its paired dosimeter were calculated for the 1-s data logged measurements. The calculated time weighted average (TWA was also compared between the devices. In experiment 2, 15 maintenance workers and 14 office workers wore an iPod and dosimeter during their work-shift for a maximum of five workdays. A mixed effects linear regression model was used to control for repeated measures and to determine the effect of the device type on the projected 8-h TWA. Results: In experiment 1, a total of 315,306 1-s data logged measurements were made. The interquartile range of the mean difference fell within ±2.0 A-weighted decibels (dBA, which is the standard used by the American National Standards Institute to classify a type 2 sound level meter. The mean difference of the calculated TWA was within ±0.5 dBA except for one outlier. In experiment 2, the results of the mixed effects model found that, on average, iPods measured an 8-h TWA 1.7 dBA higher than their paired dosimeters. Conclusion: This study shows that iPods have the ability to make reasonably accurate noise measurements in the workplace, but they are not as accurate as traditional noise dosimeters.
Orchids inventory in Sintang Regency, West Kalimantan
Directory of Open Access Journals (Sweden)
ESTI ENDAH ARIYANTI
2008-10-01
Full Text Available Orchid is one of ornamental plants which have commercial value. Therefore most species are becoming threatened or even endangered because of over exploitation. In addition, its natural habitat is also decreasing. Conservation must be done urgently, both by in situ and ex situ conservation, which can be started by orchid inventory. The orchid inventory was done in TWA Bukit Kelam, TWA Baning and several places in Regency of Sintang, West Kalimantan. The result showed that there were 40 species belonged to 27 genera, which 32 species of them (20 genera were epiphytic orchids and 8 species (7 genera were terrestrial orchids.
Foley, Pamela F; Lytle, Megan C
2015-06-01
Despite a recent increase in the number of adults who work past traditional retirement age, existing theories of vocational behavior have not yet received adequate empirical support. In a large sample of adults age 60-87, we evaluated the relationship between theorized predictors of work satisfaction proposed by Social Cognitive Career Theory (SCCT), work satisfaction as a predictor of continued work, as proposed by the Theory of Work adjustment (TWA), as well as the influence of reported experiences of discrimination on these relationships. While the results supported most of the predicted relationships, the effects of discrimination were stronger than the variables proposed by either SCCT or TWA for the present sample.
Wiegand, Susanna; Raile, Klemens; Reinehr, Thomas; Hofer, Sabine; Näke, Andrea; Rabl, Wolfgang; Holl, Reinhard W
2008-04-01
The purpose of this study was to generate insulin dose (ID) percentiles for children and adolescents with type 1 diabetes mellitus (DM1) having the opportunity to assess this important parameter in relation to age and sex. Daily IDs per weight (ID/kg) were recorded in 22,177 patients with DM1 (3-25 years of age, DM1 duration of more than 2 years, 48% female) and ID percentiles (ID-Perc) were created statistically. The ID-Perc were compared between male and female, and between multiple insulin injection therapy (MIT) and continuous s.c. insulin infusion (CSII). A multivariate regression analysis was performed for ID in the third year of DM1 with ID/kg, body weight, age, gender, and insulin delivery regimen as variables. The 50th ID-Perc (P50) varied among 0.67 IU/kg (age 3 years), 0.93 IU/kg (13 years), and 0.70 IU/kg (23 years) increasing from early childhood to adolescence and decreasing toward adulthood. Highest P50 ID was found at 12 years in females (0.94 IU/kg) and at 14 years in males (0.92 IU/kg). Using ICT, the ID was significantly higher compared with CSII (P50: 0.94 IU/kg versus 0.79 IU/kg at 13 years). In multivariate regression analysis, ID was significantly (P>0.001) associated with age, gender, and insulin delivery regime. The ID-Perc were significantly different during various periods of childhood and were influenced by gender, body weight, and insulin injection regimes. Therefore, the presented data 1) provide evidence to interpret individual ID in children and adolescents with DM1 and 2) more specifically identify children with unusually high (insulin resistance and non-compliance) or low (MODY and persistent remission) insulin requirement.
Grande Ronde Basin Supplementation Program; Lostine River, 2000 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)
2003-03-01
The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.
Grande Ronde Basin Supplementation Program; Lostine River, 2001 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)
2003-03-01
The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.
Vermeulen, Roel; Huang, Hanlin; Rothman, Nathaniel; Lan, Qing
2012-01-01
Epidemiological studies suggest that trichloroethylene (TCE) exposure may be associated with renal cancer. The biological mechanisms involved are not exactly known although nephrotoxicity is believed to play a role. Studies on TCE nephrotoxicity among humans, however, have been largely inconsistent. We studied kidney toxicity in Chinese factory workers exposed to TCE using novel sensitive nephrotoxicity markers. Eighty healthy workers exposed to TCE and 45 comparable unexposed controls were included in the present analyses. Personal TCE exposure measurements were taken over a 2-week period before urine collection. Ninety-six percent of workers were exposed to TCE below the current US Occupational Safety and Health Administration permissible exposure limit (100 ppm 8h TWA), with a mean (SD) of 22.2 (35.9) ppm. Kidney injury molecule-1 (KIM-1) and Pi-glutathione S transferase (GST) alpha were elevated among the exposed subjects as compared with the unexposed controls with a strong exposure-response association between individual estimates of TCE exposure and KIM-1 (P < 0.0001). This is the first report to use a set of sensitive nephrotoxicity markers to study the possible effects of TCE on the kidneys. The findings suggest that at relatively low occupational exposure levels a toxic effect on the kidneys can be observed. This finding supports the biological plausibility of linking TCE exposure and renal cancer. Abbreviations:GSTglutathione-S-transferaseKIM-1kidney injury molecule-1NAGN-acetyl-beta-(d)-glucosaminidaseOVMorganic vapour monitoringTCEtrichloroethyleneVEGFvascular endothelial growth factor. PMID:22665366
Energy Technology Data Exchange (ETDEWEB)
Nez Perce Tribe Resources Management Staff, (Nez Perce Tribe, Department of Fisheries Resource Management, Lapwai, ID)
2005-09-01
White sturgeon in the Hells Canyon reach (HCR) of the Snake River are of cultural importance to the Nez Perce Tribe. However, subsistence and ceremonial fishing opportunities have been severely limited as a result of low numbers of white sturgeon in the HCR. Hydrosystem development in the Columbia River Basin has depressed numbers and productivity of white sturgeon in the HCR by isolating fish in impounded reaches of the basin, restricting access to optimal rearing habitats, reducing the anadromous forage base, and modifying early life-history habitats. Consequently, a proactive management plan is needed to mitigate for the loss of white sturgeon production in the HCR, and to identify and implement feasible measures that will restore and rebuild the white sturgeon population to a level that sustains viability and can support an annual harvest. This comprehensive and adaptive management plan describes the goals, objectives, strategies, actions, and expected evaluative timeframes for restoring the white sturgeon population in the HCR. The goal of this plan, which is to maintain a viable, persistent population that can support a sustainable fishery, is supported by the following objectives: (1) a natural, stable age structure comprising both juveniles and a broad spectrum of spawning age-classes; (2) stable or increasing numbers of both juveniles and adults; (3) consistent levels of average recruitment to ensure future contribution to reproductive potential; (4) stable genetic diversity comparable to current levels; (5) a minimum level of abundance of 2,500 adults to minimize extinction risk; and (6) provision of an annual sustainable harvest of 5 kg/ha. To achieve management objectives, potential mitigative actions were developed by a Biological Risk Assessment Team (BRAT). Identified strategies and actions included enhancing growth and survival rates by restoring anadromous fish runs and increasing passage opportunities for white sturgeon, reducing mortality rates
Medium wave exposure characterisation using exposure quotients.
Paniagua, Jesús M; Rufo, Montaña; Jiménez, Antonio; Antolín, Alicia; Pinar, Iván
2010-06-01
One of the aspects considered in the International Commission on Non-Ionizing Radiation Protection guidelines is that, in situations of simultaneous exposure to fields of different frequencies, exposure quotients for thermal and electrical stimulation effects should be examined. The aim of the present work was to analyse the electromagnetic radiation levels and exposure quotients for exposure to multiple-frequency sources in the vicinity of medium wave radio broadcasting antennas. The measurements were made with a spectrum analyser and a monopole antenna. Kriging interpolation was used to prepare contour maps and to estimate the levels in the towns and villages of the zone. The results showed that the exposure quotient criterion based on electrical stimulation effects to be more stringent than those based on thermal effects or power density levels. Improvement of dosimetry evaluations requires the spectral components of the radiation to be quantified, followed by application of the criteria for exposure to multiple-frequency sources.
Styrene vapor control systems in FRP yacht plants.
Todd, W F
1985-01-01
The production of large (greater than 25-ft) fiber-reinforced plastic (FRP) yachts has presented problems of styrene exposure in excess of the Occupational Safety and Health Administration permissible exposure level (OSHA PEL) of 100 ppm. Also, the National Institute for Occupational Safety and Health (NIOSH) is currently recommending a 10-hour workshift, 40-hour workweek time weighted average (TWA) of 50 ppm for styrene. Meeting this challenge will require a system of engineering, work practice, personal protective equipment, and monitoring control measures. NIOSH has performed a study of the engineering controls in three FRP yacht plants. Work practices and the use of personal protective equipment (PPE) were also considered in the evaluation. The three systems evaluated included a dilution system, a local ventilation system, and a push-pull ventilation system. The cost of constructing and operating these systems was not evaluated in this study. Study results indicated that each type of ventilation system can meet the present PEL of 100 ppm styrene; however, it is not certain that these systems can meet a lower PEL of 50 ppm styrene.
WISEA J114724.10-204021.3: A FREE-FLOATING PLANETARY MASS MEMBER OF THE TW HYA ASSOCIATION
Energy Technology Data Exchange (ETDEWEB)
Schneider, Adam C.; Windsor, James; Cushing, Michael C. [Department of Physics and Astronomy, University of Toledo, 2801 W. Bancroft Street, Toledo, OH 43606 (United States); Kirkpatrick, J. Davy [Infrared Processing and Analysis Center, California Institute of Technology, MS 100-22, Pasadena, CA 91125 (United States); Wright, Edward L., E-mail: Adam.Schneider@Utoledo.edu [Department of Physics and Astronomy, University of California, Los Angeles, 430 Portola Plaza, Box 951547, Los Angeles, CA 90095-1547 (United States)
2016-05-01
We present WISEA J114724.10-204021.3, a young, low-mass, high-probability member of the TW Hya association (TWA). WISEA J114724.10-204021.3 was discovered based on its red AllWISE color ( W 1 − W 2 = 0.63 mag) and extremely red 2MASS J − K {sub S} color (>2.64 mag), the latter of which is confirmed with near-infrared photometry from the Visible and Infrared Survey Telescope for Astronomy Hemisphere Survey ( J − K {sub S} = 2.57 ± 0.03). Follow-up near-infrared spectroscopy shows a spectral type of L7 ± 1 as well as several spectroscopic indicators of youth. These include a peaked H -band shape and a steeper K -band slope, traits typically attributed to low surface gravity. The sky position, proper motion, and distance estimates of WISEA J114724.10-204021.3 are all consistent with membership in the ∼10 Myr old TWA. Using the age of the TWA and evolutionary models, we estimate the mass of WISEA J114724.10-204021.3 to be 5–13 M {sub Jup}, making it one of the youngest and lowest-mass free-floating objects yet discovered in the Solar neighborhood.
Cheasley, Roslyn; Keller, C Peter; Setton, Eleanor
2017-09-14
To explore differences in urban versus rural lifetime excess risk of cancer from five specific contaminants found in food and beverages. Probable contaminant intake is estimated using Monte Carlo simulations of contaminant concentrations in combination with dietary patterns. Contaminant concentrations for arsenic, benzene, lead, polychlorinated biphenyls (PCBs) and tetrachloroethylene (PERC) were derived from government dietary studies. The dietary patterns of 34 944 Canadians from 10 provinces were available from Health Canada's Canadian Community Health Survey, Cycle 2.2, Nutrition (2004). Associated lifetime excess cancer risk (LECR) was subsequently calculated from the results of the simulations. In the calculation of LECR from food and beverages for the five selected substances, two (lead and PERC) were shown to have excess risk below 10 per million; whereas for the remaining three (arsenic, benzene and PCBs), it was shown that at least 50% of the population were above 10 per million excess cancers. Arsenic residues, ingested via rice and rice cereal, registered the greatest disparity between urban and rural intake, with LECR per million levels well above 1000 per million at the upper bound. The majority of PCBs ingestion comes from meat, with values slightly higher for urban populations and LECR per million estimates between 50 and 400. Drinking water is the primary contributor of benzene intake in both urban and rural populations, with LECR per million estimates of 35 extra cancers in the top 1% of sampled population. Overall, there are few disparities between urban and rural lifetime excess cancer risk from contaminants found in food and beverages. Estimates could be improved with more complete Canadian dietary intake and concentration data in support of detailed exposure assessments in estimating LECR.
U.S. Environmental Protection Agency — The Exposure Forecaster Database (ExpoCastDB) is EPA's database for aggregating chemical exposure information and can be used to help with chemical exposure...
Papaneri, Amy B; Wirblich, Christoph; Marissen, Wilfred E; Schnell, Matthias J
2013-12-02
The safety and availability of the human polyclonal sera that is currently utilized for post-exposure treatment (PET) of rabies virus (RABV) infection remain a concern. Recombinant monoclonal antibodies have been postulated as suitable alternatives by WHO. To this extent, CL184, the RABV human antibody combination comprising monoclonal antibodies (mAbs) CR57 and CR4098, has been developed and has delivered promising clinical data to support its use for RABV PET. For this fully human IgG1 cocktail, mAbs CR57 and CR4098 are produced in the PER.C6 human cell line and combined in equal amounts in the final product. During preclinical evaluation, CR57 was shown to bind to antigenic site I whereas CR4098 neutralization was influenced by a mutation of position 336 (N336) located within antigenic site III. Here, alanine scanning was used to analyze the influence of mutations within the potential binding site for CR4098, antigenic site III, in order to evaluate the possibility of mutated rabies viruses escaping neutralization. For this approach, twenty flanking amino acids (10 upstream and 10 downstream) of the RABV glycoprotein (G) asparagine (N336) were exchanged to alanine (or serine, if already alanine) by site-directed mutagenesis. Analysis of G expression revealed four of the twenty mutant Gs to be non-functional, as shown by their lack of cell surface expression, which is a requirement for the production of infectious RABV. Therefore, these mutants were excluded from further study. The remaining sixteen mutants were introduced in an infectious clone of RABV, and recombinant RABVs (rRABVs) were recovered and utilized for in vitro neutralization assays. All of the viruses were effectively neutralized by CR4098 as well as by CR57, indicating that single amino acid exchanges in this region does not affect the broad neutralizing capability of the CL184 mAb combination. Copyright © 2013 Elsevier Ltd. All rights reserved.
77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID
2012-11-15
... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...
Exposure levels and determinants of inhalable dust exposure in bakeries.
Burstyn, I; Teschke, K; Kennedy, S M
1997-12-01
The study's objectives were to measure full-shift exposure to inhalable dust in bakeries and define the determinants of full-shift exposure. Inhalable dust was measured gravimetrically. Ninety-six bakery workers, employed in seven different bakeries, participated in the study. Two side-by-side full-shift inhalable dust samples were obtained from each study participant on a single occasion. Samples were collected on 18 days selected at random. During the entire sampling period, bakers were observed and information on 14 different tasks was recorded at 15 min intervals. Other production characteristics were also recorded for each sampling day. These task and production variables were used in statistical modelling to identify significant predictors of exposure. The mean full-shift inhalable dust exposure was 8.2 mg/m3 (range: 0.1-110 mg/m3). A regression model explained 79% of the variability in exposure. The model indicated that tasks such as weighing, pouring and operating dough-brakers and reversible sheeters increased the exposure, while packing, catching and decorating decreased the exposure. Bread and bun production lines were associated with increased full-shift inhalable dust exposure, while cake production and substitution of dusting with the use of divider oil were associated with decreased exposure. Production tasks and characteristics are strong predictors of personal full-shift exposures to flour dust among bakers; these can be altered to reduce exposure levels.
Exploring Global Exposure Factors Resources for Use in Consumer Exposure Assessments
Zaleski, Rosemary T.; Egeghy, Peter P.; Hakkinen, Pertti J.
2016-01-01
This publication serves as a global comprehensive resource for readers seeking exposure factor data and information relevant to consumer exposure assessment. It describes the types of information that may be found in various official surveys and online and published resources. The relevant exposure factors cover a broad range, including general exposure factor data found in published compendia and databases and resources about specific exposure factors, such as human activity patterns and housing information. Also included are resources on exposure factors related to specific types of consumer products and the associated patterns of use, such as for a type of personal care product or a type of children’s toy. Further, a section on using exposure factors for designing representative exposure scenarios is included, along with a look into the future for databases and other exposure science developments relevant for consumer exposure assessment. PMID:27455300
Ullage Compatible Optical Sensor for Monitoring Safety Significant Malfunctions, Phase II
National Aeronautics and Space Administration — Significant emphasis has been placed on aircraft fuel tank safety following the TWA Flight 800 accident in July 1996. Upon investigation, the National Transportation...
Stress and Fatigue in Operators Under Radiofrequency Electromagnetic Radiation and Shift Work
Directory of Open Access Journals (Sweden)
Vangelova K.
2014-12-01
Full Text Available The aim was to study the effect of radiofrequency electromagnetic radiation (EMR on stress indices, health complaints and fatigue of operators working fast-rotating extended shifts. Working conditions, job content, job control, social support, health complaints and fatigue were followed in 220 operators, 110 exposed to EMR and 110 control operators, matched by age and sex. The EMR was measured and time-weighted average (TWA was calculated. The excretion rates of stress hormones cortisol, adrenaline and noradrenaline were followed during the extended shifts in 36 operators, working at different levels of exposure and 24-hour exposure was calculated. The exposed group pointed more problems with the working conditions, including EMR, noise, currents and risk of accidents, more health complaints and higher level of fatigue. The most common health complaints were mental and physical exhaustion after work, pains in the chest, musculoskeletal complaints, headache, and apathy. High level EMR exposure (TWAmean = 3.10 μW/cm2, TWAmax = 137.00 μW/cm2 significantly increased the 24-hour excretion of cortisol and noradrenaline, whereas the increase of adrenaline excretion did not reach significance, as well as hormone excretion rates under low level exposure (TWAmean = 1.89 μW/cm2, TWAmax = 5.24 μW/cm2. In conclusion, higher number of health complaints, higher stress hormone excretion rates and fatigue were found in operators under EMR.
75 FR 28612 - Environmental Impact Statements; Notice of Availability
2010-05-21
... Counties, OR and Adams and Nez Perce Counties, ID, Wait Period Ends: 06/21/2010, Contact: Robert W. Rock.... EIS No. 20100181, Final EIS, DOE, MS, Kemper County Integrated Gasification Combined-Cycle (IGCC...
Haschke, Jan; Seif, Johannes P.; Riesen, Yannick; Tomasi, Andrea; Cattin, Jean; Tous, Loï c; Choulat, Patrick; Aleman, Monica; Cornagliotti, Emanuele; Uruena, Angel; Russell, Richard; Duerinckx, Filip; Champliaud, Jonathan; Levrat, Jacques; Abdallah, Amir A.; Aï ssa, Brahim; Tabet, Nouar; Wyrsch, Nicolas; Despeisse, Matthieu; Szlufcik, Jozef; De Wolf, Stefaan; Ballif, Christophe
2017-01-01
architectures, including so-called Aluminum back-surface-field (BSF), passivated emitter and rear cell (PERC), passivated emitter rear totally diffused (PERT), and silicon heterojunction (SHJ) solar cells. We compare measured temperature coefficients (TC
Comparison of biophysical factors influencing on emphysema quantification with low-dose CT
Heo, Chang Yong; Kim, Jong Hyo
2014-03-01
Emphysema Index(EI) measurements in MDCT is known to be influenced by various biophysical factors such as total lung volume, and body size. We investigated the association of the four biophysical factors with emphysema index in low-dose MDCT. In particular, we attempted to identify a potentially stronger biophysical factor than total lung volume. A total of 400 low-dose MDCT volumes taken at 120kVp, 40mAs, 1mm thickness, and B30f reconstruction kernel were used. The lungs, airways, and pulmonary vessels were automatically segmented, and two Emphysema Indices, relative area below -950HU(RA950) and 15th percentile(Perc15), were extracted from the segmented lungs. The biophysical factors such as total lung volume(TLV), mode of lung attenuation(ModLA), effective body diameter(EBD), and the water equivalent body diameter(WBD) were estimated from the segmented lung and body area. The association of biophysical factors with emphysema indices were evaluated by correlation coefficients. The mean emphysema indices were 8.3±5.5(%) in RA950, and -930±18(HU) in Perc15. The estimates of biophysical factors were 4.7±1.0(L) in TLV, -901±21(HU) in ModLA, 26.9±2.2(cm) in EBD, and 25.9±2.6(cm) in WBD. The correlation coefficients of biophysical factors with RA950 were 0.73 in TLV, 0.94 in ModLA, 0.31 in EBD, and 0.18 WBD, the ones with Perc15 were 0.74 in TLV, 0.98 in ModLA, 0.29 in EBD, and 0.15 WBD. Study results revealed that two biophysical factors, TLV and ModLA, mostly affects the emphysema indices. In particular, the ModLA exhibited strongest correlation of 0.98 with Perc15, which indicating the ModLA is the most significant confounding biophysical factor in emphysema indices measurement.
Evaluation of AirPollution Control fromViewpoints of Cost- Benefit Analysis in a Tile Industry
Directory of Open Access Journals (Sweden)
SJ Shahtaheri
2006-04-01
Full Text Available Background and Aims:Methyl Methacrylate (MMA which is known as a long, skin and eyeirritant is the most common form of acrylic plastic used in dental laboratories. The aims of thisstudy were to evaluate dental technicians, exposure to MMAand to assess their health with a focuson respiratory and dermal symptoms.Method: Exposure to MMA, total dust and health symptoms were investigated in 20 dentallaboratories located in Tehran, Iran. Time weighted average (TWA of MMA and peakconcentrations were determined , using XAD-2 tubes followed by GC-ID analysis. Total dustwere evaluated gravimetrically. Health symptoms were asked using a questionnaire.Results :The TWAfor technicians with direct and indirect exposure to MMAwere 327.28 + 79.42and 282.9 + 41.84 mg/m3, respectively. Peak concentration of MMA for those technicians were337.0 + 36.81 and 328.88 + 45.40 mg/m3, respectively. There were no significant differencesbetween TWAof MMAand peak concentration in different weakly workdays; low ever, within -day variations were observed (P<0.05. TWAof MMA and peak concentration correlation withthe laboratory volume were 0.61- 0.65, Dust exposure of technicians was 2.35 + 2.70 mg/m3.Cough and Skin dryness were the common health symptoms. Smoking and asbestos exposurehistory were factors influencing cough prevalence (P<0.005.Conclusion:It is concluded that the current short - Term Exposure Limit (STEL is not low enoughto protect technicians against the adverse effects caused by MMA.
Fast exposure time decision in multi-exposure HDR imaging
Piao, Yongjie; Jin, Guang
2012-10-01
Currently available imaging and display system exists the problem of insufficient dynamic range, and the system cannot restore all the information for an high dynamic range (HDR) scene. The number of low dynamic range(LDR) image samples and fastness of exposure time decision impacts the real-time performance of the system dramatically. In order to realize a real-time HDR video acquisition system, this paper proposed a fast and robust method for exposure time selection in under and over exposure area which is based on system response function. The method utilized the monotony of the imaging system. According to this characteristic the exposure time is adjusted to an initial value to make the median value of the image equals to the middle value of the system output range; then adjust the exposure time to make the pixel value on two sides of histogram be the middle value of the system output range. Thus three low dynamic range images are acquired. Experiments show that the proposed method for adjusting the initial exposure time can converge in two iterations which is more fast and stable than average gray control method. As to the exposure time adjusting in under and over exposed area, the proposed method can use the dynamic range of the system more efficiently than fixed exposure time method.
Directory of Open Access Journals (Sweden)
Kamal Moufid
2013-01-01
Conclusions: In our series, Perc-URS is a safe and efficient treatment option for proximal ureteral stone, especially when the stone size is superior to 15 mm with the presence of moderate or severe hydronephrosis.
Applying the Theory of Work Adjustment to Latino Immigrant Workers: An Exploratory Study.
Eggerth, Donald E; Flynn, Michael A
2012-02-01
Blustein mapped career decision making onto Maslow's model of motivation and personality and concluded that most models of career development assume opportunities and decision-making latitude that do not exist for many individuals from low income or otherwise disadvantaged backgrounds. Consequently, Blustein argued that these models may be of limited utility for such individuals. Blustein challenged researchers to reevaluate current career development approaches, particularly those assuming a static world of work, from a perspective allowing for changing circumstances and recognizing career choice can be limited by access to opportunities, personal obligations, and social barriers. This article represents an exploratory effort to determine if the theory of work adjustment (TWA) might meaningfully be used to describe the work experiences of Latino immigrant workers, a group living with severe constraints and having very limited employment opportunities. It is argued that there is significant conceptual convergence between Maslow's hierarchy of needs and the work reinforcers of TWA. The results of an exploratory, qualitative study with a sample of 10 Latino immigrants are also presented. These immigrants participated in key informant interviews concerning their work experiences both in the United States and in their home countries. The findings support Blustein's contention that such workers will be most focused on basic survival needs and suggest that TWA reinforcers are descriptive of important aspects of how Latino immigrant workers conceptualize their jobs.
Applying the Theory of Work Adjustment to Latino Immigrant Workers: An Exploratory Study
Eggerth, Donald E.; Flynn, Michael A.
2015-01-01
Blustein mapped career decision making onto Maslow’s model of motivation and personality and concluded that most models of career development assume opportunities and decision-making latitude that do not exist for many individuals from low income or otherwise disadvantaged backgrounds. Consequently, Blustein argued that these models may be of limited utility for such individuals. Blustein challenged researchers to reevaluate current career development approaches, particularly those assuming a static world of work, from a perspective allowing for changing circumstances and recognizing career choice can be limited by access to opportunities, personal obligations, and social barriers. This article represents an exploratory effort to determine if the theory of work adjustment (TWA) might meaningfully be used to describe the work experiences of Latino immigrant workers, a group living with severe constraints and having very limited employment opportunities. It is argued that there is significant conceptual convergence between Maslow’s hierarchy of needs and the work reinforcers of TWA. The results of an exploratory, qualitative study with a sample of 10 Latino immigrants are also presented. These immigrants participated in key informant interviews concerning their work experiences both in the United States and in their home countries. The findings support Blustein’s contention that such workers will be most focused on basic survival needs and suggest that TWA reinforcers are descriptive of important aspects of how Latino immigrant workers conceptualize their jobs. PMID:26345693
Occupational radiation exposure in Germany: many monitored persons = high exposure?
International Nuclear Information System (INIS)
Nitschke, J.
1996-01-01
Natural radiation affects the entire population in Germany, and most of Germany's inhabitants are exposed to medical radiation in their lifetime. Occupational radiation exposure, however, is a kind of exposure affecting only a limited and well-defined group of the population, and this radiation exposure has been recorded and monitored as precisely as technically possible ever since the radiation protection laws made occupational radiation exposure monitoring a mandatory obligation. Official personal dosimetry applying passive dosemeters in fact does not offer direct protection against the effects of ionizing radiation, as dosemeter read-out and dose calculation is a post-exposure process. But it nevertheless is a rewarding monitoring duty under radiation protection law, as is shown by the radiation exposure statistics accumulated over decades: in spite of the number of monitored persons having been increasing over the years, the total exposure did not, due to the corresponding improvements in occupational radiation protection. (orig.) [de
Radon daughter exposure estimation and its relation to the exposure limit
International Nuclear Information System (INIS)
Stocker, H.
1981-10-01
Under current Atomic Energy Control Regulations, the annual limit for individual exposure to radon daughters is 4 WLM. The Regulations do not specify how the exposure is to be determined nor to what accuracy the measurements should be made. This paper discusses the historical and conventional grab-sampling and time-weighting methods for assigning exposures to radon daughters in uranium mines in Canada. As a further step in the evolution of exposure assignments, the system of personal radon daughter dosimetry is introduced as the more accurate means of assigning individual exposures and of adhering to the intent of the exposure limit
The Australian Work Exposures Study: Prevalence of Occupational Exposure to Formaldehyde.
Driscoll, Timothy R; Carey, Renee N; Peters, Susan; Glass, Deborah C; Benke, Geza; Reid, Alison; Fritschi, Lin
2016-01-01
The aims of this study were to produce a population-based estimate of the prevalence of work-related exposure to formaldehyde, to identify the main circumstances of exposure and to describe the use of workplace control measures designed to decrease those exposures. The analysis used data from the Australian Workplace Exposures Study, a nationwide telephone survey, which investigated the current prevalence and exposure circumstances of work-related exposure to 38 known or suspected carcinogens, including formaldehyde, among Australian workers aged 18-65 years. Using the web-based tool OccIDEAS, semi-quantitative information was collected about exposures in the current job held by the respondent. Questions were addressed primarily at tasks undertaken rather than about self-reported exposures. Of the 4993 included respondents, 124 (2.5%) were identified as probably being exposed to formaldehyde in the course of their work [extrapolated to 2.6% of the Australian working population-265 000 (95% confidence interval 221 000-316 000) workers]. Most (87.1%) were male. About half worked in technical and trades occupations. In terms of industry, about half worked in the construction industry. The main circumstances of exposure were working with particle board or plywood typically through carpentry work, building maintenance, or sanding prior to painting; with the more common of other exposures circumstances being firefighters involved in fighting fires, fire overhaul, and clean-up or back-burning; and health workers using formaldehyde when sterilizing equipment or in a pathology laboratory setting. The use of control measures was inconsistent. Workers are exposed to formaldehyde in many different occupational circumstances. Information on the exposure circumstances can be used to support decisions on appropriate priorities for intervention and control of occupational exposure to formaldehyde, and estimates of burden of cancer arising from occupational exposure to formaldehyde
International Nuclear Information System (INIS)
Sasakawa, Yasuhiro; Matsumura, Yoshitaka; Iwasaki, Takanobu; Segawa, Hiroo; Yasuda, Sadatoshi; Kusuhara, Toshiaki
1997-01-01
We had made reports of patient radiation exposure for doctors to judge adaptation of medical radiation rightly. By these reports the doctors can be offered data of exposure dose and somatic effect. First, we sent out questionnaires so that we grasped the doctor's understanding about radiation exposure. Consequently we understood that the doctors had demanded data of exposure dose and somatic effect. Secondly, by the result of questionnaires we made the tables of exposure dose about radiological examination. As a result we have be able to presume exposure dose about high radiation sensitive organization as concrete figures. (author)
Designing exposure registries for improved tracking of occupational exposure and disease.
Arrandale, Victoria H; Bornstein, Stephen; King, Andrew; Takaro, Timothy K; Demers, Paul A
2016-06-27
Registries are one strategy for collecting information on occupational exposure and disease in populations. Recently leaders in the Canadian occupational health and safety community have shown an interest in the use of occupational exposure registries. The primary goal of this study was to review a series of Canadian exposure registries to identify their strengths and weaknesses as a tool for tracking occupational exposure and disease in Canada. A secondary goal was to identify the features of an exposure registry needed to specifically contribute to prevention, including the identification of new exposure-disease relationships. A documentary review of five exposure registries from Canada was completed. Strengths and limitations of the registries were compared and key considerations for designing new registries were identified. The goals and structure of the exposure registries varied considerably. Most of the reviewed registries had voluntary registration, which presents challenges for the use of the data for either surveillance or epidemiology. It is recommended that eight key issues be addressed when planning new registries: clear registry goal(s), a definition of exposure, data to be collected (and how it will be used), whether enrolment will be mandatory, as well as ethical, privacy and logistical considerations. When well constructed, an exposure registry can be a valuable tool for surveillance, epidemiology and ultimately the prevention of occupational disease. However, exposure registries also have a number of actual and potential limitations that need to be considered.
Yan, Zhengyu; Yang, Qiulian; Jiang, Weili; Lu, Jilai; Xiang, Zhongrun; Guo, Ruixin; Chen, Jianqiu
2018-03-01
Persistence of antibiotics in aquatic environment may pose a risk to the non-target aquatic organisms. This study provided an integrated evaluation to analyze the toxic stress of sulfamethazine (SMZ) on zebrafish in two lifespan stages (embryo-larval and adult) and three exposure periods (exposure, post-exposure and re-exposure). Zebrafish embryos and adult zebrafish were exposed to SMZ at 0.2, 20 and 2000 μg/L, respectively. The results showed that SMZ at any given concentration inhibited the hatching of embryos at 58-96 hpf (hours post-fertilization). Our result also indicated that two major kinds of the malformation, which was induced by the antibiotic, were edema and spinal curvature. Additionally, the antibiotic stimulated the heartbeat while reduced the body length of the embryo at 72 hpf. Superoxide dismutase (SOD) activities and malondialdehyde (MDA) contents significantly increased at 120 hpf when the embryos were exposed to the lowest concentration (0.2 μg/L) of the antibiotic. On the other hand, the antibiotic induced SOD activities and MDA contents in adult zebrafish in the exposure and re-exposure periods. The MDA contents could recover while SOD activities still increased in 2 d after the exposure. Both SOD activities and MDA contents could recover in 7 d after the exposure. Levels of SOD and MDA in the re-exposure were higher than those in the first exposure. Our results suggested that SMZ had toxic effects on both embryos and adult zebrafish, and provided an integrated evaluation of the toxic effects of SMZ on zebrafish at a new perspective. Copyright © 2017 Elsevier Ltd. All rights reserved.
Lifescience Database Archive (English)
Full Text Available entage concerning shoot regeneration 2 ME10-141 ... Chr07 19.51 6.84 ... 10.1186/1471-2229-11-140 22014149 ... QT73653 Solanum lycopersicum Solanaceae SpRg-7 In vitro plant regeneraion bud perc
Radiation exposure records management
International Nuclear Information System (INIS)
Boiter, H.P.
1975-12-01
Management of individual radiation exposure records begins at employment with the accumulation of data pertinent to the individual and any previous occupational radiation exposure. Appropriate radiation monitorinng badges or devices are issued and accountability established. A computer master file is initiated to include the individual's name, payroll number, social security number, birth date, assigned department, and location. From this base, a radiation exposure history is accumulated to include external ionizing radiation exposure to skin and whole body, contributing neutron exposure, contributing tritium exposure, and extremity exposure. It is used also to schedule bioassay sampling and in-vivo counts and to provide other pertinent information. The file is used as a basis for providing periodic reports to management and monthly exposure summaries to departmental line supervision to assist in planning work so that individual annual exposures are kept as low as practical. Radiation exposure records management also includes documentation of radiation surveys performed by the health physicist to establish working rates and the individual estimating and recording his estimated exposure on a day-to-day basis. Exposure information is also available to contribute to Energy Research and Development Administration statistics and to the National Transuranium Registry
Energy Technology Data Exchange (ETDEWEB)
Lenio, Martha A.T. [REC Technology US, Inc., 1159 Triton Dr., Foster City, CA 94301 (United States); Lennon, A.J.; Ho-Baillie, A.; Wenham, S.R. [ARC Photovoltaics Centre of Excellence, University of NSW, Sydney, NSW 2052 (Australia)
2010-12-15
Many existing and emerging solar cell technologies rely on plated metal to form the front surface contacts, and aluminium to form the rear contact. Interactions between the metal plating solutions and the aluminium rear can have a significant impact on cell performance. This paper describes non-uniform nickel deposition on the sintered aluminium rear surface of passivated emitter and rear contacted (PERC) cells patterned using an inkjet printing technique. Rather than being plated homogeneously over the entire rear surface as is observed on an alloyed aluminium rear, the nickel is plated only in the vicinity of the point openings in the rear surface silicon dioxide dielectric layer. Furthermore, this non-uniform nickel deposition was shown to increase the contact resistance of the rear point contacts by an order of magnitude, resulting in higher series resistance values for these fabricated PERC cells. (author)
Beryllium health effects in the era of the beryllium lymphocyte proliferation test.
Maier, L A
2001-05-01
The beryllium lymphocyte proliferation test (BeLPT) has revolutionized our approach to the diagnosis, screening, and surveillance of beryllium health effects. Based on the development of a beryllium-specific cell-mediated immune response, the BeLPT has allowed us to define early health effects of beryllium, including beryllium sensitization (BeS), and chronic beryllium disease (CBD) at a subclinical stage. The use of this test as a screening tool has improved our understanding of these health effects. From a number of studies it is apparent that BeS precedes CBD and develops after as little as 9 weeks of beryllium exposure. CBD occurs within 3 months and up to 30 years after initial beryllium exposure. Exposure-response variables have been associated with BeS/CBD, including work as a machinist, chemical or metallurgical operator, laboratory technician, work in ceramics or beryllium metal production, and years of beryllium exposure. Recent studies have found BeS and CBD in workplaces in which the majority of exposures were below the 2 microg/m3 OSHA time-weighted average (TWA). Ideally, the BeLPT would be used in surveillance aimed at defining other risk-related processes, determining exposure variables which predict BeS and CBD, and defining the exposure level below which beryllium health effects do not occur. Unfortunately, the BeLPT can result in false negative tests and still requires an invasive procedure, a bronchoscopy, for the definitive diagnosis of CBD. Thus, research is needed to establish new tests to be used alone or in conjunction with the BeLPT to improve our ability to detect early beryllium health effects.
Directory of Open Access Journals (Sweden)
Elena Okisheva
2017-01-01
Evaluation of HRT, DC and mTWA during 24-hour ECG monitoring may define the high risk of cardiovascular mortality and SCD in post-MI patients especially during the first 12 months after the baseline examination.
Dierschke, Katrin; Isaxon, Christina; Andersson, Ulla B K; Assarsson, Eva; Axmon, Anna; Stockfelt, Leo; Gudmundsson, Anders; Jönsson, Bo A G; Kåredal, Monica; Löndahl, Jakob; Pagels, Joakim; Wierzbicka, Aneta; Bohgard, Mats; Nielsen, Jörn
2017-07-01
Welders are exposed to airborne particles from the welding environment and often develop symptoms work-related from the airways. A large fraction of the particles from welding are in the nano-size range. In this study we investigate if the welders' airways are affected by exposure to particles derived from gas metal arc welding in mild steel in levels corresponding to a normal welding day. In an exposure chamber, 11 welders with and 10 welders without work-related symptoms from the lower airways and 11 non-welders without symptoms, were exposed to welding fumes (1 mg/m 3 ) and to filtered air, respectively, in a double-blind manner. Symptoms from eyes and upper and lower airways and lung function were registered. Blood and nasal lavage (NL) were sampled before, immediately after and the morning after exposure for analysis of markers of oxidative stress. Exhaled breath condensate (EBC) for analysis of leukotriene B4 (LT-B4) was sampled before, during and immediately after exposure. No adverse effects of welding exposure were found regarding symptoms and lung function. However, EBC LT-B4 decreased significantly in all participants after welding exposure compared to filtered air. NL IL-6 increased immediately after exposure in the two non-symptomatic groups and blood neutrophils tended to increase in the symptomatic welder group. The morning after, neutrophils and serum IL-8 had decreased in all three groups after welding exposure. Remarkably, the symptomatic welder group had a tenfold higher level of EBC LT-B4 compared to the two groups without symptoms. Despite no clinical adverse effects at welding, changes in inflammatory markers may indicate subclinical effects even at exposure below the present Swedish threshold limit (8 h TWA respirable dust).
Driver response to the TetraStar Navigation Assistance System by age and sex
1997-07-01
This study is part of the evaluation of the FAST-TRAC operational test of an Intelligent Transportation System (ITS) in Michigan and is concerned with user perceptions and behaviors with Advanced Traveler Information Systems (ATIS). The use and perce...
Yang, J S; Kim, E A; Lee, M Y; Park, I J; Kang, S K
2000-09-01
The objective of this study is to assess the exposure and intake dose of N,N-dimethylformamide (DMF) and the correlation between them, according to the type of exposure for the workers in the DMF industry. We monitored 345 workers occupationally exposed to DMF, from 15 workshops in the synthetic fiber, fiber coating, synthetic leather and paint manufacturing industries. Ambient monitoring was carried out with personal samplers to monitor the external exposure. Biological monitoring was done to determine the internal dose by analyzing N-methylformamide (NMF) in end-shift urine. Work procedure and exposure type of each DMF workshop was carefully surveyed, to classify workers by exposure type according to work details. Workers were classified into three groups (Group A: continuous and direct exposure through inhalation and skin; Group B: intermittent and short-term exposure through inhalation and skin; Group C: continuous and indirect exposure mostly through inhalation). Geometric mean of DMF concentration in air was 2.62 (GSD 5.30) ppm and that of NMF in urine was 14.50 (GSD 3.89) mg/l. In the case of continuous absorption through inhalation and dermal exposure (Group A), the value of NMF in urine corresponding to 10 ppm of DMF was 45.3 mg/l (r = 0.524, n = 178), 39.1 mg/g creatinine (r = 0.424), while it was 37.7 mg/l (r = 0.788, n = 37), 24.2 mg/g creatinine (r = 0.743) in the case of absorption mostly through inhalation (Group C). Creatinine correction reduced the correlation between two parameters. The NMF in urine corresponding to 10 ppm DMF, of the dermal and inhalation exposure group was 39.1 mg/g creatinine (r = 0.424, n = 178), while that of the inhalation exposure-only group was 24.2 mg/g creatinine (r = 0.743, n = 37). Co-exposure with toluene reduced the NMF excretion in urine.
DEFF Research Database (Denmark)
Munch, Anders V.
2004-01-01
Med udgangspunkt i principielle overvejelser af skalaer for design og tanken om at lave totaldesign eller Gesamtkunstwerk gennem alle skalaer laves et designhistorisk rids med analyse af eksempler som SAS Hotel Royal, TWA-terminalen og Odense Universitet....
Conflicting discourses of church youths on masculinity and sexuality ...
African Journals Online (AJOL)
However, a small number of participants challenged current gender norms and ... sexuality, young churchgoers, HIV prevention, gender equality, DR Congo ... Les garc¸ons ont e´te´ perc¸us comme des personnes qui ont des rapports sexuels ...
Soleo, Leonardo; Lovreglio, Piero; Panuzzo, Laura; D'Errico, Maria Nicolà; Basso, Antonella; Gilberti, Maria Enrica; Drago, Ignazio; Tomasi, Cesare; Apostoli, Pietro
2012-01-01
To study the urinary excretion of As, Cr, Mn, Co, Ni, Cu, Zn, Cd, Sn, Ba, Hg, Pb, Sb in workers at the Taranto integrated-cycle steel foundry and in subjects from the general population of Taranto, to assess the health risk posed by occupational exposure and environmental exposure, respectively, to these metals. The study included 49 steel foundry workers (exposed), working in the minerals and agglomerates pools, steel processing plants 1 and 2 and maritime plants, and 50 subjects belonging to the general population of Taranto resident at various distances from the factory (controls), randomly selected from the exposed subjects and controls enrolled in previous research conducted in 2005. A questionnaire was administered to all participants, enquiring into general characteristics, lifestyle, diet, and any medical conditions. Informed written consent to take part in the study was obtained from all subjects before enrolment. The results of environmental monitoring performed in 2005 in the workers' sectors, consisting of determining As, Cr, Mn, Ni, Cu, Zn, Cd and Pb in the respirable dust, revealed by both samplers applied in fixed positions and personal samplers, were considered. Urine samples were obtained from all participants on a Friday, to determine As and Cr by AAS and all the other metal elements by a multielement technique with ICP-MS. Urinary creatinine was also determined to make any necessary adjustments. All urine analyses were performed in 2005 within one month of urine collection. In the respirable dust, As and Cd were always within the LOD, whereas Cr, Mn, Ni, Cu and Pb were 1-2 orders of magnitude below the respective TLV-TWA of the ACGIH. Mn was the only metal element that presented significantly higher urinary concentrations in exposed subjects as compared to controls, although the values in both groups were in any case within the Italian reference range. Co, Cu, Zn, Sn and Sb showed significantly higher urinary concentrations in controls than in
EPA EcoBox Tools by Exposure Pathways - Exposure Pathways In ERA
Eco-Box is a toolbox for exposure assessors. Its purpose is to provide a compendium of exposure assessment and risk characterization tools that will present comprehensive step-by-step guidance and links to relevant exposure assessment data bases
Directory of Open Access Journals (Sweden)
Serkan AKKOYUNLU
2013-07-01
Full Text Available Introduction: Exposure with response prevention is an effective treatment for all anxiety disorders. According to the behavioral learning theories, fears which are conditioned via classical conditioning are reinforced by respondent conditioning. Avoidance and safety seeking behaviors prevent disconfirmation of anxious beliefs. In exposure client faces stimulates or cues that elicit fear or distress, by this avoidance is inhibited. Clients are also encouraged to resists performing safety seeking behaviors or rituals that they utilize to reduce fear or distress. Accomplishing these habituation or extinction is achieved. In addition to this clients learn that feared consequences does not realize or not harmful as they believed by experiencing. Emotional processing is believed to be the mechanism of change in exposure.Objective: The aim of this review is to provide a definition of exposure and its effectiveness briefly, and describe how to implement exposure, its steps and remarkable aspects using. Exposure therapies and treatments that involve exposure are proved to be effective in all anxiety disorders. Exposure therapy can be divided in three parts: Assessment and providing a treatment rationale, creating an exposure hierarchy and response prevention plan, implementing exposure sessions. Clients must also continue to perform exposure between sessions. Therapy transcripts are also provided to exemplify these parts. Conclusion: Exposure with response prevention is a basic and effective technique. Every cognitive behavior therapist must be able to implement this technique and be cognizant of pearls of this procedure.
Kurth, Laura; Doney, Brent; Weinmann, Sheila
2017-03-01
To compare the occupational exposure levels assigned by our National Institute for Occupational Safety and Health chronic obstructive pulmonary disease-specific job exposure matrix (NIOSH COPD JEM) and by expert evaluation of detailed occupational information for various jobs held by members of an integrated health plan in the Northwest USA. We analysed data from a prior study examining COPD and occupational exposures. Jobs were assigned exposure levels using 2 methods: (1) the COPD JEM and (2) expert evaluation. Agreement (Cohen's κ coefficients), sensitivity and specificity were calculated to compare exposure levels assigned by the 2 methods for 8 exposure categories. κ indicated slight to moderate agreement (0.19-0.51) between the 2 methods and was highest for organic dust and overall exposure. Sensitivity of the matrix ranged from 33.9% to 68.5% and was highest for sensitisers, diesel exhaust and overall exposure. Specificity ranged from 74.7% to 97.1% and was highest for fumes, organic dust and mineral dust. This COPD JEM was compared with exposures assigned by experts and offers a generalisable approach to assigning occupational exposure. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.
Nanoparticle exposure biomonitoring: exposure/effect indicator development approaches
Marie-Desvergne, C.; Dubosson, M.; Lacombe, M.; Brun, V.; Mossuz, V.
2015-05-01
The use of engineered nanoparticles (NP) is more and more widespread in various industrial sectors. The inhalation route of exposure is a matter of concern (adverse effects of air pollution by ultrafine particles and asbestos). No NP biomonitoring recommendations or standards are available so far. The LBM laboratory is currently studying several approaches to develop bioindicators for occupational health applications. As regards exposure indicators, new tools are being implemented to assess potentially inhaled NP in non-invasive respiratory sampling (nasal sampling and exhaled breath condensates (EBC)). Diverse NP analytical characterization methods are used (ICP-MS, dynamic light scattering and electron microscopy coupled to energy-dispersive X-ray analysis). As regards effect indicators, a methodology has been developed to assess a range of 29 cytokines in EBCs (potential respiratory inflammation due to NP exposure). Secondly, collaboration between the LBM laboratory and the EDyp team has allowed the EBC proteome to be characterized by means of an LC-MS/MS process. These projects are expected to facilitate the development of individual NP exposure biomonitoring tools and the analysis of early potential impacts on health. Innovative techniques such as field-flow fractionation combined with ICP-MS and single particle-ICPMS are currently being explored. These tools are directly intended to assist occupational physicians in the identification of exposure situations.
Nanoparticle exposure biomonitoring: exposure/effect indicator development approaches
International Nuclear Information System (INIS)
Marie-Desvergne, C; Dubosson, M; Mossuz, V; Lacombe, M; Brun, V
2015-01-01
The use of engineered nanoparticles (NP) is more and more widespread in various industrial sectors. The inhalation route of exposure is a matter of concern (adverse effects of air pollution by ultrafine particles and asbestos). No NP biomonitoring recommendations or standards are available so far. The LBM laboratory is currently studying several approaches to develop bioindicators for occupational health applications. As regards exposure indicators, new tools are being implemented to assess potentially inhaled NP in non-invasive respiratory sampling (nasal sampling and exhaled breath condensates (EBC)). Diverse NP analytical characterization methods are used (ICP-MS, dynamic light scattering and electron microscopy coupled to energy-dispersive X-ray analysis). As regards effect indicators, a methodology has been developed to assess a range of 29 cytokines in EBCs (potential respiratory inflammation due to NP exposure). Secondly, collaboration between the LBM laboratory and the EDyp team has allowed the EBC proteome to be characterized by means of an LC-MS/MS process. These projects are expected to facilitate the development of individual NP exposure biomonitoring tools and the analysis of early potential impacts on health. Innovative techniques such as field-flow fractionation combined with ICP-MS and single particle-ICPMS are currently being explored. These tools are directly intended to assist occupational physicians in the identification of exposure situations. (paper)
Comparative pharmacology of a new recombinant FSH expressed by a human cell line
DEFF Research Database (Denmark)
Koechling, Wolfgang; Plaksin, Daniel; Croston, Glenn E.
2017-01-01
Recombinant FSH proteins are important therapeutic agents for the treatment of infertility, including follitropin alfa expressed in Chinese Hamster Ovary (CHO) cells and, more recently, follitropin delta expressed in the human cell line PER.C6. These recombinant FSH proteins have distinct glycosy...
Eliminating the mere exposure effect through changes in context between exposure and test.
de Zilva, Daniel; Mitchell, Chris J; Newell, Ben R
2013-01-01
The present study examined the extent to which increased liking of exposed stimuli--the mere exposure effect--is dependent on experiencing the stimuli in the same context in exposure and on test. Participants were repeatedly exposed to pairs of cues (nonsense words) and target stimuli (faces and shapes), and were asked to rate the pleasantness of the target stimuli in a subsequent test phase. Familiar targets were preferred to novel targets-a mere exposure effect was obtained. This preference for familiar targets was disrupted, however, when the cue-target pairings were rearranged between exposure and test, or a novel cue was introduced at test. Overall, the study suggests that the context of exposure and test moderates the mere exposure effect. Liking of stimuli due to exposure is specific to the context of exposure and does not apply to new or familiar but different contexts.
Lower Red River Meadow Stream Restoration Project
International Nuclear Information System (INIS)
1996-05-01
As part of a continuing effort to restore anadromous fish populations in the South Fork Clearwater River basin of Idaho, Bonneville Power Administration (BPA) proposes to fund the Lower Red River Meadow Restoration Project (Project). The Project is a cooperative effort with the Idaho Soil and Water Conservation District, Nez Perce National Forest, Idaho Department of Fish and Game (IDFG), and the Nez Perce Tribe of Idaho. The proposed action would allow the sponsors to perform stream bank stabilization, aquatic and riparian habitat improvement activities on IDFG's Red River Management Area and to secure long-term conservation contracts or agreements for conducting streambank and habitat improvement activities with participating private landowners located in the Idaho County, Idaho, study area. This preliminary Environmental Assessment (EA) examines the potential environmental effects of stabilizing the stream channel, restoring juvenile fish rearing habitat and reestablishing a riparian shrub community along the stream
Personal exposure control system
International Nuclear Information System (INIS)
Tanabe, Ken-ichi; Akashi, Michio
1994-01-01
Nuclear power stations are under strict radiation control. Exposure control for nuclear workers is the most important operation, and so carefully thought out measures are taken. This paper introduces Fuji Electric's personal exposure control system that meets strict exposure control and rationalizes control operations. The system has a merit that it can provide required information in an optimum form using the interconnection of a super minicomputer and exposure control facilities and realizes sophisticated exposure control operations. (author)
Application of maximum radiation exposure values and monitoring of radiation exposure
International Nuclear Information System (INIS)
1996-01-01
The guide presents the principles to be applied in calculating the equivalent dose and the effective dose, instructions on application of the maximum values for radiation exposure, and instruction on monitoring of radiation exposure. In addition, the measurable quantities to be used in monitoring the radiation exposure are presented. (2 refs.)
Affecting Factors of Secondhand Smoke Exposure in Korea: Focused on Different Exposure Locations.
Sun, Li Yuan; Cheong, Hae Kwan; Lee, Eun Whan; Kang, Kyeong Jin; Park, Jae Hyun
2016-09-01
Exposure to secondhand smoke (SHS) not only can cause serious illness, but is also an economic and social burden. Contextual and individual factors of non-smoker exposure to SHS depend on location. However, studies focusing on this subject are lacking. In this study, we described and compared the factors related to SHS exposure according to location in Korea. Regarding individual factors related to SHS exposure, a common individual variable model and location-specific variable model was used to evaluate SHS exposure at home/work/public locations based on sex. In common individual variables, such as age, and smoking status showed different relationships with SHS exposure in different locations. Among home-related variables, housing type and family with a single father and unmarried children showed the strongest positive relationships with SHS exposure in both males and females. In the workplace, service and sales workers, blue-collar workers, and manual laborers showed the strongest positive association with SHS exposure in males and females. For multilevel analysis in public places, only SHS exposure in females was positively related with cancer screening rate. Exposure to SHS in public places showed a positive relationship with drinking rate and single-parent family in males and females. The problem of SHS embodies social policies and interactions between individuals and social contextual factors. Policy makers should consider the contextual factors of specific locations and regional and individual context, along with differences between males and females, to develop effective strategies for reducing SHS exposure.
OCCUPATIONAL EXPOSURE AND COPD
DEFF Research Database (Denmark)
Würtz, Else Toft
Chronic Obstructive Pulmonary Disease (COPD) is a common disease. The main risk factor is smoking although 15% of the COPD cases are expected to be preventable if the occupational exposures from vapour, gas, dust, and fume were eliminated; the population attributable fraction (PAF). The thesis...... addresses the association between occupational exposure and COPD in a population-based cohort of Danes aged 45-84-years. 4717 participants were included at baseline and 2624 at the four year follow-up. COPD was defined by spirometry and the occupational exposure was based on specialist defined jobs...... and questionnaires. The main occupational exposure was organic dust and 49% reported no lifetime occupational exposure. The results suggest occupational exposures to be associated to COPD also in never smokers and women. We found an exposure-response relation in the cross sectional analyses. The results...
International Nuclear Information System (INIS)
2002-01-01
the Action Level. In this case, however, monitoring was conducted during a simulation, not during the actual work conducted at the worksite. Additional sampling should be conducted at the worksite to determine the actual noise levels for the workers. Until it is determined that the actual TWA's are less than the Action Level, the workers should use PPE. A training program on the proper use and wearing of the selected PPE should be provided to each worker. Nuisance dust monitoring yielded a concentration of 10.69 milligrams per cubic meter (mg/m 3 ). Although this is less than the OSHA Permissible Exposure Limit (PEL) of 15 mg/m 3 , it is above the American Conference of Governmental Industrial Hygienists' (ACGIH) Threshold Limit Value (TLV) of 10 mg/m 3 . Fiberglass dust monitoring yielded a fiber count of 1.7 fibers per cubic centimeter (f/cc). This is above the PEL and the TLV of 1.0 f/cc. Therefore, controls should be implemented (engineering or PPE) to reduce the workers' exposure to the dust. Respirators should be used if engineering controls do not sufficiently control the dust or fiberglass generated. Respirators should be equipped with an organic vapor and acid gas cartridge with a High Efficiency Particulate Air (HEPA) filter, since during the demonstration, the workers complained of an odd smell, which may have been from the breakdown of the fiberglass
Intuitive Understanding of Base Rates
DEFF Research Database (Denmark)
Austin, Laurel
Purpose: This study examines whether physicians and other adults intuitively understand that the probability a positive test result is a true positive (positive predictive value, PPV) depends on the base rate of disease in the population tested. In particular, this research seeks to examine perce...
Sensitivity analysis of bridge health index to element failure and element conditions.
2009-11-01
Bridge Health Index (BHI) is a bridge performance measure based on the condition of the bridge elements. It : is computed as the ratio of remaining value of the bridge structure to the initial value of the structure. Since it : is expressed as a perc...
DEFF Research Database (Denmark)
Liversage, Anika; Jakobsen, Vibeke
2010-01-01
While considerable research exists on U.S. immigrant groups living in extended households, little is available on such households in Europe. This article therefore analyzes extended household living among Turkish immigrants in Denmark. From register and survey data, the article finds that 77 perc...
Self-perceived lactose intolerance may result in adverse dietary modifications; thus, more studies are needed to understand the prevalence of self-perceived lactose intolerance and how it relates to calcium intake and selected health conditions. The objective was to examine the effects of self-perce...
Veiga, Feliciano; Marques, Paulo
2001-01-01
A falta de instrumentos de avaliação da perceção dos professores acerca dos alunos sobredotados justificou o desenvolvimento da denominada "Escala de Representações dos Professores acerca dos Alunos Sobredotados" (ERPAS). Esta escala revelou adequadas qualidades psicométricas.
Contaminant exposure in terrestrial vertebrates
International Nuclear Information System (INIS)
Smith, Philip N.; Cobb, George P.; Godard-Codding, Celine; Hoff, Dale; McMurry, Scott T.; Rainwater, Thomas R.; Reynolds, Kevin D.
2007-01-01
Here we review mechanisms and factors influencing contaminant exposure among terrestrial vertebrate wildlife. There exists a complex mixture of biotic and abiotic factors that dictate potential for contaminant exposure among terrestrial and semi-terrestrial vertebrates. Chemical fate and transport in the environment determine contaminant bioaccessibility. Species-specific natural history characteristics and behavioral traits then play significant roles in the likelihood that exposure pathways, from source to receptor, are complete. Detailed knowledge of natural history traits of receptors considered in conjunction with the knowledge of contaminant behavior and distribution on a site are critical when assessing and quantifying exposure. We review limitations in our understanding of elements of exposure and the unique aspects of exposure associated with terrestrial and semi-terrestrial taxa. We provide insight on taxa-specific traits that contribute, or limit exposure to, transport phenomenon that influence exposure throughout terrestrial systems, novel contaminants, bioavailability, exposure data analysis, and uncertainty associated with exposure in wildlife risk assessments. Lastly, we identify areas related to exposure among terrestrial and semi-terrestrial organisms that warrant additional research. - Both biotic and abiotic factors determine chemical exposure for terrestrial vertebrates
Coho Salmon Master Plan, Clearwater River Basin.
Energy Technology Data Exchange (ETDEWEB)
Nez Perce Tribe; FishPro
2004-10-01
The Nez Perce Tribe has a desire and a goal to reintroduce and restore coho salmon to the Clearwater River Subbasin at levels of abundance and productivity sufficient to support sustainable runs and annual harvest. Consistent with the Clearwater Subbasin Plan (EcoVista 2003), the Nez Perce Tribe envisions developing an annual escapement of 14,000 coho salmon to the Clearwater River Subbasin. In 1994, the Nez Perce Tribe began coho reintroduction by securing eggs through U.S. v. Oregon; by 1998 this agreement provided an annual transfer of 550,000 coho salmon smolts from lower Columbia River hatchery facilities for release in the Clearwater River Subbasin. In 1998, the Northwest Power and Conservation Council authorized the Bonneville Power Administration to fund the development of a Master Plan to guide this reintroduction effort. This Master Plan describes the results of experimental releases of coho salmon in the Clearwater River Subbasin, which have been ongoing since 1995. These data are combined with results of recent coho reintroduction efforts by the Yakama Nation, general coho life history information, and historical information regarding the distribution and life history of Snake River coho salmon. This information is used to assess a number of alternative strategies aimed at restoring coho salmon to historical habitats in the Clearwater River subbasin. These data suggest that there is a high probability that coho salmon can be restored to the Clearwater River subbasin. In addition, the data also suggest that the re-establishment of coho salmon could be substantially aided by: (1) the construction of low-tech acclimation facilities; (2) the establishment of a 'localized' stock of coho salmon; and (3) the construction of hatchery facilities to provide a source of juvenile coho salmon for future supplementation activities. The Nez Perce Tribe recognizes that there are factors which may limit the success of coho reintroduction. As a result of these
Yan, Zhengyu; Yan, Kun; He, Xingliang; Liu, Yanhua; Zhang, Jie; Lopez Torres, Oscar; Guo, Ruixin; Chen, Jianqiu
2017-10-01
The anticancer drugs are getting increasing attention as an emerging contaminant in the aquatic environments. In the present study, feeding behavior of the rotifer Brachionus calyciflorus under the impact of anticancer drug imatinib was evaluated. Traditional toxicological studies usually focus on dose-effect relationship at a given exposure time, while ignore the possible impact after the exposure. Thus, how the impact varied in the post-exposure and re-exposure was also considered in the present study. The feeding depression of the rotifers was attributed to the increased concentration of imatinib. Although the filtration and ingestion rate of the rotifers recovered to a certain extent after the exposure, the significant feeding inhibition still persisted even if the exposure was ended. In the re-exposure period, the feeding behavior was less depressed than those of the exposure period, which implied that rotifers might develop a tolerance to the same toxics. The activities of acetylcholine esterase (AchE) and the levels of reactive oxygen species (ROS) in rotifers were also detected. Imatinib inhibited the activities of AchE in the exposure and re-exposure while ROS levels increased significantly in the re-exposure period. Our present study provided an integrated assessment the potential environmental risks of imatinib at a new perspective. Copyright © 2017 Elsevier Ltd. All rights reserved.
Factors Associated With Non-compliance of Asbestos Occupational Standards in Brake Repair Workers.
Cely-García, María Fernanda; Curriero, Frank C; Giraldo, Margarita; Méndez, Lorena; Breysse, Patrick N; Durán, Mauricio; Torres-Duque, Carlos A; González-García, Mauricio; Pérez, Carolina; Parada, Patricia; Ramos-Bonilla, Juan Pablo
2016-10-01
Asbestos and non-asbestos containing brake products are currently used in low- and middle-income countries like Colombia. Because brake products are distributed detached from their supports, they require manipulation before installation, which release fibers and expose workers. Previous studies of our research group have documented exposures in excess of the widely accepted 0.1 f/cm(3) exposure guideline. The aim of this study is to identify factors associated with non-compliance of the 8-h time weighted average (TWA) 0.1 f/cm(3) asbestos occupational limit among brake mechanics (i.e. riveters). Eighteen brake repair shops (BRS) located in Bogotá (Colombia) were sampled during 3 to 6 consecutive days for the entire work-shift. Personal and short-term personal samples were collected following NIOSH methods 7400 and 7402. Longitudinal based logistic regression models were used to determine the association between the odds of exceeding the 8-h TWA 0.1 f/cm(3) asbestos occupational limit and variables such as type of tasks performed by workers, workload (number of products manipulated daily), years of experience as riveters, and shop characteristics. These models can be used to estimate the odds of being currently or historically overexposed when sampling data do not exist. Since the information required to run the models can vary for both retrospective and current asbestos occupational exposure studies, three models were constructed with different information requirements. The first model evaluated the association between the odds of non-compliance with variables related to the workload, the second model evaluated the association between the odds of non-compliance with variables related to the manipulation tasks, and the third model evaluated the association between the odds of non-compliance with variables related with both the type of tasks performed by workers and the workload. Variables associated with the odds of non-compliance included conducting at least one
Park, Ji Young; Ramachandran, Gurumurthy; Raynor, Peter C; Eberly, Lynn E; Olson, Greg
2010-10-01
Recently, the appropriateness of using the 'mass concentration' metric for ultrafine particles has been questioned and surface area (SA) or number concentration metrics has been proposed as alternatives. To assess the abilities of various exposure metrics to distinguish between different exposure zones in workplaces with nanoparticle aerosols, exposure concentrations were measured in preassigned 'high-' and 'low-'exposure zones in a restaurant, an aluminum die-casting factory, and a diesel engine laboratory using SA, number, and mass concentration metrics. Predetermined exposure classifications were compared by each metric using statistical parameters and concentration ratios that were calculated from the different exposure concentrations. In the restaurant, SA and fine particle number concentrations showed significant differences between the high- and low-exposure zones and they had higher contrast (the ratio of between-zone variance to the sum of the between-zone and within-zone variances) than mass concentrations. Mass concentrations did not show significant differences. In the die cast facility, concentrations of all metrics were significantly greater in the high zone than in the low zone. SA and fine particle number concentrations showed larger concentration ratios between the high and low zones and higher contrast than mass concentrations. None of the metrics were significantly different between the high- and low-exposure zones in the diesel engine laboratory. The SA and fine particle number concentrations appeared to be better at differentiating exposure zones and finding the particle generation sources in workplaces generating nanoparticles. Because the choice of an exposure metric has significant implications for epidemiologic studies and industrial hygiene practice, a multimetric sampling approach is recommended for nanoparticle exposure assessment.
Nature of activities and natural, artificial, accidental exposures. Magnitude of these exposures
International Nuclear Information System (INIS)
Aurengo, A.
2009-01-01
The exposure to ionizing radiation (I.R.) is linked to radioelements of organism (9%), earth (12%), cosmic radiation (10%), radon (37%), atmospheric fallout ( nuclear tests 2.5% and industry 0.5%) and to medical procedures (29%). The natural exposure varies in France from 2.5 to 5 mSv by year. In some areas in the world it reaches several tens of mSv by year. The medical exposure is very heterogeneous and concerns particularly old people. For a same examination, the patients exposure varies in an important way ( sometimes from 1 to 10) according to the country, even in France. In France, 250 000 persons are occupationally exposed to ionizing radiation. Among these ones, the most of cases exceeded regulatory limits for exposure to IR concern the health sector. The accidental exposures are in relation with industrial activities (51%) research (20%) civil nuclear (13%) or military (5%) and medical activities (11%). The exposures and then the consequences are very variable, ranging from death to unapparent consequences. in the most of cases a human error is involved and these accidents could have been avoided through measures of prevention and training. (N.C.)
Application of maximum radiation exposure values and monitoring of radiation exposure
International Nuclear Information System (INIS)
1993-01-01
According to the Section 32 of the Radiation Act (592/91) the Finnish Centre for Radiation and Nuclear Safety gives instructions concerning the monitoring of the radiation exposure and the application of the dose limits in Finland. The principles to be applied to calculating the equivalent and the effective doses are presented in the guide. Also the detailed instructions on the application of the maximum exposure values for the radiation work and for the natural radiation as well as the instructions on the monitoring of the exposures are given. Quantities and units for assessing radiation exposure are presented in the appendix of the guide
Notas de filología micénica, III: el silabograma *86
Directory of Open Access Journals (Sweden)
José L. Melena
1983-12-01
Full Text Available In spite of various efforts, a few syllabograms in the Mycenaean Linear B signary are still unidentified and hence they remain untransliterated. The following is an attempt to deciphering the value of the syllabogram *86 attested exclusively in personal and place names, a fact that increases the difficulties in discovering its value, since contextual hints are not at work. After reviewing the dossier of *86, the author puts forward a transliteration dwa for this sign, which is therefore to be aligned with such compound signs as dwe and dwo. The existence of such a triplet of signs (dwa dwe dwo prompts the subsequent search for a sign twa to be similarly aligned with the extant twe and two. In an excursus the author thinks of the syllabogram *82 as the most tempting candidate to fill the slot for twa in the Linear B signary.
Smoke exposure at western wildfires.
Timothy E. Reinhardt; Roger D. Ottmar
2000-01-01
Smoke exposure measurements among firefighters at wildfires in the Western United States between 1992 and 1995 showed that altogether most exposures were not significant, between 3 and 5 percent of the shift-average exposures exceeded occupational exposure limits for carbon monoxide and respiratory irritants. Exposure to benzene and total suspended particulate was not...
Virtual reality exposure therapy
Rothbaum, BO; Hodges, L; Kooper, R
1997-01-01
It has been proposed that virtual reality (VR) exposure may be an alternative to standard in vivo exposure. Virtual reality integrates real-time computer graphics, body tracking devices, visual displays, and other sensory input devices to immerse a participant in a computer- generated virtual environment. Virtual reality exposure is potentially an efficient and cost-effective treatment of anxiety disorders. VR exposure therapy reduced the fear of heights in the first control...
Determinants of Dermal Exposure Relevant for Exposure Modelling in Regulatory Risk Assessment
Marquart, J.; Brouwer, D.H.; Gijsbers, J.H.J.; Links, I.H.M.; Warren, N.; Hemmen, J.J. van
2003-01-01
Risk assessment of chemicals requires assessment of the exposure levels of workers. In the absence of adequate specific measured data, models are often used to estimate exposure levels. For dermal exposure only a few models exist, which are not validated externally. In the scope of a large European
Lithium in Drinking Water and Incidence of Suicide
DEFF Research Database (Denmark)
Knudsen, Nikoline N.; Schullehner, Jörg; Hansen, Birgitte
2017-01-01
Suicide is a major public health concern. High-dose lithium is used to stabilize mood and prevent suicide in patients with affective disorders. Lithium occurs naturally in drinking water worldwide in much lower doses, but with large geographical variation. Several studies conducted at an aggregate...... level have suggested an association between lithium in drinking water and a reduced risk of suicide; however, a causal relation is uncertain. Individual-level register-based data on the entire Danish adult population (3.7 million individuals) from 1991 to 2012 were linked with a moving five-year time......-weighted average (TWA) lithium exposure level from drinking water hypothesizing an inverse relationship. The mean lithium level was 11.6 μg/L ranging from 0.6 to 30.7 μg/L. The suicide rate decreased from 29.7 per 100,000 person-years at risk in 1991 to 18.4 per 100,000 person-years in 2012. We found...
Lithium in drinking water and incidence of suicide
DEFF Research Database (Denmark)
Knudsen, Nikoline N.; Schullehner, Jörg; Hansen, Birgitte
2017-01-01
Suicide is a major public health concern. High-dose lithium is used to stabilize mood and prevent suicide in patients with affective disorders. Lithium occurs naturally in drinking water worldwide in much lower doses, but with large geographical variation. Several studies conducted at an aggregate...... level have suggested an association between lithium in drinking water and a reduced risk of suicide; however, a causal relation is uncertain. Individual-level register-based data on the entire Danish adult population (3.7 million individuals) from 1991 to 2012 were linked with a moving five-year time......-weighted average (TWA) lithium exposure level from drinking water hypothesizing an inverse relationship. The mean lithium level was 11.6 µg/L ranging from 0.6 to 30.7 µg/L. The suicide rate decreased from 29.7 per 100,000 person-years at risk in 1991 to 18.4 per 100,000 person-years in 2012. We found...
Sakurai, Kenji; Nakata, Aknori; Ikeda, Tomoko; Otsuka, Yasumasa; Kawahito, Junko
2014-01-01
This study explored whether workplace interpersonal conflict (WIC) is associated with insomnia, and whether the relationship between WIC and insomnia differs across different employment groups. A total of 37,646 Japanese full-time employees participated in a cross-sectional survey. Employment types included permanent employment and 2 forms of temporary employment: direct-hire and temporary work agent (TWA). Insomnia symptoms, including difficulty initiating sleep, difficulty maintaining sleep, and early morning awakening were measured. Insomnia was defined as having experienced 1 or more of these symptoms on ≥3 nights per week over the past 12 months. Results showed that WIC was significantly associated with an increased risk of insomnia (odds ratio OR = 1.63; 95% confidence interval CI = 1.55-1.71), controlling for confounders. However, the relationship between WIC and the risk of insomnia was significantly stronger for TWAs than for permanent employees (OR = 1.97; 95% CI = 1.13-3.45). A frequent exposure to WIC may increase the risk of insomnia, particularly for TWAs.
Exposure is not enough: suppressing stimuli from awareness can abolish the mere exposure effect.
Directory of Open Access Journals (Sweden)
Daniel de Zilva
Full Text Available Passive exposure to neutral stimuli increases subsequent liking of those stimuli--the mere exposure effect. Because of the broad implications for understanding and controlling human preferences, the role of conscious awareness in mere exposure has received much attention. Previous studies have claimed that the mere exposure effect can occur without conscious awareness of the stimuli. In two experiments, we applied a technique new to the mere exposure literature, called continuous flash suppression, to expose stimuli for a controlled duration with and without awareness. To ensure the reliability of the awareness manipulation, awareness was monitored on a trial-by-trial basis. Our results show that under these conditions the mere exposure effect does not occur without conscious awareness. In contrast, only when participants were aware of the stimuli did exposure increase liking and recognition. Together these data are consistent with the idea that the mere exposure effect requires conscious awareness and has important implications for theories of memory and affect.
Exposure is not enough: suppressing stimuli from awareness can abolish the mere exposure effect.
de Zilva, Daniel; Vu, Luke; Newell, Ben R; Pearson, Joel
2013-01-01
Passive exposure to neutral stimuli increases subsequent liking of those stimuli--the mere exposure effect. Because of the broad implications for understanding and controlling human preferences, the role of conscious awareness in mere exposure has received much attention. Previous studies have claimed that the mere exposure effect can occur without conscious awareness of the stimuli. In two experiments, we applied a technique new to the mere exposure literature, called continuous flash suppression, to expose stimuli for a controlled duration with and without awareness. To ensure the reliability of the awareness manipulation, awareness was monitored on a trial-by-trial basis. Our results show that under these conditions the mere exposure effect does not occur without conscious awareness. In contrast, only when participants were aware of the stimuli did exposure increase liking and recognition. Together these data are consistent with the idea that the mere exposure effect requires conscious awareness and has important implications for theories of memory and affect.
Bisbee, Yolanda J. Guzman
2013-01-01
This Indigenous Framed Research will utilize counter-storytelling through shared collaborator stories provided by Nez Perce Native American Graduates. The methodology is shaped by an Indigenous Framework as this form of research promotes and develops a culturally resonant environment for constructing, analyzing and sharing information. The…
Perceptions of team members working in cleft services in the United kingdom: a pilot study.
Scott, Julia K; Leary, Sam D; Ness, Andy R; Sandy, Jonathan R; Persson, Martin; Kilpatrick, Nicky; Waylen, Andrea E
2015-01-01
Cleft care provision in the United Kingdom has been centralized over the past 15 years to improve outcomes for children born with cleft lip and palate. However, to date, there have been no investigations to examine how well these multidisciplinary teams are performing. In this pilot study, a cross-sectional questionnaire surveyed members of all health care specialties working to provide cleft care in 11 services across the United Kingdom. Team members were asked to complete the Team Work Assessment (TWA) to investigate perceptions of team working in cleft services. The TWA comprises 55 items measuring seven constructs: team foundation, function, performance and skills, team climate and atmosphere, team leadership, and team identity; individual constructs were also aggregated to provide an overall TWA score. Items were measured using five-point Likert-type scales and were converted into percentage agreement for analysis. Responses were received from members of every cleft team. Ninety-nine of 138 cleft team questionnaires (71.7%) were returned and analyzed. The median (interquartile range) percentage of maximum possible score across teams was 75.5% (70.8, 88.2) for the sum of all items. Team performance and team identity were viewed most positively, with 82.0% (75.0, 88.2) and 88.4% (82.2, 91.4), respectively. Team foundation and leadership were viewed least positively with 79.0% (72.6, 84.6) and 76.6% (70.6, 85.4), respectively. Cleft team members perceive that their teams work well, but there are variations in response according to construct.
Environmental radioactivity and radiation exposure
International Nuclear Information System (INIS)
1980-01-01
In 1977 population exposure in the Federal Republic of Germany has not changed as compared to the previous years. The main share of the total exposure, nearly two thirds, is attributed to natural radioactive substances and cosmic radiation. The largest part (around 85%) of the artificial radiation exposure is caused by X-ray diagnostics. In comparison to this, radiation exposure from application of ionizing radiation in medical therapy, use of radioactive material in research and technology, or from nuclear facilities is small. As in the years before, population exposure caused by nuclear power plants and other nuclear facilities is distinctly less than 1% of the natural radiation exposure. This is also true for the average radiation exposure within a radius of 3 km around nuclear facilities. On the whole, the report makes clear that the total amount of artificial population exposure will substantially decrease only if one succeeds in reducing the high contribution to the radiation exposure caused by medical measures. (orig.) [de
Post-Exposure Prophylaxis (PEP)
... Child Transmission of HIV Post-Exposure Prophylaxis (PEP) Pre-Exposure Prophylaxis (PrEP) HIV Treatment HIV Treatment: The Basics Just ... to HIV frequently. Another HIV prevention method, called pre-exposure prophylaxis or PrEP, is when people at high risk ...
Development of acute exposure guideline levels for airborne exposures to hazardous substances.
Krewski, Daniel; Bakshi, Kulbir; Garrett, Roger; Falke, Ernest; Rusch, George; Gaylor, David
2004-04-01
Hazardous substances can be released into the atmosphere due to industrial and transportation accidents, fires, tornadoes, earthquakes, and terrorists, thereby exposing workers and the nearby public to potential adverse health effects. Various enforceable guidelines have been set by regulatory agencies for worker and ambient air quality. However, these exposure levels generally are not applicable to rare lifetime acute exposures, which possibly could occur at high concentrations. Acute exposure guideline levels (AEGLs) provide estimates of concentrations for airborne exposures for an array of short durations that possibly could cause mild (AEGL-1), severe, irreversible, potentially disabling adverse health effects (AEGL-2), or life threatening effects (AEGL-3). These levels can be useful for emergency responders and planners in reducing or eliminating potential risks to the public. Procedures and methodologies for deriving AEGLs are reviewed in this paper that have been developed in the United States, with direct input from international representatives of OECD member-countries, by the National Advisory Committee for Acute Exposure Guidelines for Hazardous Substances and reviewed by the National Research Council. Techniques are discussed for the extrapolation of effects across different exposure durations. AEGLs provide a viable approach for assisting in the prevention, planning, and response to acute airborne exposures to toxic agents.
Stimulus threat and exposure context modulate the effect of mere exposure on approach behaviors
Directory of Open Access Journals (Sweden)
Steven Young
2016-11-01
Full Text Available Mere-exposure research has found that initially neutral objects made familiar are preferred relative to novel objects. Recent work extends these preference judgments into the behavioral domain by illustrating that mere exposure prompts approach-oriented behavior toward familiar stimuli. However, no investigations have examined the effect of mere exposure on approach-oriented behavior toward threatening stimuli. The current work examines this issue and also explores how exposure context interacts with stimulus threat to influence behavioral tendencies. In two experiments participants were presented with both mere-exposed and novel stimuli and approach speed was assessed. In the first experiment, when stimulus threat was presented in a homogeneous format (i.e., participants viewed exclusively neutral or threatening stimuli, mere-exposure potentiated approach behaviors for both neutral and threatening stimuli. However, in the second experiment, in which stimulus threat was presented in a heterogeneous fashion (i.e., participants viewed both neutral and threatening stimuli, mere exposure facilitated approach only for initially neutral stimuli. These results suggest that mere-exposure effects on approach behaviors are highly context sensitive and depend on both stimulus valence and exposure context. Further implications of these findings for the mere-exposure literature are discussed.
Determinants of dermal exposure relevant for exposure modelling in regulatory risk assessment.
Marquart, J; Brouwer, D H; Gijsbers, J H J; Links, I H M; Warren, N; van Hemmen, J J
2003-11-01
Risk assessment of chemicals requires assessment of the exposure levels of workers. In the absence of adequate specific measured data, models are often used to estimate exposure levels. For dermal exposure only a few models exist, which are not validated externally. In the scope of a large European research programme, an analysis of potential dermal exposure determinants was made based on the available studies and models and on the expert judgement of the authors of this publication. Only a few potential determinants appear to have been studied in depth. Several studies have included clusters of determinants into vaguely defined parameters, such as 'task' or 'cleaning and maintenance of clothing'. Other studies include several highly correlated parameters, such as 'amount of product handled', 'duration of task' and 'area treated', and separation of these parameters to study their individual influence is not possible. However, based on the available information, a number of determinants could clearly be defined as proven or highly plausible determinants of dermal exposure in one or more exposure situation. This information was combined with expert judgement on the scientific plausibility of the influence of parameters that have not been extensively studied and on the possibilities to gather relevant information during a risk assessment process. The result of this effort is a list of determinants relevant for dermal exposure models in the scope of regulatory risk assessment. The determinants have been divided into the major categories 'substance and product characteristics', 'task done by the worker', 'process technique and equipment', 'exposure control measures', 'worker characteristics and habits' and 'area and situation'. To account for the complex nature of the dermal exposure processes, a further subdivision was made into the three major processes 'direct contact', 'surface contact' and 'deposition'.
Occupational exposures. Annex H
International Nuclear Information System (INIS)
1982-01-01
This Annex focuses on significant changes in the pattern of occupational exposure which have appeared since the 1972 and 1962 reports, and presents information on trends or particular causes of high exposures. A further objective is to clarify the reasons for which the Committee requires data on occupational exposure, and to suggest areas in which better data collection or analysis may be performed. Data are also reviewed on accidents involving the exposure of workers to substantial radiation doses.
Non-medical exposures - Ethical concerns
International Nuclear Information System (INIS)
O'Reilly, G.
2009-01-01
The scope of the Medical Exposure Directive (MED), 97/43/Euratom (Council Directive 97/43/EURATOM, on the health protection of individuals against the dangers of ionising radiation in relation to medical exposures. OJ L 180 of 09.07.1997), is such that it includes not only those exposures which are part of the normal diagnosis and treatment of patients but also exposures for occupational health surveillance, health-screening programmes, research and medico-legal exposures. This is the first time that radiation protection legislation has tried to deal explicitly with the issue of medico-legal exposures in a European Directive. However, it has done so in the context of a Directive whose primary focus is the protection of patients undergoing diagnostic or therapeutic medical exposures. This may not be an appropriate framework for medico-legal exposures. In considering medico-legal exposures, a significant number of ethical considerations arise. The MED may not adequately take account of these matters and in fact may not be a suitable legal instrument for dealing with them. This paper looks specifically at the issues surrounding medico-legal exposures and considers whether or not the current system provides adequate protection for the individuals exposed. (authors)
Career decision-making of the gifted and talented
African Journals Online (AJOL)
eleven gifted and talented high school students, studying in congregative gifted ... that all students have supports and guidance to promote successful ... The career or vocational counselling issues most discussed in the broader ... They suggest that the Theory of Work Adjustment (TWA; Dawis & ..... International handbook of.
2010-08-23
... technology and achievability, and that it update its Section 504 Handbook every three years. The Section 504 Handbook contains accessibility procedures and guidelines for releasing documents, holding meetings... TW-A325, Washington, DC 20554. All hand deliveries must be held together with rubber bands or...
Evaluation of environmental radiation exposure
International Nuclear Information System (INIS)
Imai, Kazuhiko
1974-01-01
The environmental radiation exposure due to radioactive rare gases is most important both at the time of reactor accidents and also in the long-term normal operation of reactor plants. The exposure dose is usually calculated by means of computers. The procedure of the calculation on environmental exposure dose is divided in several consecutive steps. The calculational formulae frequently used and those proposed recently are given with the explanation on released radionuclides, release to the atmosphere, concentration in the atmosphere, β-ray exposure, γ-ray exposure, and calculation of long-term exposure dose. (Mori, K.)
Moufid, Kamal; Abbaka, Najib; Touiti, Driss; Adermouch, Latifa; Amine, Mohamed; Lezrek, Mohammed
2013-07-01
The treatment for patients with large impacted proximal ureteral stone remains controversial, especially at institutions with limited resources. The aim of this study is to compare and to evaluate the outcome and complications of two main treatment procedures for impacted proximal ureteral calculi, retrograde ureterolithotripsy (URS), and percutaneous antegrade ureterolithotripsy (Perc-URS). Our inclusion criteria were solitary, radiopaque calculi, >15 mm in size in a functioning renal unit. Only those patients in whom the attempt at passing a guidewire or catheter beyond the calculus failed were included in this study. Between January 2007 and July 2011, a total of 52 patients (13 women and 39 men) with large impacted upper-ureteral calculi >15 mm and meeting the inclusion criteria were selected. Of these, Perc-URS was done in 22 patients (group 1) while retrograde ureteroscopy was performed in 30 patients (group 2). We analyzed operative time, incidence of complications during and after surgery, the number of postoperative recovery days, median total costs associated per patient per procedure, and the stone-free rate immediately after 5 days and after 1 month. Bivariate analysis used the Student t-test and the Mann-Whitney test to compare two means and Chi-square and Fisher's exact tests to compare two percentages. The significance level was set at 0.05. The mean age was 42.3 years (range 22-69). The mean stone sizes (mm) were 34 ± 1.2 and 29.3 ± 1.8 mm in group 1 and 2, respectively. In the Perc-URS group, 21 patients (95.45%) had complete calculus clearance through a single tract in one session of percutaneous surgery, whereas in the URS group, only 20 patients (66.7%) had complete stone clearance (P = 0.007). The mean operative time was higher in the Perc-URS group compared to group 2 (66.5 ± 21.7 vs. 52.13 ± 17.3 min, respectively; P = 0.013). Complications encountered in group 1 included transient postoperative fever (2 pts) and simple urine outflow (2
Natural radiation exposure indoors
International Nuclear Information System (INIS)
Brown, L.; Cliff, K.D.; Wrixon, A.D.
1981-01-01
A brief review is presented of the state of knowledge of indoor natural radiation exposure in the U.K. and the current survey work the N.R.P.B. is carrying out in this field. Discussion is limited in this instance to the improvement in estimation of population exposure and the identification of areas and circumstances in which high exposure occur, rather than the study of properties of a building and methods of building affecting exposure to radiation. (U.K.)
Jalali, Mahdi; Zare Sakhvidi, Mohammad Javad; Bahrami, Abdulrahman; Berijani, Nima; Mahjub, Hussein
2016-01-01
Silicosis is considered an oxidative stress related disease that can lead to the development of lung cancer. In this study, our purpose was to analysis of volatile organic compounds (VOCs) in the exhaled breath of workers exposed to silica containing dust and compare peak area of these compounds with silicosis patients and healthy volunteers (smokers and nonsmokers) groups. In this cross sectional case-control study, the exhaled breath of 69 subjects including workers exposed to silica (n=20), silicosis patient (n=4), healthy non-smoker (n=20) and healthy smoker (n=25) were analyzed. We collected breath samples using 3-liter Tedlar bags. The VOCs were extracted with solid phase micro-extraction (SPME) and analyzed by gas chromatography-mass spectrometry (GC-MS). Personal exposure intensity was measured according to NIOSH 7601 method. Respiratory parameters were measured using spirometry. Seventy percent and 100% of the exposures to crystalline silica dust exceeded from 8 h TWA ACGIH TLVs in case and positive control groups, respectively. A significant negative correlation was found between dust exposure intensity and FEV1/FVC when exposure and positive control groups were studied in a group (r2=-0.601, P<0.001). Totally, forty VOCs were found in all exhaled breath samples. Among the VOCs, the mean of peak area acetaldehyde, hexanal, nonanal, decane, pentad cane, 2-propanol and 3-hydroxy-2-butanone were higher in exhaled breath of the workers exposed to silica and silicosis patient compared to the healthy smoker and nonsmoker controls. In some cases the difference was significant (P<0.05). The analysis of some VOCs in exhaled breath of subjects is appropriate biomarker to determine of exposure to silica.
76 FR 44000 - Environmental Impact Statements; Notice of Availability
2011-07-22
..., Review Period Ends: 08/15/2011, Contact: Charles J. O'Neill 615-781-5772. EIS No. 20110226, Draft EIS, USFS, ID, Little Slate Project, Proposes Watershed Improvement, Timber Harvest, Fuel Treatments, Soil Restoration and Access Changes in the Little Slate Creek, Salmon River Ranger District, Nez Perce National...
Energy Technology Data Exchange (ETDEWEB)
Faurot, Dave; Kucera, Paul A.; Armstrong, Robyn D. (Nez Perce Tribe, Lapwai, ID)
1998-06-01
Chinook salmon populations in the Northwest are decreasing in number. The Nez Perce Tribe was funded in 1997 by the Bonneville Power Administration to coordinate and initiate gene banking of adult male gametes from Endangered Species Act (ESA) listed spring and summer chinook salmon in the Snake River basin.
Pärt, Arvo: De profundis / Barry Witherden
Witherden, Barry
1997-01-01
Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. Seven Magnificat Antiphons. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass)". Harmonia Mundi HMU40 7182; HMU90 7182 (76 minutes:DDD)
Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio / Marc Rochester
Rochester, Marc
1997-01-01
Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. Seven Magnificat Antiphons. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass). Harmonia Mundi HMU40 7182; HMU90 7182 (76 minutes:DDD)"
The Dioxin Exposure Initiative (DEI) is no longer active. This page contains a summary of the dioxin exposure initiative with illustrations, contact and background information.Originally supported by scientist Matthew Lorber, who retired in Mar 2017.
Energy Technology Data Exchange (ETDEWEB)
Lebret, E. [RIVM-National Inst. of Public Health and Environmental Protection (Netherlands)
1995-12-31
This article describes some of the features of the assessment of human exposure to environmental pollutants in epidemiological studies. Since exposure assessment in air pollution epidemiology studies typically involve professionals from various backgrounds, interpretation of a concepts like `exposure` may vary. A brief descriptions is therefore given by way of introduction
Energy Technology Data Exchange (ETDEWEB)
Lebret, E [RIVM-National Inst. of Public Health and Environmental Protection (Netherlands)
1996-12-31
This article describes some of the features of the assessment of human exposure to environmental pollutants in epidemiological studies. Since exposure assessment in air pollution epidemiology studies typically involve professionals from various backgrounds, interpretation of a concepts like `exposure` may vary. A brief descriptions is therefore given by way of introduction
van Oyen, Svein C; Peters, Susan; Alfonso, Helman; Fritschi, Lin; de Klerk, Nicholas H; Reid, Alison; Franklin, Peter; Gordon, Len; Benke, Geza; Musk, Arthur W
2015-07-01
Occupational exposure data on asbestos are limited and poorly integrated in Australia so that estimates of disease risk and attribution of disease causation are usually calculated from data that are not specific for local conditions. To develop a job-exposure matrix (AsbJEM) to estimate occupational asbestos exposure levels in Australia, making optimal use of the available exposure data. A dossier of all available exposure data in Australia and information on industry practices and controls was provided to an expert panel consisting of three local industrial hygienists with thorough knowledge of local and international work practices. The expert panel estimated asbestos exposures for combinations of occupation, industry, and time period. Intensity and frequency grades were estimated to enable the calculation of annual exposure levels for each occupation-industry combination for each time period. Two indicators of asbestos exposure intensity (mode and peak) were used to account for different patterns of exposure between occupations. Additionally, the probable type of asbestos fibre was determined for each situation. Asbestos exposures were estimated for 537 combinations of 224 occupations and 60 industries for four time periods (1943-1966; 1967-1986; 1987-2003; ≥2004). Workers in the asbestos manufacturing, shipyard, and insulation industries were estimated to have had the highest average exposures. Up until 1986, 46 occupation-industry combinations were estimated to have had exposures exceeding the current Australian exposure standard of 0.1 f ml(-1). Over 90% of exposed occupations were considered to have had exposure to a mixture of asbestos varieties including crocidolite. The AsbJEM provides empirically based quantified estimates of asbestos exposure levels for Australian jobs since 1943. This exposure assessment application will contribute to improved understanding and prediction of asbestos-related diseases and attribution of disease causation. © The
View point of medical exposure
International Nuclear Information System (INIS)
Akahane, Keiichi
2008-01-01
This text contains the following subjects. (1) Introduction, (2) Progress of medical examinations by radiation, (2-1) Decision of applying radiation, (2-2) Irradiation method, (2-3) Irradiation dose, (3) Exposure at medical examinations by radiation, (3-1) Dose to express the exposure, (3-2) Dose at medical exposure, (4) Types of medical examinations by radiation, (4-1) Radiation diagnosis, (4-2) Radiation therapy, (4-3) Nuclear medicine, (5) Radiation effects, (5-1) Types of radiation effect, (5-2) Effects of medical exposure, (6) Present status of medical examination by radiation, (6-1) Actual status of medical exposure, (6-2) Medical examinations by radiation in Japan, (7) Assessment of medical exposure, (7-1) Exposure dose, (7-2) Papers on radiation risk, and (7-3) Radiation protection. (K.Y.)
DEFF Research Database (Denmark)
Cesari, Matteo; Mehlsen, Jesper; Mehlsen, Anne-Birgitte
2016-01-01
T-wave amplitude (TWA) is a well know index of the autonomic innervation of the myocardium. However, until now it has been evaluated only manually or with simple and inefficient algorithms. In this paper, we developed a new robust single-lead electrocardiogram (ECG) T-wave delineation algorithm...
Understanding the spiral structure of the Milky Way using the local kinematic groups
Antoja Castelltort, Teresa; Figueras, F.; Romero-Gomez, M.; Pichardo, B.; Valenzuela, O.; Moreno, E.
2011-01-01
We study the spiral arm influence on the solar neighbourhood stellar kinematics. As the nature of the Milky Way (MW) spiral arms is not completely determined, we study two models: the Tight-Winding Approximation (TWA) model, which represents a local approximation, and a model with self-consistent
Stimulus threat and exposure context modulate the effect of mere exposure on approach behaviors
Steven Young; Heather Claypool; Isaiah Jones
2016-01-01
Mere-exposure research has found that initially neutral objects made familiar are preferred relative to novel objects. Recent work extends these preference judgments into the behavioral domain by illustrating that mere exposure prompts approach-oriented behavior toward familiar stimuli. However, no investigations have examined the effect of mere exposure on approach-oriented behavior toward threatening stimuli. The current work examines this issue and also explores how exposure context intera...
Fortes, Cristina; Mastroeni, Simona; Segatto M, Marjorie; Hohmann, Clarissa; Miligi, Lucia; Bakos, Lucio; Bonamigo, Renan
2016-04-01
The objective of the study was to examine the association between occupational exposure to pesticides and cutaneous melanoma, controlling for all possible confounders. A pooled analysis of two case-control studies was conducted in two different geographic areas (Italy and Brazil). Detailed pesticides exposure histories were obtained. Ever use of any pesticide was associated with a high risk of cutaneous melanoma (odds ratio 2.58; 95% confidence interval 1.18-5.65) in particular exposure to herbicides (glyphosate) and fungicides (mancozeb, maneb), after controlling for confounding factors. When subjects were exposed to both pesticides and occupational sun exposure, the risk increased even more (odds ratio 4.68; 95% confidence interval 1.29-17.0). The study suggests an augmented risk of cutaneous melanoma among subjects with exposure to pesticides, in particular among those exposed to occupational sun exposure.
Harris, Elizabeth; McFarland, Joyce; Siebold, Wendi; Aguilar, Rafael; Sarmiento, Ana
2007-01-01
The Idaho Consortium for Safe Schools Healthy Students consists of three school districts in rural North Central Idaho and the Nez Perce Tribe's Students for Success Program. Universal prevention programs implemented in the elementary schools include Second Step and the middle schools implemented the Life Skills program. Each of the three…
Industrially relevant Al2O3 deposition techniques for the surface passivation of Si solar cells
Schmidt, J.; Werner, F.; Veith, B.; Zielke, D.; Bock, R.; Tiba, M.V.; Poodt, P.; Roozeboom, F.; Li, A.; Cuevas, A.; Brendel, R.
2010-01-01
We present independently confirmed efficiencies of 21.4% for PERC cells with plasma-assisted atom-ic-layer-deposited (plasma ALD) Al2O3 rear passivation and 20.7% for cells with thermal ALD-Al2O3. Additionally, we evaluate three different industrially relevant techniques for the deposition of
increases in cross-sectional samples
African Journals Online (AJOL)
1971-03-27
Mar 27, 1971 ... TABLE Ill. PERCE 'TAGE INCREASES IN BODY M EASU REM ENTS .... population means (polynomials) for calculating total per- ... with age in males, except for very small increases in Bantu. ..... this applies at high levels of energy expenditure is another .... available for adults of all 4 populations studied.
Occupational risk and lifetime exposure
International Nuclear Information System (INIS)
Lapp, R.E.
1991-01-01
Any lowering of annual radiation limits for occupational exposure should be based on industry experience with lifetime doses and not on a worst case career exposure of 47 years. Two decades of experience show a lifetime accumulation of less than 1.5 rem for workers with measurable exposure. This is 5% of the normal lifetime exposure of Americans to natural and medical radiation. Any epidemiology of the US nuclear power workforce's two decade long exposure would have to focus on excess leukemia. Application of the Hiroshima and Nagasaki cancer mortality shows that too few leukemias would be expressed to permit a feasible epidemiology. Ionizing radiation appears to be a mild carcinogen as compared to physical and chemical agents presented in the occupational environment. A realistic factor in determining any change in occupational exposure limits for ionizing radiation should take into account the past performance of the licensee and potential health effects applicable to the workplace. Specifically, the lifetime exposure data for workers at nuclear power plants and naval shipyards should be considered. The nuclear industry and the US Navy have detailed data on the annual exposure of workers with a combined collective exposure approaching 1 million worker-rem. The lifetime dose for naval personnel and shipyard workers averages 1.1 rem J 1990. Shipyard workers have an annual dose of 0.28 rem per work-year and a mean exposure time of 4.4 years. The data apply to workers with measurable dose
Northeast Oregon Hatchery Spring Chinook Master Plan, Technical Report 2000.
Energy Technology Data Exchange (ETDEWEB)
Ashe, Becky L.; Concannon, Kathleen; Johnson, David B.
2000-04-01
Spring chinook salmon populations in the Imnaha and Grande Ronde rivers are listed as threatened under the Endangered Species Act (ESA) and are at high risk of extirpation. The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and Oregon Department of Fish and Wildlife, are co-managers of conservation/restoration programs for Imnaha and Grande Ronde spring chinook salmon that use hatchery supplementation and conventional and captive broodstock techniques. The immediate goal of these programs is to prevent extirpation and provide the potential for restoration once factors limiting production are addressed. These programs redirect production occurring under the Lower Snake River Compensation Plan (LSRCP) from mitigation to conservation and restoration. Both the Imnaha and Grande Ronde conservation/restoration programs are described in ESA Section 10 permit applications and the co-managers refer to the fish production from these programs as the Currently Permitted Program (CPP). Recently, co-managers have determined that it is impossible to produce the CPP at Lookingglass Hatchery, the LSRCP facility intended for production, and that without additional facilities, production must be cut from these conservation programs. Development of new facilities for these programs through the Columbia Basin Fish and Wildlife Program is considered a new production initiative by the Northwest Power Planning Council (NPPC) and requires a master plan. The master plan provides the NPPC, program proponents and others with the information they need to make sound decisions about whether the proposed facilities to restore salmon populations should move forward to design. This master plan describes alternatives considered to meet the facility needs of the CPP so the conservation program can be fully implemented. Co-managers considered three alternatives: modify Lookingglass Hatchery; use existing facilities elsewhere in the Basin; and use new facilities in
The Mere Exposure Instruction Effect.
Van Dessel, Pieter; Mertens, Gaëtan; Smith, Colin Tucker; De Houwer, Jan
2017-09-01
The mere exposure effect refers to the well-established finding that people evaluate a stimulus more positively after repeated exposure to that stimulus. We investigated whether a change in stimulus evaluation can occur also when participants are not repeatedly exposed to a stimulus, but are merely instructed that one stimulus will occur frequently and another stimulus will occur infrequently. We report seven experiments showing that (1) mere exposure instructions influence implicit stimulus evaluations as measured with an Implicit Association Test (IAT), personalized Implicit Association Test (pIAT), or Affect Misattribution Procedure (AMP), but not with an Evaluative Priming Task (EPT), (2) mere exposure instructions influence explicit evaluations, and (3) the instruction effect depends on participants' memory of which stimulus will be presented more frequently. We discuss how these findings inform us about the boundary conditions of mere exposure instruction effects, as well as the mental processes that underlie mere exposure and mere exposure instruction effects.
Efforts to compile and standardize exposure human factors have resulted in the development of a variety of resources available to the scientific community. For example, the U.S. EPA developed the Exposure Factors Handbook and Child-specific Exposure Factors Handbook to promote c...
Monitoring of radiation exposure
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-02-01
The guide specifies the requirements for the monitoring of radiation exposure in instances where radiation is used. In addition to workers, the guide covers students, apprentices and visitors. The guide shall also apply to exposure from natural radiation. However, the monitoring of radiation exposure in nuclear power plants is dealt with in YVL Guide 7.10 and 7.11. The guide defines the concepts relevant to the monitoring of radiation exposure and provides guidelines for determining the necessity of monitoring and subsequently arranging such in different operations. In addition, the guide specifies the criteria for the approval and regulatory control of the dosimetric service.
Monitoring of radiation exposure
International Nuclear Information System (INIS)
2000-02-01
The guide specifies the requirements for the monitoring of radiation exposure in instances where radiation is used. In addition to workers, the guide covers students, apprentices and visitors. The guide shall also apply to exposure from natural radiation. However, the monitoring of radiation exposure in nuclear power plants is dealt with in YVL Guide 7.10 and 7.11. The guide defines the concepts relevant to the monitoring of radiation exposure and provides guidelines for determining the necessity of monitoring and subsequently arranging such in different operations. In addition, the guide specifies the criteria for the approval and regulatory control of the dosimetric service
A paediatric X-ray exposure chart
Energy Technology Data Exchange (ETDEWEB)
Knight, Stephen P, E-mail: stephen.knight@health.qld.gov.au [Department of Medical Imaging, Royal Children' s Hospital, Brisbane, Queensland (Australia)
2014-09-15
The aim of this review was to develop a radiographic optimisation strategy to make use of digital radiography (DR) and needle phosphor computerised radiography (CR) detectors, in order to lower radiation dose and improve image quality for paediatrics. This review was based on evidence-based practice, of which a component was a review of the relevant literature. The resulting exposure chart was developed with two distinct groups of exposure optimisation strategies – body exposures (for head, trunk, humerus, femur) and distal extremity exposures (elbow to finger, knee to toe). Exposure variables manipulated included kilovoltage peak (kVp), target detector exposure and milli-ampere-seconds (mAs), automatic exposure control (AEC), additional beam filtration, and use of antiscatter grid. Mean dose area product (DAP) reductions of up to 83% for anterior–posterior (AP)/posterior–anterior (PA) abdomen projections were recorded postoptimisation due to manipulation of multiple-exposure variables. For body exposures, the target EI and detector exposure, and thus the required mAs were typically 20% less postoptimisation. Image quality for some distal extremity exposures was improved by lowering kVp and increasing mAs around constant entrance skin dose. It is recommended that purchasing digital X-ray equipment with high detective quantum efficiency detectors, and then optimising the exposure chart for use with these detectors is of high importance for sites performing paediatric imaging. Multiple-exposure variables may need to be manipulated to achieve optimal outcomes.
Estimating Contact Exposure in Football Using the Head Impact Exposure Estimate.
Kerr, Zachary Y; Littleton, Ashley C; Cox, Leah M; DeFreese, J D; Varangis, Eleanna; Lynall, Robert C; Schmidt, Julianne D; Marshall, Stephen W; Guskiewicz, Kevin M
2015-07-15
Over the past decade, there has been significant debate regarding the effect of cumulative subconcussive head impacts on short and long-term neurological impairment. This debate remains unresolved, because valid epidemiological estimates of athletes' total contact exposure are lacking. We present a measure to estimate the total hours of contact exposure in football over the majority of an athlete's lifespan. Through a structured oral interview, former football players provided information related to primary position played and participation in games and practice contacts during the pre-season, regular season, and post-season of each year of their high school, college, and professional football careers. Spring football for college was also included. We calculated contact exposure estimates for 64 former football players (n = 32 college football only, n = 32 professional and college football). The head impact exposure estimate (HIEE) discriminated between individuals who stopped after college football, and individuals who played professional football (p < 0.001). The HIEE measure was independent of concussion history (p = 0.82). Estimating total hours of contact exposure may allow for the detection of differences between individuals with variation in subconcussive impacts, regardless of concussion history. This measure is valuable for the surveillance of subconcussive impacts and their associated potential negative effects.
Revisiting TW Hydrae in light of new astrometric data
Teixeira, R.; Ducourant, C.; Galli, P. A. B.; Le Campion, J. F.; Zuckerman, B.; Krone-Martins, A. G. O.; Chauvin, G.; Song, I.
2014-10-01
Our efforts in the present work focused mainly on refining and improving the previous description and understanding of the stellar association TW Hydrae (TWA) including a very detailed membership analysis and its dynamical and evolutionary age.To achieve our objectives in a fully reliable way we take advantage of our own astrometric measurements (Ducourant et al. 2013) performed with NTT/EFOSC2 - ESO (La Silla - Chile) spread over three years (2007 - 2010) and of those published in the literature.A very detailed membership analysis based on the convergent point strategy as developed by our team (Galli et al. 2012, 2013) allowed us to define a consistent kinematic group containing 31 stars among the 44 proposed as TWA member in the literature. Assuming that our sample of stars may be contaminated by non-members and to get rid of the particular influence of each star we applied a Jacknife resampling technique generating 2000 random lists of 13 stars taken from our 16 stars and calculated for each the epoch of convergence when the radius is minimum. The mean of the epochs obtained and the dispersion about the mean give a dynamical age of 7.5± 0.7 Myr for the association that is in good agreement with the previous traceback age (De La Reza et al. 2006). We also estimated age for TWA moving group members from pre-main sequence evolutionary models (Siess et al. 2000) and find a mean age of 7.4± 1.2 Myr. These results show that the dynamical age of the association obtained via the traceback technique and the average age derived from theoretical evolutionary models are in good agreement.
Mr Price, PSP
2012-01-01
This thesis explores the concept of using exposure information to understand, organize, and manage the risks associated with cumulative exposures to chemicals (exposures to multiple chemicals from multiple sources). The issue of cumulative exposures was identified in more than 30 years ago, but in
Couch, James R; Petersen, Martin; Rice, Carol; Schubauer-Berigan, Mary K
2011-05-01
To construct a job-exposure matrix (JEM) for an Ohio beryllium processing facility between 1953 and 2006 and to evaluate temporal changes in airborne beryllium exposures. Quantitative area- and breathing-zone-based exposure measurements of airborne beryllium were made between 1953 and 2006 and used by plant personnel to estimate daily weighted average (DWA) exposure concentrations for sampled departments and operations. These DWA measurements were used to create a JEM with 18 exposure metrics, which was linked to the plant cohort consisting of 18,568 unique job, department and year combinations. The exposure metrics ranged from quantitative metrics (annual arithmetic/geometric average DWA exposures, maximum DWA and peak exposures) to descriptive qualitative metrics (chemical beryllium species and physical form) to qualitative assignment of exposure to other risk factors (yes/no). Twelve collapsed job titles with long-term consistent industrial hygiene samples were evaluated using regression analysis for time trends in DWA estimates. Annual arithmetic mean DWA estimates (overall plant-wide exposures including administration, non-production, and production estimates) for the data by decade ranged from a high of 1.39 μg/m(3) in the 1950s to a low of 0.33 μg/m(3) in the 2000s. Of the 12 jobs evaluated for temporal trend, the average arithmetic DWA mean was 2.46 μg/m(3) and the average geometric mean DWA was 1.53 μg/m(3). After the DWA calculations were log-transformed, 11 of the 12 had a statistically significant (p < 0.05) decrease in reported exposure over time. The constructed JEM successfully differentiated beryllium exposures across jobs and over time. This is the only quantitative JEM containing exposure estimates (average and peak) for the entire plant history.
Radiation camera exposure control
International Nuclear Information System (INIS)
Martone, R.J.; Yarsawich, M.; Wolczek, W.
1976-01-01
A system and method for governing the exposure of an image generated by a radiation camera to an image sensing camera is disclosed. The exposure is terminated in response to the accumulation of a predetermined quantity of radiation, defining a radiation density, occurring in a predetermined area. An index is produced which represents the value of that quantity of radiation whose accumulation causes the exposure termination. The value of the predetermined radiation quantity represented by the index is sensed so that the radiation camera image intensity can be calibrated to compensate for changes in exposure amounts due to desired variations in radiation density of the exposure, to maintain the detectability of the image by the image sensing camera notwithstanding such variations. Provision is also made for calibrating the image intensity in accordance with the sensitivity of the image sensing camera, and for locating the index for maintaining its detectability and causing the proper centering of the radiation camera image
Examining the Need for a Code of Conduct in New Jersey Teacher Union Contracts
Guarneri, Cristina M.
2009-01-01
The purpose of this cross-sectional, comparison study attempted to investigate if a code of conduct existed in New Jersey teacher union contracts to nursing/hospital union contracts. Archived data of public school district and nursing/hospital union contracts held with the New Jersey Public Employment Relations Committee (NJ PERC) and Health…
Static Thrust and Power Characteristics of Six Full-Scale Propellers
1940-01-01
8217 v’arri’a’t aaINt Ilio- adasigns tip) speed’a by 1ii1) ,i vinag .10 perce’ant aI’a’aita’n Itiliil tha’ thar’ist a’auaflia’i’iit o’’~af n faictaoi
Kostense, Stefan; Moore, Susan; Companjen, Arjen; Bakker, Alexander B. H.; Marissen, Wilfred E.; von Eyben, Rie; Weverling, Gerrit Jan; Hanlon, Cathleen; Goudsmit, Jaap
2012-01-01
Monoclonal antibodies are successful biologics in treating a variety of diseases, including the prevention or treatment of viral infections. CL184 is a 1:1 combination of two human monoclonal IgG1 antibodies (CR57 and CR4098) against rabies virus, produced in the PER.C6 human cell line. The two
Based on a study done by Thoma et al. (2010) the energy used in fluid milk processing in the United States of America is responsible for approximately 2 million metric tons of greenhouse gas (GHG) emissions within the total life cycle of milk. These emissions come from electricity use (about 75 perc...
Salmonid Gamete Preservation in the Snake River Basin, 1998 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Armstrong, Robyn; Kucera, Paul A. (Nez Perce Tribe, Lapwai, ID)
1999-03-01
Steelhead (Oncorhynchus mykiss) and salmon (Oncorhynchus tshawytscha)populations in the Northwest are decreasing. The Nez Perce Tribe (Tribe) was funded in 1998 by the Bonneville Power Administration to coordinate gene banking of male gametes from Endangered Species Act (ESA) listed steelhead and spring and summer chinook salmon in the Snake River basin.
Pärt, Arvo: De profundis. Missa Sillabica / Patric Wiklacz
Wiklacz, Patric
1997-01-01
Uuest heliplaadist "Pärt, Arvo: De profundis. Missa Sillabica. Solfeggio. And one of the Pharisees. Cantate Domino. Summa. 7 Antiennes du Magnificat. The Beautitudes. Magnificat. Christopher Bowers-Broadbent (org.), Daniel Kennedy (perc.). Theatre of Voices / Paul Hillier (bass)" Harmonia Mundi HMU907 182 F (CD:165F). 1996. TT:1h 16'06"
Long- and short-term exposure to PM2.5 and mortality: using novel exposure models.
Kloog, Itai; Ridgway, Bill; Koutrakis, Petros; Coull, Brent A; Schwartz, Joel D
2013-07-01
Many studies have reported associations between ambient particulate matter (PM) and adverse health effects, focused on either short-term (acute) or long-term (chronic) PM exposures. For chronic effects, the studied cohorts have rarely been representative of the population. We present a novel exposure model combining satellite aerosol optical depth and land-use data to investigate both the long- and short-term effects of PM2.5 exposures on population mortality in Massachusetts, United States, for the years 2000-2008. All deaths were geocoded. We performed two separate analyses: a time-series analysis (for short-term exposure) where counts in each geographic grid cell were regressed against cell-specific short-term PM2.5 exposure, temperature, socioeconomic data, lung cancer rates (as a surrogate for smoking), and a spline of time (to control for season and trends). In addition, for long-term exposure, we performed a relative incidence analysis using two long-term exposure metrics: regional 10 × 10 km PM2.5 predictions and local deviations from the cell average based on land use within 50 m of the residence. We tested whether these predicted the proportion of deaths from PM-related causes (cardiovascular and respiratory diseases). For short-term exposure, we found that for every 10-µg/m increase in PM 2.5 exposure there was a 2.8% increase in PM-related mortality (95% confidence interval [CI] = 2.0-3.5). For the long-term exposure at the grid cell level, we found an odds ratio (OR) for every 10-µg/m increase in long-term PM2.5 exposure of 1.6 (CI = 1.5-1.8) for particle-related diseases. Local PM2.5 had an OR of 1.4 (CI = 1.3-1.5), which was independent of and additive to the grid cell effect. We have developed a novel PM2.5 exposure model based on remote sensing data to assess both short- and long-term human exposures. Our approach allows us to gain spatial resolution in acute effects and an assessment of long-term effects in the entire population rather than a
The Australian Work Exposures Study: prevalence of occupational exposure to diesel engine exhaust.
Peters, Susan; Carey, Renee N; Driscoll, Timothy R; Glass, Deborah C; Benke, Geza; Reid, Alison; Fritschi, Lin
2015-06-01
Diesel engines are widely used in occupational settings. Diesel exhaust has been classified as a lung carcinogen, but data on number of workers exposed to different levels of diesel exhaust are not available in Australia. The aim of this study was to estimate the current prevalence of exposure to diesel engine exhaust in Australian workplaces. A cross-sectional survey of Australian males and females (18-65 years old) in current paid employment was undertaken. Information about the respondents' current job and various demographic factors was collected in a telephone interview using the web-based tool OccIDEAS. Semi-quantitative occupational exposure levels to diesel exhaust were assigned using programmed decision rules and numbers of workers exposed in Australia in 2011 were estimated. We defined substantial exposure as exposed at a medium or high level, for at least 5h per week. Substantial occupational exposure to diesel exhaust was experienced by 13.4% of the respondents in their current job. Exposure prevalence varied across states, ranging from 6.4% in the Australian Capital Territory to 17.0% in Western Australia. Exposures occurred mainly in the agricultural, mining, transport and construction industries, and among mechanics. Men (20.4%) were more often exposed than women (4.7%). Extrapolation to the total working population indicated that 13.8% (95% confidence interval 10.0-20.4) of the 2011 Australian workforce were estimated to be substantially exposed to diesel exhaust, and 1.8% of the workers were estimated to experience high levels of exposures in their current job. About 1.2 million Australian workers were estimated to have been exposed to diesel exhaust in their workplace in 2011. This is the first study to describe the prevalence of occupational diesel exhaust exposure in Australia and will enable estimation of the number of lung cancers attributable to diesel exhaust exposure in the workplace. © The Author 2015. Published by Oxford University Press
Directory of Open Access Journals (Sweden)
Jingli Liu
Full Text Available Bisphenol A (BPA is a widespread endocrine-disrupting chemical used as the building block for polycarbonate plastics. Epidemiological evidence has correlated BPA exposure with higher risk of heart disease and type 2 diabetes. However, it remains unknown whether there are critical windows of susceptibility to BPA exposure on the development of dysglycemia. This study was an attempt to investigate the critical windows and the long-term consequences of perinatal exposure to BPA on glucose homeostasis. Pregnant mice were given either vehicle or BPA (100 µg/kg/day at different time of perinatal stage: 1 on days 1-6 of pregnancy (P1-P6, preimplantation exposure; 2 from day 6 of pregnancy until postnatal day (PND 0 (P6-PND0, fetal exposure; 3 from lactation until weaning (PND0-PND21, neonatal exposure; and 4 from day 6 of gestation until weaning (P6-PND21, fetal and neonatal exposure. At 3, 6 and 8 months of age, offspring in each group were challenged with glucose and insulin tolerance tests. Then islet morphometry and β-cell function were measured. The glucose homeostasis was impaired in P6-PND0 mice from 3 to 6 months of age, and this continued to 8 months in males, but not females. While in PND0-PND21 and P6-PND21 BPA-treated groups, only the 3-month-old male offspring developed glucose intolerance. Moreover, at the age of 3 months, perinatal exposure to BPA resulted in the increase of β-cell mass mainly due to the coordinate changes in cell replication, neogenesis, and apoptosis. The alterations of insulin secretion and insulin sensitivity, rather than β-cell mass, were consistent with the development of glucose intolerance. Our findings suggest that BPA may contribute to metabolic disorders relevant to glucose homeostasis and the effects of BPA were dose, sex, and time-dependent. Fetal development stage may be the critical window of susceptibility to BPA exposure.
Brand, P; Havlicek, P; Steiners, M; Holzinger, K; Reisgen, U; Kraus, T; Gube, M
2013-01-01
Studies concerning welding fume-related adverse health effects in welders are hampered by the heterogeneity of workplace situations, resulting in complex and non-standardized exposure conditions. In order to carry out welding fume exposure studies under controlled and standardized conditions, the Aachen Workplace Simulation Laboratory was developed. This laboratory consists of an emission room, in which welding fume is produced, and an exposure room in which human subjects are exposed to these fumes. Both rooms are connected by a ventilation system which allows the welding fume concentration to be regulated. Particle mass concentration was measured with a TEOM microbalance and the particle number-size distribution using a Grimm SMPS device. In a study, which is the subject of this paper, it has been shown that welding fume concentration can easily be regulated between 1 and about 3 mg m(-3). The chosen concentration can be kept constant for more than 8 h. However, transport of the particles from the emission room into the exposure room leads to a change in particle size distribution, which is probably due to coagulation of the fraction of smallest particles. The Aachen Workplace Simulation Laboratory is suitable for controlled exposure studies with human subjects.
The validated sun exposure questionnaire
DEFF Research Database (Denmark)
Køster, B; Søndergaard, J; Nielsen, J B
2017-01-01
Few questionnaires used in monitoring sun-related behavior have been tested for validity. We established criteria validity of a developed questionnaire for monitoring population sun-related behavior. During May-August 2013, 664 Danes wore a personal electronic UV-dosimeter for one week...... that measured the outdoor time and dose of erythemal UVR exposure. In the following week, they answered a questionnaire on their sun-related behavior in the measurement week. Outdoor time measured by dosimetry correlated strongly with both outdoor time and the developed exposure scale measured...... in the questionnaire. Exposure measured in SED by dosimetry correlated strongly with the exposure scale. In a linear regression model of UVR (SED) received, 41 percent of the variation was explained by skin type, age, week of participation and the exposure scale, with the exposure scale as the main contributor...
Benzene exposures in urban areas
International Nuclear Information System (INIS)
Valerio, F.; Pala, M.; Cipolla, M.; Stella, A.
2001-01-01
Benzene exposures in urban areas were reviewed. Available data confirm that both in USA and Europe, benzene concentrations measured by fixed outdoor monitoring stations underestimate personal exposures of urban residents. Indoor sources, passive smoke and the high exposures during commuting time may explain this difference. Measures in European towns confirm that very frequently mean daily personal exposures to benzene exceed 10 μg/m 3 , current European air quality guideline for this carcinogenic compound [it
DEFF Research Database (Denmark)
Höglund, Lena; Räisänen, Jouni; Hämäläinen, Anne-Maija
range of more or less well-documented values originating from many different sources. The purpose of this report is to give an overview and to evaluate exposure factors that are currently used by the authorities and industry in the exposure assessments for both adults (occupational and consumer exposure......) and children in relation to REACH. Another important purpose of the report is to contribute towards a further harmonisation of exposure factors by giving recommendations of most valid and representative defaults. These recommendations can be used besides REACH also in biocide's and plant protection product...
Sound Exposure of Symphony Orchestra Musicians
DEFF Research Database (Denmark)
Schmidt, Jesper Hvass; Pedersen, Ellen Raben; Juhl, Peter Møller
2011-01-01
dBA and their left ear was exposed 4.6 dB more than the right ear. Percussionists were exposed to high sound peaks >115 dBC but less continuous sound exposure was observed in this group. Musicians were exposed up to LAeq8h of 92 dB and a majority of musicians were exposed to sound levels exceeding......Background: Assessment of sound exposure by noise dosimetry can be challenging especially when measuring the exposure of classical orchestra musicians where sound originate from many different instruments. A new measurement method of bilateral sound exposure of classical musicians was developed...... and used to characterize sound exposure of the left and right ear simultaneously in two different symphony orchestras.Objectives: To measure binaural sound exposure of professional classical musicians and to identify possible exposure risk factors of specific musicians.Methods: Sound exposure was measured...
2013-09-27
... 9, 2013, the DISH Network Corporation, on behalf of its wholly-owned subsidiaries, Gamma Acquisition... held by its wholly-owned subsidiaries, Gamma Acquisition LLC (Call Signs T060430001-T060430176) and New... Commission's Secretary must be delivered to FCC Headquarters at 445 12th Street SW., Room TW-A325, Washington...
Velez, Brandon L.; Moradi, Bonnie
2012-01-01
The present study explored the links of 2 workplace contextual variables--perceptions of workplace heterosexist discrimination and lesbian, gay, and bisexual (LGB)-supportive climates--with job satisfaction and turnover intentions in a sample of LGB employees. An extension of the theory of work adjustment (TWA) was used as the conceptual framework…
The sources of radiation exposure
International Nuclear Information System (INIS)
Bennett, B.G.
1992-01-01
Radiation protection of workers and of members of the public requires an assessment of the various sources of exposure, their variations in time or under specific conditions or circumstances, and the possibilities for control or limitation. The United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR) has evaluated the various components of natural and man-made sources in some detail. Natural exposures form the largest component of radiation exposure of man. Variability in exposures depends on elevation, the concentrations of radionuclides in soil, food and water, the composition of building materials and the susceptibility of indoor spaces to radon build-up. Man-made sources have included exposures to fallout from atmospheric nuclear testing and discharged from nuclear fuel cycle installations in routine operations or in accidents. The other main source of radiation exposures of individuals is in medical diagnostic examinations and therapeutic treatments. (author)
Assessment of Human Exposure to ENMs.
Jiménez, Araceli Sánchez; van Tongeren, Martie
2017-01-01
Human exposure assessment of engineered nanomaterials (ENMs) is hampered, among other factors, by the difficulty to differentiate ENM from other nanomaterials (incidental to processes or naturally occurring) and the lack of a single metric that can be used for health risk assessment. It is important that the exposure assessment is carried out throughout the entire life-cycle as releases can occur at the different stages of the product life-cycle, from the synthesis, manufacture of the nano-enable product (occupational exposure) to the professional and consumer use of nano-enabled product (consumer exposure) and at the end of life.Occupational exposure surveys should follow a tiered approach, increasing in complexity in terms of instruments used and sampling strategy applied with higher tiers in order tailor the exposure assessment to the specific materials used and workplace exposure scenarios and to reduce uncertainty in assessment of exposure. Assessment of consumer exposure and of releases from end-of-life processes currently relies on release testing of nano-enabled products in laboratory settings.
Brown, Kathleen; Phillips, Martin; Grulke, Christopher; Yoon, Miyoung; Young, Bruce; McDougall, Robin; Leonard, Jeremy; Lu, Jingtao; Lefew, William; Tan, Yu-Mei
2015-12-01
Sources of uncertainty involved in exposure reconstruction for short half-life chemicals were characterized using computational models that link external exposures to biomarkers. Using carbaryl as an example, an exposure model, the Cumulative and Aggregate Risk Evaluation System (CARES), was used to generate time-concentration profiles for 500 virtual individuals exposed to carbaryl. These exposure profiles were used as inputs into a physiologically based pharmacokinetic (PBPK) model to predict urinary biomarker concentrations. These matching dietary intake levels and biomarker concentrations were used to (1) compare three reverse dosimetry approaches based on their ability to predict the central tendency of the intake dose distribution; and (2) identify parameters necessary for a more accurate exposure reconstruction. This study illustrates the trade-offs between using non-iterative reverse dosimetry methods that are fast, less precise and iterative methods that are slow, more precise. This study also intimates the necessity of including urine flow rate and elapsed time between last dose and urine sampling as part of the biomarker sampling collection for better interpretation of urinary biomarker data of short biological half-life chemicals. Resolution of these critical data gaps can allow exposure reconstruction methods to better predict population-level intake doses from large biomonitoring studies. Published by Elsevier Inc.
Radiation exposure during ureteroscopy
International Nuclear Information System (INIS)
Bagley, D.H.; Cubler-Goodman, A.
1990-01-01
Use of fluoroscopy during ureteroscopy increases the risk of radiation exposure to the urologist and patient. Radiation entrance dosages were measured at skin level in 37 patients, and at the neck, trunk and finger of the urologist, and neck and trunk of the circulating nurse. Radiation exposure time was measured in 79 patients, and was related to the purpose of the procedure and the type of ureteroscope used, whether rigid or flexible. Exposure could be minimized by decreasing the fluoroscopy time. A portable C-arm fluoroscopy unit with electronic imaging and last image hold mode should be used to minimize exposure time. Lead aprons and thyroid shields should be used by the urologist and other personnel in the endoscopy room
Exposures to natural radiation in Switzerland
International Nuclear Information System (INIS)
Murith, Ch.; Gurtner, A.
1999-01-01
The exposure of human beings to ionising radiation from natural sources is a continuing and inescapable feature of life on earth. There are two main sources that contribute to this exposure: high-energy cosmic-ray particles incident to the earth's atmosphere and radioactive nuclides that originated in the earth's crust and are present everywhere in the environment, including human body itself. Both external and internal exposures to humans arise from these sources. Exposures to natural radiation sources in Switzerland and some of their variations are here summarised and the resulting effective doses are compared to those from man-made sources exposures. It results that the natural background exposures are more significant for the population than most exposures to man-made sources. (authors)
International Nuclear Information System (INIS)
Kojo, Katja; Jansen, Christer T.; Nybom, Pia; Huurto, Laura; Laihia, Jarmo; Ilus, Taina; Auvinen, Anssi
2006-01-01
Ultraviolet radiation (UVR) is the principal cause of cutaneous malignant melanoma (CMM). However, the relation between CMM and UVR exposure is not clear. We present the trends of population exposure to UVR and conduct a time-series analysis of the relation between UVR exposure and incidence of CMM. Data on CMM incidence were obtained from the Finnish Cancer Registry. Clothing coverage of the body was scored from archival photographs and the proportion of uncovered skin was used as a measure of solar exposure. Information on the number of sunny resort holidays, duration of annual holidays, and sunscreen sales were obtained from various sources. Exposed skin area doubled from 1920 to 1985. The average duration of annual holidays increased 30-fold. The number of sunny resort holidays and the sales of sunscreens increased rapidly from 1980. CMM was most strongly associated with solar exposure of 5-19 years earlier. There is a considerable decrease in clothing coverage during the 20th century. UVR exposure preceding CMM occurrence 4 years or less does not appear relevant, whereas the period 5-19 years prior to CMM occurrence might be the most relevant period. However, findings of ecological studies may not be applicable at the individual level
Garzón-Villalba, Ximena P; Wu, Yougui; Ashley, Candi D; Bernard, Thomas E
2017-07-01
Heat stress exposure limits based on wet-bulb globe temperature (WBGT) were designed to limit exposures to those that could be sustained for an 8-h day using limited data from Lind in the 1960s. In general, Sustainable exposures are heat stress levels at which thermal equilibrium can be achieved, and Unsustainable exposures occur when there is a steady increase in core temperature. This paper addresses the ability of the ACGIH® Threshold Limit Value (TLV®) to differentiate between Sustainable and Unsustainable heat exposures, to propose alternative occupational exposure limits, and ask whether an adjustment for body surface area improves the exposure decision. Two progressive heat stress studies provided data on 176 trials with 352 pairs of Sustainable and Unsustainable exposures over a range of relative humidities and metabolic rates using 29 participants wearing woven cotton clothing. To assess the discrimination ability of the TLV, the exposure metric was the difference between the observed WBGT and the TLV adjusted for metabolic rate. Conditional logistic regression models and receiver operating characteristic curves (ROC) along with ROC's area under the curve (AUC) were used. Four alternative models for an occupational exposure limit were also developed and compared to the TLV. For the TLV, the odds ratio (OR) for Unsustainable was 2.5 per 1°C-WBGT [confidence interval (CI) 2.12-2.88]. The AUC for the TLV was 0.85 (CI 0.81-0.89). For the alternative models, the ORs were also about 2.5/°C-WBGT, with AUCs between 0.84 and 0.88, which were significantly different from the TLV's AUC but have little practical difference. This study (1) confirmed that the TLV is appropriate for heat stress screening; (2) demonstrated the TLV's discrimination accuracy with an ROC AUC of 0.85; and (3) established the OR of 2.5/°C-WBGT for unsustainable exposures. The TLV has high sensitivity, but its specificity is very low, which is protective. There were no important
AirPEx. Air Pollution Exposure Model
Energy Technology Data Exchange (ETDEWEB)
Freijer, J.I.; Bloemen, H.J.Th.; De Loos, S.; Marra, M.; Rombout, P.J.A.; Steentjes, G.M.; Van Veen, M.P.
1997-12-01
Analysis of inhalatory exposure to air pollution is an important area of investigation when assessing the risks of air pollution for human health. Inhalatory exposure research focuses on the exposure of humans to air pollutants and the entry of these pollutants into the human respiratory tract. The principal grounds for studying the inhalatory exposure of humans to air pollutants are formed by the need for realistic exposure/dose estimates to evaluate the health effects of these pollutants. The AirPEx (Air Pollution Exposure) model, developed to assess the time- and space-dependence of inhalatory exposure of humans to air pollution, has been implemented for use as a Windows 3.1 computer program. The program is suited to estimating various exposure and dose quantities for individuals, as well as for populations and subpopulations. This report describes the fundamentals of the AirPEx model and provides a user manual for the computer program. Several examples included in the report illustrate the possibilities of the AirPEx model in exposure assessment. The model will be used at the National Institute of Public Health and the Environment as a tool in analysing the current exposure of the Dutch population to air pollutants. 57 refs.
Hartley, Ruth A; Barker, Bethan L; Newby, Chris; Pakkal, Mini; Baldi, Simonetta; Kajekar, Radhika; Kay, Richard; Laurencin, Marie; Marshall, Richard P; Sousa, Ana R; Parmar, Harsukh; Siddiqui, Salman; Gupta, Sumit; Brightling, Chris E
2016-05-01
There is a paucity of studies comparing asthma and chronic obstructive pulmonary disease (COPD) based on thoracic quantitative computed tomographic (QCT) parameters. We sought to compare QCT parameters of airway remodeling, air trapping, and emphysema between asthmatic patients and patients with COPD and explore their relationship with airflow limitation. Asthmatic patients (n = 171), patients with COPD (n = 81), and healthy subjects (n = 49) recruited from a single center underwent QCT and clinical characterization. Proximal airway percentage wall area (%WA) was significantly increased in asthmatic patients (62.5% [SD, 2.2]) and patients with COPD (62.7% [SD, 2.3]) compared with that in healthy control subjects (60.3% [SD, 2.2], P Emphysema assessed based on lung density measured by using Hounsfield units below which 15% of the voxels lie (Perc15) was a feature of COPD only (patients with COPD: mean, -964 [SD, 19.62] vs asthmatic patients: mean, -937 [SD, 22.7] and healthy subjects: mean, -937 [SD, 17.1], P < .001). Multiple regression analyses showed that the strongest predictor of lung function impairment in asthmatic patients was %WA, whereas in the COPD and asthma subgrouped with postbronchodilator FEV1 percent predicted value of less than 80%, it was air trapping. Factor analysis of QCT parameters in asthmatic patients and patients with COPD combined determined 3 components, with %WA, air trapping, and Perc15 values being the highest loading factors. Cluster analysis identified 3 clusters with mild, moderate, or severe lung function impairment with corresponding decreased lung density (Perc15 values) and increased air trapping. In asthmatic patients and patients with COPD, lung function impairment is strongly associated with air trapping, with a contribution from proximal airway narrowing in asthmatic patients. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.
Tmannetje, AM; McLean, DJ; Eng, AJ; Kromhout, H; Kauppinen, T; Fevotte, J; Pearce, NE
2011-01-01
In New Zealand, there is a need for a comprehensive and accessible database with national occupational exposure information, such as a general population job-exposure matrix (GPJEM). However, few New Zealand-specific exposure data exist that could be used to construct such a GPJEM. Here, we present the methods used to develop a GPJEM for New Zealand (NZJEM), by combining GPJEMs from other countries with New Zealand-specific exposure information, using wood dust as an example to illustrate thi...
Directory of Open Access Journals (Sweden)
George Maldonado
2009-09-01
Full Text Available Abstract: In a follow-up study of mortality among North American synthetic rubber industry workers, cumulative exposure to 1,3-butadiene was positively associated with leukemia. Problems with historical exposure estimation, however, may have distorted the association. To evaluate the impact of potential inaccuracies in exposure estimation, we conducted uncertainty analyses of the relation between cumulative exposure to butadiene and leukemia. We created the 1,000 sets of butadiene estimates using job-exposure matrices consisting of exposure values that corresponded to randomly selected percentiles of the approximate probability distribution of plant-, work area/job group-, and year specific butadiene ppm. We then analyzed the relation between cumulative exposure to butadiene and leukemia for each of the 1,000 sets of butadiene estimates. In the uncertainty analysis, the point estimate of the RR for the first non zero exposure category (>0–<37.5 ppm-years was most likely to be about 1.5. The rate ratio for the second exposure category (37.5–<184.7 ppm-years was most likely to range from 1.5 to 1.8. The RR for category 3 of exposure (184.7–<425.0 ppm-years was most likely between 2.1 and 3.0. The RR for the highest exposure category (425.0+ ppm-years was likely to be between 2.9 and 3.7. This range off RR point estimates can best be interpreted as a probability distribution that describes our uncertainty in RR point estimates due to uncertainty in exposure estimation. After considering the complete probability distributions of butadiene exposure estimates, the exposure-response association of butadiene and leukemia was maintained. This exercise was a unique example of how uncertainty analyses can be used to investigate and support an observed measure of effect when occupational exposure estimates are employed in the absence of direct exposure measurements.
Relationships between water table and model simulated ET
Prem B. Parajuli; Gretchen F. Sassenrath; Ying Ouyang
2013-01-01
This research was conducted to develop relationships among evapotranspiration (ET), percolation (PERC), groundwater discharge to the stream (GWQ), and water table fluctuations through a modeling approach. The Soil and Water Assessment Tool (SWAT) hydrologic and crop models were applied in the Big Sunflower River watershed (BSRW; 7660 km2) within the Yazoo River Basin...
Are groups working in the Information Technology class? | Mentz ...
African Journals Online (AJOL)
We discuss teache rs' perce ption of the use of group work in the Information Technology (IT) classroom. We describe the current situation regarding the implementation of group work in IT classrooms in South Africa as well as the challenges that IT teachers face when implementing group work. This information will be used ...
International Nuclear Information System (INIS)
Solomon, S.B.
1982-01-01
Radiation induced carcinogenesis and mutagenesis form the main risks to health from exposure to low levels of radiation. There is scant data on somatic and genetic risks at environmental and occupational levels of radiation exposure. The available data on radiation induced carcinogenesis and mutagenesis are for high doses and high dose rates of radiation. Risk assessments for low level radiation are obtained using these data, assuming a linear dose-response relationship. During uranium mining the chief source of radiation hazard is inhalation of radon daughters. The correlation between radon daughter exposure and the increased incidence of lung cancer has been well documented. For radiation exposures at and below occupational limits, the associated risk of radiation induced cancers and genetic abnormalities is small and should not lead to a detectable increase over naturally occurring rates
Safety lock for radiography exposure device
International Nuclear Information System (INIS)
Gaines, T.M.
1982-01-01
A safety lock for securing a radiation source in a radiography exposure device is disclosed. The safety lock prevents the inadvertent extension of the radiation source from the exposure device. The exposure devices are used extensively in industry for nondestructive testing of metal materials for defect. Unnecessary exposure of the radiographer or operator occurs not infrequently due to operator's error in believing that the radiation source is secured in the exposure device when, in fact, it is not. The present invention solves this problem of unnecessary exposure by releasingly trapping the radiation source in the shield of the radiography exposure device each time the source is retracted therein so that it is not inadvertently extended therefrom without the operator resetting the safety lock, thereby releasing the radiation source. Further, the safety lock includes an indicator which indicates when the source is trapped in the exposure device and also when it is untrapped. The safety lock is so designed that it does not prevent the return of the source to the trapped, shielded position in the exposure device. Further the safety lock includes a key means for locking the radiation source in the trapped position. The key means cannot be actuated until said radiation source is in said trapped position to further insure the safety lock cannot be inadvertently locked with the source untrapped and thus still extendable from the exposure device
Exposure scenario libraries as a tool for exposure assessment
International Nuclear Information System (INIS)
Jiménez, Araceli Sánchez; Rashid, Shahzad; Van Tongeren, Martie; Brouwer, Derk; Fransman, Wouter; Fito, Carlos; Boulougouris, George
2015-01-01
The development of nanotechnology has reached a point where it is being widely applied, and numerous nanomaterials and nano-enabled products are handled across a broad range of industrial sectors. Exposure extends beyond occupational settings as products containing nanomaterials are used by different consumer groups.Despite the knowledge on their toxic effects is growing there is still not OEL for most NMS and therefore the precautionary approach is still used where levels are kept as low as possible Therefore there is a need to assess workers and consumers exposure. (paper)
Stimulus Threat and Exposure Context Modulate the Effect of Mere Exposure on Approach Behaviors.
Young, Steven G; Jones, Isaiah F; Claypool, Heather M
2016-01-01
Mere-exposure (ME) research has found that initially neutral objects made familiar are preferred relative to novel objects. Recent work extends these preference judgments into the behavioral domain by illustrating that mere exposure prompts approach-oriented behavior toward familiar stimuli. However, no investigations have examined the effect of mere exposure on approach-oriented behavior toward threatening stimuli. The current work examines this issue and also explores how exposure context interacts with stimulus threat to influence behavioral tendencies. In two experiments participants were presented with both mere-exposed and novel stimuli and approach speed was assessed. In the first experiment, when stimulus threat was presented in a homogeneous format (i.e., participants viewed exclusively neutral or threatening stimuli), ME potentiated approach behaviors for both neutral and threatening stimuli. However, in the second experiment, in which stimulus threat was presented in a heterogeneous fashion (i.e., participants viewed both neutral and threatening stimuli), mere exposure facilitated approach only for initially neutral stimuli. These results suggest that ME effects on approach behaviors are highly context sensitive and depend on both stimulus valence and exposure context. Further implications of these findings for the ME literature are discussed.
International Nuclear Information System (INIS)
Spector, A.C.; Smith, J.C.; Hollander, G.R.
1986-01-01
Radiation-induced taste aversion has been suggested to possibly play a role in the dietary difficulties observed in some radiotherapy patients. In rats, these aversions can still be formed even when the radiation exposure precedes the taste experience by several hours. This study was conducted to examine whether increasing the radiation exposure level could extend the range of the exposure-taste interval that would still support the formation of a taste aversion. Separate groups of rats received either a 100 or 300 R gamma-ray exposure followed 1, 3, 6, or 24 h later by a 10-min saccharin (0.1% w/v) presentation. A control group received a sham exposure followed 1 h later by a 10-min saccharin presentation. Twenty-four hours following the saccharin presentation all rats received a series of twelve 23-h two-bottle preference tests between saccharin and water. The results indicated that the duration of the exposure-taste interval plays an increasingly more important role in determining the initial extent of the aversion as the dose decreases. The course of recovery from taste aversion seems more affected by dose than by the temporal parameters of the conditioning trial
Fernandez, Renae C; Peters, Susan; Carey, Renee N; Davies, Michael J; Fritschi, Lin
2014-10-01
To develop a job-exposure matrix (JEM) that estimates exposure to eight variables representing different aspects of shiftwork among female workers. Occupational history and shiftwork exposure data were obtained from a population-based breast cancer case-control study. Exposure to light at night, phase shift, sleep disturbances, poor diet, lack of physical activity, lack of vitamin D, and graveyard and early morning shifts, was calculated by occupational code. Three threshold values based on the frequency of exposure were considered (10%, 30% and 50%) for use as cut-offs in determining exposure for each occupational code. JEM-based exposure classification was compared with that from the OccIDEAS application (job-specific questionnaires and assessment by rules) by assessing the effect on the OR for phase shift and breast cancer. Using data from the Australian Workplace Exposure Study, the specificity and sensitivity of the threshold values were calculated for each exposure variable. 127 of 413 occupational codes involved exposure to one or more shiftwork variables. Occupations with the highest probability of exposure shiftwork included nurses and midwives. Using the 30% threshold, the OR for the association between phase shift exposure and breast cancer was decreased and no longer statistically significant (OR=1.14, 95% CI 0.92 to 1.42). The 30% cut-off point demonstrated best specificity and sensitivity, although results varied between exposure variables. This JEM provides a set of indicators reflecting biologically plausible mechanisms for the potential impact of shiftwork on health and may provide an alternative method of exposure assessment in the absence of detailed job history and exposure data. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
Aircrew radiation exposure: sources-risks-measurement
International Nuclear Information System (INIS)
Duftschmid, K.E.
1994-05-01
A short review is given on the actual aircrew exposure and its sources. The resulting risks for harmful effects to the health and discuss methods for in-flight measurements of exposure is evaluated. An idea for a fairly simple and economic approach to a practical, airborne active dosimeter for the assessment of individual crew exposure is presented. The exposure of civil aircrew to cosmic radiation, should not be considered a tremendous risk to the health, there is no reason for panic. However, being significantly higher than the average exposure to radiation workers, it can certainly not be neglected. As recommended by ICRP, aircrew exposure has to be considered occupational radiation exposure and aircrews are certainly entitled to the same degree of protection, as other ground-based radiation workers have obtained by law, since long time. (author)
Effects after prenatal radiation exposures
International Nuclear Information System (INIS)
Streffer, C.
2001-01-01
The mammalian organism is highly radiosensitive during all prenatal developmental periods. For most effects a dose relationship with a threshold is observed. These threshold doses are generally above the exposures from medical diagnostic procedures. The quality and extent of radiation effects are very much dependent on the developmental stage during which an exposure takes place and on the radiation dose. An exposure during the preimplantation period will cause lethality. Malformations are usually induced after exposures during the major organogenesis. Growth retardation is also possible during the late organogenesis and foetal periods. The lower limits of threshold doses for these effects are in the range of 100 mGy. A radiation exposure during the early foetal period can lead to severe mental retardation and impairment of intelligence. There are very serious effects with radiation doses above 0.3 Gy. Carcinogenesis can apparently occur after radiation exposures during the total prenatal development period. The radiation risk factor up to now has not been clear, but it seems that it is in the range of risk factors for cancer that are observed after exposures during childhood. For radiation doses that are used in radiological diagnostics the risk is zero or very low. A termination of pregnancy after doses below 100 mGy should not be considered. (author)
Mitchell, Jade; Arnot, Jon A; Jolliet, Olivier; Georgopoulos, Panos G; Isukapalli, Sastry; Dasgupta, Surajit; Pandian, Muhilan; Wambaugh, John; Egeghy, Peter; Cohen Hubal, Elaine A; Vallero, Daniel A
2013-08-01
While only limited data are available to characterize the potential toxicity of over 8 million commercially available chemical substances, there is even less information available on the exposure and use-scenarios that are required to link potential toxicity to human and ecological health outcomes. Recent improvements and advances such as high throughput data gathering, high performance computational capabilities, and predictive chemical inherency methodology make this an opportune time to develop an exposure-based prioritization approach that can systematically utilize and link the asymmetrical bodies of knowledge for hazard and exposure. In response to the US EPA's need to develop novel approaches and tools for rapidly prioritizing chemicals, a "Challenge" was issued to several exposure model developers to aid the understanding of current systems in a broader sense and to assist the US EPA's effort to develop an approach comparable to other international efforts. A common set of chemicals were prioritized under each current approach. The results are presented herein along with a comparative analysis of the rankings of the chemicals based on metrics of exposure potential or actual exposure estimates. The analysis illustrates the similarities and differences across the domains of information incorporated in each modeling approach. The overall findings indicate a need to reconcile exposures from diffuse, indirect sources (far-field) with exposures from directly, applied chemicals in consumer products or resulting from the presence of a chemical in a microenvironment like a home or vehicle. Additionally, the exposure scenario, including the mode of entry into the environment (i.e. through air, water or sediment) appears to be an important determinant of the level of agreement between modeling approaches. Copyright © 2013 Elsevier B.V. All rights reserved.
Mitchell, Jade; Arnot, Jon A.; Jolliet, Olivier; Georgopoulos, Panos G.; Isukapalli, Sastry; Dasgupta, Surajit; Pandian, Muhilan; Wambaugh, John; Egeghy, Peter; Cohen Hubal, Elaine A.; Vallero, Daniel A.
2014-01-01
While only limited data are available to characterize the potential toxicity of over 8 million commercially available chemical substances, there is even less information available on the exposure and use-scenarios that are required to link potential toxicity to human and ecological health outcomes. Recent improvements and advances such as high throughput data gathering, high performance computational capabilities, and predictive chemical inherency methodology make this an opportune time to develop an exposure-based prioritization approach that can systematically utilize and link the asymmetrical bodies of knowledge for hazard and exposure. In response to the US EPA’s need to develop novel approaches and tools for rapidly prioritizing chemicals, a “Challenge” was issued to several exposure model developers to aid the understanding of current systems in a broader sense and to assist the US EPA’s effort to develop an approach comparable to other international efforts. A common set of chemicals were prioritized under each current approach. The results are presented herein along with a comparative analysis of the rankings of the chemicals based on metrics of exposure potential or actual exposure estimates. The analysis illustrates the similarities and differences across the domains of information incorporated in each modeling approach. The overall findings indicate a need to reconcile exposures from diffuse, indirect sources (far-field) with exposures from directly, applied chemicals in consumer products or resulting from the presence of a chemical in a microenvironment like a home or vehicle. Additionally, the exposure scenario, including the mode of entry into the environment (i.e. through air, water or sediment) appears to be an important determinant of the level of agreement between modeling approaches. PMID:23707726
International Nuclear Information System (INIS)
Khlifi, Rim; Hamza-Chaffai, Amel
2010-01-01
Chronic exposures to heavy metals via tobacco smoking and professional exposure may increase the risk of head and neck cancer, although the epidemiologic evidence is limited by problems of low study power and inadequate adjustment for tobacco and professional exposure use. Numerous scientific reviews have examined the association of various heavy metals exposure with respiratory cancer as well as other cancer types, but few have been published on head and neck cancer. The purpose of this paper, therefore, is to review the head and neck tract cancer-related data on exposure to heavy metals via smoking and working exposure and to study the major mechanisms underlying some toxic metals carcinogenesis.
Pesticide Exposure in Children
Roberts, James R.; Karr, Catherine J.
2018-01-01
Pesticides are a collective term for a wide array of chemicals intended to kill unwanted insects, plants, molds, and rodents. Food, water, and treatment in the home, yard, and school are all potential sources of children’s exposure. Exposures to pesticides may be overt or subacute, and effects range from acute to chronic toxicity. In 2008, pesticides were the ninth most common substance reported to poison control centers, and approximately 45% of all reports of pesticide poisoning were for children. Organophosphate and carbamate poisoning are perhaps the most widely known acute poisoning syndromes, can be diagnosed by depressed red blood cell cholinesterase levels, and have available antidotal therapy. However, numerous other pesticides that may cause acute toxicity, such as pyrethroid and neonicotinoid insecticides, herbicides, fungicides, and rodenticides, also have specific toxic effects; recognition of these effects may help identify acute exposures. Evidence is increasingly emerging about chronic health implications from both acute and chronic exposure. A growing body of epidemiological evidence demonstrates associations between parental use of pesticides, particularly insecticides, with acute lymphocytic leukemia and brain tumors. Prenatal, household, and occupational exposures (maternal and paternal) appear to be the largest risks. Prospective cohort studies link early-life exposure to organophosphates and organochlorine pesticides (primarily DDT) with adverse effects on neurodevelopment and behavior. Among the findings associated with increased pesticide levels are poorer mental development by using the Bayley index and increased scores on measures assessing pervasive developmental disorder, inattention, and attention-deficit/hyperactivity disorder. Related animal toxicology studies provide supportive biological plausibility for these findings. Additional data suggest that there may also be an association between parental pesticide use and adverse birth
Exposure scenarios for workers
Marquart, H.; Northage, C.; Money, C.
2007-01-01
The new European chemicals legislation REACH (Registration, Evaluation, Authorisation and restriction of Chemicals) requires the development of Exposure Scenarios describing the conditions and risk management measures needed for the safe use of chemicals. Such Exposure Scenarios should integrate
International Nuclear Information System (INIS)
Prillinger, G.; Konynenburg, R.A. van
1998-01-01
As a result of the popularity of the Agencies report 'Neutron Irradiation Embrittlement of Reactor Pressure Vessel Steels' of 1975, it was decided that another report on this broad subject would be of use. In this report, background and contemporary views on specially identified areas of the subject are considered as self-contained chapters, written by experts. In chapter 6, LWR-PV neutron transport calculations and dosimetry methods and how they are combined to evaluate the neutron exposure of the steel of pressure vessels are discussed. An effort to correlate neutron exposure parameters with damage is made
Challenges and perspectives of nanoparticle exposure assessment.
Lee, Ji Hyun; Moon, Min Chaul; Lee, Joon Yeob; Yu, Il Je
2010-06-01
Nanoparticle exposure assessment presents a unique challenge in the field of occupational and environmental health. With the commercialization of nanotechnology, exposure usually starts from the workplace and then spreads to environment and consumer exposure. This report discusses the current trends of nanoparticle exposure assessment, including the definition of nanotechnology relevant terms, essential physicochemical properties for nanomaterial characterization, current international activities related nanomaterial safety, and exposure assessment standard development for nanotechnology. Further this report describes challenges of nanoparticle exposure assessment such as background measurement, metrics of nanoparticle exposure assessment and personal sampling.
Radiation exposure during ESWL
International Nuclear Information System (INIS)
McCullough, D.L.; Van Swearingen, F.L.; Dyer, R.B.; Appel, B.
1987-01-01
This paper discusses exposure to ionizing radiation by the ESWL patient and for health professionals. Although the patient is exposed acutely to the highest level of radiation, the lithotripter team is chronically exposed to ionizing radiation at varying levels. Attention to detail is important in reducing that exposure. The operator should follow the guidelines set forth in this chapter in order to minimize exposure to the patient, himself or herself, and to all co-workers. At the present time, investigation of an alternative modality for stone localization, ultrasound, is being investigated
India | Page 121 | IDRC - International Development Research Centre
International Development Research Centre (IDRC) Digital Library (Canada)
Read more about Environmental pollution. Language English. Dans le monde arabe, on assiste à des percées historiques alors que tombent les obstacles au plein exercice, par les femmes, de leurs droits de citoyennes dans leur propre pays. Depuis quelques années, en Algérie, en Égypte et au Maroc, des femmes ...
Batterman, Stuart; Su, Feng-Chiao; Li, Shi; Mukherjee, Bhramar; Jia, Chunrong
2014-06-01
different analysis focused on the sources inside the home and outside (but close to the home), it was assumed that 100% of VOCs from outside sources would penetrate the home. Outdoor VOC sources accounted for 5% (d-limonene) to 81% (carbon tetrachloride [CTC]) of the total exposure. Personal exposure and indoor measurements had similar determinants depending on the VOC. Gasoline-related VOCs (e.g., benzene and methyl tert-butyl ether [MTBE]) were associated with city, residences with attached garages, pumping gas, wind speed, and home air exchange rate (AER). Odorant and cleaning-related VOCs (e.g., 1,4-DCB and chloroform) also were associated with city, and a residence's AER, size, and family members showering. Dry-cleaning and industry-related VOCs (e.g., tetrachloroethylene [or perchloroethylene, PERC] and trichloroethylene [TCE]) were associated with city, type of water supply to the home, and visits to the dry cleaner. These and other relationships were significant, they explained from 10% to 40% of the variance in the measurements, and are consistent with known emission sources and those reported in the literature. Outdoor concentrations of VOCs had only two determinants in common: city and wind speed. Overall, personal exposure was dominated by the home setting, although a large fraction of indoor VOC concentrations were due to outdoor sources. City of residence, personal activities, household characteristics, and meteorology were significant determinants. Concentrations in RIOPA were considerably lower than levels in the nationally representative NHANES for all VOCs except MTBE and 1,4-DCB. Differences between RIOPA and NHANES results can be explained by contrasts between the sampling designs and staging in the two studies, and by differences in the demographics, smoking, employment, occupations, and home locations. (ABSTRACT TRUNCATED)
Ethical issues in medico-legal exposures
International Nuclear Information System (INIS)
O'Reilly, G.; Malone, J. F.
2008-01-01
The Medical Exposure Directive (MED) 97/43/Euratom defines medico-legal procedures as 'procedures performed for insurance or legal purposes without a medical indication'. The term 'medico-legal exposures' covers a wide range of possible types of exposures, very different in nature, for which the only feature in common is the fact that the main reason for performing them does not relate directly to the health of the individual being exposed to ionising radiation. The key issue in medico-legal exposures is justification. Balancing the advantages and disadvantages of such exposures is complex because not only can these be difficult to quantify and hence compare, but often the advantage may be to society whereas the disadvantage is usually to an individual. This adds an additional layer of ethical complexity to the problem and one, which requires input from a number of sources beyond the established radiation protection community. Because medico-legal exposures are considered to be medical exposures, they are not subject to dose limits. In medico-legal exposures where the benefit is not necessarily to the individual undergoing the exposure, the question must be asked as to whether or not this is an appropriate framework within which to conduct such exposures. This paper looks at the current situation in Europe, highlighting some of the particular problems that have arisen, and tries to identify the areas, which require further clarification and guidance. (authors)
Batterman, Stuart; Su, Feng-Chiao; Li, Shi; Mukherjee, Bhramar; Jia, Chunrong
2015-01-01
concentrations for most VOCs. In a different analysis focused on the sources inside the home and outside (but close to the home), it was assumed that 100% of VOCs from outside sources would penetrate the home. Outdoor VOC sources accounted for 5% (d-limonene) to 81% (carbon tetrachloride [CTC]) of the total exposure. Personal exposure and indoor measurements had similar determinants depending on the VOC. Gasoline-related VOCs (e.g., benzene and methyl tert-butyl ether [MTBE]) were associated with city, residences with attached garages, pumping gas, wind speed, and home air exchange rate (AER). Odorant and cleaning-related VOCs (e.g., 1,4-DCB and chloroform) also were associated with city, and a residence’s AER, size, and family members showering. Dry-cleaning and industry-related VOCs (e.g., tetrachloroethylene [or perchloroethylene, PERC] and trichloroethylene [TCE]) were associated with city, type of water supply to the home, and visits to the dry cleaner. These and other relationships were significant, they explained from 10% to 40% of the variance in the measurements, and are consistent with known emission sources and those reported in the literature. Outdoor concentrations of VOCs had only two determinants in common: city and wind speed. Overall, personal exposure was dominated by the home setting, although a large fraction of indoor VOC concentrations were due to outdoor sources. City of residence, personal activities, household characteristics, and meteorology were significant determinants. Concentrations in RIOPA were considerably lower than levels in the nationally representative NHANES for all VOCs except MTBE and 1,4-DCB. Differences between RIOPA and NHANES results can be explained by contrasts between the sampling designs and staging in the two studies, and by differences in the demographics, smoking, employment, occupations, and home locations. A portion of these differences are due to the nature of the convenience (RIOPA) and representative (NHANES) sampling
Dalterio, S; Steger, R; Mayfield, D; Bartke, A
1984-01-01
Maternal exposure to delta 9-tetrahydrocannabinol (THC), the major psychoactive constituent in marihuana, or to the non-psychoactive cannabinol (CBN) or cannabidiol (CBD) alters endocrine functions and concentrations of brain biogenic amines in their male offspring. Prenatal CBN exposure on day 18 of gestation resulted in decreased plasma FSH levels, testicular testosterone (T) concentrations, and seminal vesicles weights, but increased plasma levels of luteinizing hormone (LH) and follicle-stimulating hormone (FSH) post-castration in adulthood. Prenatal exposure to THC significantly enhanced the responsiveness of the testes to intratesticular LH injection in vivo and tended to increase human chorionic gonadotropin (hCG)-stimulated T production by decapsulated testes in vitro. In the CBN-exposed mice, hCG-stimulated T production was enhanced, while CBD exposure had no effect. Prenatal THC exposure altered the negative feedback effects of exogenous gonadal steroids in castrated adults, with lower plasma T and FSH levels after 20 micrograms T than in castrated controls. In contrast, CBD-exposed mice had higher levels of LH in plasma post-castration. In CBN-exposed adults, two weeks post-castration the concentration of norepinephrine (NE) and dopamine (DA) in hypothalamus and remaining brain were reduced, while levels of serotonin (5-HT) and its metabolite, 5-HIAA, were elevated compared to that in castrated OIL-controls. Prenatal CBD-exposure also reduced NE and elevated 5-HT and 5-HIAA, but did not affect DA levels post-castration. Concentrations of brain biogenic amines were not influenced by prenatal THC exposure in the present study. A single prenatal exposure to psychoactive or non-psychoactive components of marihuana results in long term alterations in the function of the hypothalamo-pituitary-gonadal axis. Changes in the concentrations of brain biogenic amines may be related to these effects of prenatal cannabinoids on endocrine function in adult male mice.
Mercury exposure in children: a review
International Nuclear Information System (INIS)
Counter, S. Allen; Buchanan, Leo H.
2004-01-01
Exposure to toxic mercury (Hg) is a growing health hazard throughout the world today. Recent studies show that mercury exposure may occur in the environment, and increasingly in occupational and domestic settings. Children are particularly vulnerable to Hg intoxication, which may lead to impairment of the developing central nervous system, as well as pulmonary and nephrotic damage. Several sources of toxic Hg exposure in children have been reported in biomedical literature: (1) methylmercury, the most widespread source of Hg exposure, is most commonly the result of consumption of contaminated foods, primarily fish; (2) ethylmercury, which has been the subject of recent scientific inquiry in relation to the controversial pediatric vaccine preservative thimerosal; (3) elemental Hg vapor exposure through accidents and occupational and ritualistic practices; (4) inorganic Hg through the use of topical Hg-based skin creams and in infant teething powders; (5) metallic Hg in dental amalgams, which release Hg vapors, and Hg 2+ in tissues. This review examines recent epidemiological studies of methylmercury exposure in children. Reports of elemental Hg vapor exposure in children through accidents and occupational practices, and the more recent observations of the increasing use of elemental Hg for magico-religious purposes in urban communities are also discussed. Studies of inorganic Hg exposure from the widespread use of topical beauty creams and teething powders, and fetal/neonatal Hg exposure from maternal dental amalgam fillings are reviewed. Considerable attention was given in this review to pediatric methylmercury exposure and neurodevelopment because it is the most thoroughly investigated Hg species. Each source of Hg exposure is reviewed in relation to specific pediatric health effects, particularly subtle neurodevelopmental disorders
Energy Technology Data Exchange (ETDEWEB)
Cohen, Mervyn D. [Indiana University School of Medicine, Department of Radiology, Riley Children' s Hospital, Indianapolis, IN (United States); Riley Hospital for Children, Department of Radiology, Indianapolis, IN (United States); Cooper, Matt L.; Piersall, Kelly [Indiana University School of Medicine, Department of Radiology, Riley Children' s Hospital, Indianapolis, IN (United States); Apgar, Bruce K. [Agfa HealthCare Corporation, Greenville, SC (United States)
2011-05-15
Many methods are used to track patient exposure during acquisition of plain film radiographs. A uniform international standard would aid this process. To evaluate and describe a new, simple quality-assurance method for monitoring patient exposure. This method uses the ''exposure index'' and the ''deviation index,'' recently developed by the International Electrotechnical Commission (IEC) and American Association of Physicists in Medicine (AAPM). The deviation index measures variation from an ideal target exposure index value. Our objective was to determine whether the exposure index and the deviation index can be used to monitor and control exposure drift over time. Our Agfa workstation automatically keeps a record of the exposure index for every patient. The exposure index and deviation index were calculated on 1,884 consecutive neonatal chest images. Exposure of a neonatal chest phantom was performed as a control. Acquisition of the exposure index and calculation of the deviation index was easily achieved. The weekly mean exposure index of the phantom and the patients was stable and showed <10% change during the study, indicating no exposure drift during the study period. The exposure index is an excellent tool to monitor the consistency of patient exposures. It does not indicate the exposure value used, but is an index to track compliance with a pre-determined target exposure. (orig.)
International Nuclear Information System (INIS)
Cohen, Mervyn D.; Cooper, Matt L.; Piersall, Kelly; Apgar, Bruce K.
2011-01-01
Many methods are used to track patient exposure during acquisition of plain film radiographs. A uniform international standard would aid this process. To evaluate and describe a new, simple quality-assurance method for monitoring patient exposure. This method uses the ''exposure index'' and the ''deviation index,'' recently developed by the International Electrotechnical Commission (IEC) and American Association of Physicists in Medicine (AAPM). The deviation index measures variation from an ideal target exposure index value. Our objective was to determine whether the exposure index and the deviation index can be used to monitor and control exposure drift over time. Our Agfa workstation automatically keeps a record of the exposure index for every patient. The exposure index and deviation index were calculated on 1,884 consecutive neonatal chest images. Exposure of a neonatal chest phantom was performed as a control. Acquisition of the exposure index and calculation of the deviation index was easily achieved. The weekly mean exposure index of the phantom and the patients was stable and showed <10% change during the study, indicating no exposure drift during the study period. The exposure index is an excellent tool to monitor the consistency of patient exposures. It does not indicate the exposure value used, but is an index to track compliance with a pre-determined target exposure. (orig.)
Radiation exposure and infant cancer
Energy Technology Data Exchange (ETDEWEB)
Watari, T [Tokyo Univ. (Japan). Faculty of Medicine
1974-12-01
Medical exposures accompanied by an increase in radiation use in the field of pediatrics were described. Basic ideas and countermeasures to radiation injuries were outlined. In order to decrease the medical exposure, it is necessary for the doctor, x-ray technician and manufacturer to work together. The mechanism and characteristics of radio carcinogenesis were also mentioned. Particularly, the following two points were described: 1) How many years does it take before carcinogenesis appears as a result of radiation exposure in infancy 2) How and when does the effect of fetus exposure appear. Radiosensitivity in infants and fetuses is greater than that of an adult. The occurrence of leukemia caused by prenatal exposure was reviewed. The relation between irradiation for therapy and morbidity of thyroid cancer was mentioned. Finally, precautions necessary for infants, pregnant women and nursing mothers when using radioisotopes were mentioned.
International Nuclear Information System (INIS)
Telle-Lamberton, M.; Bouville, P.; Bergot, D.; Gagneau, M.; Marot, S.; Telle-Lamberton, M.; Giraud, J.M.; Gelas, J.M.
2005-01-01
A 'Facility-Exposure Matrix' (FEM) is proposed to assess exposure to chemical carcinogens and radionuclides in a cohort of nuclear workers. Exposures are to be attributed in the following way: a worker reports to an administrative unit and/or is monitored for exposure to ionising radiation in a specific workplace. These units are connected with a list of facilities for which exposure is assessed through a group of experts. The entire process of the FEM applied in one of the nuclear centres included in the study shows that the FEM is feasible: exposure durations as well as groups of correlated exposures are presented but have to be considered as possible rather than positive exposures. Considering the number of facilities to assess (330), ways to simplify the method are proposed: (i) the list of exposures will be restricted to 18 chemical products retained from an extensive bibliography study; (ii) for each of the following classes of facilities: nuclear reactors, fuel fabrication, high-activity laboratories and radiation chemistry, accelerators and irradiators, waste treatment, biology, reprocessing, fusion, occupational exposure will be deduced from the information already gathered by the initial method. Besides taking into account confusion factors in the low doses epidemiological study of nuclear workers, the matrix should help in the assessment of internal contamination and chemical exposures in the nuclear industry. (author)
Benchmarking of a T-wave alternans detection method based on empirical mode decomposition.
Blanco-Velasco, Manuel; Goya-Esteban, Rebeca; Cruz-Roldán, Fernando; García-Alberola, Arcadi; Rojo-Álvarez, José Luis
2017-07-01
T-wave alternans (TWA) is a fluctuation of the ST-T complex occurring on an every-other-beat basis of the surface electrocardiogram (ECG). It has been shown to be an informative risk stratifier for sudden cardiac death, though the lack of gold standard to benchmark detection methods has promoted the use of synthetic signals. This work proposes a novel signal model to study the performance of a TWA detection. Additionally, the methodological validation of a denoising technique based on empirical mode decomposition (EMD), which is used here along with the spectral method, is also tackled. The proposed test bed system is based on the following guidelines: (1) use of open source databases to enable experimental replication; (2) use of real ECG signals and physiological noise; (3) inclusion of randomized TWA episodes. Both sensitivity (Se) and specificity (Sp) are separately analyzed. Also a nonparametric hypothesis test, based on Bootstrap resampling, is used to determine whether the presence of the EMD block actually improves the performance. The results show an outstanding specificity when the EMD block is used, even in very noisy conditions (0.96 compared to 0.72 for SNR = 8 dB), being always superior than that of the conventional SM alone. Regarding the sensitivity, using the EMD method also outperforms in noisy conditions (0.57 compared to 0.46 for SNR=8 dB), while it decreases in noiseless conditions. The proposed test setting designed to analyze the performance guarantees that the actual physiological variability of the cardiac system is reproduced. The use of the EMD-based block in noisy environment enables the identification of most patients with fatal arrhythmias. Copyright © 2017 Elsevier B.V. All rights reserved.
The Young L Dwarf 2MASS J11193254-1137466 Is a Planetary-mass Binary
Best, William M. J.; Liu, Michael C.; Dupuy, Trent J.; Magnier, Eugene A.
2017-07-01
We have discovered that the extremely red, low-gravity L7 dwarf 2MASS J11193254-1137466 is a 0.″14 (3.6 au) binary using Keck laser guide star adaptive optics imaging. 2MASS J11193254-1137466 has previously been identified as a likely member of the TW Hydrae Association (TWA). Using our updated photometric distance and proper motion, a kinematic analysis based on the BANYAN II model gives an 82% probability of TWA membership. At TWA’s 10 ± 3 Myr age and using hot-start evolutionary models, 2MASS J11193254-1137466AB is a pair of {3.7}-0.9+1.2 {M}{Jup} brown dwarfs, making it the lowest-mass binary discovered to date. We estimate an orbital period of {90}-50+80 years. One component is marginally brighter in K band but fainter in J band, making this a probable flux-reversal binary, the first discovered with such a young age. We also imaged the spectrally similar TWA L7 dwarf WISEA J114724.10-204021.3 with Keck and found no sign of binarity. Our evolutionary model-derived {T}{eff} estimate for WISEA J114724.10-204021.3 is ≈230 K higher than for 2MASS J11193254-1137466AB, at odds with the spectral similarity of the two objects. This discrepancy suggests that WISEA J114724.10-204021.3 may actually be a tight binary with masses and temperatures very similar to 2MASS J11193254-1137466AB, or further supporting the idea that near-infrared spectra of young ultracool dwarfs are shaped by factors other than temperature and gravity. 2MASS J11193254-1137466AB will be an essential benchmark for testing evolutionary and atmospheric models in the young planetary-mass regime.
Teachers' Autonomy in Today's Educational Climate: Current Perceptions from an Acceptable Instrument
Strong, Luman E. G.; Yoshida, Roland K.
2014-01-01
This research evaluated the psychometric properties of Friedman's (1999) Teacher Work-Autonomy Scale (TWA) to determine whether it was an acceptable instrument to measure U.S. teacher autonomy in the present educational context. A second purpose was to ascertain the current status of teachers' perceptions of their autonomy from a sample of U.S.…
Energy Technology Data Exchange (ETDEWEB)
Caudeville, Julien, E-mail: Julien.CAUDEVILLE@ineris.fr [INERIS (French National Institute for Industrial Environment and Risks), Parc Technologique Alata, BP 2, 60550 Verneuil-en-Halatte (France); Joint research unit UMR 6599, Heudiasyc (Heuristic and Diagnoses of Complex Systems), University of Technology of Compiegne and CNRS, Rue du Dr Schweitzer, 60200 Compiegne (France); Bonnard, Roseline, E-mail: Roseline.BONNARD@ineris.fr [INERIS (French National Institute for Industrial Environment and Risks), Parc Technologique Alata, BP 2, 60550 Verneuil-en-Halatte (France); Boudet, Celine, E-mail: Celine.BOUDET@ineris.fr [INERIS (French National Institute for Industrial Environment and Risks), Parc Technologique Alata, BP 2, 60550 Verneuil-en-Halatte (France); Denys, Sebastien, E-mail: Sebastien.DENYS@ineris.fr [INERIS (French National Institute for Industrial Environment and Risks), Parc Technologique Alata, BP 2, 60550 Verneuil-en-Halatte (France); Govaert, Gerard, E-mail: gerard.govaert@utc.fr [Joint research unit UMR 6599, Heudiasyc (Heuristic and Diagnoses of Complex Systems), University of Technology of Compiegne and CNRS, Rue du Dr Schweitzer, 60200 Compiegne (France); Cicolella, Andre, E-mail: Andre.CICOLELLA@ineris.fr [INERIS (French National Institute for Industrial Environment and Risks), Parc Technologique Alata, BP 2, 60550 Verneuil-en-Halatte (France)
2012-08-15
Analyzing the relationship between the environment and health has become a major focus of public health efforts in France, as evidenced by the national action plans for health and the environment. These plans have identified the following two priorities: -identify and manage geographic areas where hotspot exposures are a potential risk to human health; and -reduce exposure inequalities. The aim of this study is to develop a spatial stochastic multimedia exposure model for detecting vulnerable populations and analyzing exposure determinants at a fine resolution and regional scale. A multimedia exposure model was developed by INERIS to assess the transfer of substances from the environment to humans through inhalation and ingestion pathways. The RESPIR project adds a spatial dimension by linking GIS (Geographic Information System) to the model. Tools are developed using modeling, spatial analysis and geostatistic methods to build and discretize interesting variables and indicators from different supports and resolutions on a 1-km{sup 2} regular grid. We applied this model to the risk assessment of exposure to metals (cadmium, lead and nickel) using data from a region in France (Nord-Pas-de-Calais). The considered exposure pathways include the atmospheric contaminant inhalation and ingestion of soil, vegetation, meat, egg, milk, fish and drinking water. Exposure scenarios are defined for different reference groups (age, dietary properties, and the fraction of food produced locally). The two largest risks correspond to an ancient industrial site (Metaleurop) and the Lille agglomeration. In these areas, cadmium, vegetation ingestion and soil contamination are the principal determinants of the computed risk. -- Highlights: Black-Right-Pointing-Pointer We present a multimedia exposure model for mapping environmental disparities. Black-Right-Pointing-Pointer We perform a risk assessment on a region of France at a fine scale for three metals. Black-Right-Pointing-Pointer We
International Nuclear Information System (INIS)
Caudeville, Julien; Bonnard, Roseline; Boudet, Céline; Denys, Sébastien; Govaert, Gérard; Cicolella, André
2012-01-01
Analyzing the relationship between the environment and health has become a major focus of public health efforts in France, as evidenced by the national action plans for health and the environment. These plans have identified the following two priorities: -identify and manage geographic areas where hotspot exposures are a potential risk to human health; and -reduce exposure inequalities. The aim of this study is to develop a spatial stochastic multimedia exposure model for detecting vulnerable populations and analyzing exposure determinants at a fine resolution and regional scale. A multimedia exposure model was developed by INERIS to assess the transfer of substances from the environment to humans through inhalation and ingestion pathways. The RESPIR project adds a spatial dimension by linking GIS (Geographic Information System) to the model. Tools are developed using modeling, spatial analysis and geostatistic methods to build and discretize interesting variables and indicators from different supports and resolutions on a 1-km 2 regular grid. We applied this model to the risk assessment of exposure to metals (cadmium, lead and nickel) using data from a region in France (Nord-Pas-de-Calais). The considered exposure pathways include the atmospheric contaminant inhalation and ingestion of soil, vegetation, meat, egg, milk, fish and drinking water. Exposure scenarios are defined for different reference groups (age, dietary properties, and the fraction of food produced locally). The two largest risks correspond to an ancient industrial site (Metaleurop) and the Lille agglomeration. In these areas, cadmium, vegetation ingestion and soil contamination are the principal determinants of the computed risk. -- Highlights: ► We present a multimedia exposure model for mapping environmental disparities. ► We perform a risk assessment on a region of France at a fine scale for three metals. ► We examine exposure determinants and detect vulnerable population. ► The largest
Children's exposure to polybrominated diphenyl ethers.
Zuurbier, Moniek; Leijs, Marike; Schoeters, Greet; ten Tusscher, Gavin; Koppe, Janna G
2006-10-01
Polybrominated biphenyl ethers (PBDEs), a class of brominated flame retardants, are frequently used in consumer products. PBDEs levels in environmental and human samples have increased in recent decades. Children are exposed to PBDEs through diet, mainly through fish, meat and milk. Total dietary exposure of children in Europe was calculated to be 2-3 ng/kg b.w./day. For nursing infants the main source of PBDE exposure is breast milk; exposure levels are around 15 ng/kg b.w./day. PBDE exposure levels in North America are 10 to a 100 times higher. Because of their persistence and their similarity to polychlorinated biphenyls (PCBs), concern has been raised about the effects of PBDEs on human health. Exposure to penta- and octa-BDE led to learning impairment and impaired motor behaviour in rodents. Exposure to penta-, octa- and also deca-BDE caused effects on thyroid homeostasis in animals. The EU has banned the production and use of penta- and octa-BDE since 2004; however, exposure will continue during the coming decades. Based upon current toxicological evidence, human exposure to deca-BDEs is not expected to lead to health effects, but data on exposure to deca-BDE and data on toxicity of deca-BDE are scarce. Therefore, monitoring studies and toxicity studies on deca-BDEs and other BDEs should continue.
Human Exposure Assessment for Air Pollution.
Han, Bin; Hu, Li-Wen; Bai, Zhipeng
2017-01-01
Assessment of human exposure to air pollution is a fundamental part of the more general process of health risk assessment. The measurement methods for exposure assessment now include personal exposure monitoring, indoor-outdoor sampling, mobile monitoring, and exposure assessment modeling (such as proximity models, interpolation model, air dispersion models, and land-use regression (LUR) models). Among these methods, personal exposure measurement is considered to be the most accurate method of pollutant exposure assessment until now, since it can better quantify observed differences and better reflect exposure among smaller groups of people at ground level. And since the great differences of geographical environment, source distribution, pollution characteristics, economic conditions, and living habits, there is a wide range of differences between indoor, outdoor, and individual air pollution exposure in different regions of China. In general, the indoor particles in most Chinese families comprise infiltrated outdoor particles, particles generated indoors, and a few secondary organic aerosol particles, and in most cases, outdoor particle pollution concentrations are a major contributor to indoor concentrations in China. Furthermore, since the time, energy, and expense are limited, it is difficult to measure the concentration of pollutants for each individual. In recent years, obtaining the concentration of air pollutants by using a variety of exposure assessment models is becoming a main method which could solve the problem of the increasing number of individuals in epidemiology studies.
DEFF Research Database (Denmark)
Nelsing, S; Nielsen, T L; Nielsen, Jens Ole
1993-01-01
We investigated mechanisms of mucocutaneous exposure (MCE) and percutaneous exposure (PCE) to blood, and compliance with protective barriers among all former and presently employed medical staff at a Danish Department of Infectious Diseases. All subjects were asked to complete an anonymous...
Video exposure monitoring as part of a strategy to assess exposure to nanoparticles
Beurskens-Comuth, P.A.W.V.; Verbist, K.; Brouwer, D.
2011-01-01
Objectives: There is a growing awareness of the potential risks for human health of exposure to ultrafine particles or nanoparticles. In that context, workplace air measurements become important, and various strategies have been developed to monitor exposure. In addition, observations and
Constant exposure technique in industrial radiography
International Nuclear Information System (INIS)
Domanus, J.C.
1983-08-01
The principles and advantages of the constant exposure technique are explained. Choice of exposure factors is analyzed. Film, paper and intensifying screens used throughout the investigation and film and paper processing are described. Exposure technique and the use of image quality indicators are given. Methods of determining of radiographic image quality are presented. Conclusions about the use of constant exposure vs. constant kilovoltage technique are formulated. (author)
Economic Exposure and Integrated Risk Management
Miller, Kent D.
1994-01-01
Most corporate risk management research focuses on particular risk exposures to the exclusion of other interrelated exposures. By contrast, this study models corporate risk exposures using a multivariate approach integrating the distinct exposures of interest to finance and strategy researchers. The paper addresses the implications of multivariate modeling for corporate risk management, some key methodological issues arising in empirical estimation of corporate economic exposrues, and direc...
Isaacs, Kristin K; Glen, W Graham; Egeghy, Peter; Goldsmith, Michael-Rock; Smith, Luther; Vallero, Daniel; Brooks, Raina; Grulke, Christopher M; Özkaynak, Halûk
2014-11-04
United States Environmental Protection Agency (USEPA) researchers are developing a strategy for high-throughput (HT) exposure-based prioritization of chemicals under the ExpoCast program. These novel modeling approaches for evaluating chemicals based on their potential for biologically relevant human exposures will inform toxicity testing and prioritization for chemical risk assessment. Based on probabilistic methods and algorithms developed for The Stochastic Human Exposure and Dose Simulation Model for Multimedia, Multipathway Chemicals (SHEDS-MM), a new mechanistic modeling approach has been developed to accommodate high-throughput (HT) assessment of exposure potential. In this SHEDS-HT model, the residential and dietary modules of SHEDS-MM have been operationally modified to reduce the user burden, input data demands, and run times of the higher-tier model, while maintaining critical features and inputs that influence exposure. The model has been implemented in R; the modeling framework links chemicals to consumer product categories or food groups (and thus exposure scenarios) to predict HT exposures and intake doses. Initially, SHEDS-HT has been applied to 2507 organic chemicals associated with consumer products and agricultural pesticides. These evaluations employ data from recent USEPA efforts to characterize usage (prevalence, frequency, and magnitude), chemical composition, and exposure scenarios for a wide range of consumer products. In modeling indirect exposures from near-field sources, SHEDS-HT employs a fugacity-based module to estimate concentrations in indoor environmental media. The concentration estimates, along with relevant exposure factors and human activity data, are then used by the model to rapidly generate probabilistic population distributions of near-field indirect exposures via dermal, nondietary ingestion, and inhalation pathways. Pathway-specific estimates of near-field direct exposures from consumer products are also modeled
Epidemic gasoline exposures following Hurricane Sandy.
Kim, Hong K; Takematsu, Mai; Biary, Rana; Williams, Nicholas; Hoffman, Robert S; Smith, Silas W
2013-12-01
Major adverse climatic events (MACEs) in heavily-populated areas can inflict severe damage to infrastructure, disrupting essential municipal and commercial services. Compromised health care delivery systems and limited utilities such as electricity, heating, potable water, sanitation, and housing, place populations in disaster areas at risk of toxic exposures. Hurricane Sandy made landfall on October 29, 2012 and caused severe infrastructure damage in heavily-populated areas. The prolonged electrical outage and damage to oil refineries caused a gasoline shortage and rationing unseen in the USA since the 1970s. This study explored gasoline exposures and clinical outcomes in the aftermath of Hurricane Sandy. Prospectively collected, regional poison control center (PCC) data regarding gasoline exposure cases from October 29, 2012 (hurricane landfall) through November 28, 2012 were reviewed and compared to the previous four years. The trends of gasoline exposures, exposure type, severity of clinical outcome, and hospital referral rates were assessed. Two-hundred and eighty-three gasoline exposures were identified, representing an 18 to 283-fold increase over the previous four years. The leading exposure route was siphoning (53.4%). Men comprised 83.0% of exposures; 91.9% were older than 20 years of age. Of 273 home-based calls, 88.7% were managed on site. Asymptomatic exposures occurred in 61.5% of the cases. However, minor and moderate toxic effects occurred in 12.4% and 3.5% of cases, respectively. Gastrointestinal (24.4%) and pulmonary (8.4%) symptoms predominated. No major outcomes or deaths were reported. Hurricane Sandy significantly increased gasoline exposures. While the majority of exposures were managed at home with minimum clinical toxicity, some patients experienced more severe symptoms. Disaster plans should incorporate public health messaging and regional PCCs for public health promotion and toxicological surveillance.
A PREDICTIVE STUDY: CARBON MONOXIDE EMISSION MODELING AT A SIGNALIZED INTERSECTION
Directory of Open Access Journals (Sweden)
FREDDY WEE LIANG KHO
2014-02-01
Full Text Available CAL3QHC dispersion model was used to predict the present and future carbonmonoxide (CO levels at a busy signalized intersection. This study attempted to identify CO “hot-spots” at nearby areas of the intersection during typical A.M. and P.M. peak hours. The CO concentration “hot-spots” had been identified at 101 Commercial Park and the simulated maximum 1-hour Time-Weighted Average (1-h TWA ground level CO concentrations of 18.3 ppm and 18.6 ppm had been observed during A.M. and P.M. peaks, respectively in year 2006. This study shows that there would be no significant increment in CO level for year 2014 although a substantial increase in the number of vehicles is assumed to affect CO levels. It was also found that CO levels would be well below the Malaysian Ambient Air Quality Guideline of 30 ppm (1-h TWA. Comparisons between the measured and simulated CO levels using quantitative data analysis technique and statistical methods indicated that CAL3QHC dispersion model correlated well with measured data.
[Effects of 1-bromopropane on neurological and hematological changes of female exposed workers].
Li, Wei-Hua; Zhou, Zhi-Jun; Wang, Qiang-Yi; Ichihara, Gaku; Takeuchi, Yasuhiro; Ding, Xun-Cheng
2010-05-01
To investigate the health effects of 1-bromopropane (1-BP) on female exposed workers. Four 1-BP manufacturing plants were investigated. Workers were interviewed with questionnaire and examined with neurobehavioral core test battery, nerve conduction velocity tests of nervus tibialis and nervus suralis, vibration sensation test, hematological and biochemical tests. Ambient 1-BP concentration was measured with detection tube, and time-weighed average levels of individual workers were estimated with passive samplers. 1-BP concentration in the plants ranged from 0 to 402.40 mg/m3 (Geomean 32.19 mg/m3). Time-weighted average exposure levels (TWA-8 h) ranged from 0.35 to 535.19 mg/m3 (Geomean 14.08 mg/m3). Compared with the control group, 1-BP exposed workers showed reduced motor nerve conduction velocity [(44.8 +/- 8.7) m/s] and sensory nerve conduction velocity [(45.5 +/- 4.9) m/s], prolonged distal latency [(7.5 +/- 2.1) ms], reduced toe vibration perception, and altered neurobehavior parameters(POMS vigor, tension, anxiety, confusion) significantly (P system, and lead to abnormal hematological and biomedical indicators.
Radiation exposure of uranium mill workers
International Nuclear Information System (INIS)
Jha, Giridhar; Saha, S.C.
1982-01-01
The uranium mill workers at Jaduguda were covered by a regular film badge service from 1969 onwards. Since the log normal plot is useful in interpreting occupational exposure, a statistical analysis of the radiation exposure data was attempted. Exposure data for each year has been plotted as cumulative percentage and worker's population with exposure levels in different class intervals. The plot for each of the year under investigation shows an occupational exposure distribution more or less consistent with the log normal distribution function. The analysis shows that more than 98% of radiation workers received less than 200 mrem (2 mSv). (author)
Radiation exposure during equine radiography
International Nuclear Information System (INIS)
Ackerman, N.; Spencer, C.P.; Hager, D.A.; Poulos, P.W. Jr.
1988-01-01
All personnel present in the X-ray examination room during equine radiography were monitored using low energy direct reading ionization chambers (pockets dosimeters) worn outside the lead apron at neck level. The individuals' task and dosimeter readings were recorded after each examination. Average doses ranged from 0 to 6 mrad per study. The greatest exposures were associated with radiography of the shoulder and averaged less than 4 mrad. The individual extending the horse's limb was at greatest risk although the individual holding the horse's halter and the one making the X-ray exposure received similar exposures. A survey of the overhead tube assembly used for some of the X-ray examinations also was performed. Meter readings obtained indicated an asymetric dose distribution around the tube assembly, with the highest dose occurring on the side to which the exposure cord was attached. Although the exposures observed were within acceptable limits for occupational workers, we have altered our protocol and no longer radiograph the equine shoulder unless the horse is anesthetized. Continued use of the pocket dosimeters and maintenance of a case record of radiation exposure appears to make the technologists more aware of radiation hazards
Environmental radioactivity and radiation exposure
International Nuclear Information System (INIS)
1976-01-01
The environmental radioactivity in the Federal Republic of Germany was almost as high in 1976 as in 1975. It only increased temporarily in autumn 1976 as a result of the above-ground nuclear weapons test of the People's Republic of China on September 29th 1976 and then returned to its previous level. The radioactivity in food had a slight decreasing trend in 1976, apart from a temporary increase in the radioactivity in milk also caused by the nuclear weapons test mentioned. The population exposure remains basically unchanged in 1976 compared with 1975. The artificial radiation exposure is about half as high as the natural radiation exposure to which man has always been exposed. The former is based to 83% on using X-rays in medicine, particularly for X-ray diagnostic purposes. The population exposure due to nuclear power plants and other nuclear plants is still well below 1% of the natural radiation exposure although in 1976 three new nuclear power plants were put into operation. This is also true for the average radiation exposure within an area of 3 km around the nuclear plant. (orig.) [de
Sources of radiation exposure - an overview
International Nuclear Information System (INIS)
Mason, G.C.
1990-01-01
Sources of radiation exposure are reviewed from the perspective of mining and milling of radioactive ores in Australia. The major sources of occupational and public exposure are identified and described, and exposures from mining and milling operations are discussed in the context of natural radiation sources and other sources arising from human activities. Most radiation exposure of humans comes from natural sources. About 80% of the world average of the effective dose equivalents received by individual people arises from natural radiation, with a further 15-20% coming from medical exposures*. Exposures results from human activities, such as mining and milling of radioactive ores, nuclear power generation, fallout from nuclear weapons testing and non-medical use of radioisotopes and X-rays, add less than 1% to the total. 9 refs., 4 tabs., 10 figs
Skin exposure to isocyanates: reasons for concern.
Bello, Dhimiter; Herrick, Christina A; Smith, Thomas J; Woskie, Susan R; Streicher, Robert P; Cullen, Mark R; Liu, Youcheng; Redlich, Carrie A
2007-03-01
Isocyanates (di- and poly-), important chemicals used worldwide to produce polyurethane products, are a leading cause of occupational asthma. Respiratory exposures have been reduced through improved hygiene controls and the use of less-volatile isocyanates. Yet isocyanate asthma continues to occur, not uncommonly in settings with minimal inhalation exposure but opportunity for skin exposure. In this review we evaluate the potential role of skin exposure in the development of isocyanate asthma. We reviewed the published animal and human literature on isocyanate skin-exposure methods, workplace skin exposure, skin absorption, and the role of skin exposure in isocyanate sensitization and asthma. We selected relevant articles from computerized searches on Medline, U.S. Environmental Protection Agency, Occupational Safety and Health Administration, National Institute for Occupational Safety and Health, and Google databases using the keywords "isocyanate," "asthma," "skin," "sensitization," and other synonymous terms, and our own extensive collection of isocyanate publications. Isocyanate production and use continues to increase as the polyurethane industry expands. There is substantial opportunity for isocyanate skin exposure in many work settings, but such exposure is challenging to quantify and continues to be underappreciated. Isocyanate skin exposure can occur at work, even with the use of personal protective equipment, and may also occur with consumer use of certain isocyanate products. In animals, isocyanate skin exposure is an efficient route to induce sensitization, with subsequent inhalation challenge resulting in asthma-like responses. Several lines of evidence support a similar role for human isocyanate skin exposure, namely, that such exposure occurs and can contribute to the development of isocyanate asthma in certain settings, presumably by inducing systemic sensitization. Integrated animal and human research is needed to better understand the role of skin
Radiation exposure from incorporated isotopes
Energy Technology Data Exchange (ETDEWEB)
Beleznay, F [Hungarian Academy of Sciences, Budapest. Central Research Inst. for Physics
1985-01-01
Recommendations for the limitation of the burden of the human body from radiation exposure were developed to avoid direct radiation health damage such that the occurrence of stochastic damage can be held below a resonable risk level. The recommendations, published under ICRP 26 and ICRP 30, contain several guidelines and concepts which are discussed here. They include the primary internal dose exposure limits, secondary and implied limits for the monitoring of internal radiation exposure (Annual Limit of Intake, Derived Air Concentrations). Methods are presented for inspection and monitoring of internal exposure in medical laboratories, inspection of incorporation of sup(131)I and sup(99m)Tc.
International Nuclear Information System (INIS)
Son, Ji-Young; Bell, Michelle L
2013-01-01
Most studies of short-term particulate matter (PM) exposure use 24 h averages. However, other pollutants have stronger effects in shorter timeframes, which has influenced policy (e.g., ozone 8 h maximum). The selection of appropriate exposure timeframes is important for effective regulation. The US EPA identified health effects for sub-daily PM exposures as a critical research need. Unlike most areas, Seoul, Korea has hourly measurements of PM 10 , although not PM 2.5 . We investigated PM 10 and mortality (total, cardiovascular, respiratory) in Seoul (1999–2009) considering sub-daily exposures: 24 h, daytime (7 am–8 pm), morning (7–10 am), nighttime (8 pm–7 am), and 1 h daily maximum. We applied Poisson generalized linear modeling adjusting for temporal trends and meteorology. All PM 10 metrics were significantly associated with total mortality. Compared to other exposure timeframes, morning exposure had the most certain effect on total mortality (based on statistical significance). Increases of 10 μg m −3 in 24 h, daytime, morning, nighttime, and 1 h maximum PM 10 were associated with 0.15% (95% confidence interval 0.02–0.28%), 0.14% (0.01–0.27%), 0.10% (0.03–0.18%), 0.12% (0.03–0.22%), and 0.10% (0.00–0.21%) increases in total mortality, respectively. PM 10 was significantly associated with cardiovascular mortality for 24 h, morning, and nighttime exposures. We did not identify significant associations with respiratory mortality. The results support use of a 24 h averaging time as an appropriate metric for health studies and regulation, particularly for PM 10 and mortality. (letter)
Estimating Contact Exposure in Football Using the Head Impact Exposure Estimate
Kerr, Zachary Y.; Littleton, Ashley C.; Cox, Leah M.; DeFreese, J.D.; Varangis, Eleanna; Lynall, Robert C.; Schmidt, Julianne D.; Marshall, Stephen W.; Guskiewicz, Kevin M.
2015-01-01
Over the past decade, there has been significant debate regarding the effect of cumulative subconcussive head impacts on short and long-term neurological impairment. This debate remains unresolved, because valid epidemiological estimates of athletes' total contact exposure are lacking. We present a measure to estimate the total hours of contact exposure in football over the majority of an athlete's lifespan. Through a structured oral interview, former football players provided information rel...
DEFF Research Database (Denmark)
Nelsing, S; Nielsen, T L; Nielsen, Jens Ole
1993-01-01
We investigated mechanisms of mucocutaneous exposure (MCE) and percutaneous exposure (PCE) to blood, and compliance with protective barriers among all former and presently employed medical staff at a Danish Department of Infectious Diseases. All subjects were asked to complete an anonymous questi...
Medical exposure and the effects of radiation
International Nuclear Information System (INIS)
Okuyama, Chio
2011-01-01
Radiation gives cracks to genes. The influence is divided into deterministic effect with a threshold value, and the stochastic effect (tumor and genetic effect) which increases according to the exposure amount. Although we are put to various non-artificial radiations, which we cannot be avoided, on the earth, the contamination by artificial radiation can be defended. Artificial radioactive exposure includes medical exposure and non-medical exposure for example by nuclear power plant. As to medical examinations using radiation, the inquiry about the radiation exposure is increasing after the occurrence of the first nuclear power plant disaster of Fukushima. While concern about non-medical radioactive exposure increases, the uneasiness to medical irradiation is also increasing. The dose limit by artificial radioactive exposure other than medical exposure is set up in order to prevent the influence on the health. While the dose limit of the public exposure is set to the lower value than the total dose of non-artificial exposure concerning of a safety margin for all people, the dose limit of medical exposure is not defined, since it is thought that medical irradiation has a benefit for those who receive irradiation. Making an effort to decrease the radiation dose in performing the best medical treatment is the responsibility with which we are burdened. (author)
Teeguarden, Justin G; Tan, Yu-Mei; Edwards, Stephen W; Leonard, Jeremy A; Anderson, Kim A; Corley, Richard A; Kile, Molly L; Simonich, Staci M; Stone, David; Tanguay, Robert L; Waters, Katrina M; Harper, Stacey L; Williams, David E
2016-05-03
Driven by major scientific advances in analytical methods, biomonitoring, computation, and a newly articulated vision for a greater impact in public health, the field of exposure science is undergoing a rapid transition from a field of observation to a field of prediction. Deployment of an organizational and predictive framework for exposure science analogous to the "systems approaches" used in the biological sciences is a necessary step in this evolution. Here we propose the aggregate exposure pathway (AEP) concept as the natural and complementary companion in the exposure sciences to the adverse outcome pathway (AOP) concept in the toxicological sciences. Aggregate exposure pathways offer an intuitive framework to organize exposure data within individual units of prediction common to the field, setting the stage for exposure forecasting. Looking farther ahead, we envision direct linkages between aggregate exposure pathways and adverse outcome pathways, completing the source to outcome continuum for more meaningful integration of exposure assessment and hazard identification. Together, the two frameworks form and inform a decision-making framework with the flexibility for risk-based, hazard-based, or exposure-based decision making.
Paternal Exposures and Pregnancy
... increased risk for birth defects. Can the father’s workplace exposures affect my pregnancy? There have been a number of studies looking ... else could a father’s work exposure affect a pregnancy? Men exposed to ... chemicals in the workplace may carry these agents on their clothes and ...
Swuste, P.; Dahhan, M.; Burdorf, A.
2008-01-01
The aim of this article was to describe the structure and content of a job-exposure matrix (JEM) for historical asbestos exposure in The Netherlands. The JEM contained 309 occupational job title groups in 70 branches of industry during 10 periods of 5 years during 1945– 1994, resulting in 3090
P. Swuste (Paul); M. Dahhan; A. Burdorf (Alex)
2008-01-01
textabstractThe aim of this article was to describe the structure and content of a job-exposure matrix (JEM) for historical asbestos exposure in The Netherlands. The JEM contained 309 occupational job title groups in 70 branches of industry during 10 periods of 5 years during 1945-1994, resulting in
Khazaal, Y; Frésard, E; Zullino, D
2007-01-01
Exposure to drugs or related cues is associated with psycho-physiological reactivity. These responses are conditioned during periods of active consumption. Exposure with response prevention (EPR) is a treatment established for anxiety disorder and aims to reduce anxiety by an extinction of previously conditioned responses. The conditioning recognized in additive processes has led to research into EPR's therapeutic potential for treating addiction. This paper is a review of the main studies on reactivity to cues, and EPR, particularly with respect to addiction to alcohol, opiates, cocaine and tobacco. This review is based on information from the Medline database, dealing with cue reactivity, attentional bias during exposure to cues and exposure treatment for addiction in general and, in particular, for each of the aforementioned substances. Exposure to drug-related cues is clearly associated with psycho-physiological reactivity and with attentional bias. Those phenomena are associated with craving and more difficulty in maintaining abstinence. The subject's attention is thus held by a large number of drug-related environmental stimuli. These observations are linked with conditioning phenomena and suggest the possibility of treatment by EPR conditioning extinction procedures. EPR has been most widely studied for abuse and alcohol addiction. Case reports give favourable outcomes. Results from controlled studies are less clear. Studies on patients addicted to cocaine or heroine are still limited and not conclusive. Different controlled studies on EPR for nicotine addiction have not produced conclusions in favour of this treatment. Generally, the EPR procedures used vary among studies. Studies focussing particularly on the evolution of physiological responses in a laboratory setting after EPR have demonstrated reduced autonomic nervous system activity. These results do not consistently lead to a reduction in consumption behaviour and in craving when the patient is in
Fugitive emissions from nanopowder manufacturing
International Nuclear Information System (INIS)
Trompetter, W. J.; Ancelet, T.; Davy, P. K.; Kennedy, J.
2016-01-01
In response to health and safety questions and concerns regarding particulate matter emissions from equipment used for synthesizing NiFe and TiO 2 nanopowders, a study was undertaken to assess their impact on the air quality inside and outside a laboratory where the manufacturing equipment is operated. Elemental concentrations determined by ion beam analysis (IBA) of air particulate matter (PM) samples collected hourly with a Streaker TM sampler were used to identify possible sources and estimate contributions from nanopowder production and other sources. The fugitive nanopowder emissions were the highest at the indoor sampling location when powders were being manufactured. Average fugitive emissions of 210 ng m −3 (1-h average) (maximum 2163 ng m −3 1-h average) represented 2 % (maximum 20 %) of the average PM collected (9359 ng m −3 1-h average). The measured NiFe alloy or TiO 2 PM concentrations were much smaller than the 8-h time-weighted average (TWA) workplace exposure standards (WES) for these materials (≥1,000,000 ng m −3 ). Most PM was found to be from infiltrated outdoor ambient sources. This suggests that nanopowder production in the laboratory is not likely to have adverse health effects on individuals using the equipment, although further improvements can be made to further limit exposure.Graphical abstract
Hamzah, Nurul Ainun; Mohd Tamrin, Shamsul Bahri; Ismail, Noor Hassim
2016-07-01
Metallic dust is a heterogeneous substance with respiratory sensitizing properties. Its long term exposure adversely affected lung function, thus may cause acute or chronic respiratory diseases. A cross-sectional study was conducted in a steel factory in Terengganu, Malaysia to assess the metal dust exposure and its relationship to lung function values among 184 workers. Metal dust concentrations values (Co, Cr, and Ni) for each worker were collected using air personal sampling. Lung function values (FEV 1 , FVC, and %FEV 1 /FVC) were determined using spirometer. Exposure to cobalt and chromium were 1-3 times higher than permissible exposure limit (PEL) while nickel was not exceeding the PEL. Cumulative of chromium was the predictor to all lung function values (FEV 1 , FVC, and %FEV 1 /FVC). Frequency of using mask was positively associated with FVC (Adj b = 0.263, P = 0.011) while past respiratory illnesses were negatively associated with %FEV 1 /FVC (Adj b = -1.452, P = 0.026). Only few workers (36.4%) were found to wear their masks all times during the working hours. There was an exposure-response relationship of cumulative metal dust exposure with the deterioration of lung function values. Improvement of control measures as well as proper and efficient use or personal protection equipment while at work could help to protect the respiratory health of workers.
Minimizing radiation exposure during percutaneous nephrolithotomy.
Chen, T T; Preminger, G M; Lipkin, M E
2015-12-01
Given the recent trends in growing per capita radiation dose from medical sources, there have been increasing concerns over patient radiation exposure. Patients with kidney stones undergoing percutaneous nephrolithotomy (PNL) are at particular risk for high radiation exposure. There exist several risk factors for increased radiation exposure during PNL which include high Body Mass Index, multiple access tracts, and increased stone burden. We herein review recent trends in radiation exposure, radiation exposure during PNL to both patients and urologists, and various approaches to reduce radiation exposure. We discuss incorporating the principles of As Low As reasonably Achievable (ALARA) into clinical practice and review imaging techniques such as ultrasound and air contrast to guide PNL access. Alternative surgical techniques and approaches to reducing radiation exposure, including retrograde intra-renal surgery, retrograde nephrostomy, endoscopic-guided PNL, and minimally invasive PNL, are also highlighted. It is important for urologists to be aware of these concepts and techniques when treating stone patients with PNL. The discussions outlined will assist urologists in providing patient counseling and high quality of care.
Natural background radiation exposures world-wide
International Nuclear Information System (INIS)
Bennett, B.G.
1993-01-01
The average radiation dose to the world's population from natural radiation sources has been assessed by UNSCEAR to be 2.4 mSv per year. The components of this exposure, methods of evaluation and, in particular, the variations in the natural background levels are presented in this paper. Exposures to cosmic radiation range from 0.26 mSv per year at sea level to 20 times more at an altitude of 6000 m. Exposures to cosmogenic radionuclides ( 3 H, 14 C) are relatively insignificant and little variable. The terrestrial radionuclides 40 K, 238 U, and 232 Th and the decay products of the latter two constitute the remainder of the natural radiation exposure. Wide variations in exposure occur for these components, particularly for radon and its decay products, which can accumulate to relatively high levels indoors. Unusually high exposures to uranium and thorium series radionuclides characterize the high natural background areas which occur in several localized regions in the world. Extreme values in natural radiation exposures have been estimated to range up to 100 times the average values. (author). 15 refs, 3 tabs
Use of dose constraints in medical exposure
International Nuclear Information System (INIS)
Mutanga, N. V. T.
2013-04-01
Medical-related radiation is the largest source of controllable radiation exposure to humans and it accounts for more than 95% of radiation exposure from man-made sources. Medical exposure to radiation is exposure incurred by patients as part of their own medical or dental diagnosis or treatment; by persons, other than those occupationally exposed, knowingly, while voluntarily helping in the support and comfort of patients; and by volunteers in a programme of biomedical research involving their exposure. Because it is planned exposure, medical exposure has to conform to a set of principles of protection that apply equally to all controllable exposure situations: the principle of justification, the principle of optimisation of protection, and the principle of application of limits on maximum doses in planned situations. In this study the concept of dose constraints is being scrutinized to see if it can be applied in medical exposures and the benefits of such restrictions. Dose constraints can only be applied to exposure to persons voluntary helping in the support and comfort of patients as well as volunteers in the programme of biomedical research. There are no dose constraints for patients but the concept of reference levels applies. (au)
Low-exposure tritium radiotoxicity in mammals
International Nuclear Information System (INIS)
Dobson, R.L.
1982-01-01
Studies of tritium radiotoxicity involving chronic 3 H0H exposures in mammals demonstrate in both mice and monkeys that biological effects can be measured following remarkably low levels of exposure - levels in the range of serious practical interest to radiation protection. These studies demonstrate also that deleterious effects of 3 H beta radiation do not differ significantly from those of gamma radiation at high exposures. In contrast, however, at low exposures tritium is significantly more effective than gamma rays, rad for rad, by a factor approaching 3. This is important for hazard evaluation and radiation protection because knowledge concerning biological effects of chronic low-level radiation exposure has come mainly from gamma-ray data; and predictions based on gamma-ray data will underestimate tritium effects - especially at low exposures - unless the RBE is fully taken into account
Rabies exposures, post-exposure prophylaxis and deaths in a region of endemic canine rabies.
Directory of Open Access Journals (Sweden)
Katie Hampson
Full Text Available Thousands of human deaths from rabies occur annually despite the availability of effective vaccines following exposure, and for disease control in the animal reservoir. Our aim was to assess risk factors associated with exposure and to determine why human deaths from endemic canine rabies still occur.Contact tracing was used to gather data on rabies exposures, post-exposure prophylaxis (PEP delivered and deaths in two rural districts in northwestern Tanzania from 2002 to 2006. Data on risk factors and the propensity to seek and complete courses of PEP was collected using questionnaires. Exposures varied from 6-141/100,000 per year. Risk of exposure to rabies was greater in an area with agropastoralist communities (and larger domestic dog populations than an area with pastoralist communities. Children were at greater risk than adults of being exposed to rabies and of developing clinical signs. PEP dramatically reduced the risk of developing rabies (odds ratio [OR] 17.33, 95% confidence interval [CI] 6.39-60.83 and when PEP was not delivered the risks were higher in the pastoralist than the agro-pastoralist area (OR 6.12, 95% CI 2.60-14.58. Low socioeconomic class and distance to medical facilities lengthened delays before PEP delivery. Over 20% of rabies-exposed individuals did not seek medical treatment and were not documented in official records and <65% received PEP. Animal bite injury records were an accurate indicator of rabies exposure incidence.Insufficient knowledge about rabies dangers and prevention, particularly prompt PEP, but also wound management, was the main cause of rabies deaths. Education, particularly in poor and marginalized communities, but also for medical and veterinary workers, would prevent future deaths.
Combined Toxic Exposures and Human Health: Biomarkers of Exposure and Effect
Directory of Open Access Journals (Sweden)
Johan Högberg
2011-02-01
Full Text Available Procedures for risk assessment of chemical mixtures, combined and cumulative exposures are under development, but the scientific database needs considerable expansion. In particular, there is a lack of knowledge on how to monitor effects of complex exposures, and there are few reviews on biomonitoring complex exposures. In this review we summarize articles in which biomonitoring techniques have been developed and used. Most examples describe techniques for biomonitoring effects which may detect early changes induced by many chemical stressors and which have the potential to accelerate data gathering. Some emphasis is put on endocrine disrupters acting via epigenetic mechanisms and on carcinogens. Solid evidence shows that these groups of chemicals can interact and even produce synergistic effects. They may act during sensitive time windows and biomonitoring their effects in epidemiological studies is a challenging task.
Occupational dermatoses from colophony exposure
Directory of Open Access Journals (Sweden)
Aleš Christian Mihelač
2015-04-01
Full Text Available Colophony is a resin, obtained from pine trees. It has many applications in industry as well as in products for everyday life and exposure is virtually impossible to avoid. In article, we concentrate on occupational exposure, which is frequent in workers in electronics, furniture and paper industry, production of adhesives, plastics, printing ink and synthetic rubber as well as in everyone, daily in contact with products, which contain colophony, or pine wood, like carpenters and woodworkers. Main allergens are oxidation products of abietic-type acids, but cross-reactivity with fragrances, wood resins, Balsam of Peru, wood tar and oil of turpentine is also possible. Exposure to colophony manifests itself on skin in allergic patients mainly as allergic contact dermatitis. The diagnosis is based on history of exposure, clinical presentation and epicutaneous testing. Although the only effective treatment is complete avoidance of exposure, it is difficult to avoid colophony. Consequently, prophylaxis is essential and concentrates on safe working practices, personal hygiene and protection.
Occupational exposure to ionizing radiation
International Nuclear Information System (INIS)
Snihs, J.O.
1985-01-01
An overview of occupational exposure is presented. Concepts and quantities used for radiation protection are explained as well as the ICRP system of dose limitation. The risks correlated to the limits are discussed. However, the actual exposure are often much lower than the limits and the average risk in radiation work is comparable with the average risk in other safe occupations. Actual exposures in various occupations are presented and discussed. (author)
Environmental Source of Arsenic Exposure
Chung, Jin-Yong; Yu, Seung-Do; Hong, Young-Seoub
2014-01-01
Arsenic is a ubiquitous, naturally occurring metalloid that may be a significant risk factor for cancer after exposure to contaminated drinking water, cigarettes, foods, industry, occupational environment, and air. Among the various routes of arsenic exposure, drinking water is the largest source of arsenic poisoning worldwide. Arsenic exposure from ingested foods usually comes from food crops grown in arsenic-contaminated soil and/or irrigated with arsenic-contaminated water. According to a ...
From dermal exposure to internal dose
Sandt, J.J.M. van de; Dellarco, M.; Hemmen, J.J. van
2007-01-01
Exposure scenarios form an essential basis for chemical risk assessment reports under the new EU chemicals regulation REACH (Registration, Evaluation, Authorisation and restriction of Chemicals). In case the dermal route of exposure is predominant, information on both exposure and dermal
2017-06-30
Research and Development Program [SERDP] project #ER-2542) into the canister would provide enhancement of the quantitative estimation of the TWA...Department of Defense EOD Explosive Ordnance Disposal EPA United States Environmental Protection Agency EQL Environmental Quantitation Limit EST...Laboratory Quantitation Limit MC Munitions Constituents mL Milliliter MR Munitions Response NESDI Navy’s Environmental Security Development to
33 CFR 149.697 - What are the requirements for a noise level survey?
2010-07-01
... and Equipment Noise Limits § 149.697 What are the requirements for a noise level survey? (a) A survey... measured over 12 hours to derive a time weighted average (TWA) using a sound level meter and an A-weighted filter or equivalent device. (c) If the noise level throughout a space is determined to exceed 85 db(A...
Directory of Open Access Journals (Sweden)
Editorial, Equipo
1961-04-01
Full Text Available Formando parte de su programa, la TWA ha construido recientemente un hangar para servicio y reparaciones de su flota aérea de naves ordinarias y de aviones de reacción en el aeropuerto internacional de Los Angeles (Estados Unidos. El proyecto de esta obra se encargó a la empresa constructora Holmes & Narver, Inc.
Patient radiation exposure during pediatric cardiac catheterization
International Nuclear Information System (INIS)
Fellows, K.E.; Leibovic, S.J.
1983-01-01
Exposure air product (EAP) and center field entrance exposure (free-in-air) were measured in seventeen pediatric patients undergoing cardiac catheterization. Exposures were recorded separately for biplane fluoroscopy and cine angiocardiography using flat-plate ionization chambers. In the posterior-anterior (PA) projections, median EAP was 425 Roentgen-square centimeter (R-cm 2 ), with a range of 90.5-3,882 R-cm 2 ; 29-35% of this exposure occurred during cine filming. In the lateral projection, median EAP was 276 R-cm 2 (range 117-1,173); 52-59% of this exposure was due to cine filming. Median center field entrance exposure in the PA view was 7.86 Roentgens (R) with a range 2.16-73.9 of and in the lateral projection 7.39 R (range 2.64-24.6). As much as 25% of the exposure from the entire examination was contributed by manual ''test'' exposures to set cine radiographic kVp. We recommend use of testing circuits, which determine cine radiographic factors automatically and thus should lower levels of exposure
Patient radiation exposure during pediatric cardiac catheterization
International Nuclear Information System (INIS)
Fellows, K.E.; Leibovic, S.J.
1983-01-01
Exposure are product (EAP) and center field entrance exposure (free-in-air) were measured in seventeen pediatric patients undergoing cardiac catheterization. Exposures were recorded separately for biplane fluoroscopy and cine angiocardiography using flat-plate ionization chambers. In the posterior-anterior (PA) projections, median EAP was 425 Roentgen-square centimeter (R-cm 2 ), with a range of 90.5-3,882 R-cm 2 ; 29-35% of this exposure occurred during cine filming. In the lateral projection, median EAP was 276 R-cm 2 (range 117-1,173); 52-59% of this exposure was due to cine filming. Median center field entrance exposure in the PA view was 7.86 Roentgens (R) with a range 2.16-73.9 of and in the lateral projection 7.39 R (range 2.64-24.6). As much as 25% of the exposure from the entire examination was contributed by manual ''test'' exposures to set cine radiographic kVp. We recommend use of testing circuits, which determine cine radiographic factors automatically and thus should lower levels of exposure. (orig.)
International Nuclear Information System (INIS)
Dhondt, Stijn; Beckx, Carolien; Degraeuwe, Bart; Lefebvre, Wouter; Kochan, Bruno; Bellemans, Tom; Int Panis, Luc; Macharis, Cathy; Putman, Koen
2012-01-01
In both ambient air pollution epidemiology and health impact assessment an accurate assessment of the population exposure is crucial. Although considerable advances have been made in assessing human exposure outdoors, the assessments often do not consider the impact of individual travel behavior on such exposures. Population-based exposures to NO 2 and O 3 using only home addresses were compared with models that integrate all time-activity patterns—including time in commute—for Flanders and Brussels. The exposure estimates were used to estimate the air pollution impact on years of life lost due to respiratory mortality. Health impact of NO 2 using an exposure that integrates time-activity information was on average 1.2% higher than when assuming that people are always at their home address. For ozone the overall estimated health impact was 0.8% lower. Local differences could be much larger, with estimates that differ up to 12% from the exposure using residential addresses only. Depending on age and gender, deviations from the population average were seen. Our results showed modest differences on a regional level. At the local level, however, time-activity patterns indicated larger differences in exposure and health impact estimates, mainly for people living in more rural areas. These results suggest that for local analyses the dynamic approach can contribute to an improved assessment of the health impact of various types of pollution and to the understanding of exposure differences between population groups. - Highlights: ► Exposure to ambient air pollution was assessed integrating population mobility. ► This dynamic exposure was integrated into a health impact assessment. ► Differences between the dynamic and residential exposure were quantified. ► Modest differences in health impact were found at a regional level. ► At municipal level larger differences were found, influenced by gender and age.
Hekkert, Paul; Thurgood, Clementine; Whitfield, T W Allan
2013-10-01
The finding that repeated exposure to a stimulus enhances attitudes directed towards it is a well-established phenomenon. Despite this, the effects of exposure to products are difficult to determine given that they could have previously been exposed to participants any number of times. Furthermore, factors other than simple repeated exposure can influence affective evaluations for stimuli that are meaningful. In our first study, we examined the influence of existing familiarity with common objects and showed that the attractiveness of shapes representing common objects increases with their rated commonness. In our second study, we eliminated the effects of prior exposure by creating fictitious yet plausible products; thus, exposure frequency was under complete experimental control. We also manipulated the attention to be drawn to the products' designs by placing them in contexts where their visual appearance was stressed to be important versus contexts in which it was indicated that little attention had been paid to their design. Following mere exposure, attractiveness ratings increased linearly with exposure frequency, with the slope of the function being steeper for stimuli presented in an inconspicuous context-indicating that individuals engage in more deliberate processing of the stimuli when attention is drawn to their visual appearance. © 2013 Elsevier B.V. All rights reserved.
PET radiation exposure control for nurses
International Nuclear Information System (INIS)
Kawabata, Yumiko; Kikuta, Daisuke; Anzai, Taku
2005-01-01
Recently, the number of clinical PET centers is increasing all over Japan. For this reason, the monitoring and control of radiation exposure of employees, especially nurses, in PET-dedicated clinics and institutions are becoming very important issues for their health. We measured the radiation exposure doses of the nurses working at Nishidai Diagnostic Imaging Center, and analyzed the exposure data obtained from them. The exposure doses of the nurses were found to be 4.8 to 7.1 mSv between April 2003 and March 2004. We found that the nurses were mostly exposed to radiation when they had to have contact with patients received an FDG injection or they had trouble with the FDG automatic injection system. To keep radiation exposure of nurses to a minimum we reconfirmed that a proper application of the three principles of protection against radiation exposure was vital. (author)
Natural and anthropogenic radiation exposure of humans in Germany
International Nuclear Information System (INIS)
Koelzer, Winfried
2016-12-01
The contribution on natural and anthropogenic radiation exposure in Germany covers the following issues: (1) natural radiation exposure: external radiation exposure - cosmic and terrestric radiation, internal radiation exposure - primordial and cosmogenic radionuclides; radiation exposure due to sola neutrinos and geo-neutrinos. (2) Anthropogenic radiation exposure: radiation exposure in medicine, radioactivity in industrial products, radiation exposure during flights, radiation exposure due to nuclear facilities, radiation exposure due to fossil energy carriers in power generation, radiation exposure due to nuclear explosions, radiation exposure due to nuclear accidents. (3) Occupational radiation exposure in Germany: radiation monitoring with personal dosimeters in medicine and industry, dose surveillance of the aviation personal, working places with increases radiation exposure by natural radiation sources.
Calculating radiation exposure and dose
International Nuclear Information System (INIS)
Hondros, J.
1987-01-01
This paper discusses the methods and procedures used to calculate the radiation exposures and radiation doses to designated employees of the Olympic Dam Project. Each of the three major exposure pathways are examined. These are: gamma irradiation, radon daughter inhalation and radioactive dust inhalation. A further section presents ICRP methodology for combining individual pathway exposures to give a total dose figure. Computer programs used for calculations and data storage are also presented briefly
10 CFR 850.24 - Exposure monitoring.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Exposure monitoring. 850.24 Section 850.24 Energy... Exposure monitoring. (a) General. The responsible employer must ensure that: (1) Exposure monitoring is... activities properly. (b) Initial monitoring. The responsible employer must perform initial monitoring in...
Relevance of protection quantities in medical exposures
International Nuclear Information System (INIS)
Pradhan, A.S.
2008-01-01
International Commission on Radiological Protection (ICRP) continues to classify the exposures to radiation in three categories; namely 1- occupational exposure, 2- public exposure, and 3- medical exposure. Protection quantities are primarily meant for the regulatory purpose in radiological protection for controlling and limiting stochastic risks in occupational and public exposures. These are based on two basic assumptions of 1- linear no-threshold dose-effect relationship (LNT) at low doses and 2- long-term additivity of low doses. Medical exposure are predominantly delivered to individuals (patients) undergoing diagnostic examinations, interventional procedures and radiation therapy but also include individual caring for or comforting patients incurring exposure and the volunteers of biomedical medical research programmes. Radiation protection is as relevant to occupational and public exposure as to medical exposures except that the dose limits set for the formers are not applicable to medical exposure but reference levels and dose constrains are recommended for diagnostic and interventional medical procedures. In medical institutions, both the occupational and medical exposure takes place. Since the doses in diagnostic examinations are low, it has been observed that not only the protection quantities are often used in such cases but these are extended to estimate the number of cancer deaths due to such practices. One of the striking features of the new ICRP recommendations has been to elaborate the concepts of the dosimetric quantities. The limitation of protection quantities ((Effective dose, E=Σ RT D TR .W T .W R and Equivalent Dose H T =Σ RT D TR .W R ) have been brought out and this has raised a great concern and initiated debates on the use of these quantities in medical exposures. Consequently, ICRP has set a task group to provide more details and the recommendations. It has, therefore, became important to draw the attention of medical physics community
Subliminal mere exposure: specific, general, and diffuse effects.
Monahan, J L; Murphy, S T; Zajonc, R B
2000-11-01
The present research examined the possibility that repeated exposure may simultaneously produce specific and diffuse effects. In Study 1, participants were presented with 5-ms exposures of 25 stimuli each shown once (single-exposure condition) or with five repetitions of 5 stimuli (repeated-exposure condition). Participants in the repeated-exposure condition subsequently rated their own mood more positively than those in the single-exposure condition. Study 2 examined whether affect generated by subliminal repeated exposures transfers to unrelated stimuli. After a subliminal exposure phase, affective reactions to previously exposed stimuli, to new but similar stimuli, and to stimuli from a different category were obtained. Previously exposed stimuli were rated most positively and novel different stimuli least positively. All stimuli were rated more positively in the repeated-exposure condition than in the single-exposure condition. These findings suggest that affect generated by subliminal repeated exposure is sufficiently diffuse to influence ratings of unrelated stimuli and mood.
International Nuclear Information System (INIS)
Dekant, Wolfgang; Voelkel, Wolfgang
2008-01-01
Human exposure to bisphenol A is controversially discussed. This review critically assesses methods for biomonitoring of bisphenol A exposures and reported concentrations of bisphenol A in blood and urine of non-occupationally ('environmentally') exposed humans. From the many methods published to assess bisphenol A concentrations in biological media, mass spectrometry-based methods are considered most appropriate due to high sensitivity, selectivity and precision. In human blood, based on the known toxicokinetics of bisphenol A in humans, the expected very low concentrations of bisphenol A due to rapid biotransformation and the very rapid excretion result in severe limitations in the use of reported blood levels of bisphenol A for exposure assessment. Due to the rapid and complete excretion of orally administered bisphenol A, urine samples are considered as the appropriate body fluid for bisphenol A exposure assessment. In urine samples from several cohorts, bisphenol A (as glucuronide) was present in average concentrations in the range of 1-3 μg/L suggesting that daily human exposure to bisphenol A is below 6 μg per person (< 0.1 μg/kg bw/day) for the majority of the population
Tian, Zhexi; Kim, Seung-Kyu; Shoeib, Mahiba; Oh, Jeong-Eun; Park, Jong-Eun
2016-05-15
A wide range of per- and polyfluoroalkyl substances (PFASs), including fluorotelomer alcohols (FTOHs), perfluorooctane sulfonamidoethanols (FOSEs), perfluoroalkyl carboxylic acids (PFCAs), and perfluoroalkane sulfonic acids (PFSAs), were measured in fifteen house dust and two nonresidential indoor dust of Korea. Total concentrations of PFASs in house dust ranged from 29.9 to 97.6 ng g(-1), with a dominance of perfluorooctane sulfonic acid (PFOS), followed by 8:2 FTOH, N-Ethyl perfluorooctane sulfonamidoethanol (EtFOSE), perfluoroctanoic acid (PFOA). In a typical exposure scenario, the estimated daily intakes (EDIs) of total PFASs via house dust ingestion were 2.83 ng d(-1) for toddlers and 1.13 ng d(-1) for adults, which were within the range of the mean EDIs reported from several countries. For PFOA and PFOS exposure via house dust ingestion, indirect exposure (via precursors) was a minor contributor, accounting for 5% and 12%, respectively. An aggregated exposure (hereafter, overall-EDIs) of PFOA and PFOS occurring via all pathways, estimated using data compiled from the literature, were 53.6 and 14.8 ng d(-1) for toddlers, and 20.5 and 40.6 ng d(-1) for adults, respectively, in a typical scenario. These overall-EDIs corresponded to 82% (PFOA) and 92% (PFOS) of a pharmacokinetic model-based EDIs estimated from adults' serum data. Direct dietary exposure was a major contributor (>89% of overall-EDI) to PFOS in both toddlers and adults, and PFOA in toddlers. As for PFOA exposure of adults, however direct exposure via tap water drinking (37%) and indirect exposure via inhalation (22%) were as important as direct dietary exposure (41%). House dust-ingested exposure (direct+indirect) was responsible for 5% (PFOS in toddlers) and house-dust ingestion was a minor contributor in this study, but should not be ignored for toddlers' PFOS exposure due to its significance in the worst-case scenario. Copyright © 2016 Elsevier B.V. All rights reserved.
Sud du Sahara | Page 6 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Langue French. Read more about Journal supplement features 10 years of West African health systems research. Langue English. Un virologiste canadien a réalisé une percée : il a créé un vaccin unique contre cinq maladies du bétail qui pourrait transformer la vie de millions de gens en Afrique et ailleurs dans le monde.
Effects of Moist Heat and Dry Heat on the Nutritional Value of Velvet ...
African Journals Online (AJOL)
constitute lOand 20 perc~nt of the experimental diets andfed to laying hens. The results revealed an over- ... was ci better method of heat treatment than roasting, for velvet bfans fed to the laying hens. Keywords: Heat .... 'Vegetable oil was added to make up the required amount of energy in the diets. bProvide per kg diet: Vit ...
India : Maternal and Reproductive Health at a Glance
Sameh El-Saharty; Naoko Ohno; Intissar Sarker; Federica Secci; Vikram Rajan
2014-01-01
India is the third largest economy and has the second largest population in the world. It achieved millennium development goal (MDG) on poverty reduction; however, gender inequality still persists. Maternal mortality rate is 190 deaths per 100,000 live births, representing a 65 percent decline from 1990. Fertility fell to 2.5, while contraceptive prevalence rate increased to nearly 55 perc...
30 CFR 57.5071 - Exposure monitoring.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Exposure monitoring. 57.5071 Section 57.5071... Exposure monitoring. (a) Mine operators must monitor as often as necessary to effectively determine, under... miners and their representatives with an opportunity to observe exposure monitoring required by this...
AirPEx: Air Pollution Exposure Model
Freijer JI; Bloemen HJTh; Loos S de; Marra M; Rombout PJA; Steentjes GM; Veen MP van; LBO
1997-01-01
Analysis of inhalatory exposure to air pollution is an important area of investigation when assessing the risks of air pollution for human health. Inhalatory exposure research focuses on the exposure of humans to air pollutants and the entry of these pollutants into the human respiratory tract. The
Occupational Exposures and Chronic Airflow Limitation
Directory of Open Access Journals (Sweden)
Helen Dimich-Ward
1996-01-01
Full Text Available The recent literature was reviewed to evaluate whether chronic airflow limitation is associated with occupational exposures to dusts. Only those studies that controlled for the effects of smoking were included. There is compelling evidence that exposure to inorganic dusts, such as from coal and hardrock mining or asbestos, are associated with the development of chronic airflow limitation, independently of pneumoconiosis. Nonsmoking gold miners are particularly at high risk of airflow obstruction and emphysema. Findings from studies of organic dusts, such as exposures to wood, cotton, grain or other agricultural dusts, or to mixed dust exposures, were less consistent but tended to show positive dose-response associations. In the majority of studies, no statistical interaction was shown between dust exposures and smoking; however, the effects of the dust exposures were often more pronounced. An occupational history should be considered, in addition to a smoking history, as an integral part of an investigation of chronic airflow limitation in a patient.
Radon exposure in uranium mining industry vs. exposure in tourist caves
International Nuclear Information System (INIS)
Quindos Poncela, L.; Fernandez Navarro, P.; Sainz Fernandez, C.; Gomez Arozamena, J.; Bordonoba Perez, M.
2004-01-01
There is a fairly general consensus among health physicists and radiation professionals that exposure to radon progeny is the largest and most variable contribution to the population's exposure to natural sources of radiation. However, this exposure is the subject of continuing debate concerning the validity of risk assessment and recommendations on how to act in radon-prone areas. The purpose of this contribution is to situate the radon issue in Spain in two very different settings. The first is a uranium mining industry located in Saelices el Chico (Salamanca), which is under strict control of the Spanish Nuclear Safety Council (CSN). We have measured radon concentrations in different workplaces in this mine over a five-year period. The second setting comprises four tourist caves, three of which are located in the province of Cantabria and the fourth on the Canary Island of Lanzarote. These caves are not subject to any administrative control of radiation exposure. Measured air 222 Rn concentrations were used to estimate annual effective doses due to radon inhalation in the two settings, and dose values were found to be from 2 to 10 times lower in the uranium mine than in the tourist caves. These results were analysed in the context of the new European Basic Safety Standards Directive (EU-BSS, 1996). (authors)
An Exposure Assessment of Polybrominated Diphenyl Ethers ...
EPA announced the availability of the final report, An Exposure Assessment of Polybrominated Diphenyl Ethers. This report provides a comprehensive assessment of the exposure of Americans to this class of persistent organic pollutants. Individual chapters in this document address: the production, use, and lifecycle of PBDEs; environmental fate; environmental levels; and human exposure. This final report addresses the exposure assessment needs identified in the OPBDE Workgroup project plan. It provides a comprehensive assessment of the exposure of Americans to this class of persistent organic pollutants. Individual chapters in this document address: the production, use, and lifecycle of PBDEs; environmental fate; environmental levels; and human exposure.
Oral Chromium Exposure and Toxicity
Sun, Hong; Brocato, Jason
2015-01-01
Hexavalent chromium [Cr(VI)] is a known carcinogen when inhaled. However, inhalational exposure to Cr(VI) affects only a small portion of the population, mainly by occupational exposures. In contrast, oral exposure to Cr(VI) is widespread and affects many people throughout the globe. In 2008, the National Toxicology Program (NTP) released a 2-year study demonstrating that ingested Cr(VI) was carcinogenic in rats and mice. The effects of Cr(VI) oral exposure is mitigated by reduction in the gut, however a portion evades the reductive detoxification and reaches target tissues. Once Cr(VI) enters the cell, it ultimately gets reduced to Cr(III), which mediates its toxicity via induction of oxidative stress during the reduction while Cr intermediates react with protein and DNA. Cr(III) can form adducts with DNA that may lead to mutations. This review will discuss the potential adverse effects of oral exposure to Cr(VI) by presenting up-to-date human and animal studies, examining the underlying mechanisms that mediate Cr(VI) toxicity, as well as highlighting opportunities for future research. PMID:26231506
Attentional Modulation of the Mere Exposure Effect
Yagi, Yoshihiko; Ikoma, Shinobu; Kikuchi, Tadashi
2009-01-01
The "mere exposure effect" refers to the phenomenon where previous exposures to stimuli increase participants' subsequent affective preference for those stimuli. This study explored the effect of selective attention on the mere exposure effect. The experiments manipulated the to-be-attended drawings in the exposure period (either red or green…
Environmental source of arsenic exposure.
Chung, Jin-Yong; Yu, Seung-Do; Hong, Young-Seoub
2014-09-01
Arsenic is a ubiquitous, naturally occurring metalloid that may be a significant risk factor for cancer after exposure to contaminated drinking water, cigarettes, foods, industry, occupational environment, and air. Among the various routes of arsenic exposure, drinking water is the largest source of arsenic poisoning worldwide. Arsenic exposure from ingested foods usually comes from food crops grown in arsenic-contaminated soil and/or irrigated with arsenic-contaminated water. According to a recent World Health Organization report, arsenic from contaminated water can be quickly and easily absorbed and depending on its metabolic form, may adversely affect human health. Recently, the US Food and Drug Administration regulations for metals found in cosmetics to protect consumers against contaminations deemed deleterious to health; some cosmetics were found to contain a variety of chemicals including heavy metals, which are sometimes used as preservatives. Moreover, developing countries tend to have a growing number of industrial factories that unfortunately, harm the environment, especially in cities where industrial and vehicle emissions, as well as household activities, cause serious air pollution. Air is also an important source of arsenic exposure in areas with industrial activity. The presence of arsenic in airborne particulate matter is considered a risk for certain diseases. Taken together, various potential pathways of arsenic exposure seem to affect humans adversely, and future efforts to reduce arsenic exposure caused by environmental factors should be made.
Environmental Source of Arsenic Exposure
Directory of Open Access Journals (Sweden)
Jin-Yong Chung
2014-09-01
Full Text Available Arsenic is a ubiquitous, naturally occurring metalloid that may be a significant risk factor for cancer after exposure to contaminated drinking water, cigarettes, foods, industry, occupational environment, and air. Among the various routes of arsenic exposure, drinking water is the largest source of arsenic poisoning worldwide. Arsenic exposure from ingested foods usually comes from food crops grown in arsenic-contaminated soil and/or irrigated with arsenic-contaminated water. According to a recent World Health Organization report, arsenic from contaminated water can be quickly and easily absorbed and depending on its metabolic form, may adversely affect human health. Recently, the US Food and Drug Administration regulations for metals found in cosmetics to protect consumers against contaminations deemed deleterious to health; some cosmetics were found to contain a variety of chemicals including heavy metals, which are sometimes used as preservatives. Moreover, developing countries tend to have a growing number of industrial factories that unfortunately, harm the environment, especially in cities where industrial and vehicle emissions, as well as household activities, cause serious air pollution. Air is also an important source of arsenic exposure in areas with industrial activity. The presence of arsenic in airborne particulate matter is considered a risk for certain diseases. Taken together, various potential pathways of arsenic exposure seem to affect humans adversely, and future efforts to reduce arsenic exposure caused by environmental factors should be made.
International Nuclear Information System (INIS)
Che, Magnus M.; Conti, Michele; Chanda, Soma; Boylan, Megan; Sabnekar, Praveena; Rezk, Peter; Amari, Ethery; Sciuto, Alfred M.; Gordon, Richard K.; Doctor, Bhupendra P.; Nambiar, Madhusoodana P.
2009-01-01
We evaluated the protective efficacy of nasal atropine methyl bromide (AMB) which does not cross the blood-brain barrier against sarin inhalation exposure. Age and weight matched male guinea pigs were exposed to 846.5 mg/m 3 sarin using a microinstillation inhalation exposure technique for 4 min. The survival rate at this dose was 20%. Post-exposure treatment with nasal AMB (2.5 mg/kg, 1 min) completely protected against sarin induced toxicity (100% survival). Development of muscular tremors was decreased in animals treated with nasal AMB. Post-exposure treatment with nasal AMB also normalized acute decrease in blood oxygen saturation and heart rate following sarin exposure. Inhibition of blood AChE and BChE activities following sarin exposure was reduced in animals treated with nasal AMB, indicating that survival increases the metabolism of sarin or expression of AChE. The body weight loss of animals exposed to sarin and treated with nasal AMB was similar to saline controls. No differences were observed in lung accessory lobe or tracheal edema following exposure to sarin and subsequent treatment with nasal AMB. Total bronchoalveolar lavage fluid (BALF) protein, a biomarker of lung injury, showed trends similar to saline controls. Surfactant levels post-exposure treatment with nasal AMB returned to normal, similar to saline controls. Alkaline phosphatase levels post-exposure treatment with nasal AMB were decreased. Taken together, these data suggest that nasal AMB blocks the copious airway secretion and peripheral cholinergic effects and protects against lethal inhalation exposure to sarin thus increasing survival.
30 CFR 62.130 - Permissible exposure level.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Permissible exposure level. 62.130 Section 62... REGULATIONS OCCUPATIONAL NOISE EXPOSURE § 62.130 Permissible exposure level. (a) The mine operator must assure that no miner is exposed during any work shift to noise that exceeds the permissible exposure level. If...
Double blind placebo controlled exposure to molds
DEFF Research Database (Denmark)
Meyer, H W; Jensen, K A; Nielsen, K F
2005-01-01
non-significant, and at the same level as after placebo exposure. The developed exposure system based on the Particle-Field and Laboratory Emission Cell (P-FLEC) makes it possible to deliver a precise and highly controlled dose of mold spores from water-damaged building materials, imitating realistic......The objective was to develop an experimental setup for human exposure to mold spores, and to study the clinical effect of this exposure in sensitive subjects who had previously experienced potentially building-related symptoms (BRS) at work. From three water-damaged schools eight employees....... In conclusion this is, to our knowledge, the first study to successfully conduct a human exposure to a highly controlled dose of fungal material aerosolized directly from wet building materials. This short-term exposure to high concentrations of two different molds induced no more reactions than exposure...
Peripheral blood signatures of lead exposure.
Directory of Open Access Journals (Sweden)
Heather G LaBreche
Full Text Available BACKGROUND: Current evidence indicates that even low-level lead (Pb exposure can have detrimental effects, especially in children. We tested the hypothesis that Pb exposure alters gene expression patterns in peripheral blood cells and that these changes reflect dose-specific alterations in the activity of particular pathways. METHODOLOGY/PRINCIPAL FINDING: Using Affymetrix Mouse Genome 430 2.0 arrays, we examined gene expression changes in the peripheral blood of female Balb/c mice following exposure to per os lead acetate trihydrate or plain drinking water for two weeks and after a two-week recovery period. Data sets were RMA-normalized and dose-specific signatures were generated using established methods of supervised classification and binary regression. Pathway activity was analyzed using the ScoreSignatures module from GenePattern. CONCLUSIONS/SIGNIFICANCE: The low-level Pb signature was 93% sensitive and 100% specific in classifying samples a leave-one-out crossvalidation. The high-level Pb signature demonstrated 100% sensitivity and specificity in the leave-one-out crossvalidation. These two signatures exhibited dose-specificity in their ability to predict Pb exposure and had little overlap in terms of constituent genes. The signatures also seemed to reflect current levels of Pb exposure rather than past exposure. Finally, the two doses showed differential activation of cellular pathways. Low-level Pb exposure increased activity of the interferon-gamma pathway, whereas high-level Pb exposure increased activity of the E2F1 pathway.
Energy Technology Data Exchange (ETDEWEB)
Dhondt, Stijn, E-mail: stijn.dhondt@vub.ac.be [Department of Medical Sociology and Health Sciences, Vrije Universiteit Brussel, Laarbeeklaan 103, B-1090, Brussels (Belgium); Beckx, Carolien, E-mail: Carolien.Beckx@vito.be [Flemish Institute for Technological Research (VITO), Boeretang 200, 2400 Mol (Belgium); Degraeuwe, Bart, E-mail: Bart.Degraeuwe@vito.be [Flemish Institute for Technological Research (VITO), Boeretang 200, 2400 Mol (Belgium); Lefebvre, Wouter, E-mail: Wouter.Lefebvre@vito.be [Flemish Institute for Technological Research (VITO), Boeretang 200, 2400 Mol (Belgium); Kochan, Bruno, E-mail: Bruno.Kochan@uhasselt.be [Transportation Research Institute, Hasselt University, Wetenschapspark 5 bus 6, 3590 Diepenbeek (Belgium); Bellemans, Tom, E-mail: Tom.Bellemans@uhasselt.be [Transportation Research Institute, Hasselt University, Wetenschapspark 5 bus 6, 3590 Diepenbeek (Belgium); Int Panis, Luc, E-mail: Luc.intpanis@vito.be [Flemish Institute for Technological Research (VITO), Boeretang 200, 2400 Mol (Belgium); Transportation Research Institute, Hasselt University, Wetenschapspark 5 bus 6, 3590 Diepenbeek (Belgium); Macharis, Cathy, E-mail: cjmachar@vub.ac.be [Department MOSI-Transport and Logistics, Vrije Universiteit Brussel, Pleinlaan 2, B-1050, Brussels (Belgium); Putman, Koen, E-mail: kputman@vub.ac.be [Department of Medical Sociology and Health Sciences, Vrije Universiteit Brussel, Laarbeeklaan 103, B-1090, Brussels (Belgium); Interuniversity Centre for Health Economics Research (I-CHER), Vrije Universiteit Brussel, Brussels (Belgium)
2012-09-15
In both ambient air pollution epidemiology and health impact assessment an accurate assessment of the population exposure is crucial. Although considerable advances have been made in assessing human exposure outdoors, the assessments often do not consider the impact of individual travel behavior on such exposures. Population-based exposures to NO{sub 2} and O{sub 3} using only home addresses were compared with models that integrate all time-activity patterns-including time in commute-for Flanders and Brussels. The exposure estimates were used to estimate the air pollution impact on years of life lost due to respiratory mortality. Health impact of NO{sub 2} using an exposure that integrates time-activity information was on average 1.2% higher than when assuming that people are always at their home address. For ozone the overall estimated health impact was 0.8% lower. Local differences could be much larger, with estimates that differ up to 12% from the exposure using residential addresses only. Depending on age and gender, deviations from the population average were seen. Our results showed modest differences on a regional level. At the local level, however, time-activity patterns indicated larger differences in exposure and health impact estimates, mainly for people living in more rural areas. These results suggest that for local analyses the dynamic approach can contribute to an improved assessment of the health impact of various types of pollution and to the understanding of exposure differences between population groups. - Highlights: Black-Right-Pointing-Pointer Exposure to ambient air pollution was assessed integrating population mobility. Black-Right-Pointing-Pointer This dynamic exposure was integrated into a health impact assessment. Black-Right-Pointing-Pointer Differences between the dynamic and residential exposure were quantified. Black-Right-Pointing-Pointer Modest differences in health impact were found at a regional level. Black
Gamma radiographic exposure time indicator
International Nuclear Information System (INIS)
Risbud, V.H.; Thiagarajan, A.; Gangadharan, P.
1979-01-01
In industrial radiography, with the proper selection of source and film, the radiographic quality depends very much on the exposure time, which in turn depends upon the source strength and the source to film distance. Conventional methods to arrive at correct exposure time involve time consuming calculations and in these methods the knowledge of the above mentioned parameters is imperative. An instrument to determine the required exposure time has been developed which indicates exposure times in about 30 secs. This covers two commonly used gamma radiography sources, viz., 192 Ir and 60 Co and six commonly used radiography films of different speeds. Knowledge of source strength and source to film distance is not required with the use of this instrument. With a knowledge of the total exposure required by the film to give the required sensitivity and by the measurement of radiation level at the film location, the correct exposure time is determined. The radiation level is measured by placing a GM counter behind the radiographic specimen at the film location. To match the responses of the film and the GM counter, the counter is incorporated in a suitably designed probe. In this instruments, an integrator to integrate the GM-pulses and a constant current integrator (timer) are started simultaneously. The voltage at the GM-pulse integrator is compared with a preselected voltage, (selected on the basis of film type, source, source strength and order of object thickness) by a comparator. The comparator is so adjusted that when the GM-pulse integrator voltage exceeds the preselected voltage, it switches its state and stops the integration of constant current. The constant current integrator output which is proportional to the time taken for the GM-pulse integrator to reach the preselected voltage, is read on a meter graduated in terms of exposure time. The instrument can measure exposure times from 5 minutes to 10 hours read in two ranges, the range-changing being automatic
Personal exposure to ultrafine particles.
Wallace, Lance; Ott, Wayne
2011-01-01
Personal exposure to ultrafine particles (UFP) can occur while people are cooking, driving, smoking, operating small appliances such as hair dryers, or eating out in restaurants. These exposures can often be higher than outdoor concentrations. For 3 years, portable monitors were employed in homes, cars, and restaurants. More than 300 measurement periods in several homes were documented, along with 25 h of driving two cars, and 22 visits to restaurants. Cooking on gas or electric stoves and electric toaster ovens was a major source of UFP, with peak personal exposures often exceeding 100,000 particles/cm³ and estimated emission rates in the neighborhood of 10¹² particles/min. Other common sources of high UFP exposures were cigarettes, a vented gas clothes dryer, an air popcorn popper, candles, an electric mixer, a toaster, a hair dryer, a curling iron, and a steam iron. Relatively low indoor UFP emissions were noted for a fireplace, several space heaters, and a laser printer. Driving resulted in moderate exposures averaging about 30,000 particles/cm³ in each of two cars driven on 17 trips on major highways on the East and West Coasts. Most of the restaurants visited maintained consistently high levels of 50,000-200,000 particles/cm³ for the entire length of the meal. The indoor/outdoor ratios of size-resolved UFP were much lower than for PM₂.₅ or PM₁₀, suggesting that outdoor UFP have difficulty in penetrating a home. This in turn implies that outdoor concentrations of UFP have only a moderate effect on personal exposures if indoor sources are present. A time-weighted scenario suggests that for typical suburban nonsmoker lifestyles, indoor sources provide about 47% and outdoor sources about 36% of total daily UFP exposure and in-vehicle exposures add the remainder (17%). However, the effect of one smoker in the home results in an overwhelming increase in the importance of indoor sources (77% of the total).
Bateson, Thomas F; Kopylev, Leonid
2015-01-01
Recent meta-analyses of occupational epidemiology studies identified two important exposure data quality factors in predicting summary effect measures for asbestos-associated lung cancer mortality risk: sufficiency of job history data and percent coverage of work history by measured exposures. The objective was to evaluate different exposure parameterizations suggested in the asbestos literature using the Libby, MT asbestos worker cohort and to evaluate influences of exposure measurement error caused by historically estimated exposure data on lung cancer risks. Focusing on workers hired after 1959, when job histories were well-known and occupational exposures were predominantly based on measured exposures (85% coverage), we found that cumulative exposure alone, and with allowance of exponential decay, fit lung cancer mortality data similarly. Residence-time-weighted metrics did not fit well. Compared with previous analyses based on the whole cohort of Libby workers hired after 1935, when job histories were less well-known and exposures less frequently measured (47% coverage), our analyses based on higher quality exposure data yielded an effect size as much as 3.6 times higher. Future occupational cohort studies should continue to refine retrospective exposure assessment methods, consider multiple exposure metrics, and explore new methods of maintaining statistical power while minimizing exposure measurement error.
Bases for establishing radiation exposure limits
International Nuclear Information System (INIS)
Pochin, E.E.
1977-01-01
It is an essential requirement of good radiation protection that all unnecessary exposure of people should be avoided and that any necessary exposure, whether of workers or of members of the general public, should be minimized. It is, however, an additional requirement that such necessary exposures should not exceed certain stated limits. These principles are based on the possibility that even the smallest exposures may involve some risk of harm, that any risk of harm should be justifiable by the circumstances necessitating it, and that risk should always be limited to an appropriately low level. The bases for establishing exposure limits must therefore involve an assessment of the risk involved in any form of radiation exposure, and an opinion as to the degree of safety that should be ensured in circumstances which necessitate any occupational or public exposure to radiation. There is increasing quantitative evidence on the frequency on which harm, and particularly the induction of malignancies, may be caused in people exposed to radiation at high doses; and somewhat clearer bases than previously for inferring the possible frequencies at low doses. It is therefore easier to assess the degree of safety ensured by restricting radiation exposure to particular levels. It is clear also that a comparable degree of safety should be ensured whether the radiation exposure involves the whole body more of less uniformly, or individual tissues or organs selectively. The ''weighting'' factors appropriate to irradiation of particular tissues from internal emitters can thus be defined in terms of their likely individual contributions to the harm of whole-body irradiation. In this way the limits for different modes of exposure by external or internal radiation can be related so as to ensure that protection should be equally effective for different distributions of absorbed dose in the body. In particular, the over-simplified concept of a single critical organ determining the
Asbestos Exposure Assessment Database
Arcot, Divya K.
2010-01-01
Exposure to particular hazardous materials in a work environment is dangerous to the employees who work directly with or around the materials as well as those who come in contact with them indirectly. In order to maintain a national standard for safe working environments and protect worker health, the Occupational Safety and Health Administration (OSHA) has set forth numerous precautionary regulations. NASA has been proactive in adhering to these regulations by implementing standards which are often stricter than regulation limits and administering frequent health risk assessments. The primary objective of this project is to create the infrastructure for an Asbestos Exposure Assessment Database specific to NASA Johnson Space Center (JSC) which will compile all of the exposure assessment data into a well-organized, navigable format. The data includes Sample Types, Samples Durations, Crafts of those from whom samples were collected, Job Performance Requirements (JPR) numbers, Phased Contrast Microscopy (PCM) and Transmission Electron Microscopy (TEM) results and qualifiers, Personal Protective Equipment (PPE), and names of industrial hygienists who performed the monitoring. This database will allow NASA to provide OSHA with specific information demonstrating that JSC s work procedures are protective enough to minimize the risk of future disease from the exposures. The data has been collected by the NASA contractors Computer Sciences Corporation (CSC) and Wyle Laboratories. The personal exposure samples were collected from devices worn by laborers working at JSC and by building occupants located in asbestos-containing buildings.
Exposure to wet work in working Australians.
Keegel, Tessa G; Nixon, Rosemary L; LaMontagne, Anthony D
2012-02-01
The Australian National Hazard Exposure Worker Surveillance (NHEWS) Survey 2008 was a cross-sectional survey undertaken by Safe Work Australia to inform the development of exposure prevention initiatives for occupational disease. This is a descriptive study of workplace exposures. To assess the occupational and demographic characteristics of workers reporting exposure to wet work. Computer-assisted telephone interviews were conducted with 4500 workers. Two wet work exposure outcomes (frequent washing of hands and duration of time spent at work with the hands immersed in liquids) were analysed. The response rate for the study was 42.3%. For hand-washing, 9.8% [95% confidence interval (CI) 8.9-10.7] reported washing their hands more than 20 times per day. For immersion of hands in liquids, 4.5% (95% CI 3.9-5.1) reported immersion for more than 2 hr per day. Females were more likely to report exposure to frequent hand-washing than males [odds ratio (OR) 1.97, 95% CI 1.49-2.61]. Workers in the lowest occupational skill level jobs were more likely to report increased exposure to hands immersed in liquids than those in the highest (OR 6.41, 95% CI 3.78-10.88). Workers reporting skin exposure to chemicals were more likely to report exposure to hand-washing (OR 3.68, 95% CI 2.91-4.66) and immersion of the hands in liquids (OR 4.09, 95% CI 2.92-5.74). Specific groups of workers reported high levels of exposure to wet work. There were differences between the profiles of workers reporting frequent hand-washing and workers reporting increased duration of exposure to hands immersed in liquids. We also found a high correlation between wet work and chemical exposure. © 2011 John Wiley & Sons A/S.
A new radiation exposure record system
International Nuclear Information System (INIS)
Lyon, M.; Berndt, V.L.; Trevino, G.W.; Oakley, B.M.
1993-04-01
The Hanford Radiological Records Program (HRRP) serves all Hanford contractors as the single repository for radiological exposure for all Hanford employees, subcontractors, and visitors. The program administers and preserves all Hanford radiation exposure records. The program also maintains a Radiation Protection Historical File which is a historical file of Hanford radiation protection and dosimetry procedures and practices. Several years ago DOE declared the existing UNIVAC mainframe computer obsolete and the existing Occupational Radiation Exposure (ORE) system was slated to be redeveloped. The new system named the Radiological Exposure (REX) System is described in this document
Estimating Exposure of Terrestrial Wildlife to Contaminants
Energy Technology Data Exchange (ETDEWEB)
Sample, B.E.
1994-01-01
This report presents a general model for exposure of terrestrial wildlife to contaminants (Sect. 2), methods for estimating parameters of the model (Sect. 3), species specific parameters for endpoint species on the Oak Ridge Reservation (ORR) (Sect. 4), and a sample application (Sect. 5). Exposure can be defined as the coincidence in both space and time of a receptor and a stressor, such that the receptor and stressor come into contact and interact (Risk Assessment Forum 1992). In the context of ecological risk assessment, receptors include all endpoint species or communities identified for a site [see Suter (1989) and Suter et al. (1994) for discussions of ecological endpoints for waste sites]. In the context of waste site assessments, stressors are chemical contaminations, and the contact and interaction are uptake of the contaminant by the receptor. Without sufficient exposure of the receptor to the contaminants, there is no ecological risk. Unlike some other endpoint assemblages, terrestrial wildlife are significantly exposed to contaminants in multiple media. They may drink or swim in contaminated water, ingest contaminated food and soil, and breath contaminated air. In addition, because most wildlife are mobile, moving among and within habitats, exposure is not restricted to a single location. They may integrate contamination from several spatially discrete sources. Therefore, exposure models for terrestrial wildlife must include multiple media. This document provides models and parameters for estimating exposure of birds and mammals. Reptiles and amphibians are not considered because few data exist with which to assess exposure to these organisms. In addition, because toxicological data are scarce for both classes, evaluation of the significance of exposure estimates is problematic. However, the general exposure estimation procedure developed herein for birds and mammals is applicable to reptiles and amphibians. Exposure models must be appropriate to the
CONSEXPO 3.0, consumer exposure and uptake models
Veen MP van; LBM
2001-01-01
The report provides a modelling approach to consumer exposure to chemicals, based on mathematical contact, exposure and uptake models. For each route of exposure, a number of exposure and uptake models are included. A general framework joins the exposure and uptake models selected by the user. By
International Nuclear Information System (INIS)
Hinwood, A.L.; Stasinska, A.; Callan, A.C.; Heyworth, J.; Ramalingam, M.; Boyce, M.; McCafferty, P.; Odland, J.Ø.
2015-01-01
Most studies of metals exposure focus on the heavy metals. There are many other metals (the transition, alkali and alkaline earth metals in particular) in common use in electronics, defense industries, emitted via combustion and which are naturally present in the environment, that have received limited attention in terms of human exposure. We analysed samples of whole blood (172), urine (173) and drinking water (172) for antimony, beryllium, bismuth, cesium, gallium, rubidium, silver, strontium, thallium, thorium and vanadium using ICPMS. In general most metals concentrations were low and below the analytical limit of detection with some high concentrations observed. Few factors examined in regression models were shown to influence biological metals concentrations and explained little of the variation. Further study is required to establish the source of metals exposures at the high end of the ranges of concentrations measured and the potential for any adverse health impacts in children. - This study has demonstrated exposure to alkali, alkali earth and transition metals in pregnant women with factors such as breastfeeding, fish oil use and diet affecting exposures
Caudeville, Julien; Bonnard, Roseline; Boudet, Céline; Denys, Sébastien; Govaert, Gérard; Cicolella, André
2012-08-15
Analyzing the relationship between the environment and health has become a major focus of public health efforts in France, as evidenced by the national action plans for health and the environment. These plans have identified the following two priorities: - identify and manage geographic areas where hotspot exposures are a potential risk to human health; and - reduce exposure inequalities. The aim of this study is to develop a spatial stochastic multimedia exposure model for detecting vulnerable populations and analyzing exposure determinants at a fine resolution and regional scale. A multimedia exposure model was developed by INERIS to assess the transfer of substances from the environment to humans through inhalation and ingestion pathways. The RESPIR project adds a spatial dimension by linking GIS (Geographic Information System) to the model. Tools are developed using modeling, spatial analysis and geostatistic methods to build and discretize interesting variables and indicators from different supports and resolutions on a 1-km(2) regular grid. We applied this model to the risk assessment of exposure to metals (cadmium, lead and nickel) using data from a region in France (Nord-Pas-de-Calais). The considered exposure pathways include the atmospheric contaminant inhalation and ingestion of soil, vegetation, meat, egg, milk, fish and drinking water. Exposure scenarios are defined for different reference groups (age, dietary properties, and the fraction of food produced locally). The two largest risks correspond to an ancient industrial site (Metaleurop) and the Lille agglomeration. In these areas, cadmium, vegetation ingestion and soil contamination are the principal determinants of the computed risk. Copyright © 2012 Elsevier B.V. All rights reserved.
Rodriguez, Delphy; Valari, Myrto; Markakis, Konstantinos; Payan, Sébastien
2016-04-01
Currently, ambient pollutant concentrations at monitoring sites are routinely measured by local networks, such as AIRPARIF in Paris, France. Pollutant concentration fields are also simulated with regional-scale chemistry transport models such as CHIMERE (http://www.lmd.polytechnique.fr/chimere) under air-quality forecasting platforms (e.g. Prev'Air http://www.prevair.org) or research projects. These data may be combined with more or less sophisticated techniques to provide a fairly good representation of pollutant concentration spatial gradients over urban areas. Here we focus on human exposure to atmospheric contaminants. Based on census data on population dynamics and demographics, modeled outdoor concentrations and infiltration of outdoor air-pollution indoors we have developed a population exposure model for ozone and PM2.5. A critical challenge in the field of population exposure modeling is model validation since personal exposure data are expensive and therefore, rare. However, recent research has made low cost mobile sensors fairly common and therefore personal exposure data should become more and more accessible. In view of planned cohort field-campaigns where such data will be available over the Paris region, we propose in the present study a statistical framework that makes the comparison between modeled and measured exposures meaningful. Our ultimate goal is to evaluate the exposure model by comparing modeled exposures to monitor data. The scientific question we address here is how to downscale modeled data that are estimated on the county population scale at the individual scale which is appropriate to the available measurements. To assess this question we developed a Bayesian hierarchical framework that assimilates actual individual data into population statistics and updates the probability estimate.
[Occupational exposure to nanoparticles. Assessment of workplace exposure].
Bujak-Pietrek, Stella
2010-01-01
Nanotechnology is currently one of the most popular branch of science. It is a technology that enables designing, manufacturing and application of materials and structures of very small dimensions, and its products are applied in almost every field of life. Nanoparticles are the structures having one or more dimensions of the order of 100 nm or less. They are used in precise mechanics, electronics, optics, medicine, pharmacy, cosmetics and many other spheres. Due to their very small size, nanostructures have completely different and specific properties, unknown for the bulk of materials. Fast-growing nanotechnology provides a wide spectrum of applications, but it also brings about new and unknown danger to human health. Nanotechnology is the branch that has developed rather recently, and much information about health risk and its influence on the environment is beyond our knowledge. Nanoparticles, released in many technological processes, as well as manufactured nanoparticles can induce occupational hazards to workers. The lack of regulations and standards, compulsory in the manufacture and use ofnanoparticles is a fundamental problem faced in the evaluation of exposure. Another problem is the choice of proper measurement equipment for surveying of very small particles - their number, mass and surface area in the workpost air. In this article, the possibility and scope of exposure assessment is discussed and a brief specification of available instrumentation for counting and assessing the parameters essential for classifying the exposure to nanoparticles is presented.
DEFF Research Database (Denmark)
Steinle, Susanne; Reis, Stefan; Sabel, Clive E
2013-01-01
exposure studies to accurately assess human health risks. ? We discuss potential and shortcomings of methods and tools with a focus on how their development influences study design. ? We propose a novel conceptual model for integrated health impact assessment of human exposure to air pollutants. ? We......Quantifying human exposure to air pollutants is a challenging task. Ambient concentrations of air pollutants at potentially harmful levels are ubiquitous in urban areas and subject to high spatial and temporal variability. At the same time, every individual has unique activity-patterns. Exposure...... results from multifaceted relationships and interactions between environmental and human systems, adding complexity to the assessment process. Traditionally, approaches to quantify human exposure have relied on pollutant concentrations from fixed air quality network sites and static population...
Zebrowitz, Leslie A; White, Benjamin; Wieneke, Kristin
2008-01-01
White participants were exposed to other-race or own-race faces to test the generalized mere exposure hypothesis in the domain of face perception, namely that exposure to a set of faces yields increased liking for similar faces that have never been seen. In Experiment 1, rapid supraliminal exposures to Asian faces increased White participants' subsequent liking for a different set of Asian faces. In Experiment 2, subliminal exposures to Black faces increased White participants' subsequent liking for a different set of Black faces. The findings are consistent with prominent explanations for mere exposure effects as well as with the familiar face overgeneralization hypothesis that prejudice derives in part from negative reactions to faces that deviate from the familiar own-race prototype.
Measuring water ingestion from spray exposures.
Sinclair, Martha; Roddick, Felicity; Nguyen, Thang; O'Toole, Joanne; Leder, Karin
2016-08-01
Characterisation of exposure levels is an essential requirement of health risk assessment; however for water exposures other than drinking, few quantitative exposure data exist. Thus, regulatory agencies must use estimates to formulate policy on treatment requirements for non-potable recycled water. We adapted the use of the swimming pool chemical cyanuric acid as a tracer of recreational water ingestion to permit detection of small water volumes inadvertently ingested from spray exposures. By using solutions of 700-1000 mg/L cyanuric acid in an experimental spray exposure scenario, we were able to quantify inadvertent water ingestion in almost 70% of participants undertaking a 10 min car wash activity using a high pressure spray device. Skin absorption was demonstrated to be negligible under the experimental conditions, and the measured ingestion volumes ranged from 0.06 to 3.79 mL. This method could be applied to a range of non-potable water use activities to generate exposure data for risk assessment processes. The availability of such empirical measurements will provide greater assurance to regulatory agencies and industry that potential health risks from exposure to non-potable water supplies are well understood and adequately managed to protect public health. Copyright © 2016 Elsevier Ltd. All rights reserved.
Health Effects of Chronic Arsenic Exposure
Directory of Open Access Journals (Sweden)
Young-Seoub Hong
2014-09-01
Full Text Available Arsenic is a unique element with distinct physical characteristics and toxicity whose importance in public health is well recognized. The toxicity of arsenic varies across its different forms. While the carcinogenicity of arsenic has been confirmed, the mechanisms behind the diseases occurring after acute or chronic exposure to arsenic are not well understood. Inorganic arsenic has been confirmed as a human carcinogen that can induce skin, lung, and bladder cancer. There are also reports of its significant association to liver, prostate, and bladder cancer. Recent studies have also suggested a relationship with diabetes, neurological effects, cardiac disorders, and reproductive organs, but further studies are required to confirm these associations. The majority of research to date has examined cancer incidence after a high exposure to high concentrations of arsenic. However, numerous studies have reported various health effects caused by chronic exposure to low concentrations of arsenic. An assessment of the health effects to arsenic exposure has never been performed in the South Korean population; thus, objective estimates of exposure levels are needed. Data should be collected on the biological exposure level for the total arsenic concentration, and individual arsenic concentration by species. In South Korea, we believe that biological exposure assessment should be the first step, followed by regular health effect assessments.
International Nuclear Information System (INIS)
Kirsch-Volders, M.; Poma, K.; Verschaeve, L.; Hens, L.; Susanne, C.; Elegem, P. van
1978-01-01
In utero acute low-level exposure to X-rays (300 to 350 mrads) induces a significant increase of band-loss in G-trypsin banded chromosomes of umbilical lymphocytes. Results, however, have to be confirmed by dose-effect relation studies and analysis with spectro-photometric scanning of deleted chromosomes. The same in utero exposure induces a significant dissociaton of chromosome pair 13 as revealed by centromere-centromere, angle and association tendency analysis of chromosome distribution in comparison with a control group. Occupational chronic low-level exposure to ionizing radiation does not modify significantly the amount of SCE in lymphocytes of peripheral blood. However, an analysis of centromere-centromere distances, angle values and associaton tendencies of the different chromosome combinations clearly shows an association of chromosome pair 12-16 after exposure to ionizing radiation. It is difficult to assess the exact biological importance of the observed chromosome modifications. However, referring to the already described dissociation of human acrocentric chromosomes after in vivo exposure to low levels of phenyl Hg acetate or inorganic Pb, the chromosome distribution seems not to be significantly disturbed by chronic or acute low-level exposure to ionizing radiation. (author)
Swartjes F; ECO
2003-01-01
Twenty scenarios, differing with respect to land use, soil type and contaminant, formed the basis for calculating human exposure from soil contaminants with the use of models contributed by seven European countries (one model per country). Here, the human exposures to children and children
Outdoor ultraviolet exposure of children and adolescents
International Nuclear Information System (INIS)
Diffey, B.L.; Gibson, C.J.
1996-01-01
The weekday and weekend outdoor ultraviolet exposure of young people from primary and secondary schools in three geographically distinct regions of England was determined over a 3-month period in summer. Ultraviolet exposure was measured using personal film badges worn by each young person and time spent outdoors, in hourly intervals, assessed using exposure records. In each area a class of 9-10 year-old children from a primary school and a class of 14-15-year-old adolescents from a secondary school took part, giving a total of 180 subjects. We found that primary school children received higher outdoor ultraviolet exposure than young people in secondary schools, and geographical differences in exposure could not be accounted for solely by differences in ambient ultraviolet. There was little difference between the exposure of males and females. Children and adolescents did not behave as homogeneous groups with regard to exposure. (Author)
Williams, Ron; Creason, John; Zweidinger, Roy; Watts, Randall; Sheldon, Linda; Shy, Carl
A 17-day pilot study investigating potential PM exposures of an elderly population was conducted near Baltimore, Maryland. Collection of residential indoor, residential outdoor, and ambient monitoring data associated with the subjects living at a common retirement facility was integrated with results from a paired epidemiological pilot study. This integration was used to investigate the potential pathophysiological health effects resulting from daily changes in estimated PM exposures with results reported elsewhere. Objectives of the exposure study were to determine the feasibility of performing PM exposure assessment upon an elderly population and establishing relationships between the various exposure measures including personal monitoring. PM 2.5 was determined to be the dominant outdoor size fraction (0.83 PM 2.5/PM 10 mass ratio by dichot monitoring). Individual 24-h PM 1.5 personal exposures ranged from 12 to 58 μg m -3. Comparison of data from matched sampling dates resulted in mean daily PM 1.5 personal, PM 2.5 outdoor, and PM 1.5 indoor concentrations of 34, 17, and 17 μg m -3, respectively. Activity patterns of the study population indicated a generally sedentary population spending a mean of 96% of each day indoors. Future studies would benefit from the use of a consistent sampling methodology across a larger number of PM measurement sites relevant to the elderly subjects, as well as a larger personal PM exposure study population to more successfully collect data needed in matched epidemiological-exposure studies.
Ruder, Avima M.; Succop, Paul; Waters, Martha A.
2015-01-01
Although polychlorinated biphenyls (PCBs) have been banned in many countries for more than three decades, exposures to PCBs continue to be of concern due to their long half-lives and carcinogenic effects. In National Institute for Occupational Safety and Health studies, we are using semiquantitative plant-specific job exposure matrices (JEMs) to estimate historical PCB exposures for workers (n=24,865) exposed to PCBs from 1938 to 1978 at three capacitor manufacturing plants. A subcohort of these workers (n=410) employed in two of these plants had serum PCB concentrations measured at up to four times between 1976 and 1989. Our objectives were to evaluate the strength of association between an individual worker’s measured serum PCB levels and the same worker’s cumulative exposure estimated through 1977 with the (1) JEM and (2) duration of employment, and to calculate the explained variance the JEM provides for serum PCB levels using (3) simple linear regression. Consistent strong and statistically significant associations were observed between the cumulative exposures estimated with the JEM and serum PCB concentrations for all years. The strength of association between duration of employment and serum PCBs was good for highly chlorinated (Aroclor 1254/HPCB) but not less chlorinated (Aroclor 1242/LPCB) PCBs. In the simple regression models, cumulative occupational exposure estimated using the JEMs explained 14–24 % of the variance of the Aroclor 1242/LPCB and 22–39 % for Aroclor 1254/HPCB serum concentrations. We regard the cumulative exposure estimated with the JEM as a better estimate of PCB body burdens than serum concentrations quantified as Aroclor 1242/LPCB and Aroclor 1254/HPCB. PMID:23475397
Modelling exposure opportunities
DEFF Research Database (Denmark)
Sabel, Clive E.; Gatrell, Anthony C.; Löytönen, Markku
2000-01-01
This paper addresses the issues surrounding an individual's exposure to potential environmental risk factors, which can be implicated in the aetiology of a disease. We hope to further elucidate the 'lag' or latency period between the initial exposure to potential pathogens and the physical...... boundaries.We use kernel estimation to model space-time patterns. Raised relative risk is assessed by adopting appropriate adjustments for the underlying population at risk, with the use of controls. Significance of the results is assessed using Monte Carlo simulation, and comparisons are made with results...
International Nuclear Information System (INIS)
1988-01-01
Part 3 is given of the Code of Practice approved by the UK Health and Safety Commission with the consent of the Secretary of State for the purpose of providing practical guidance with respect to the provisions of the Ionising Radiations Regulations 1985. Part 3 gives specific guidance on the application of the Regulations to certain work involving exposure to isotopes of radon and their decay products. Aspects covered in the Regulations include restriction of exposure, dose limits, controlled areas, radiation protection advisers and supervisors, dosimetry and area monitoring. (U.K.)
International Nuclear Information System (INIS)
Green, B.M.R.
1985-01-01
A brief report is given of a seminar on the exposure to enhanced natural radiation and its regulatory implications held in 1985 at Maastricht, the Netherlands. The themes of the working sessions included sources of enhanced natural radiation, parameters influencing human exposure, measurement and survey programmes, technical countermeasures, risk and assessment studies, philosophies of dose limitations and national and international policies. (U.K.)
Axelrod, Terry S
2014-11-01
This article describes the basic bony, ligamentous, and neurologic anatomy of the structures about the elbow. The surgical exposures of the elbow joint are described, providing details of the various posterior, lateral, and medial approaches to the articular segments. Clinical applications describing the potential benefits of each surgical exposure are provided as examples. Copyright © 2014 Elsevier Inc. All rights reserved.
Blade, L M; Yencken, M Story; Wallace, M E; Catalano, J D; Khan, A; Topmiller, J L; Shulman, S A; Martinez, A; Crouch, K G; Bennett, J S
2007-08-01
The National Institute for Occupational Safety and Health (NIOSH) conducted 21 field surveys in selected industries to characterize workers' exposures to hexavalent chromium-containing airborne particulate and to evaluate existing technologies for controlling these exposures. Hexavalent chromium Cr(VI) is a respiratory irritant and chronic inhalation may cause lung cancer. Primary evaluation methods included collection of full work shift, personal breathing-zone (PBZ) air samples for Cr(VI), measurement of ventilation system parameters, and documentation of processes and work practices. This study emphasized evaluation of engineering exposure control measures, so PBZ exposures were measured on the outside of personal protective equipment, for example, respirators. Field surveys were conducted in two chromium electroplating facilities, including one where full-shift PBZ exposures to Cr(VI) ranged from 3.0 to 16 times the 1 micro g/m(3)NIOSH recommended exposure limit (REL) despite several engineering controls on the plating tanks. At a painting and coating facility that used Cr(VI)-containing products, full-shift exposures of painters and helpers (2.4 to 55 micro g/m(3)) exceeded the REL, but LEV effectiveness was limited. Other operations evaluated included welding in construction; metal cutting operations on chromium-containing materials in ship breaking; chromate-paint removal with abrasive blasting; atomized alloy-spray coating; foundry operations; printing; and the manufacture of refractory brick, colored glass, prefabricated concrete products, and treated wood products. NIOSH researchers concluded that, in many of the evaluated processes, Cr(VI) exposures at or below the current NIOSH REL are achievable. However, for some processes, it is unclear whether controlling exposures to this range is consistently achievable without respirator use. Some operations involving the application of coatings and finishes may be among those most difficult to control to this
Dalbøge, Annett; Frost, Poul; Andersen, Johan Hviid; Svendsen, Susanne Wulff
2018-03-01
We aimed to identify intensities of occupational mechanical exposures (force, arm elevation and repetition) that do not entail an increased risk of surgery for subacromial impingement syndrome (SIS) even after prolonged durations of exposure. Additionally, we wanted to evaluate if exposure to hand-arm vibration (HAV) is an independent risk factor. We used data from a register-based cohort study of the entire Danish working population (n=2 374 403). During follow-up (2003-2008), 14 118 first-time events of surgery for SIS occurred. For each person, we linked register-based occupational codes (1993-2007) to a general population job exposure matrix to obtain year-by-year exposure intensities on measurement scales for force, upper arm elevation >90° and repetition and expert rated intensities of exposure to HAV. For 10-year exposure time windows, we calculated the duration of exposure at specific intensities above minimal (low, medium and high). We used a logistic regression technique equivalent to discrete survival analysis adjusting for cumulative effects of other mechanical exposures. We found indications of safe exposure intensities for repetition (median angular velocity 90° >2 min/day implied an increased risk reaching ORs of 1.7 and 1.5 after 10 years at low intensities. No associations were found for HAV. We found indications of safe exposure intensities for repetition. Any intensities of force and upper arm elevation >90° above minimal implied an increased risk across 10-year exposure time windows. No independent associations were found for HAV. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
International Nuclear Information System (INIS)
Hornhardt, S.; Jung, T.; Burkart, W.
2000-01-01
Health effects from exposures to ionizing radiation are in general the result of complex multi-step reaction chains involving changes and responses on the level of molecules, cells, tissues and organisms. In environmental low dose exposure situations ionizing radiation only contributes a small fraction to the life-long attack on DNA by other exogenous and endogenous genotoxins. Nevertheless, efforts to assess and quantify deleterious effects at low exposure levels are directed mainly towards radiation as a single isolated agent, and rarely towards the concomitant presence of other natural and anthropogenic toxicants. Only these combined exposures may lead to observable health risk effects. In addition they might differ from those expected from simple addition of the individual risks due to interaction. The existing data base on combined effects is rudimentary, mainly descriptive and rarely covers exposure ranges large enough to make direct inferences to present day low dose exposure situations. Therefore, any risk assessment will have to consider the question whether combined effects, i.e. interaction between two or more agents will influence the health outcome from specific exposure situations in such a way that predictions derived from simple standard exposure situations would have to be revised. In view of the multitude of possible interactions between the large number of potentially harmful agents in the human environment, descriptive approaches will have to be supplemented by the use of mechanistic models for critical health endpoints such as cancer. Agents will have to be grouped depending on their physical or chemical mode of action at the molecular and cellular level, to generalize and predict the outcome of combined exposures at low exposure levels and the possibility of interactions. (author)
Exposure to background radiation in Australia
International Nuclear Information System (INIS)
Solomon, S.B.
1997-01-01
The average effective dose received by the Australian population is estimated to be ∼1.8 mSv / year. One half of this exposure arises from exposure from terrestrial radiation and cosmic rays, the remainder from radionuclides within the body and from inhalation of radon progeny. This paper reviews a number of research programmes carried out by the Australian Radiation Laboratory to study radiation exposure from natural background, particularly in the workplace and illustrate approaches to the quantification and management of exposure to natural radiation. The average radiation doses to the Australian population are relatively low; the average annual radon concentration ranged from 6 Bq m -3 in Queensland to 16 Bq m -3 in the Australian Capital Territory (ACT). Of more importance is the emerging issue of exposure to elevated background radiation in the workplace. Two situation are presented; the radiation exposure to air crues and show cave tour guides. Annual doses up to 3.8 mSv were estimated for international crew members while the highest estimate for show cave tour guides was 9 mSv per year
Hearing loss and contributing factors among airport workers in Malaysia.
Nasir, H M; Rampal, K G
2012-02-01
Sensorineural hearing loss is a common and important source of disability among the workers and often caused by occupational noise exposure. Aims of the study were to determine the prevalence and contributing factors of hearing loss among airport workers. A cross-sectional study was carried out at an airport in Malaysia. This study used stratified sampling method that involved 358 workers who were working in 3 different units between November 2008 and March 2009. Data for this study were collected by using questionnaires eliciting sociodemographic, occupational exposure history (previous and present), life-style including smoking habits and health-related data. Otoscopic and pure-tone audiometric tests were conducted for hearing assessment. Noise exposure status was categorize by using a noise logging dosimeter to obtain 8-hour Time-Weighted Average (TWA). Data was analyzed by using SPSS version 12.0.1 and EpiInfo 6.04. The prevalence of hearing loss was 33.5%. Age >40 years old (aOR 4.3, 95%CI 2.2-8.3) is the main risk factors for hearing loss followed by duration of noise exposure >5 years (aOR 2.5, 95%CI 1.4-4.7), smoking (aOR 2.1, 95%CI 1.2-3.4), duration of service >5 years (aOR 2.1, 95%CI 1.1-3.9), exposure to explosion (aOR 6.1, 95%CI 1.3-29.8), exposure to vibration (aOR 2.2, 95%CI 1.1-4.3) and working in engineering unit (aOR 5.9, 95%CI 1.1-30.9). The prevalence rate ratio of hearing loss for nonsmokers aged 40 years old and younger, smokers aged 40 years old and younger, non-smokers older than 40 years old and smokers older than 40 years old was 1.0, 1.7, 2.8 and 4.6 respectively. This result contributes towards better understanding of risk factors for hearing loss, which is relatively common among Malaysian workers.
Vincent, Raymond; Catani, Jacques; Créau, Yvon; Frocaut, Anne-Marie; Good, Andrée; Goutet, Pierre; Hou, Alain; Leray, Fabrice; André-Lesage, Marie-Ange; Soyez, Alain
2009-06-01
An assessment survey of occupational exposure to beryllium (Be) was conducted in France between late 2004 and the end of 2006. Exposure estimates were based on the analytical results of samples collected from workplace air and from work surfaces in 95 facilities belonging to 37 sectors of activity. The results of this study indicated airborne Be concentrations in excess of the occupational exposure limit value of 2 microg m(-3) recommended in France. Metallurgy and electronic component manufacturing represented the activities and occupations where workers had the highest arithmetic mean exposures to Be. Surface contamination levels were also high and frequently exceeded thresholds recommended by different bodies. These results should prompt the development of prevention programmes that include Be substitution, process control and surface decontamination, in conjunction with suitable medical surveillance.
Challenges and Perspectives of Nanoparticle Exposure Assessment
Lee, Ji Hyun; Moon, Min Chaul; Lee, Joon Yeob; Yu, Il Je
2010-01-01
Nanoparticle exposure assessment presents a unique challenge in the field of occupational and environmental health. With the commercialization of nanotechnology, exposure usually starts from the workplace and then spreads to environment and consumer exposure. This report discusses the current trends of nanoparticle exposure assessment, including the definition of nanotechnology relevant terms, essential physicochemical properties for nanomaterial characterization, current international activi...
Environmental radiation and exposure to radiation
International Nuclear Information System (INIS)
1981-02-01
Compared to 1977 the exposure to radiation of the population of the Federal Republic of Germany from both natural and artificial radiation sources has not greatly charged. The amin part of exposure to natural radiation is caused by environmental radiation and by the absorption of naturally radioactive substances into the body. Artificial exposure to radiation of the population is essentially caused by the use of ionizing rays and radioactive substances in medicine. When radioactive materials are released from nuclear facilities the exposure to radiation of the population is only very slightly increased. The real exposure to radiation of individual people can even in the worst affected places, have been at most fractions of a millirem. The exposure to radiation in the worst afected places in the area of a hard-coal power station is higher than that coming from a nuclear power station of the same capacity. The summation of all contributions to the exposure of radiation by nuclear facilities to the population led in 1978 in the Federal Republic of Germany to a genetically significant dose of clearly less than 1 millerem per year. The medium-ranged exposure to radiation by external radiation effects through professional work was in 1978 at 80 millirems. No difference to 1977. The contribution of radionuclide from the fallout coming from nuclear-weapon tests and which has been deposited in the soil, to the whole-body dose for 1978 applies the same as the genetically significant dose of the population with less than 1 millirem. (orig./HP) [de
Time-activity relationships to VOC personal exposure factors
Edwards, Rufus D.; Schweizer, Christian; Llacqua, Vito; Lai, Hak Kan; Jantunen, Matti; Bayer-Oglesby, Lucy; Künzli, Nino
Social and demographic factors have been found to play a significant role in differences between time-activity patterns of population subgroups. Since time-activity patterns largely influence personal exposure to compounds as individuals move across microenvironments, exposure subgroups within the population may be defined by factors that influence daily activity patterns. Socio-demographic and environmental factors that define time-activity subgroups also define quantifiable differences in VOC personal exposures to different sources and individual compounds in the Expolis study. Significant differences in exposures to traffic-related compounds ethylbenzene, m- and p-xylene and o-xylene were observed in relation to gender, number of children and living alone. Categorization of exposures further indicated time exposed to traffic at work and time in a car as important determinants. Increased exposures to decane, nonane and undecane were observed for males, housewives and self-employed. Categorization of exposures indicated exposure subgroups related to workshop use and living downtown. Higher exposures to 3-carene and α-pinene commonly found in household cleaning products and fragrances were associated with more children, while exposures to traffic compounds ethylbenzene, m- and p-xylene and o-xylene were reduced with more children. Considerable unexplained variation remained in categorization of exposures associated with home product use and fragrances, due to individual behavior and product choice. More targeted data collection methods in VOC exposure studies for these sources should be used. Living alone was associated with decreased exposures to 2-methyl-1-propanol and 1-butanol, and traffic-related compounds. Identification of these subgroups may help to reduce the large amount of unexplained variation in VOC exposure studies. Further they may help in assessing impacts of urban planning that result in changes in behavior of individuals, resulting in shifts in
DOE 2010 occupational radiation exposure
Energy Technology Data Exchange (ETDEWEB)
none,
2011-11-01
The U.S. Department of Energy (DOE) Office of Analysis within the Office of Health, Safety and Security (HSS) publishes the annual DOE Occupational Radiation Exposure Report to provide an overview of the status of radiation protection practices at DOE.* The DOE 2010 Occupational Radiation Exposure Report provides an evaluation of DOE-wide performance regarding compliance with DOE Part 835 dose limits and as low as reasonably achievable (ALARA) process requirements. In addition, the report provides data to DOE organizations responsible for developing policies for protection of individuals from the effects of radiation. The report provides a summary and an analysis of occupational radiation exposure information from the monitoring of individuals involved in DOE activities. The occupational radiation exposure information is analyzed in terms of aggregate data, dose to individuals, and dose by site over the past 5 years.
Spee, Ton; Huizer, Daan
2017-10-01
%) to MMA were higher than the Dutch occupational exposure limit of 205mg/m 3 (8h TWA), which equals the DNEL. For semi-enclosed situations this was 1 out of 6 (17%). Exposures varied from 31 to 367mg/m 3 . The results emphasize that ECETOC-TRA exposure estimates in poorly controlled situations need better underpinning. Copyright © 2017 Elsevier GmbH. All rights reserved.
Bases for establishing radiation exposure limits
International Nuclear Information System (INIS)
Pochin, E.E.
1977-01-01
It is an essential requirement of good radiation protection that all unnecessary exposure of people should be avoided and that any necessary exposure, whether of workers or of members of the general public, should be minimised. It is, however, an additional requirement that such necessary exposures should not exceed certain stated limits. These principles are based on the possibility that even the smallest exposures may involve some risk of harm, that any risk of harm should be justifiable by the circumstances necessitating it, and that risk should always be limited to an appropriately low level. The bases for establishing exposure limits must therefore involve an assessment of the risk involved in any form of radiation exposure, and an opinion as to the degree of safety that should be ensured in circumstances which necessitate any occupational or public exposure to radiation. There is increasing quantitative evidence on the frequency on which harm, and particularly the induction of malignancies, may be caused in people exposed to radiation at high doses; and somewhat clearer bases than previously for inferring the possible frequencies at low doses. It is therefore easier to assess the degree of safety ensured by restricting radiation exposure to particular levels. The degree of safety which should be regarded as appropriate in different circumstances remains a matter for review, but suggestions are made as to levels which would be advocated by informed opinion, and the exposure limits which would correspond to these. It is clear also that a comparable degree of safety should be ensured whether the radiation exposure involves the whole body more of less uniformly, or individual tissues or organs selectively. Increasing epidemiological evidence is available on the relative sensitivity to radiation induction of malignancies in a number of organs, and to the apparently much lower sensitivity of other organs; and experimental evidence in animals allows a comparable
Open-field exposure facilitates consummatory extinction.
Justel, Nadia; Psyrdellis, Mariana; Pautassi, Ricardo M
2016-12-07
During extinction, the organism learns that a conditioned stimulus or a conditioned response is no longer associated with an unconditioned stimulus, and as a consequence, a decrement in the response is presented. The exposure to novel situations (e.g. exploration of a novel open field) has been used widely to modulate (i.e. either enhance or deteriorate) learning and memory. The aim of the present study was to test whether open-field exposure could modulate consummatory extinction. The results indicated that open-field exposure accelerated the extinction response (i.e. experimental animals provided novelty exposure had lower consummatory behavior than control animals) when applied before - but not after - the first extinction trial, or when applied before the second extinction trial. The results suggest that environmental treatments such as novelty exposure provide a valuable, nonpharmacological alternative to potentially modulate extinction processes.
External radiation exposure of the public
International Nuclear Information System (INIS)
Mehl, J.
1977-01-01
Results of several ten thousand measurements on external radiation (outside buildings, in living rooms) are used for illustrating by isodose charts covering the total area of the Federal Republic of Germany the exposure of the public from external radiation originating from natural radiation of the environment. Results of calculations on external radiation exposure of the public due to releases of radioactivity in air from nuclear installations are used for illustrating by coloured isodose charts the exposure of the public in the plant site vicinity. From comparison of the exposure levels it becomes obvious that if exposure levels of several 10 mrem per year are considered to be of real concern to public health, control of natural radoactivity in the environment of man would require more attention than present and foreseeable releases of radioactivity in air from nuclear inst
Cost benefit analysis for occupational radiation exposure
International Nuclear Information System (INIS)
Caruthers, G.F.; Rodgers, R.C.; Donohue, J.P.; Swartz, H.M.
1978-01-01
In the course of system design, many decisions must be made concerning different aspects of that particular system. The design of systems and components in a nuclear power plant has the added faction of occupational exposure experienced as a result of that design. This paper will deal with the different methods available to factor occupational exposure into design decisions. The ultimate goal is to have exposures related to the design 'As Low As Reasonably Achievable' or ALARA. To do this an analysis should be performed to show that the cost of reducing exposures any further cannot be justified in a cost-benefit analysis. In this paper examples will be given that will show that it is possible to change to a design which would increase occupational exposure somewhat but would increase the benefit over the cost of the extra exposure received. It will also be shown that some changes in design or additional equipment could be justified due to a reduction in exposure while some changes could not be justified on a reduction in exposure aspect alone but are justified on a time saving aspect such as during a refueling outage. (author)