WorldWideScience

Sample records for tussen het niveau

  1. Naar een beter evenwicht tussen autonomie en solidariteit in het relatievermogensrecht

    OpenAIRE

    Declerck, Charlotte

    2015-01-01

    In dit editoriaal worden enkele voorstellen tot het bereiken van een beter evenwicht tussen de huidige samenlevingsvormen geformuleerd samenlevingsvormen; huwelijk; wettelijke samenwoning; feitelijke samenwoning; evenwicht

  2. Aquatische biomassa, het verwaarden van waterige reststromen op lokaal niveau

    NARCIS (Netherlands)

    Huurman, Sander; Weide, van der R.Y.

    2015-01-01

    Het verwaarden van lokaal geproduceerde waterige reststromen door middel van aquatische biomassa is onderdeel van de PPS Kleinschalige bioraffinage (WP5). In dit deelrapport is een overzicht van een aantal in Nederland aanwezige waterige reststromen weergegeven. Een aantal van deze reststromen is

  3. Na(ar) goed overleg... Achtergronden en verbeteringen van overleg in het openbaar bestuur in het bijzonder in verhoudingen tussen overheden.

    NARCIS (Netherlands)

    Bleker, Hinderk

    1984-01-01

    Tal van besluiten van Nederlandse overheidsinstanties komen tot stand nadat overleg is gevoerd met andere overheidsorganen, met maatschappelijke organisaties of met individuele burgers. Deze studie gaat over het overleg zoals dat veelvuldig tussen overheidsinstanties van verschillende

  4. Het verband tussen geluk, wijsheid, Twitter en Serendipity

    NARCIS (Netherlands)

    drs. Frans van den Reep

    2012-01-01

    1e alinea column: Life happens to you while you are busy making other plans, J. Lennon Hoe komen succesvolle innovaties in de internettijd tot stand? Toeval, geluk, reputatie en timing blijven een rol spelen, maar social media en 24*7 wereldwijd verbonden maken het spel wel anders dan vroeger.

  5. Daar Heb Jij Niets Mee te Maken! Longitudinale Relaties Tussen Privacyschending en Ouder-Adolescentconflict

    NARCIS (Netherlands)

    Keijsers, Loes; Hawk, Skyler T.; Hale, Bill; Meeus, W.H.J.

    2011-01-01

    Het reguleren van de grenzen van privacy tussen jongeren en ouders is moeilijk, aangezien jongeren steeds trachten de grenzen van hun privédomein te verruimen. Als jongeren het idee hebben dat hun ouders de privacygrenzen overtreden kan dit leiden tot conflicten, maar een hoger niveau van conflicten

  6. Tussen uitspraak en detentie : Een verklaring voor het verschil tussen twee methoden om de behoefte aan sanctiecapaciteit te meten

    NARCIS (Netherlands)

    Moolenaar, D.E.G.

    2001-01-01

    Het WODC maakt regelmatig prognoses van de behoefte aan sanctiecapaciteit. Bij de strafrechtelijke sanctiecapaciteit van het gevangeniswezen voor meerderjarigen laten verschillende bronnen echter een uiteenlopend beeld zien. Het gaat hiet om verschillende modellen gehanteerd door het WODC en de

  7. De Journaux de Hollande en hun functie als forum voor het wetenschappelijk debat tussen de leden van de Republiek der Letteren

    Directory of Open Access Journals (Sweden)

    Hans Bots

    1997-12-01

    Full Text Available De Journeaux de Hollande zijn de Franstalige tijdschriften die tussen 1675 en 1750 in de Republiek verschenen. In dit artikel wordt ingegaan op de vraag in hoeverre deze tijdschriften plaats boden aan het contemporaine wetenschappelijke debat.

  8. Achtergronden van het natuurbeheer bij het conflict tussen natuur en cultuur : een literatuurstudie

    NARCIS (Netherlands)

    Kemmers, R.H.

    1977-01-01

    De veronderstelling dat orde in het biotische systeem slechts kan samengaan met lage energetische niveaus lijkt gerechtvaardigd. Ecologisch betekent dit dat aan de meer droge, donkere, koude, voedselarme, venige kant meer kans op ordening aanwezig is dan aan de natte, lichte, warme, voedselrijke en

  9. De relatie tussen het niveau van de openbare verlichting en de verkeersveiligheid : een aanvullende literatuurstudie.

    NARCIS (Netherlands)

    Schreuder, D.A.

    1988-01-01

    Public lighting has a fourfold function. It has to ensure the civil security, to improve traffic flow and traffic safety at night and to improve the feeling of safety of the residents. A cost benefit analysis should be made to determine the quantitative relationship between the quality of life

  10. De relatie tussen het niveau van de openbare verlichting en de verkeersveiligheid : een voorstudie.

    NARCIS (Netherlands)

    Schreuder, D.A.

    1989-01-01

    Road lighting represents only a relative small post on the expenditure, both regarding costs and energy. Nevertheless it involves considerable sums, and it seems to be justified to use the money and the energy for road lighting as good as possible, particularly in times where public expenditure and

  11. Personeel van sociale instituties. Over het verband tussen vrouwenbeweging en maatschappelijk werk

    Directory of Open Access Journals (Sweden)

    Berteke Waaldijk

    2015-06-01

    Full Text Available Staffing Social Institutions: The Relation between the Women’s Movement and Social WorkBerteke Waaldijk discusses the way ideals of feminism and women’s emancipation in the Netherlands found their way into the design and delivery of social interventions. She compares ideals of women’s movement around 1913 with practices designed by the ‘Benevolent Colonies’ in the 1820s for Dutch paupers and with the feminist training for social workers of the 1970s and 1980s in the Netherlands. She concludes that ideals about the liberation of women were often expressed as those of professional social work aimed at making clients (‘paupers’ in 1820, ‘the poor’ in 1913 become self-reliant citizens. Respect for clients and trainedexpertise of the social workers were the requirement for such social interventions. In the examples discussed disciplinary practices and emancipatory ideals are not mutually exclusive. More research therefore is required on the way connections between feminist movements and training for social professionals facilitate disciplining social policies.Berteke Waaldijk bespreekt de historische vervlechting tussen vrouwenbewegingen en sociale interventies. Uit een vergelijking van de idealen van het sociaal werk rond 1913 met de praktijken van de Maatschappij voor Weldadigheid concludeert zij dat nadruk op zelfredzaamheid van de cliënt en respect en deskundigheid van de hulpverlener niet nieuw waren. De idealen van Hélène Mercier en MarieMuller-Lulofs rond 1900 leken in veel opzichten op de idealen van dat oudere disciplinerende sociale project. Met een beschrijving van de idealen van de tweede feministische golf binnen de sociale beroepsopleiding ‘Vrouwen en Welzijnswerk’ laat Waaldijk zien dat ook in de jaren zeventig en tachtig van de twintigste eeuwfeministische idealen soms geformuleerd werden als pleidooien voor professioneel sociaal werk. De rol van de denkbeelden over bevrijding en emancipatie van vrouwen in het

  12. Wim Cöp, Het spel van de macht. De familie Van Broechoven en de politieke en economische elite in ’s-Hertogenbosch tussen 1597 en 1629

    Directory of Open Access Journals (Sweden)

    Klaas Van Gelder

    2016-06-01

    Full Text Available Wim Cöp, Het spel van de macht. De familie Van Broechoven en de politieke en economische elite in ’s-Hertogenbosch tussen 1597 en 1629 (Ph.D Tilburg University 2014; Hilversum: Verloren, 2015, 344 pp., isbn 978 90 8704 464 0.

  13. Twisten tussen woningcorporatie en huurder: garandeert het Unierecht een recht op schotelantennes?

    NARCIS (Netherlands)

    van Harten, Herman; van Hees, Sander

    In het huurreglement van de Arnhemse woningcorporatie SVA is opgenomen dat een huurder niet zonder voorafgaande schriftelijke toestemming het gehuurde mag wijzigen. Daaronder wordt mede begrepen het plaatsen van antennes. De vordering van de woningcorporatie tot verwijdering van een door een huurder

  14. Alles is betrekkelijk: over de relatie tussen normschending en sanctie in het aansprakelijkheidsrecht

    NARCIS (Netherlands)

    S.D. Lindenbergh (Siewert)

    2006-01-01

    textabstractIs de Nederlandse Bank als toezichthouder aansprakelijk voor de schade van houders van levensverzekeringspolissen van de door wanbeheer faillietverklaarde verzekeringsmaatschappij Vie d’Or? Is de producent van het ondeugdelijke voorbehoedmiddel Implanix aansprakelijk voor de kosten van

  15. Onderzoek naar het verband tussen instrumenteel bepaald breukgedrag en sensorisch bepaalde textuur van pizza's

    NARCIS (Netherlands)

    Oortwijn, H.; Herstel, H.

    1988-01-01

    Het breukgedrag van 34 pizzabodemmonsters is instrumenteel bepaald. Met behulp van de cluster- respectievelijk principale - componenten analyse is de verzameling pizza's in groepen verdeeld, die zich in breukgedrag onderscheidden. Nagegaan is in hoeverre deze groepsindeling overeenstemde met die van

  16. Onderzoek naar de relatie tussen het zoutgehalte van de bodem, de bodemvruchtbaarheid, de vegetatie, de bladsamenstelling en de boniteit van opstanden van zomereik (Quercus robur) in de boswachterij Wieringermeer (voorjaar-najaar 1981) = Investigation of relationships between soil salinity, soil fertility, natural vegetation, foliar composition and site index of stands of pedunculate oak (Q.robur)

    NARCIS (Netherlands)

    Burg, van den J.; Leys, H.N.; Lynden, van K.R.

    1984-01-01

    Het verband tussen de natuurlijke vegetatie, het bodemprofiel, de bodemchemische eigenschappen, de grondwaterstand, het zoutgehalte van de bodem en de boniteit van zomereik (Quercus robur) werd in 1981 onderzocht in 26 proefplekken in de boswachterij Wieringermeer. Het doel van het onderzoek in deze

  17. De relatie tussen roken en cafeïnegebruik en het (genetische) mechanisme wat hieraan ten grondslag ligt [The association between smoking and caffeine use and the (genetic) mechanism underlying this association

    NARCIS (Netherlands)

    Treur, J.L.

    2016-01-01

    Het is aangetoond dat roken sterk samenhangt met koffiegebruik, maar of dit ook zo is voor roken en andere cafeïnehoudende dranken is nog onbekend. Ook weten we nog niet welk mechanisme hieraan ten grondslag ligt. Met vragenlijstgegevens heeft de auteur allereerst de relatie tussen roken en het

  18. ADR in het strafrecht; de derde in een verticale rechtsstrijd tussen de bestraffende overheid en de verdachte.

    NARCIS (Netherlands)

    Kwakman, Nico (N.J.M.)

    2006-01-01

    In deze bijdrage wordt de vraag aan de orde gesteld of alternatieve geschilbeslechting wel past in een 'verticale' rechtsstrijd tussen de bestraffende overheid en de verdachte. Onder welke voorwaarden kunnen vormen van AGB (zoals bijvoorbeeld mediation) daadwerkelijk een aantrekkelijk alternatief

  19. Het veranderende gezin. Relaties tussen trends in het gezin in Nederland en de afbeelding in dramaprogramma’s op de Nederlandse televisie, 1980-2005

    NARCIS (Netherlands)

    Emons, P.A.A.; Scheepers, P.L.H.; Wester, F.P.J.

    2007-01-01

    Deze systematische inhoudsanalyse richt zich op veranderingen in de portrettering van het gezin in dramaprogramma’s op de Nederlandse televisie en gaat de relatie na met sociaal-culturele veranderingen in het gezin in de Nederlandse maatschappij.

  20. Het effect van het calciumgehalte van pootgoed op de ziektegevoeligheid

    NARCIS (Netherlands)

    Velema, R.; Griend, van de P.; Velvis, H.

    2001-01-01

    Het onderzoek dat in dit verslag is beschreven heeft betrekking op de relatie tussen het calciumgehalte in de knol en het optreden van de ziekten Fusarium spp, Helminthosporium solani, Phytophthora infestans en Erwinia spp.

  1. Het verschil tussen Polygonatum odoratum (Mill.) Druce (Welriekende salomonszegel) en P. x hybridum Brügger (Tuinsalomonszegel)

    NARCIS (Netherlands)

    Duistermaat, Leni (H.)

    1999-01-01

    Bij het controleren van waarnemingen die aan FLORBASE zijn toegevoegd¹² bleek dat veel waarnemingen van Polygonatum odoratum (Welriekende salomonszegel) buiten het duingebied betrekking hebben op P. x hybridum (Tuinsalomonszegel). Polygonatum odoratum is een soort van droge, kalkrijke grond; hij is

  2. Inzicht interactie tussen TBM en doorboorde grond

    NARCIS (Netherlands)

    Festa, D.

    2012-01-01

    Doordat er onvoldoende bekend is over de interactie tussen de tunnelboormachine (TBM) en de doorboorde grond zijn zettingspredicties niet altijd realistisch. Daniele Festa, promovendus aan de TU Delft, wil het inzicht in de TBM-grondinteractie verbeteren door enerzijds het gedrag van het boorschild

  3. Tussen de oren, voor paard en pony in praktijk

    NARCIS (Netherlands)

    Bruin, G.; Knaap, J.; Smolders, E.A.A.; Spek, van der M.C.

    1997-01-01

    Dit boek is echter voor tussen de oren van de eigenaar, verzorger, ruiter of amazone. Het bevat praktische adviezen op het gebied van voeding, opfok, gezondheid, africhting, vruchtbaarheid, beweiding en bodems

  4. Tussen prudentie en prestatie in finance & accounting : verkennend onderzoek naar bedrijfsethiek, leiderschap en morele professionele ontwikkeling in het bachelor onderwijs

    NARCIS (Netherlands)

    Krabbe, Hans; de Graaf, Frank Jan

    2013-01-01

    Dit is een verslag van een pilotonderzoek naar ethisch leiderschap bij de minor Inspirerend Leiderschap. Hierin hebben studenten professionals ondervraagd over ethiek en leiderschap in de financiële sector en zakelijke dienstverlening. Het ging bij dit onderzoek niet alleen om de uitkomsten, maar

  5. Resistentie tegen het maiswortelknobbelaaltje in bladrammenas

    NARCIS (Netherlands)

    Visser, J.H.M.

    2009-01-01

    Het niveau van resistentie van bladrammenasrassen tegen het maiswortelknobbelaaltje, Meloidogyne chitwoodi, kan op meerdere manieren worden bepaald. Om het resistentieniveau van rassen objectief vast te kunnen stellen, is een betrouwbare en door een onafhankelijke instantie uit te voeren

  6. Het wezen van de schilderkunst volgens Leonardo da Vinci : over de verhouding tussen kunsttheorie en de praktijk van de schilder in de Renaissance

    NARCIS (Netherlands)

    Kwakkelstein, M.W.|info:eu-repo/dai/nl/74032615

    2011-01-01

    Op 19 oktober houdt prof. dr. Michael Kwakkelstein zijn oratie aan de Universiteit Utrecht over de verhouding tussen kunsttheorie en -praktijk bij Leonardo da Vinci. Kwakkelstein stelt dat Leonardo’s schilderkunst niet altijd beantwoordt aan de criteria voor goede schilderkunst die de grote

  7. Bijnierschorsactiviteit bij CARA (Astma); onderzoek naar de corticosteron en cortisolspiegel in het bloed

    NARCIS (Netherlands)

    Weller, Herman Hendrik

    1965-01-01

    SAMENVATTING EN CONCLUSIES Het onderzoek werd opgezet teneinde enkele endocrinologische aspecten van het probleem 'astma' te benaderen, waarbij de bijnierschors activiteit centraal werd gesteld. vVerkhypothese was hierbij de gedachtengang dat er een nauwe verwantschap bestaat tussen het astma

  8. Tussen weerstand en weerbaarheid en andere recepten : een effectevaluatie van het WIBO-lesprogramma met behulp van vragenlijsten, dagboeken en observaties

    NARCIS (Netherlands)

    Boelhouwer, Marieke Dharmayanti

    2013-01-01

    This dissertation discusses evaluation of the WIBO (Weerbaarheid in het BasisOnderwijs) program for improving the empowerment of children in grades 5 and 6. We investigated whether or not WIBO was effective, in three separate studies: a questionnaire study and a diary study (n= 764, 372 girls, 392

  9. 'Het gaat niet over zwart en wit'

    NARCIS (Netherlands)

    Drs. Kennedy Aquilino Tielman; prof dr Douwe Beijaard; Dr. Perry den Brok; Dr. S. Bolhuis

    2009-01-01

    'Het gaat niet over zwart en wit' De meeste mbo-scholen hebben samenwerking tussen de leerlingen hoog in het vaandel. Kunnen samenwerken is belangrijk voor de latere beroepsuitoefening en het functioneren van de leerlingen in de samenleving. De grote culturele diversiteit binnen de leerlingpopulatie

  10. Towards new roads in environmental policy; Naar nieuwe wegen in het milieubeleid

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    From this report it appears that the environmental policy in the Netherlands is not sufficient to deal with the environmental problems that will occur in the (near) future. In a separate report six cases are presented and discussed which illustrate the results of this report. [Dutch] Het beleid van de Nederlandse overheid is niet afdoende voor de milieuproblemen die zich in de (nabije) toekomst zullen voordoen. Voor nog openstaande en nieuwe milieuproblemen, zoals de problematiek van de klimaatverandering en de afnemende biodiversiteit, kan niet worden uitgegaan van de bestaande, vertrouwde beleidsconcepten. Deze pasten wel bij de zintuiglijk waarneembare milieuproblemen, zoals stank, geluidshinder of verontreinigd zwemwater. Maar bij de nieuwe problemen doen de effecten zich niet hier en nu voor, en is er daardoor nog geen gevoel van maatschappelijke urgentie. Immers, niemand merkt er nu nog wat van. Kennis over wat er mis kan gaan moet worden gemobiliseerd, en die kennis moet breed maatschappelijk worden gedeeld en gedragen. Het beleid moet dit zien te bereiken, omdat anders de milieubelangen op langere termijn het steeds zullen afleggen tegen andere belangen. Dit is de kern van het rapport. Het nationale milieubeleid staat meer dan voorheen voor de opgave om 'voor de fout uit te leren'. Dit vraagt om doordacht overheidshandelen voordat de nadelige effecten zich daadwerkelijk, voor het grote publiek zichtbaar, manifesteren. Deze opgave stelt hoge eisen aan de maatschappelijke legitimatie van milieubeleid, terwijl het gevoel van maatschappelijke urgentie van milieuproblemen steeds verder afneemt. Deze kwetsbaarheid in het huidige en komende milieubeleid wordt nog onvoldoende onderkend. Voor de vorming van nieuw milieubeleid zijn volgens de raad kennisontwikkeling, maatschappelijke inbedding van die kennis, en een goede schakeling tussen het nationale en internationale - vooral Europese - niveau van belang. Ten aanzien van het eerste punt dient de inbreng

  11. Plaagonderdrukkende landschappen vanuit het perspectief van natuurlijke vijanden

    NARCIS (Netherlands)

    Baveco, J.M.; Bianchi, F.J.J.A.

    2007-01-01

    De samenstelling en het beheer van het omringende landschap kunnen bijdragen aan de effectiviteit van natuurlijke vijanden in het reguleren van plagen in gewassen. Uit ons onderzoek blijkt een duidelijke relatie tussen groenblauwe dooradering van het landschap en de mate van plaagbeheersing in de

  12. Met zorg ondernemen: Bouwstenen voor succesvolle samenwerking tussen ondernemers en langdurige zorg

    NARCIS (Netherlands)

    Mogendorff, K.

    2007-01-01

    Het project Samenwerking tussen langdurige zorg en leidinggevenden (in het bedrijfsleven) wil relevante partijen inspireren en stimuleren om meer met elkaar te gaan samenwerken om zo doelstellingen als het vergroten van de maatschappelijke participatie van mensen met een langdurige zorgbehoefte te

  13. Het bepalen van het gehalte aan polychloorbifenylen in vetbiopten afkomstig uit menselijk weefsel

    NARCIS (Netherlands)

    Driessen, J.J.M.; Traag, W.A.; Tuinstra, L.G.M.Th.

    1982-01-01

    Inventariserend onderzoek naar het voorkomen, zowel kwalitatief als kwantitatief, van polychloorbifenylen in vetbiopten. De vetbiopten zijn genomen bij studenten van de vakgroep voeding van de Landbouwhogeschool te Wageningen. In het kader van een samenwerkingsverband tussen het RIKILT en de LH te

  14. Relatie tussen ITS, weerstand tegen vervorming en de mengsels samenstelling : Gebruik van de MEPDG relaties voor Nederlandse mengsels uit NL-LAB

    NARCIS (Netherlands)

    Erkens, Sandra; Kasbergen, C.; Villani, M.M.; Scarpas, Athanasios; Florio, E.; Berti, C.

    2014-01-01

    Sinds 2008 werken we in Nederland met functionele eigenschappen voor asfalt
    beton. Hierbij wordt niet zo zeer op het “recept” van het asfalt gestuurd, als
    wel op de eigenschappen ervan die van belang zijn voor het gedrag in de weg.
    Binnen het NL-LAB programma wordt de relatie tussen deze

  15. Samen onderwijs maken. Over het ontwerpen van adaptief onderwijs

    NARCIS (Netherlands)

    Terwel, J.

    1994-01-01

    In deze inaugurele rede staat het vraagstuk van de afstemming (adaptatie) van de leeromgeving op de leerlingen centraal. Bij afstemming gaat het altijd om een dynamische interactie tussen leerling en leeromgeving. In de eerste drie jaren van het voortgezet onderwijs, de basisvorming, worden

  16. Review of the National Reduction Plan for NMVOM [Non-Methane Volatile Organic Materials]. Sectors industry, energy, TSG [trade, services and government] and building; Terugblik op het Nationaal Reductieplan NMVOS [Niet-Methaan Vluchtige Organische Stoffen]. Industrie, energie, HDO [handel, diensten en overheid] en bouw

    Energy Technology Data Exchange (ETDEWEB)

    Locht, G.

    2012-09-15

    The title project aims to reduce emissions of Volatile Organic Compounds (VOC) from several sectors in the period 2000-2010. This report is a review of the project and is based on the definitive data over these years in the Dutch Pollutant Release and Transfer Register (PRTR). Compared to the start of the NRP-NMVOS, there are now less instruments for environmental policy. There are more general binding environmental rules and less environmental permits. Furthermore, several agreements between governments and branches have ended. May 2012 the Gothenburg protocol was revised. It shows a VOC emission reduction for the Netherlands of 8% in 2020 compared to 2005. It is expected this will be achieved by means of the current policy and legislation [Dutch] Het titel project is opgesteld om de VOS-emissies van deze sectoren tereduceren. Het NRP-NMVOS heeft betrekking op de jaren 2000 tot en met 2010. Dit rapport is een terugblik op het project en gaat uit van de medio 2012 beschikbare definitieve emissiegegevens over al deze jaren. In vergelijking met de start van het NRP-NMVOS zijn er minder milieubeleidsinstrumenten. Er zijn meer algemene milieuregels en minder vergunningen en diverse convenanten tussen overheden en bedrijfsleven zijn afgelopen. In het herziene Gothenburg protocol van mei 2012 is voor Nederland voor 2020 en verder een NMVOS reductie van 8% ten opzichte van het 2005 niveau afgesproken. Het ligt in de verwachting dat dit gehaald gaat worden bij voortzetting van het huidige beleid en instrumentatie.

  17. De wortels van de Randstad. Overheidsinvloed en stedelijke hiërarchie in het westen van Nederland tussen de 13de en 20ste eeuw

    Directory of Open Access Journals (Sweden)

    Nikki Brand

    2013-02-01

    Full Text Available The starting point of this study concerns the origins of the polycentric nature of contemporary cities in the western area of the Netherlands, commonly known as ‘the Randstad’. Within the disciplines of planning and urban design the Randstad is considered a textbook example of a polycentric urban hierarchy. Yet, although quite a popular topic, very little is actually known about the driving forces that have given shape to existing urban hierarchies throughout the world. Moreover, the Randstad has also been dubbed ‘Holland’s paradox’ because of its assumed reversed evolution from a primate city hierarchy focused on Amsterdam in early modern times, to a polycentric hierarchy in the 19th century. Why do urban hierarchies change over time and which factors were decisive for the rise of the polycentric Randstad? Expansion of Haarlem, Amsterdam, Leiden, Den Haag, Gouda, Utrecht, Delft, Rotterdam en Dordrecht. This map was produced as a part of the Mapping the Randstad Holland-project and was published before in Borger, G.J., et al. (2011. Twaalf eeuwen ruimtelijke transformatie in het westen van Nederland in zes kaartbeelden. Overholland, (10/11.This study consists of two parts and six chapters. Part I explores the determining factors of change within urban hierarchies. The first chapter gives an assessment of the usefulness of existing theory and ends in confusion: firstly, historiography turns out to be a medley of explanations that are heterogeneous and sometimes even contradictive. Secondly, comparisons of the long-term development of multiple towns are lacking, which makes it difficult to come up with a theoretical approach. In order to make such comparisons and ascertain the impact of certain factors on urban hierarchies over time, it’s necessary to look at the development of a group of towns over a long time-span. Therefore, in the second chapter, simple statistics are compared with existing theory and literature. To do so

  18. Lezen boven AVI-niveau kan prima : leesvaardigheid ontwikkelen

    NARCIS (Netherlands)

    Boendermaker, Conny; Blok, Henk; Oostdam, Ron

    2013-01-01

    Hoe zorg je ervoor dat kinderen met enthousiasme lezen? Is het belangrijk dat ze lezen op hun eigen API-niveau of is hun persoonlijke voorkeur belangrijker? Dit artikel laat zien dat leerlingen vooral boeken moeten kunnen kiezen die hen interesseren.

  19. De waarde van studentensport : onderzoek naar de relatie tussen USC lidmaatschap en studieprestaties van bachelorstudenten in Amsterdam, Utrecht, Wageningen en Nijmegen

    NARCIS (Netherlands)

    Dekkers, Vera; Deutekom, Marije

    Er bestaan significante verschillen tussen het aantal behaalde studiepunten van niet-leden en leden van een Universitair Sportcentrum (USC). Dat blijkt uit onderzoek van het lectoraat “Kracht van Sport” van de Hogeschool van Amsterdam (HvA) en Hogeschool Inholland. Het onderzoek laat zien dat leden

  20. De prijsvorming van hout uit het Nederlandse bos

    NARCIS (Netherlands)

    Slangen, L.H.G.

    1984-01-01

    De prijsvorming van hout op stam en hout geveld uit het Nederlandse bos op het niveau van het bosbedrijf staat centraal in deze publikatie. Na een schets van een aantal facetten die invloed hebben op de prijsvorming wordt nader ingegaan op de prijsvorming zelf. Onderzocht wordt of er verschil in

  1. Die verband tussen werknemertevredenheid en organisasieverbondenheid

    Directory of Open Access Journals (Sweden)

    A. A. S. Pretorius

    2004-10-01

    Full Text Available The relationship between employee satisfaction and organisational commitment. The primary goal of the study is to determine whether a relationship exists between employee satisfaction and organisational commitment. A secondary goal is to determine whether any biographical variables mediate this relationship. Standardised instruments were used for operationalising these two contructs. A sample of convenience yielded 167 respondents out of a sampling frame of 300 employees from a financial organisation. Only 145 respondents returned fully completed questionnaires that were used for final analysis. Responses from both questionnaires were subjected to a factor and item analysis. A statistically significant relation between employee satisfaction and organisational commitment was found. The implications of the findings are discussed further. Opsomming Die primêre doel van die studie is om vas te stel of daar ’n verband bestaan tussen werknemertevredenheid en organisasieverbondenheid. ’n Sekondêre oogmerk is om te bepaal of enige biografiese veranderlikes hierdie verband medieer. Gestandaardiseerde instrumente is gebruik om hierdie twee konstrukte te operasionaliseer. ’n Gerieflikheidsteekproef het 167 respondente uit ’n steekproefraamwerk van 300 werknemers van ’n finansiële instelling opgelewer. Slegs 145 respondente het volledig voltooide vraelyste terugbesorg, wat vir finale ontleding gebruik is. Response op albei vraelyste is aan ’n faktor- en itemontleding onderwerp. ’n Statisties-beduidende verband tussen werknemertevredenheid en organisasieverbondenheid is gevind. Die implikasies van die bevindinge word verder bespreek.

  2. Het Fries als voorbeeldige taal - in alle stadia

    NARCIS (Netherlands)

    Versloot, A.P.

    2008-01-01

    ‘In ons Morfo-project proberen we de structuur van de Friese woordenschat bloot te leggen. We verbinden taalelementen die van dezelfde stam zijn afgeleid met elkaar: binnen én tussen de taalstadia. Een voorbeeld is het woord hûs, "huis". Dat zit in het woord útfanhûzje, "logeren", net zo goed als in

  3. Het perspectief van de vooruitgang : denken over politiek in het Spaanse fin de siècle, 1890-1914

    NARCIS (Netherlands)

    Storm, Hendrik Jan

    1999-01-01

    Anders dan veelal gedacht wordt, valt de intellectuele crisis waarin Spanje rond 1900 in terecht kwam niet te wijten aan de desastreus verlopen oorlog tegen de Verenigde Staten in 1898. Het politieke debat in Spanje tussen 1890 en 1914 was in de eerste plaats een reactie op de crisis van het

  4. Het beste van beide werelden: Succesfactoren van Turks-Nederlandse innovatieve ondernemers

    Directory of Open Access Journals (Sweden)

    Gürkan Çelik

    2013-09-01

    Full Text Available The Best of Both Worlds: Success factors of Turkish-Dutch innovative entrepreneurs In recent years, a number of countries, among them the Netherlands, attach great importance to stimulating the economic development in the country, by promoting entrepreneurship in general and within the ethnic and cultural entrepreneurial groups in particular. Innovation is generally the result of an interactive process involving synergy between the diverse backgrounds and characteristics. Based on a qualitative research, this article provides an overview of insights in the critical success factors of Turkish-Dutch innovative entrepreneurs in the Netherlands. The success factors of ethnic entrepreneurs are approached in this study from three different dimensions: individual factors, social factors, and environmental factors. The individual factors are presented as personality traits and personal motivations. The social factors are discussed from the perspective of social networks, socio-cultural and socio-economic characteristics. As for environmental factors, they are divided into regional characteristics as well as the availability of resources and the presence of opportunities. Turkish-Dutch entrepreneurs, also called “ethnic entrepreneurs”, appear proficient in linking different innovation opportunities to their own strengths. They are operating better in both worlds, and are successfully navigating between the two cultures. This article also formulates several suggestions for the Dutch government, business world and educational institutions to stimulate innovation. Het beste van beide werelden: Succesfactoren van Turks-Nederlandse innovatieve ondernemers De laatste jaren hechten vele landen, onder andere Nederland, er groot belang aan om de economische ontwikkelingen op een hoger niveau te tillen door ondernemerschap in het algemeen, en binnen de etnische en culturele groepen in het bijzonder, te stimuleren. Innovatie is een gevolg van een interactief

  5. Voor het verval. Belemmeringen en voorwaarden voor vroegsignalering en bewonersparticipatie

    Directory of Open Access Journals (Sweden)

    Vasco Lub

    2009-12-01

    Dit artikel onderzoekt de mogelijkheden van preventieve strategieën in het aanpakken van wijkverval en sociale onveiligheid. Gebaseerd op het vermoeden dat het broken windows-beleid doeltreffend kan zijn bij de aanpak van wijkverval, is een brochure met een lijst van 34 sociale en fysieke indicatoren ontwikkeld om bewoners en professionals te helpen bij het signaleren en aanpakken van tekens van verval. Door middel van een actieonderzoek in een aandachtswijk werd de bruikbaarheid van deze indicatoren onderzocht en werd in kaart gebracht welke factoren preventieve strategieën kunnen belemmeren, dan wel kunnen bevorderen. Het onderzoek toont aan dat verscheidene contextuele, bestuurlijke en bureaucratische factoren een belemmering vormen voor een effectieve preventieve aanpak. Daarbij kan onder andere gedacht worden aan: verschillen in verwachtingspatroon tussen bewoners en professionals; de manier waarop tekens van verval in de leefomgeving worden geïnterpreteerd door lokale actoren; de middelen waarmee frontliniewerkers in hun taakuitvoering worden toegerust; en het gebrek aan een verantwoordingswijze die gebaseerd is op het behalen van zichtbare resultaten. Voor het goed functioneren van een vroegtijdige aanpak van wijkverval, is het van groot belang dat lokale overheden een gemeenschappelijk perspectief ontwikkelen, de samenwerking tussen bewoners en professionals – en tussen professionals onderling – faciliteren, instanties aanspreken op resultaten en doelstellingen expliciteren om van overleg tot collectieve actie te komen.

  6. Schatgraven in 'de mijnen van het Oosten'. Europa's eerste tijdschrift voor oriëntaalse studies

    Directory of Open Access Journals (Sweden)

    Peter Rietbergen

    1999-06-01

    Full Text Available Tussen 1809 en 1818 verscheen Fundgruben des Orients. Dit eerste Europese tijdschrift voor oriëntaalse studies was een spreekbuis voor liefhebbers van de cultuur van het Oosten. De redactie wilde de nadruk leggen op het Nabije Oosten. De groeiende koloniale invloed van Engeland in Azië, met name in India, weerspiegelde zich echter ook in de kolommen van het tijdschrift. Een politiek gevoelig artikel maakte waarschijnlijk een einde aan het blad.

  7. Antibioticumresistentie in Escherichia coli O 157 geisoleerd tussen 1998 en 2003 in Nederland = Antibiotic resistance in Escherichia coli O157 isolated between 1998 and 2003 in The Netherlands

    NARCIS (Netherlands)

    Roest, H.I.J.; Liebana, E.; Wannet, W.; Duynhoven, van Y.; Veldman, K.T.; Mevius, D.J.

    2007-01-01

    Nederlands: Over het vóórkomen van antibioticumresistentie bij E. coli O157 in Nederland is weinig bekend. In deze studie werden tussen 1998 en 2003 218 humane en 247 niethumane isolaten onderzocht op antibioticumgevoeligheid. Het antibioticumresistentieniveau van E. coli O157 geïsoleerd uit de

  8. Het Melkveemodel

    NARCIS (Netherlands)

    Mandersloot, F.; Meulen, van der M.A.

    1991-01-01

    Voor het nabootsen van de opbouw van een veestapel is bij het PR het melkveemodel ontwikkeld. Met dit model is het mogelijk om een veestapel samen te stellen waarbij rekening wordt gehouden met verschillen in leeftijd en kalfdatum en met uitstoot van dieren tijdens de lactatie. Het model geeft aan

  9. Talent herkend! Een profielschets van sportofficials op internationaal/nationaal en regionaal niveau

    NARCIS (Netherlands)

    Sebastiaan Platvoet; Ben Halle

    2009-01-01

    In dit onderzoek wordt de aandacht gericht op talentherkenning bij sportofficials. Het doel van deze studie is vast te stellen welke talenten / kenmerken officials bezitten die actief zijn op internationaal / nationaal niveau en welke gemeenschappelijke kenmerken officials bezitten die actief zijn

  10. Think Global, Act Local: Maasvlakte II en het Mainportconcept (1993-2008)

    NARCIS (Netherlands)

    D.M. Koppenol (Dirk)

    2014-01-01

    markdownabstract__Abstract__ Tussen 1993 en 2008 vond het besluitvormingsproces plaats van een havenuitbreiding van de grootste haven ter wereld, Rotterdam.2 Dit project, Maasvlakte II, dat de haven met 20 procent moest vergroten, vond zijn basis in het mainport-model. Een model dat in Nederland

  11. P rof. D r . J. H. K roeze, Paraphrase van het boek Hooglied. Franeker,

    African Journals Online (AJOL)

    Test

    twyfeld word „het onderwerp van het Hooglied in Oud en Nieuw. Testament gebezigd als beeld van Christus en Zijn gemeente" (bl. 30), ja, die onderwerp van die Hooglied, nl. die liefde tussen man en vrou, maar nie die nadere inhoud van die Hooglied nie en geen enkele van sy tiperende vorme of beelde of toneeltjies nie.

  12. Vitamine C, bijnier en adaptatie : enige onderzoekingwn over de invloed van vitamine C op het leverglycogeengehalte van een koude blootgestelde normale en bijnierloze nier

    NARCIS (Netherlands)

    Wied, David de

    1952-01-01

    Allereerst werd een overzicht gegeven van de bestaande literatuur betreffende de relatie tussen vitanine C en de bijnierschors. Het doel van ons onderzoek was, na te gaan, of vitamine C van belang is bij de reactie van het lichaam op een schadelijke prikkel en, meer in het bijzonder, in hoeverre

  13. Drift bij een experimentele mastspuit in de hoge laanbomenteelt : effect van sensoren voor detectie van boomkroon en gaten tussen bomen

    NARCIS (Netherlands)

    Stallinga, H.; Nieuwenhuizen, A.T.; Lans, van der A.M.; Velde, van P.; Zande, van de J.C.

    2013-01-01

    Bij bespuitingen van laanbomen met gewasbeschermingsmiddelen is het vaak moeilijk om de top van de bomen te bereiken. Vooral wanneer de bomen geplant zijn met weinig ruimte in en tussen de rijen. Vaak worden axiaalspuiten gebruikt met een hoge capaciteit luchtondersteuning om zo hoog mogelijk een

  14. CQ-index Reumatoïde Artritis: onderzoek naar het discriminerend vermogen: kwaliteit van reumazorg vanuit het perspectief van patiënten met reumatoïde artritis.

    NARCIS (Netherlands)

    Koopman, L.; Rademakers, J.J.D.J.M.

    2008-01-01

    Patiënten vinden de kwaliteit van de reumazorg goed en de verschillen in ervaren kwaliteit tussen ziekenhuizen zijn klein, zo blijkt uit onderzoek naar het discriminerend vermogen van de CQ-index Reumatoïde artritis. De CQ-index Reumatoïde Artritis biedt een goede basis voor het meten van de

  15. Betekenis van macro-economische ontwikkelingen voor natuur en landschap : een eerste oriëntatie van het veld

    NARCIS (Netherlands)

    Woltjer, G.B.; Jongeneel, R.A.; Groot, de H.L.F.

    2007-01-01

    Vanuit een theoretisch perspectief wordt de relatie geanalyseerd tussen macro-economie en natuur- en landschaps-ontwikkeling. Het is een poging te komen tot een juiste invalshoek: een denkoefening vanuit economisch-theoretisch perspectief. Allereerst wordt het probleem in verband gebracht met de

  16. Energy conservation in the Netherlands 1995-2006. Update on the basis of the Protocol Monitoring Energy Conservation; Energiebesparing in Nederland 1995-2006. Update op basis van het Protocol Monitoring Energiebesparing

    Energy Technology Data Exchange (ETDEWEB)

    Boonekamp, P.G.M.; Gerdes, J. [ECN Beleidsstudies, Petten (Netherlands); Vreuls, H.H.J. [SenterNovem, Utrecht (Netherlands); Verdonk, M. [Planbureau voor de Leefomgeving PBL, Bilthoven (Netherlands); Pouwels, H. [Centraal bureau voor de Statistiek CBS, Voorburg/Heerlen (Netherlands)

    2008-07-15

    Results are presented of realized energy savings in the Netherlands for the period 1995-2006 for the sectors households, industry, agriculture, services, transport, refineries and electricity, and for the national level. The figures on energy savings are based on the 'Protocol Monitoring Energy Savings', a common methodology and database to calculate the amount of energy savings. A description of the methodology used can be found elsewhere. Results are presented for savings on final energy use, conversion in end-use sectors (co-generation) and conversion in the energy sector. National savings for the period 1995-2006 equal 0.9% per year on average, with a decreasing tendency in recent years. For end-use sectors the highest figure is found for agriculture (2.1%) and the lowest figure for transport (0.4%). An uncertainty analysis reveals that the margin for the national savings figure is {+-} 0.3 percent-point. [Dutch] In dit rapport worden de energiebesparingcijfers gepresenteerd voor de periode 1995-2006, berekend volgens het Protocol Monitoring Energiebesparing (PME). De besparing wordt berekend voor de verbruiksectoren industrie, huishoudens, transport, land- en tuinbouw, diensten en raffinaderijen, de elektriciteitscentrales en het nationale niveau. De nationale besparing in de periode 1995-2006 bedroeg gemiddeld ruim 0,9% per jaar. Als er vanaf 1995 niet zou zijn bespaard, dan zou het energiegebruik in 2006 ongeveer 11% hoger zijn geweest. Per sector varieert de besparing tussen 0,4% voor Transport en 2,1% voor de Land- en tuinbouw (inclusief 0,4% door warmte/kracht). In de figuur wordt het verloop van de gemiddelde jaarlijkse besparing vanaf 1995 gegeven. De nationale besparing blijkt na 2000 geleidelijk af te nemen. Hetzelfde geldt voor de Industrie en, met fluctuaties, Huishoudens en Transport. De besparing door warmte/kracht-productie bij verbruikers is ook afgenomen na 2000. Hetzelfde geldt voor besparing bij centrales, hoewel hier in 2006 een

  17. Optimale taakverdeling tussen bouwer en ontwikkelaar

    NARCIS (Netherlands)

    Dieren, van T.; Makkinga, E.; Voordijk, J.T.; Reymen, I.M.M.J.

    2006-01-01

    Het bouwbedrijf wint terrein in het bouwproces. Momenteel is een ontwikkeling gaande waarbij het bouwbedrijf in toenemende mate verantwoordelijkheden krijgt toebedeeld die voorheen tot het domein van de projectontwikkelaar behoorden. Projectontwikkelaars geven bouwers steeds meer ruimte voor de

  18. Interdisciplinair samenwerken in het onderwijs

    Directory of Open Access Journals (Sweden)

    Friedje Swart

    2009-09-01

    Full Text Available Several disciplines form alliances in primary schools and secondary schools to guide pupils with complex and multifaceted learning and behavioural problems. The functioning of these alliances is discussed in this article. The author presents the results of a qualitative study into the organisation of the alliances at three schools. Based on literature study, interviews, observations and document analyses, the author describes how professionals try to agree during consultation and how they learn from each other. She concludes with recommendations for effective co-operation when pupils need care. These recommendations refer to a clear structure of the alliance, attention for informal processes and professionals who account for their actions by expressing their knowing-in-practice. In basis- en voortgezet onderwijs werken verschillende disciplines samen in de zorg aan leerlingen met complexe gedragsproblemen. In dit artikel wordt verslag gedaan van een kwalitatief onderzoek naar deze samenwerkingsverbanden. In het onderzoek, dat plaatsvond op drie scholen, is gebruik gemaakt van literatuurstudie, interviews, observaties en documentanalyse. De resultaten worden in dit artikel besproken en hebben betrekking op de organisatie van het samenwerkingsverband, op de inhoudelijke afstemming tussen professionals tijdens overlegsituaties en op het leren van elkaar. De auteur sluit af met een aantal aanbevelingen voor effectieve samenwerking rondom zorgleerlingen. Deze aanbevelingen gaan over een heldere structuur van het samenwerkingsverband, aandacht voor informele processen en professionals die hun handelen verantwoorden door hun ervaringskennis expliciet te maken.

  19. Professionalisering van het FTO in Noord-Holland Noord: evaluatie van een pilot.

    NARCIS (Netherlands)

    Jansen, J.; Dijk, L. van; Wagner, C.; Bakker, D. de

    2004-01-01

    Voor een succesvol Farmaco Therapie Overleg (FTO) zijn een goede voorbereiding, een strenge voorzitter, een duidelijk afgebakend onderwerp en heldere afspraken nodig. Daarmee is het mogelijk het functioneren van zo'n overleg naar een (nog) hoger niveau te tillen. Dit blijkt uit een

  20. Effecten van het verzuringsbeleid in de provincie Limburg; evaluatie en prognose voor de realisatie van de gewenste natuurkwaliteit

    NARCIS (Netherlands)

    Smits, N.A.C.; Bleeker, A.; Huiskes, H.P.J.

    2004-01-01

    Effecten van verzurende depositie op de natuur. Alterra en MEP TNO hebben gekeken naar huidige en toekomstige effecten, zowel op provinciaal niveau als voor een 16 tal natuurgebieden. Vervolgens is het verzuringsbeleid geëvalueerd

  1. Gym tussen wens en werkelijkheid

    NARCIS (Netherlands)

    dr. Lars B. Borghouts

    2009-01-01

    Wat wensen wij te bereiken met de Lichamelijke Opvoeding, en welke effecten bereiken wij daad- werkelijk? Om duidelijk te maken aan politici, beleidsmakers en schooldirecties waarom het bewegingsonderwijs een belangrijke plaats ver- dient in het onderwijs, moet je dit scherp kunnen neerzetten. Een

  2. Stikstofdeling bij snijmais : verslag van onderzoek op ROC's De Waag, Heino, Cranendonck en De Vlierd tussen 1985 en 1988 (project 96-2-19)

    NARCIS (Netherlands)

    Schroeder, J.

    1990-01-01

    Tussen 1985 en 1988 is in een negental veldproeven nagegaan welke invloed gedeelde N-giften hebben op de opbrengst van snijmais en op de N-huishouding van bodem en gewas. Hierbij is ook nagegaan of bepalingen van het N-gehalte in de bodem of gewas een handvat bieden bij bemestingsbeslissingen

  3. De dans van de taal in het sociaal werk

    Directory of Open Access Journals (Sweden)

    Hilde Vlaeminck

    2010-12-01

    Taal is een erg belangrijke kwestie in elke wetenschap. Het maakt de transfer en de circulatie van kennis mogelijk, wat noodzakelijk is voor een permanente evolutie en groei van een professie. In het sociaal werk lijkt taal te vaak gereduceerd tot de directe interactie tussen een sociaal werker en een cliënt. Maar dit is slechts het halve verhaal. Dit artikel argumenteert waarom taal meer wetenschappelijke aandacht verdient, vooral in het verbindende domein tussen praktijkreflectie en theorie in het sociaal werk. Meer dan honderd jaar na de publicatie van Mary Richmonds boek Friendly visiting among the poor (in 1899! is de vraag vooral of en in welk opzicht taal wijzigde. Werden er slechts enkel nieuwe woorden ingevoerd of wijzigde ook de inhoud en de onderliggende visie? Tegenwoordig beschikken sociaal werkers over meerdere taalkanalen: de gesproken taal, de geschreven taal, de telefoontaal, de virtuele taal. Vooral die laatste ontwikkeling opent taalkundig nieuwe registers. Dit artikel gaat na waarom sociaal werkers en onderzoekers linguïstische veranderingen moeten bestuderen en meer zorg dragen voor hun linguïstisch kapitaal. Taal danst doorheen de geschiedenis van het vak in meerdere opzichten. Maar sociaal werkers benutten de hele dansvloer nog niet.

  4. De effectiviteit van huidbescherimgsmiddelen bij het werken met bestrijdingsmiddelen in de glastuinbouw [Effectiveness of personal protective equipment for skin protection while working with pesticides in greenhouses

    NARCIS (Netherlands)

    Hemmen, J.J. van; Brouwer, D.H.; Havenith, G.; Kaaijk, J.; Brouwers, A.A.F.

    1994-01-01

    In veel gevallen is het gebruik van semi-permeabele kleding en nitrilrubber handschoenen handschoenen een goede compromis tussen bescherming en comfort bij het toepassen van bestrijdingsmiddelen in de glastuinbouw. In de land- en tuinbouw worden diverse bestrijdingsmiddelen gebruikt die de

  5. Comfort-box controls individual level of comfort. Domotica home network for indoor climate management; Comfort-box regelt individueel comfort-niveau. Domotica-huisnetwerk voor beheer binnenklimaat

    Energy Technology Data Exchange (ETDEWEB)

    Kamphuis, I.G; Warmer, C.J.; Bakker, E.J. [ECN Duurzame Energie in de Gebouwde Omgeving DEGO, Petten (Netherlands)

    2005-03-01

    The Comfort-Box (or C-Box) project is an automatic and continuous control system for energy efficient and cost-effective thermal comfort in houses. In this article detailed information is given of the design and performance of the C-Box. [Dutch] De huidige regelsystemen voor het binnenklimaat in woningen zijn voor verbetering vatbaar. Met het Comfort-boxconcept is een regeling ontwikkeld die automatisch en continu het individuele comfortniveau regelt in woningen, waarbij afwegingen worden gemaakt tussen kosten en comfort. De Comfort-box blijkt in staat te zijn het binnencomfort op energie- en kostenefficiente wijze te beheren.

  6. De zin van het economische opnieuw beschouwd

    Directory of Open Access Journals (Sweden)

    T. P. van der Kooy

    1964-03-01

    Full Text Available In 1950 heb ik het hoogleraarschap in de economie aan de juridische faculteit der Vrije Universiteit te Amsterdam aanvaard m et een rede over de zin van het economische. Sinds- dien heeft dit centiaal m elhodologisch vraagstuk van de we- tenschap der economie mij ook verder bezig gehouden. Het is voor een economist een m oeilijk vraagstuk, om dat het tevens een wijsgerig vraagstuk is. Over het algemeen vindt de econo­ m ist daarover weinig in de filosofische liLeratuur. Dit is zeer begrijpelijk, w ant wijsgeren kunnen op zijn best m aar heel sum m ier kennis nem en van wat er in de vakw etenschappen omgaat, terw ijl zij, voor zover mij bekend, in den regel slechts weinig belangstelling voor de economie aan den dag leggen. Omgekeerd zijn econom islen m eestal niet bijzonder filosofisch aangelegd, en hebben zij de handen vol om de storm achtige ontwikkeling van liun eigen literatuur enigzins bij te houden afgezien nog van het l'eit dat zij in den regel vele praktischc beslom m eringen hebben, ten gevolge waarvan zij zich niet ongestoord aan de studie kunnen wijden. Van een behoorlijk sam enspel tussen filosolen en economislen komt over het ge- heel ook niet veel terecht. Wat de wijsgerige kant van m ijn overpeizingen betreft, ben ik dus door de nood gedwongen slechts am ateur. Ik kom daar gaarne voor uit, en ik ben steeds bereid te zwichten voor het beter oordeel der wijsgeren, m its ik dat kan vatten, en in m ijn eigen w erk daar iets mee uit kan richten. Men behoeft nog geen door de wol geverfd prag­ m atist of operationalist te zijn om te weten dat ieder werk zijn eigen eisen stelt.

  7. Organisatiecultuur en performance management : pas op voor het Pavlov-effect

    NARCIS (Netherlands)

    Nieboer, Stephanie

    Dit artikel bespreekt de relatie tussen organisatiecultuur en performance management. De auteurs stellen dat gedrag niet op zichzelf staat, maar wordt gevormd door onderliggende waarden en overtuigingen. Om performance management in de praktijk succesvol te laten zijn, moet het worden opgenomen in

  8. Geloof in eigen kunnen: het effect van JOBS, een groepsinterventie voor werklozen

    NARCIS (Netherlands)

    Brenninkmeijer, V.; Houwelingen, A. van; Blonk, R.; Yperen, M. van

    2006-01-01

    In dit onderzoek staat de JOBS-training centraal. Dit betreft een groepstraining gericht op de reïntegratie van werklozen (Vinokur, Van Ryn, Gramlich & Price, 1991) door middel van het verhogen van de zelfeffectiviteit van de deelnemers. Eerst is er een theoretische vergelijking gemaakt tussen de

  9. McGregor-Mayweather: het gevecht dat alle mediarecords zal verbreken

    NARCIS (Netherlands)

    René Foolen

    De roddel domineert al maandenlang het nieuws en de echte vechtsportliefhebbers raken er maar niet over uitgesproken: een gevecht tussen MMA-vechter Conor McGregor en bokser Floyd Mayweather. Totaal ondenkbaar, want twee verschillende gevechtsdisciplines, maar tegelijkertijd ook heel logisch. Want

  10. Het meten van spontane en uitgelokte confabulaties: De Nijmegen-Venray Confabulatie Lijst-20 (NVCL-20)

    NARCIS (Netherlands)

    Rensen, Y.C.M.; Oosterman, J.M.; Eling, P.A.T.M.; Wester, A.J.; Kessels, R.P.C.

    2016-01-01

    Confabuleren kan voorkomen na hersenletsel, bijvoorbeeld bij patiënten met frontale laesies of patiënten met het korsakovsyndroom (KS). Vaak wordt er een onderscheid gemaakt tussen twee vormen van confabulatiegedrag: uitgelokt en spontaan. Op dit moment bestaan er alleen instrumenten die uitgelokte

  11. Het aanvullen van een leemte in de overeenkomst naar Nederlands en Engels recht

    NARCIS (Netherlands)

    Hendrikx, A.M.M.; Boom, van W.H.; Breedveld-de, Voogd C.G.; Castermans, A.G.; De, Deugd-Dijkman M.D.R.M.; Hijma, J.

    2016-01-01

    In deze bijdrage wordt stilgestaan bij de rol van de redelijkheid en billijkheid bij de aanvulling van een leemte in een overeenkomst naar Nederlands recht en de aanvullende werking van implied terms in het Engelse recht, waarbij ook gekeken zal worden naar de verschillen tussen beide

  12. Die verband tussen werknemerstatus en werkhoudings in 'n winkelgroep

    Directory of Open Access Journals (Sweden)

    F. G. Prinsloo

    1998-06-01

    Full Text Available The relation between employment status and work attitudes in a retail group. Employment status refers to the type of employment contract that may be concluded between an employer and an employee. It rests upon a continuum, varying from a permanent full-time appointment to a temporary appointment for a certain task or period. More and more organisations maintain a smaller core group of permanent full-time employees, which is supplemented by temporary or part-time employees. In this research the job satisfaction of full-time and part-time workers in a retail group is compared. The part-time group differed significantly from the full-time group regarding one facet of job satisfaction namely a lower level of satisfaction with supervision. Opsomming Werknemerstatus het betrekking op die tipe dienskontrak wat tussen 'n werkgewer en werknemer gesluit word. Dit berus op 'n kontinuum wat wissel vanaf 'n permanent-voltvdse aanstelling tot 'n tvdelike aanstelling vir 'n bepaalde taak of tydperk. Meer en meer organisasies handhaaf 'n kleiner kemgroep van permanent-voltydse werknemers/ wat aangevul word met tydelike of deeltydse werknemers. In hierdie navorsing word die werktevredenheid van voltydse en deeltydse werknemers in 'n winkelgroep vergelvk. Die deeltydse groep het beduidend van die voltydse groep verskil ten opsigte van een faset van werktevredenheid, naamlik 'n laer vlak van tevredenheid met toesighouding.

  13. Die verband tussen die sielkundige kontrak en organisasieverbondenheid

    Directory of Open Access Journals (Sweden)

    K. J. Stanz

    1999-06-01

    Full Text Available The relationship between the psychological contract and organisational commitment. The aim of this study is to design a measuring instrument with acceptable metric characteristics for the strength of the psychological contract within the South African context, and to determine empirically the relation between the strength of the psychological contract and organisational commitment. The Dhammanungune Model served as foundation for the design of the Strength of the Psychological Contract Questionnaire which consists of two scales namely, a needs expectation scale and a needs fulfilment expectation scale. The items of each scale have been formulated in the manner that ensures that the respondent reacts consecutively to two instructions namely, (a the level of the expectation and (b the importance of the expectation. This questionnaire was administered together with the Organisational Commitment Questionnaire to two population groups within the military environment. The Pearson Product Moment Correlation was calculated between the strength of the psychological contract and organisational commitment and the significance of the correlations was evaluated. Opsomming Die doel van die studie is om 'n meetinstrument met aanvaarbare metriese eienskappe vir die sterkte van die sielkundige kontrak vir Suid-Afrikaanse omstandighede te ontwerp en om empirics die verband tussen die sterkte van die sielkundige kontrak en organisasieverbondenheid te bepaal. Die sterkte van die sielkundige kontrak vraelys is op grond van die Dhammanungune-model ontwerp en het uit twee skale naamlik, die behoefteverwagting- en vervullingsverwagtingskale bestaan. Items vir eike skaal is sodanig geformuleer dat die respondent agteropeenvolgens op twee instruksies naamlik (a die vlak van die verwagting en (b die belangrikheid van die verwagting moet reageer. Die vraelys is saam met die organisasieverbondenheidsvraelys op twee populasies uit 'n militere omgewing toegepas. Die Pearson

  14. Onderskeiding tussen beroepsrealistiese en -onrealistiese adolessente met behulp van die waardeskaal

    Directory of Open Access Journals (Sweden)

    R. E. Zeier

    1995-06-01

    Full Text Available Differentiation between vocational realistic and unrealistic adolescents by means of a value scale. The usefulness of the Value Scale for distinguishing between adolescents with realistic or unrealistic approaches towards vocational choice was studied. A group of std. 10 pupils from a specific secondary school in the Cape Peninsula participated in the study. An evaluation with regard to the degree of realism of vocational decisions was made by three counselling psychologists. Classification of subjects was based on the agreement between their vocational choice, interest profiles, academic performance, intelligence test scores and course prerequisites. A number of variables were identified by discriminant analysis which distinguished significantly between realistic and unrealistic approaches. Value-preferences for realistic adolescents were more homogeneous and were globally interpreted as an intrinsic value pattern while subjects with unrealistic approaches showed a more differentiated pattern. Opsomming Die bruikbaarheid van die Waardeskaal vir die onderskeiding tussen beroepsrealistiese en beroepsonrealistiese adolessente is ondersoek deur 'n groep st. 10-leerlinge uit 'n spesifieke hoerskool in die Kaapse Skiereiland by die ondersoek te betrek. 'n Evaluering met betrekking tot realisme van verklaarde loopbaankeuse is deur drie voorligtingsielkundiges gemaak op grond van ooreenstemming tussen verklaarde beroepskeuse, belangstellings, akademiese prestasie, verstandstoetstellings en kursusvoorvereistes. Beduidende verskille met betrekking tot werkwaardes is tussen die groepe met behulp van diskriminant-analise gei'dentifiseer. Die waardevoorkeure van die beroepsrealistiese groep was meer homogeen van aard en kon globaal as intrinsieke waardevoorkeure beskryf word, terwyl die beroepsonrealistiese groep meer gedifferensieerde waardevoorkeurpatrone geopenbaar het.

  15. Tussen de mazen van het net : drie Poolse mannen in Den Haag aan het woord

    NARCIS (Netherlands)

    Karijn Nijhoff

    In deze publicatie staan de verhalen van drie Poolse mannen in Den Haag centraal. De onderzoeker, Karijn Nijhoff, heeft zeer intensief deze mannen gevolgd en hun verhalen opgetekend. We lezen over aankomst, vertrek en terugkomst. We zien een grillig proces van werken en niet werken, klussen en

  16. Ernstige bezwaren tegen het onderzoek naar het verband tussen wiegendood en kinderopvang

    NARCIS (Netherlands)

    Brand, P. L. P.; Offringa, M.

    2008-01-01

    A recent case-control study suggests that the risk of sudden infant death syndrome (SIDS) is strongly increased in children attending day care. There are several methodological concerns regarding this study. Problems with the selection of both cases and controls may have inflated the observed odds

  17. Quickscan of substances for which the set reduction of emissions has not been realised; Quickscan van stoffen met niet gerealiseerde emissiereducties uit het Doelgroepbeleid Milieu en Industrie

    Energy Technology Data Exchange (ETDEWEB)

    Bakker, J.

    2011-11-15

    In a Quickscan study the RIVM has examined how much the Dutch industry contributes to the release of 14 substances to air or water. Furthermore the RIVM has investigated to what extent the measured concentrations of these substances in the environment exceed the environmental quality standards in the Netherlands. The Quickscan was requested because the government and industry sectors had agreed by contract to reduce the release of priority substances to air and water in 2010. The industry sectors have not yet been able to achieve the agreed reduction levels for the 14 substances. Four out of the fourteen substances do not meet the maximum permissible concentration level or the limit value for air quality on the regional or national level. It concerns fine particulate matter (PM10), nitrogen oxides, polycyclic aromatic compounds and copper. The Dutch industry contributes approximately about 20 percent to the national emission to air of fine particulate matter as well as polycyclic aromatic compounds. For both nitrogen oxides (air) and copper (water) the share in the national emission is less than ten percent. For four substances, namely sulphur dioxide, arsenic, benzene and carbon monoxide, the target value is exceeded. The other six substances do not cause difficulties in terms of air or water because they hardly exceed the environmental quality standards, if at all [Dutch] Het RIVM heeft in een Quickscan onderzocht wat de Nederlandse industrie bijdraagt aan de emissie van 14 stoffen naar lucht of water. Daarnaast is onderzocht in welke mate de gemeten concentraties van deze stoffen in het milieu de geldende milieukwaliteitsnormen overschrijden. De Quickscan is uitgevoerd omdat tussen de overheid en bedrijfstakken in het Doelgroepbeleid Milieu en Industrie (DMI) afspraken zijn gemaakt om de uitstoot van stoffen naar zowel lucht als water in 2010 te verminderen. De bedrijfstakken zijn er voor de 14 onderzochte stoffen nog niet in zijn geslaagd de gestelde reductie

  18. Die verband tussen waargenome leierskap en die vlak van outonomie binne spanverband

    Directory of Open Access Journals (Sweden)

    A. Van der Heyde

    2003-10-01

    Full Text Available The relationship between perceived leadership and the level of outonomy in a team context remains a contemporary theme in the work environment and seemingly has a substantial influence on organisational success. This study attempted to ascertain the relationship between leadership and the level of outonomy in a team context. Two hundred and thirty (N=230 individuals, grouped into 56 teams from four South African companies participated in the study. The superordinate’s leadership style as well as the level of outonomy in the specific group was measured. Apart from the useful information obtained in comparison with international research, especially in terms of leadership data, the study did conclusively point out a significant correlation between leadership style and autonomy in team context. Opsomming Leierskap en selfgerigte spanfunksionering bly kontemporêre temas in die bedryfsmilieu, wat oënskynlik organisasiesukses wesenlik kan beïnvloed. Die doel van hierdie studie was om die waargenome verband tussen leierskap en die vlak van outonomie binne spanverband te bepaal. Tweehondered-en-dertig (N=230 individue, gegroepeer in 56 spanne vanuit vier Suid-Afrikaanse maatksappye het aan die studie deelgeneem. ‘n Meting van sowel die bogeskikte se leierskapstyl en die vlak van outonomie binne spanverband is verkry. Afgesien van bruikbare inligting rondom veral die leierskapdata in vergelyking met internasionale navorsing, het die studie ‘n beduidende verband tussen leierskapstyl en outonomie binne spanverband uitgewys.

  19. Duurzaamheid als planningsopgave : gebiedsgerichte afstemming tussen de ruimtelijke ordening, het milieubeleid en het waterhuishoudkundig beleid voor het landelijk gebied

    NARCIS (Netherlands)

    Vlist, van der M.

    1998-01-01

    Introduction

    Since the publication of 'Our Common Future' (1987) by the World Commission on Environment and Development, sustainability or sustainable development has become one of the most important aims of environmental policy throughout the world. But it has proved

  20. Op het raakvlak van historische disciplines

    Directory of Open Access Journals (Sweden)

    Dick E.H. de Boer

    2015-12-01

    Full Text Available At the Meeting Point of Historical DisciplinesThis contribution introduces the way in which the interaction between history and archaeology is examined, taking the case of the identification of a tomb and remains of Count William II of Holland, King of the Holy Roman Empire (†1256, in the former abbey church of Middelburg. It stresses the necessity of strict source criticism, which should be self-evident, but is at risk of receiving less attention. This is even truer when one of the disciplines is used as an auxiliary argument to support the other instead of a balanced approach. Wishful interpretation in such a case is a clear risk. The contribution gives some examples, before sketching the advance made thanks to the reapprochement of history and archaeology, and the consequent need for a registration system of archaeological data that can facilitate multi-disciplinary analysis. It ends with an introduction to the different stands in the dossier.Deze bijdrage biedt een inleiding op de wijze waarop de interactie tussen geschiedenis en archeologie wordt bekeken aan de hand van een casus betreffende het graf en de overblijfselen van de in 1256 gesneuvelde graaf Willem II van Holland, koning van het Heilige Roomse Rijk, in de voormalige abdijkerk van Middelburg. Hij benadrukt de noodzaak van een nauwgezette bronnenkritiek. Hoewel deze als vanzelfsprekend moet worden beschouwd, is er een zeker risico van verminderde zorgvuldigheid. Dit speelt vooral wanneer één van de disciplines wordt gebruikt als een hulp-argument, dat de uitkomsten van de andere moet ondersteunen, in plaats van een benadering waarbij beide disciplines in evenwicht zijn. Bij een onbalans is het risico van interpreteren in het licht van de gewenste uitkomst duidelijk aanwezig. De bijdrage geeft hiervan enkele voorbeelden, alvorens de vooruitgang te schetsen die is geboekt juist dankzij de toenadering tussen geschiedenis en archeologie, en aan te geven dat er behoefte is aan een

  1. Messiaanse vredestichters: Intertekstuele relaties tussen Zacharia 9 ...

    African Journals Online (AJOL)

    13 aug 2015 ... in Zechariah 9–14 on the basis of word fields related to violence and universal peace. The second section ... between Jesus's role in Matthew as the bringer of a peaceful ethical message, and his violent and vindictive role at ..... Boda and Porter (2005:226) wijzen op intertekstuele relaties tussen Zacharia ...

  2. Toezicht op het accountantsberoep

    NARCIS (Netherlands)

    Vergoossen, R.G.A.; Wallage, P.

    2004-01-01

    De laatste jaren heeft een groot aantal geruchtmakende zaken gespeeld waarin frauduleuze jaarrekeningen zijn opgemaakt. Een van de gevolgen daarvan is een sterke vermindering van het vertrouwen dat het publiek heeft in het optreden van de controlerend accountant. Het is dan ook niet verwonderlijk

  3. Het Farmaco Therapie Overleg in 1999: stand van zaken en effecten op

    NARCIS (Netherlands)

    Dijk, L. van; Barnhoorn, H.; Bakker, D. de

    2001-01-01

    Vrijwel alle huisartsen en openbare apothekers in Nederland participeren in een groep voor Farmaco Therapie Overleg (FTO). In totaal zijn er ruim 800 FTO-groepen. De Stichting Doelmatige Geneesmiddelen Voorziening DGV) heeft op landelijk niveau een coördinerende en stimulerende rol voor het FTO. Om

  4. Comment on the RIVM report 'A comparison between (passive) NO2 measurements and results of calculations for 2010'; Commentaar op het RIVM-rapport 'Een vergelijking tussen (passieve) NO2 metingen en rekenresultaten in 2010'

    Energy Technology Data Exchange (ETDEWEB)

    Cats, G.

    2013-04-15

    In 2011, the RIVM (Netherlands) published measurements and calculations of NO2 concentrations along highways. New analysis suggests that the calculations underestimate the contribution of highways with 40%. This is particularly important for areas where there is a risk of standards being exceeded [Dutch] Het RIVM heeft in 2011 metingen en berekeningen van de NO2-concentratie langs snelwegen gepubliceerd. Een nieuwe analyse ervan suggereert dat de berekeningen de bijdrage van de snelweg met 40% onderschatten. Dit is vooral van belang op plaatsen waar normoverschrijding dreigt.

  5. Laveren tussen loyaal en formalistisch

    Directory of Open Access Journals (Sweden)

    H. Renders

    2008-01-01

    Full Text Available Meindert Fennema en Johan Rhijnsburger, Dr. Max Hirschfeld. Man van het grote geld (Amsterdam 2007.Hovering between Loyalty and BureaucracyHans Max Hirschfeld has often been the subject of discussion: he was Secretary General of the Ministry of Trade and Industry during World War II and, as such, a collaborator. Or should we regard him as a faithful and obedient civil servant who simply performed the task entrusted to him by his successive (political superiors? The question is all the more intriguing because Hirschfeld was of German descent, even though he only lived in the land of his birth for four months of his life. Hirschfeld has been the subject of two successive biographies. In the opening article of this dossier on Meindert Fennema’s biography of Hirschfeld, Hans Renders describes the value that the biographical genre holds for history writing. Although there is certainly some criticism to be levelled at Fennema’s biography, he has succeeded in providing a balanced account of this sphinx-like man. This is indeed an achievement, as Hirschfeld’s private archive was destroyed upon his death. Thanks to the use of other sources, the biographer makes a convincing case that Hirschfeld’s thoughts and deeds were strongly influenced by the headstrong Claude-Henri de Saint-Simon (1760-1825.

  6. Het "JeugdSynergiePlan", Meer effectiviteit voor verenigingen. : Bestand 1 = Rapport 37p;Bestand 2 = Artikel 4p;Bestand 3 = Bijlage 15p.

    NARCIS (Netherlands)

    drs Paul WA van Kempen

    2012-01-01

    Het JeugdSynergiePlan beschrijft de wijze waarop er bij verenigingen door een effectieve samenwerking tussen de verschillende stakeholders meer kan worden bereikt voor iedereen. De belangrijkste samenwerkende partijen (stakeholders) bestaan uit de leden, de ouders en vrijwilligers, de verenigingen,

  7. Oriënterend onderzoek naar de mogelijkheid om met behulp van NIRS het gehalte aan olie en y-linoleenzuur in teunisbloemzaad te bepalen

    NARCIS (Netherlands)

    Munsteren, van A.J.; Frankhuizen, R.; Veen, van der N.G.

    1987-01-01

    Nagaan of met behulp van NIRS het gehalte aan olie en y-linoleenzuur in teunisbloemzaad voldoende nauwkeurig te bepalen is. Van 21 monsters teunisbloemzaad zijn met behulp van verschillende rekenmethoden correlatieberekeningen uitgevoerd tussen de chemisch bepaalde gehalten aan olie en

  8. De werkhouding bevorderen aan de hand van een growth mindset: Hoe kan je als leerkracht van groep acht op PCB de Oranje Nassau in Zwammerdam de growth mindset van leerlingen bevorderen zodat leerlingen in de werkhouding laten zien dat zij het proces van eigen doelen belangrijker vinden dan cijfers?

    OpenAIRE

    Vis, Wieke

    2017-01-01

    In dit onderzoek staat de verbinding tussen het leren zichtbaar maken van Hattie (2008) en de theorie van de mindsets van Dweck (2007) centraal. Het doel van dit onderzoek is om de werkhouding van leerlingen ten opzichte van eigen doelen te bevorderen aan de hand van een growth mindset. Het onderzoek wordt uitgevoerd op PCB de Oranje Nassau in Zwammerdam. Dit is een voorbeeldschool wat betreft wetenschap en techniek, en leren zichtbaar maken (Boer & Graaff, 2016). De school streeft naar onder...

  9. Slim bewegen tussen haven en stad

    NARCIS (Netherlands)

    van Duin, Ron

    2017-01-01

    Wat moet de havenstad Rotterdam gaan doen met alle toekomstige kansen en bedreigingen? Welke disruptieve veranderingen zijn bij uitstek geschikt voor de haven- en stadsontwikkeling en welke ontwikkelingen zien wij op ons afkomen? Op welke manier kunnen we daar op inspelen met het onderzoek en het

  10. Evolusie: Die misverstand tussen teologie en biologie

    African Journals Online (AJOL)

    Reeds in 1830 publiseer Charles Leyll sy siening oor uniformitarianisme waarin hy, op grond van geologiese data, beweer dat die aarde miljoene jare oud is en deur geieidelike prosesse oor eeue been ontwikkel het. Hierdie siening het die weg gebaan vir Darwin se teorie oor biologiese evolusie. (Hickman, Roberts ...

  11. Certificering in het Hoger Onderwijs: De medewerking van professionals aan kwaliteitscontrole

    Directory of Open Access Journals (Sweden)

    Everard van Kemenade

    2010-06-01

    Dit artikel presenteert de resultaten van een onderzoek naar de bereidheid van professionals in Hogescholen in Nederland en Vlaanderen om mee te werken aan het accreditatieproces. Betoogd wordt dat accreditatie eigenlijk een vorm van certificering is. Conclusies zijn dat professionals loyaal zijn naar hun organisatie en bereid zijn verantwoording af te leggen. De nadruk in de certificering zou dan echter moeten liggen op de inhoud van het werk en de beoordeling zou moeten worden gedaan door vakgenoten (peer review. Er treden meer problemen op bij het certificeringproces, als het management de certificering onvoldoende ondersteunt of als de interne kwaliteitszorg onvoldoende op orde is. Er is een risico dat er window dressing optreedt. Uiteindelijk leidt dat tot de conclusie dat controle (door middel van bijvoorbeeld ISO of HKZcertificering gescheiden zou moeten worden van verbetering. Er zijn voldoende overeenkomsten tussen hoger onderwijs en maatschappelijk werk om te bezien of de resultaten ook gelden voor maatschappelijk werk.

  12. Het Italiaanse voorzetsel da

    NARCIS (Netherlands)

    Boer, M.G. de

    2010-01-01

    SAMENVATTING In een voorzetselstudie in het kader van Jackendoffs semantische theorie wordt het sterk polyseme Italiaanse voorzetsel da geanalyseerd als een verzameling deelbetekenissen waarbij de meeste door een of meer semantische regels afgeleid kunnen worden van de basisbetekenis ruimtelijke

  13. Die verband tussen angs en prestasie in takseer sentrumdimensies

    Directory of Open Access Journals (Sweden)

    E. J. Ehlers

    1996-06-01

    Full Text Available The relationship between anxiety and performance in assessment centre dimensions. This study is aimed at determining whether there is a relationship between Anxiety (Tension and Anxiety, as measured by the Sixteen Personality Factor Questionnaire, and performance in assessment centre dimensions. The data set was collected from 145 white male candidates on entry and middle management level in an auditing firm in Gauteng. Ages of candidates varied from 24 to 35 years (x = 27,52; sd = 6,33. By using regression analyses it was found that Tension and Anxiety mainly show a negative relationship with the so-called interpersonal behaviour dimensions, such as Perseverance, Eogical and persuasive reasoning ability, and Perceived leadership image. The multiple analyses of variance (MANOVAS for the low, middle and high tension groups and low, middle and high anxiety groups revealed no statistically significant differences in respect of the assessment centre dimensions as a whole. Implications of the findings are discussed in the article. Opsomming Hierdie studie is daarop toegespits om vas te stel of daar 'n verband tussen Angs (Spanning en Angstigheid, soos deur die Sestien-persoonlikheidsfaktorvraelys gemeet, en prestasie in takseersentrumdimensies bestaan. Data is ingesamel van 145 blanke manlike kandidate op toetrede- en middelbestuursvlak in 'n ouditeursfirma in Gauteng. Ouderdomme van kandidate het gewissel van 24 to 35 jaar (x = 27,52; s = 6,33. Daar is deur middel van regressieontledings bevind dat Spanning en Angstigheid hoofsaaklik 'n negatiewe verband met die sogenaamde interpersoonlike gedragsdimensies, byvoorbeeld Deursettingsverrnoe, Eogiese en oorredende redenasievermoe en Waargeiwme leierskapsbeeld toon. Meervoudige variansieontledings (MANOVAS vir die lae, gemiddelde en hoe spanningsgroepe en die lae, gemiddelde en hoe angstigheidsgroepe hot gcen statisties-beduidende verskille ten opsigte van die takseersentrumdimensies in die geheel

  14. Kroniek van het mededingingsrecht

    NARCIS (Netherlands)

    Wesseling, R.; Truijens Martinez, J.

    2015-01-01

    Waar liggen de grenzen van het bereik van het mededingingsrecht? Die vraag komt steeds vaker op. Buiten het mededingingsrecht heeft de Europese Commissie beperkte handhavingsbevoegdheden. Voor de Commissie is een probleem dus al snel een mededingingsrechtelijke kwestie. De Libor-affaire en

  15. Energy consumption of storing special flower bulbs. Allium, Muscari, Zantedeschia and Fritillaria; Energieverbruik bij het bewaren van bijzondere bolgewassen. Allium, Muscari, Zantedeschia en Fritillaria

    Energy Technology Data Exchange (ETDEWEB)

    Wildschut, J. [Praktijkonderzoek Plant en Omgeving PPO, Bloembollen, Boomkwekerij en Fruit, Lisse (Netherlands); Vasen, R. [DLV Plant, Wageningen (Netherlands)

    2010-03-15

    The energy use of drying and storing special flower bulbs has been mapped. From the variation in energy use between various businesses, more energy efficient ventilation, circulation and temperature standards can be derived. This way the costs for energy use in a business and at sector level can be reduced significantly [Dutch] Het energieverbruik voor drogen en bewaren van bijzondere bolgewassen is in kaart gebracht. Uit de variatie in het energieverbruik tussen de verschillende bedrijven kunnen energiezuiniger ventilatie-, circulatie- en temperatuursnormen worden afgeleid. Hiermee kunnen de kosten voor energieverbruik op het bedrijf en op sectorniveau fors verlaagd worden.

  16. Sexual transmission of the [Het-s] prion leads to meiotic drive in Podospora anserina

    NARCIS (Netherlands)

    Dalstra, H.J.P.; Swart, K.; Debets, A.J.M.; Saupe, S.J.; Hoekstra, R.F.

    2003-01-01

    In the filamentous fungus Podospora anserina, two phenomena are associated with polymorphism at the het-s locus, vegetative incompatibility and ascospore abortion. Two het-s alleles occur naturally, het-s and het-S. The het-s encoded protein is a prion propagating as a self-perpetuating amyloid

  17. Two cases of subdural hematoma with niveau formation on CT

    International Nuclear Information System (INIS)

    Shimizu, Satoshi; Fukuda, Atsuhiro; Sato, Masaharu; Kohama, Akitsugu

    1984-01-01

    The authors report a case of a bilateral chronic subdural hematoma with niveau formation and another rare case of an acute subdural hematoma with niveau formation on plain CT. The different mechanisms of the niveau formation in these cases are speculated about. The first case was a 75-year-old male who showed a drowsy state, urinary incontinence, and muscle weakness of the bilateral lower limbs. No definite history of head trauma could be found. A plain CT scan showed a bilateral-crescent type fluid collection with niveau formation, consisting of a low-density area in the upper part and a high-density area in the lower part. An operation showed bilateral, moderately encapsulated subdural hematomas; they were evacuated. The second case was a 61-year-old male with head trauma due to a fall from a ladder. On admission, neurological examination revealed a decerebrate posture, a deep coma, and anisocoria. A plain CT scan twenty hours after the onset showed a crescent-type fluid collection with niveau formation in the left fronto-parietal region. The operation showed an acute subdural hematoma containing xanthochromic fluid and coagulated blood. No capsule of hematoma could be seen. The incidence of niveau formation in chronic subdural hematomas is not low (5 - 20%); such niveau formation is thought to be caused by rebleeding into the hematoma and the spending of considerable time in the supine position. On the other hand, no case of an acute subdural hematoma with niveau formation has previously been reported. With regard to this mechanism of niveau formation, we speculate that the hematoma is mixed with cerebrospinal fluid from the arachnoidal tear caused by the head trauma; also, a considerable time in the supine position is necessary. (author)

  18. Functional foods : verbindende schakel tussen food en farma?

    NARCIS (Netherlands)

    Stijnen, D.; Dagevos, H.

    2001-01-01

    Argumenten voor het met vereende krachten betreden van de markt voor functional foods. De resultaten van een gezamenlijke studie door ATO en het LEI zijn vastgelegd in het rapport: "De wereld van functional foods: op het raakvlak van twee ketens". In twee artikelen wordt dit rapport behandeld

  19. Is die ortodoksie se verstaan van die sondeval belemmerend vir die gesprek tussen teologie en natuurwetenskap?

    Directory of Open Access Journals (Sweden)

    Johan Buitendag

    2012-11-01

    Full Text Available In hierdie artikel is betoog dat die Gereformeerde Ortodoksie se begrip van die sondeval ’n  belemmering  was  vir  die  gesprek  tussen  teologie  en  natuurwetenskap.  Die  rede hiervoor was dat dit ten eerste ’n bepaalde verstaan van liniêre tyd nahou en ten tweede dat dit ’n bonatuurlike ingryp veronderstel het. Albei hierdie aspekte het die debat onnodig problematiseer. Die argument is ontwikkel deur eerstens die probleem te definieer, gevolg deur ’n uiteensetting van die standpunte van Augustinus en Calvyn onderskeidelik oor die sondeval. As ’n heuristiese sleutel is die konsepte van infralapsarisme en supralapsarisme aangewend om die tema te ontleed. Die artikel is afgesluit met die oortuiging dat die imago Dei ’n beliggaamde menslike persoon is wat biologies in die geskiedenis in terme van selfbewussyn en morele verantwoordelikheid ontluik het. Is the Orthodoxy’s notion of the Fall inhibitory for the dialogue between theology and science? In this article it was argued that the Reformed Orthodoxy’s interpretation of the Fall had become an impediment in the dialogue between theology and science. The reason was that it assumed firstly a specific understanding of linear time and secondly a metaphysical intervention. Both events were unnecessarily problematising the debate. The argument was deployed by stating the problem, followed by an exposition of the views of Augustine and Calvin on the Fall. As a heuristic key, the concepts of infralapsarism and supralapsarism were applied respectively to analyse the topic. The article concluded with the conviction that the imago Dei is an embodied human person that had biologically emerged in history as a center of self-awareness, and moral responsibility.

  20. Karakterisering van het Etimologiewoordeboek van Afrikaans (EWA

    Directory of Open Access Journals (Sweden)

    Fons Moerdijk

    2011-10-01

    Full Text Available

    Samenvatting: Zesendertig jaar na Afrikaanse etimologieë van Boshoff en Nienaber verscheener in 2003 een nieuw etymologisch woordenboek van het Afrikaans: het Etimologiewoordeboek vanAfrikaans (EWA. Tussen die twee woordenboeken bestaat een wezenlijk verschil. Het werk vanBoshoff en Nienaber is vrijwel alleen toegankelijk voor specialisten en niet specifiek bedoeld vooreen breed publiek. EWA is juist allereerst bestemd voor de leek die zich interesseert voor de oorsprongen de geschiedenis van de eigen taal. Daarnaast biedt het ook de etymoloog en historischtaalkundige een hoop gegevens en inspiratie voor nader onderzoek. Als etymologisch woordenboekbezit EWA een aantal bijzondere, eigen kenmerken. De selectie van de woorden is bepaalddoor het beoogde gebruikerspubliek. Als gevolg daarvan bevat EWA verscheidene typen woordendie in traditionele etymologische woordenboeken doorgaans veronachtzaamd worden, zoals afleidingen,samenstellingen, neologismen en gemeenzame spreektaalwoorden. De artikelstructuurwordt gekenmerkt door een hoge graad van uniformiteit en consistentie. Het accent ligt op dezogenaamde etymologia proxima, de etymologie waarbij men één stap teruggaat en de meestdirecte herkomst van het woord biedt. Voorts is speciale aandacht besteed aan polysemie: nietalleen de herkomst van de dominante betekenis van een woord wordt gegeven, maar ook die vanzijn eventuele andere betekenis(sen. Benoemingsmotieven komen ook veelvuldig aan bod. In eeneventuele tweede druk zouden opvallende verschillen in vorm of betekenis altijd verklaard of inieder geval besproken moeten worden. Dat blijft nu nogal eens achterwege. Ook zou voorafgaandaan zo'n volgende editie meer onderzoek naar woordhistorisch materiaal uit primaire bronnenvoor met name de 17de–19de eeuw verricht moeten worden. Het zou mooi zijn als deze eersteuitgave van EWA de aanleiding tot een dergelijk onderzoek zou vormen.

    Sleutelwoorden: BENOEMINGSMOTIEF, ETYMOLOGIA PROXIMA

  1. Die Eerste Verhoudinge Tussen Boer en Brit.

    Directory of Open Access Journals (Sweden)

    D. H. Cilliers

    1951-03-01

    Full Text Available Mens hoor deesdae, veral van Engelse kant, weer heelwat omtrent die „gevoel,” „rassehaat” e.s.m. wat daar dan tussen Afrikaans- en Engelssprekendes sou bestaan. Nou wil ek sommer dadelik sê dat dit een van dié oordrewe en gevaarlike algemeenhede is wat maklik is om te beweer maar wat gewoonlik op onkunde en/of kwaadwilligheid berusen meestal ook nie bewys kan word nie, iets wat dikwels sommer uit die lug gegryp is en hoofsaaklik op papier bestaan—in Engels sou ek met’n woordspeling wou sê: „On paper, more specifically, in the Englishpapers.”

  2. Ziekten van het ruggenmerg

    NARCIS (Netherlands)

    Groen, Robertus; Kuks, Joannes; Snoek, Jozef; Kuks, Jan B.M.; Snoek, Jos W.

    2016-01-01

    Er zijn vele oorzaken voor een myelopathie. Beschadiging van het myelum kan compleet zijn (zoals in het geval van een complete dwarslaesie), maar is vaker incompleet (zoals bij een incomplete traumatische dwarslaesie en de meeste vormen van myelopathie op basis van niet-traumatische oorzaken). Er

  3. Productiviteitstrends in het gevangeniswezen

    NARCIS (Netherlands)

    Niaounakis, T.K.; Urlings, T.H.; Van Heezik, A.A.S.

    2014-01-01

    Dit rapport schetst een beeld van de belangrijkste ontwikkelingen in beleid en produc-tiviteit in het gevangeniswezen gedurende de periode 1970-2012. Om het verloop van de productiviteit bloot te leggen, worden ontwikkelingen in de kosten aan de hand van statistische methoden gerelateerd aan

  4. Het geheim van Alibaba

    NARCIS (Netherlands)

    den Butter, F.A.G.; Wu, X.

    2016-01-01

    Alibaba is in korte tijd uitgegroeid tot het grootste internet handelsplatform in de wereld. Volgens de Amsterdamse hoogleraar Frank den Butter en de Chinese studente Xiaoyi Wu weet Alibaba uitstekend in te spelen op de Chinese cultuur en instituties bij het omlaag brengen van de kosten van

  5. Beter aan het werk

    NARCIS (Netherlands)

    Gerda Jehoel-Gijsbers

    2007-01-01

    Jarenlang was Nederland koploper in Europa in het aantal gevallen van ziekteverzuim en arbeidsongeschiktheid. Om dit probleem tegen te gaan zijn in de afgelopen decennia veel beleidsmaatregelen ontwikkeld en vaak ook weer aangepast. Hebben deze maatregelen tot resultaat geleid? Is het

  6. Management en het familiebedrijf

    NARCIS (Netherlands)

    Flören, R.H.; Jansen, S.F.

    2006-01-01

    Ieder bedrijf heeft ondernemerschap nodig om te overleven. De kunst om nieuwe ideeën te genereren en uiteindelijk succesvol op de markt te brengen, draagt bij aan de continuïteit van het bedrijf. Maar ondernemerschap alleen zal niet genoeg zijn. Ook het zorg dragen voor de werknemers, klanten,

  7. Beheersing van het Schmallenbergvirus

    NARCIS (Netherlands)

    Poel, van der W.H.M.

    2013-01-01

    Schmallenbergvirus (SVB) werd in 2011 voor het eerst in Europa gezien en veroorzaakte een epidemie van aangeboren afwijkingen, vooral misvormde ledematen en hersenafwijkingen, bij kalveren en lammeren. Het ging om een niet eerder gevonden virus, dat om die reden aanvankelijk moeilijk onderkend kon

  8. Het onzichtbare circuit

    NARCIS (Netherlands)

    Nauta, Bram

    2013-01-01

    De chip, of geïntegreerde schakeling, heeft in een razend tempo ons leven ingrijpend veranderd. Het lijkt zo vanzelfsprekend dat er weer een nieuwe generatie smartphones, tablets of computers is. Maar dat is het niet. Prof.dr.ir. Bram Nauta, hoogleraar Integrated Circuit Design, laat in zijn rede

  9. Film en het moderne leven in Limburg. Het bioscoopwezen tussen commercie en katholieke cultuurpolitiek (1909-1929)

    NARCIS (Netherlands)

    Oort, T. van

    2007-01-01

    Film and Modern Life in Limburg. Cinema Exhibition between Commerce and Catholic Cultural Politics (1909-1929) The aim of this book is to provide a deeper understanding of the development of a local and regional infrastructure of cinema exhibition as an element in a larger process of modernization

  10. The right indoor climate. In monuments with a museum function; Het verantwoorde binnenklimaat. In monumenten met een museal functie

    Energy Technology Data Exchange (ETDEWEB)

    Schellen, H.L.; Ankersmit, B. [Faculteit Bouwkunde, Technische Universiteit Eindhoven TUE, Eindhoven (Netherlands); Neuhaus, E. [Afdeling Onderzoek, Instituut Collectie Nederland ICN, Amsterdam (Netherlands); Martens, M. [Ingenieursbureau PHYSITEC, Rotterdam (Netherlands)

    2008-06-15

    Establishing a museum quality indoor climate for the preservation of a collection which is housed in a historic building is sometimes in conflict with the need to preserve the building itself. This article illustrates the dilemma referencing four examples from important museums. New Dutch guidelines have been issued for museum climate conditions. They aim to do justice both to preservation of the collection and preservation of the (historic) building. The new guidelines return to the source: the relation between relative humidity and temperature, and the damage that may occur to objects. It presents a four-step plan to help a collection manager select absolute values for an appropriate indoor climate. [Dutch] De realisatie van een museaal binnenklimaat voor het behoud van een collectie in oude gebouwen staat op gespannen voet met het behoud van het monumentale gebouw. Aan de hand van vier voorbeelden van toonaangevende musea wordt dit geillustreerd. In Nederland worden nieuwe richtlijnen voor het museale binnenklimaat opgesteld, die zowel recht proberen te doen aan het behoud van de collectie als het (monumentale) gebouw waarin het museum is gehuisvest. De nieuwe richtlijn gaat terug naar de bron: de relatie tussen de relatieve vochtigheid en temperatuur en de schade aan objecten. Een vier stappen plan wordt aangereikt om een collectiemanager te laten komen tot een keuze van absolute waarden voor een verantwoord binnenklimaat.

  11. De kloof tussen wetenschap en praktijk dichten Carel hulshof

    NARCIS (Netherlands)

    Putten, D. van

    2011-01-01

    Carel Hulshof is per 1 mei 2011 benoemd tot bijzonder hoogleraar Arbeids- en Bedrijfsgeneeskunde aan de Universiteit van Amsterdam bij het Coronel Instituut voor Arbeid en Gezondheid van het Academisch Medisch Centrum.

  12. Vervolging, verbanning en het nazi-regime in het tijdschrift Het fundament (1934-1940

    Directory of Open Access Journals (Sweden)

    Marianne Kröger

    1999-06-01

    Full Text Available Het socialistische maandblad Het fundament verscheen in de zes jaren voorafgaande aan de Tweede Wereldoorlog. Het tijdschrift besteedde opvallend veel aandacht aan de vluchtelingenstroom die na de machtsovername door Hitler vanuit Duitsland op gang was gekomen. Veel linkse Duitse intellectuelen, die in Nederland hun toevlucht zochten voor het nazi-regime, behoorden tot de medewerkers van Het fundament. Een eerste verkenning.

  13. Klik naar het verleden

    NARCIS (Netherlands)

    Henrieke Wubs; Frank Huysmans

    2006-01-01

    De toegankelijkheid van museumcollecties, archeologische vondsten, monumenten en archieven is in de afgelopen jaren enorm vergroot door de ontsluiting van historisch waardevolle documenten en afbeeldingen van museale objecten op het internet. Voor iedereen die over een

  14. Die verband tussen werkbetrokkenheid en werkprestasie

    Directory of Open Access Journals (Sweden)

    M. M. E. Bleeker

    2002-09-01

    Full Text Available The relationship between work involvement and work performance. The primary goal of the study was to determine whether a relationship exists between the work involvement scores and work performance ratings of employees. A secondary goal was to determine whether work involvement could predict future work performance. The ‘‘Alienation-Involvement Scale’’ together with the ‘‘Comprehensive Structured Interviewing for Potential’’, were applied to a sample of convenience of 200 employees in job levels of workers, teamleaders and managers in a large manufacturing organisation. Opsomming Die primere doel van die studie was om vas te stel of daar ’n verband bestaan tussen die werkbetrokkenheidtellings en die werkprestasie-beoordelings van werkers.’n Sekondere oogmerk was om te bepaal of werkbetrokkenheid toekomstige werkprestasie kan voorspel. Die ‘‘Alienation-Involvement Scale’’ saam met die ‘‘Comprehensive Structured Interviewing for Potential’’ is op ’n gerieflikheidsteekproef van 200 werknemers op die posvlakke vanwerkers, spanleiers en bestuurders in ’n goot vervaardigingsonderneming toegepas.

  15. Genetic defects in patients with mitochondrial encephalomyopathies

    NARCIS (Netherlands)

    I.F.M. de Coo (René)

    2005-01-01

    textabstractDit proefschrift is een bijdrage aan het snel groeiende kennisgebied gewijd aan de verbetering van de diagnostiek op DNA-niveau bij patiënten met mitochondriële encephalomyopathieën en is onder andere geïnspireerd door de hypothese van de communicatie over en weer tussen het kerngenoom

  16. Het nieuwe werken bij Microsoft, een impressie

    NARCIS (Netherlands)

    Rip, F.I.

    2009-01-01

    VIAS organiseerde op 15 oktober 2009 een bedrijfsbezoek aan het Microsoft-kantoor op Schiphol, waar sinds de ingebruikname van het gebouw gewerkt wordt via het concept "het nieuwe werken". Juist daarover gaat deze bijdrage

  17. De positie van huishoudelijke consumenten in het EU Winterpakket : Tussen participeren en beschermen

    NARCIS (Netherlands)

    Hesselman, Marlies; Diestelmeier, Lea

    2018-01-01

    This contribution acknowledges that the "household electricity customer" is an increasingly heterogenous group of energy consumers, consisting of 'vulnerable customers', 'energy poor customers', 'prosumers' or 'active consumers', which may or may not organize themselves in 'local energy communities'

  18. Het verband tussen natuurlijke en anthropogene landschapsvormen, bezien vanuit de betrekkingen in grensmilieu’s

    NARCIS (Netherlands)

    Leeuwen, van Chr.G.

    1965-01-01

    The isomorphy of natural and anthropogeneous landscapes with regard to the environmental conditions in border areas The contact in space between opposite situations constitutes two main types of boundaries. The distinction of these two types offers a useful expedient in ecology. It may also clarify

  19. Representatie en zintuiglijkheid : Het debat tussen Rancière en Lyotard over kunst

    NARCIS (Netherlands)

    van Peperstraten, Frans

    2015-01-01

    If representation means making something present again, what is its relationship to sensibility, especially in art? Could the work of art represent our sensory inputs, or does such representation always fall short of the adequate re-presentation of the sensory? The debate on representation and

  20. De antirachitische werking van Nederlandse ruwvoeders in verband met het antagonisme tussen caroteen en vitamine D

    NARCIS (Netherlands)

    Weits, J.

    1956-01-01

    A method was devised for estimating vitamin D in roughages. After boiling with 10 % alcoholic KOH the material was extracted with petroleum ether, and purified by chromatography through an activated alumina column with petroleum ether. Chromatography removed an unsaponifiable factor antagonistic to

  1. De invloed van automassa op het letselrisico bij botsingen tussen twee personenauto's : een kwantitatieve analyse.

    OpenAIRE

    Berends, E.M.

    2009-01-01

    On European roads, the dispersion of vehicle mass as well as the average vehicle mass are increasing. This has road safety consequences. Drivers in light cars have higher injury and death rates. This means that they have a higher risk of being injured or killed in a crash with a heavier vehicle. The research literature shows that large differences in vehicle mass are not only a threat for the safety of individual drivers, but also for the total number of casualties. A larger dispersion of mas...

  2. De invloed van automassa op het letselrisico bij botsingen tussen twee personenauto's : een kwantitatieve analyse.

    NARCIS (Netherlands)

    Berends, E.M.

    2009-01-01

    On European roads, the dispersion of vehicle mass as well as the average vehicle mass are increasing. This has road safety consequences. Drivers in light cars have higher injury and death rates. This means that they have a higher risk of being injured or killed in a crash with a heavier vehicle. The

  3. De relatie tussen positieve communicatiestrategieën en het beloop van alledaagse klachten.

    NARCIS (Netherlands)

    Dulmen, S. van; Fassaert, T.; Jagt, L. van der; Schellevis, F.

    2010-01-01

    Introduction: Consultations for minor ailments constitute a large part of the workload of general practitioners (GPs). Specific communication strategies, such as active listening and creating positive treatment expectations, might contribute to patient self-care. The aims of this study were to

  4. Het verband tussen predisponerende factoren bij leverabcessen en de bacteriële verwekkers

    NARCIS (Netherlands)

    Lim, T. T.; Kuijper, E. J.; Jansen, P. L.; Speelman, P.; Lubbers, M. J.; Dankert, J.

    1991-01-01

    In order to assess the correlation between bacteria isolated from liver abscesses and factors predisposing to liver abscesses, a retrospective study of clinical and bacteriological data on 21 patients with 27 episodes of pyogenic abscesses was carried out at the University Medical Centre, Amsterdam.

  5. Een nieuw terrein voor het bewakingssysteem : Interacties tussen geneesmiddelen en drugs

    NARCIS (Netherlands)

    Touw, D.J.

    2001-01-01

    The use of drugs of abuse is not uncommon nowadays. Use of drugs of abuse may vary from the relatively innocent use of cannabis to severe forms of addiction to heroin and cocaine. Many users of drugs of abuse are being treated with medicines because of medical or psychiatric illness, so many drug

  6. De loonkloof tussen mannen en vrouwen: Een review van het onderzoek in Nederland

    NARCIS (Netherlands)

    Tijdens, K.G.; van Klaveren, M.

    2011-01-01

    This article examines 20 studies on the remuneration of men and women in the Netherlands, where the influence of nine groups of factors was viewed: human capital, industry, job classification, job level, glass ceiling, firm size, working hours, gender-composition of occupation, and family building

  7. Assessment of the Dutch National Air Quality Plan 2004; Beoordeling van het Nationaal Luchtkwaliteitsplan 2004

    Energy Technology Data Exchange (ETDEWEB)

    Beck, J.P.; Buringh, E.; Wieringa, K.

    2005-02-01

    The Dutch government expects that targets for the reduction of emission of particulates and nitrogen dioxide can not be reached in time. Therefore, the Netherlands is obliged to draft a plan of actions in order to realize those targets within the period that has been agreed upon in the context of the European Union air quality policy. The present plan of action has been assessed by the Netherlands Environmental Assessment Agency (MNP) with regard to the feasibility of the boundary values and the preconditions for action plans as formulated by the European Committee. Also, the plan has been assessed for the prevention or limitation of health effects and the Dutch position with regard to particulates. [Dutch] Het luchtbeleid heeft als doelstelling dat op lange termijn de gezondheidsrisico's en de effecten op ecosystemen en biodiversiteit moeten dalen tot een verwaarloosbaar niveau. Daartoe zijn in Europees verband normen voor de luchtkwaliteit vastgesteld. Nederland verwacht dat met het vastgestelde beleid niet tijdig aan de grenswaarden voor fijn stof en stikstofdioxide zal worden voldaan. Hierdoor is Nederland verplicht om een actieplan op te stellen. De uitvoering ervan zal er toe moeten leiden dat Nederland alsnog de doelen binnen de gestelde termijn haalt. Het Milieu- en Natuurplanbureau (MNP) van het RIVM heeft het actieplan getoetst aan de haalbaarheid van grenswaarden en aan de voorwaarden die door de Europese Commissie voor actieplannen zijn opgesteld. Daarnaast is het plan beoordeeld in het perspectief van de doelstelling van de richtlijn: het voorkomen of verminderen van gezondheidseffecten. Tenslotte geeft de evaluatie aanknopingspunten voor het herijken van de Nederlandse positie in de fijnstofproblematiek.

  8. Pedagogisch klimaat in het hbo? : Een verkenning

    NARCIS (Netherlands)

    Janneke Wubs

    2013-01-01

    In het hoger onderwijs wordt het pedagogisch klimaat veronachtzaamd. Het concept wordt niet mee in beschouwing genomen bij onderwijsinnovatie en onderwijsonderzoek. Dit artikel definieert het concept voor het hbo en werkt het uit op basis van de Zelf-Determinatie Theorie van Ryan en Deci

  9. Het eBook in het OU Onderwijs

    NARCIS (Netherlands)

    Mofers, Frans; Hermans, Henry; Verjans, Steven; Gorissen, Chantal

    2010-01-01

    Het deelproject eBooks heeft zich tot hoofddoel gesteld mogelijkheden tot uitlevering van cursusmaterialen via eBooks verder te onderzoeken en te beproeven. Meer specifiek zijn de volgende doelen geformuleerd: 1. Het onderzoeken en monitoren van markt van eReaders (‘apparaten’). 2. Het onderzoeken

  10. De verleidelijkheid van het grote gebaar : Het werk van Dogma

    NARCIS (Netherlands)

    Teerds, P.J.

    2013-01-01

    In vier portacabins op het parkeerterrein van de Delftse Faculteit Bouwkunde is nog tot volgende week de tentoonstelling 11+1 projects te zien, een overzichtstentoonstelling van het intrigerende werk van het Brusselse bureau Dogma. Met de tentoonstelling zet de faculteit na de brand in 2008 weer een

  11. Digitale incunabelen : Over het belang van het archiveren van websites

    NARCIS (Netherlands)

    Voerman, Gerrit; Keyzer, Andreas; den Hollander, Franciscus

    'Het geheugen van Nederland verpulvert'. Zo luidde de noodkreet van ruim twintig grote bibliotheken in het voorjaar van 1998. In een advertentie in enkele landelijke dagbladen vroegen deze bibliotheken om honderden miljoenen guldens voor het restaureren, fotograferen en digitaliseren van boeken en

  12. Digitale incunabelen : Over het belang van het archiveren van websites

    NARCIS (Netherlands)

    Voerman, Gerrit; Keyzer, Andreas; den Hollander, Franciscus

    2000-01-01

    'Het geheugen van Nederland verpulvert'. Zo luidde de noodkreet van ruim twintig grote bibliotheken in het voorjaar van 1998. In een advertentie in enkele landelijke dagbladen vroegen deze bibliotheken om honderden miljoenen guldens voor het restaureren, fotograferen en digitaliseren van boeken en

  13. Next Generation of Greenhouse Cultivation Tomato 2010; Het Nieuwe Telen Tomaat 2010

    Energy Technology Data Exchange (ETDEWEB)

    De Gelder, A.; Warmenhoven, M. [Wageningen UR Glastuinbouw, Wageningen (Netherlands); Grootscholten, M. [GreenQ, Bleiswijk (Netherlands)

    2012-08-15

    In 2010 a second experiment with the next generation cultivation of tomato was performed. With 23 m{sup 3} natural gas per m{sup 2} greenhouse 68 kg of the truss tomato 'Komeett' was harvested. Extra transparent foil used at the start of the experiment was changed by AC-foil. The amount of CO2 used was high, but the registration of this amount was unsure. Botrytis control both for spore pressure and infection was controlled well. For the next generation cultivation a zero tolerance for Botrytis is necessary. The relation between global radiation and temperature used in this experiment to keep the plant in good balance was 17.5C + 1.5C per 1000 joule/cm{sup 2}.day. The realized energy input was simulated with KASPRO. The simulation fitted well to the measured values per week. Product quality was good [Dutch] In 2010 is het tweede experiment voor Het Nieuwe Telen met tomaat uitgevoerd. Daarin is met 23 m{sup 3} aardgas per m{sup 2} kas 68 kg grove trostomaat 'Komeett' geproduceerd. Het extra heldere folie waarmee de teelt startte is vanwege condens problemen vervangen door AC-Folie. Het CO2 gebruik was hoog maar onzeker is of dit goed is geregistreerd. De botrytis druk en infectie waren goed beheersbaar. Ook bij het nieuwe telen tomaat moet het uitgangspunt zijn geen botrytis infectie. De temperatuur in relatie tot de stralingssom per dag werd goed gerealiseerd. In deze proef was de relatie tussen straling en temperatuur 17.5C + 1.5C per 1000 joule/cm{sup 2}.dag. Het gerealiseerde energie gebruik was met KASPRO goed na te rekenen. De simulatie klopte zeer goed met de gemeten waarden per week. Er waren geen problemen met de vrucht kwaliteit.

  14. Transmissie van Mycobacterium bovis tussen mens en dier

    NARCIS (Netherlands)

    Vries, de G.; Beer, de J.; Bakker, D.; Soolingen, D.

    2015-01-01

    Nederland is officieel vrij van rundertuberculose. Toch komt af en toe nog Mycobacterium bovis-tuberculose voor bij relatief jonge autochtone Nederlanders. Ook zijn er recent nog wel boviene-uitbraken geweest. Dat roept de vraag op of er ook nu nog transmissie is van M.bovis tussen mens en dier.

  15. Nieuwe Scheikunde in het vmbo

    NARCIS (Netherlands)

    Prof. dr. Albert Pilot; Drs. Kennedy Aquilino Tielman; Machiel Stolk; Sergine Lansman; John Hukom

    2011-01-01

    Het scheikunde onderwijs op het VMBO staat onder druk. NaSk2 dreigt te verdwijnen. Om de interesse van leerlingen voor NaSk2 te vergroten en positie van het vak te versterken, stellen wij voor om actuele en herkenbare contexten in NaSk 2 te implementeren. Tevens nodigen wij docenten uit op om mee te

  16. Kroniek Causaliteit in het verzekeringsrecht

    NARCIS (Netherlands)

    Brouwer, H.M.B.

    2013-01-01

    In deze kroniek staat centraal de causaliteit in het verzekeringsrecht. Onlosmakelijk daarmee verbonden blijkt de vraag welk criterium gehanteerd dient te worden om het causaal verband vast te stellen. Eerst maak ik enige algemene opmerkingen over causaliteit in het verzekeringsrecht en vervolgens

  17. Toezicht op menswaardige behandeling van gedetineerden in Europa : een onderzoek naar de verhouding tussen het EHRM en het CPT bij de effectuering van het folterverbod

    NARCIS (Netherlands)

    Hagens, Mireille

    2011-01-01

    The fight against torture and inhuman or degrading treatment or punishment is of fundamental importance, which has been broadly acknowledged, and resulted in different ways to pursue the effectuation of this prohibition. The coexistence of multiple monitoring mechanisms in the same field can raise

  18. You need to do everything with tact. Climatic change and the relation between science and the government; Je moet alles met beleid doen. Klimaatverandering en de relatie tussen wetenschap en overheid

    Energy Technology Data Exchange (ETDEWEB)

    Bregman, B.

    2011-12-15

    The author discusses the challenges in the field of climate change and climate science by means of a number of central themes in the relation between science and government: dealing with uncertainties, communication, knowledge management, the credibility of climate science and the role of social media [Dutch] De auteur bespreekt de uitdagingen m.b.t. klimaatbeleid en de klimaatwetenschap aan de hand van thema’s die centraal staan in de relatie tussen wetenschap en overheid: het omgaan met onzekerheden, communicatie, kennismanagement, de geloofwaardigheid van de klimaatwetenschap en de rol van sociale media.

  19. Het interieurjaar 2001

    Directory of Open Access Journals (Sweden)

    B. de Vries

    2004-01-01

    Full Text Available R. Baarsen, Rococo in Nederland F. van Burkom, Leven in toen. Vier eeuwen Nederlands interieur in beeld H.C.M. Kleijn, Interieurs belicht: M. Westermann, C.W. Fock, E.J. Sluijter, H.P. Chapman, Art and home. Dutch interiors in the age of Rembrandt C.W. Fock, Het Nederlandse interieur in beeld 1600-1900

  20. Het presteren van FM

    NARCIS (Netherlands)

    van der Voordt, D.J.M.

    2008-01-01

    Prestatieafspraken. Prestatiespecificaties. Prestatiecontracten. Het woord prestatie duikt steeds vaker op in de wereld van FM. Maar wat bedoelen we er nu precies mee? En kunnen we de prestaties van FM wel op een betrouwbare en valide manier meten? Een beschouwing vanuit de wereld van een

  1. Het paradijs der dwazen

    NARCIS (Netherlands)

    Boekestijn, A.J.

    2006-01-01

    Een reputatie vestigen is heel wat lastiger dan er een te laten sneuvelen. Na de donkere dagen van Srebrenica heeft Nederland jaren nodig gehad om weer aanzien te verwerven in de wereld. Jaren daarna hebben de missies in onder meer Bosnië, Kosovo, Eritrea en Irak het imago van ons land weer een

  2. Rapport van het onderzoek naar de kosten, verbonden aan het bewaren van consumptie-aardappelen

    NARCIS (Netherlands)

    Anonymous,

    1941-01-01

    Het doel van deit rapport is vast te stellen hoe het verloop van den prijs van consumptie-aardappelen gedurende den winter en het voorjaar moet zijn om de gemaakte kosten en het verlies aan product goed te maken.

  3. The printerless office. A study on the use of e-readers to replace printed paper; Het printerloos kantoor. Een studie naar het gebruik van e-readers ter vervanging van geprint papier

    Energy Technology Data Exchange (ETDEWEB)

    Bijleveld, M.M.; Sevenster, M.N.

    2011-03-15

    A life-cycle analysis was conducted to compare the environmental burden of e-readers with printed paper. The turning point when the e-reader starts to offer environmental benefits over printed paper, at an operational life of two years, lies between 3,000 and 13,000 prints per year. [Dutch] Door middel van levenscyclusanalyse is de milieubelasting van e-readers en geprint papier bepaald en met elkaar vergeleken. Het kantelpunt waarop een e-reader, bij gebruiksduur van 2 jaar, milieuvoordeel gaat bieden boven papieren prints, ligt tussen de 3.000 en 13.000 printjes per jaar.

  4. Gastvrijheid in het Albert Schweitzer ziekenhuis

    NARCIS (Netherlands)

    Doets, M.; van der Voordt, D.J.M.; Bos, P.; Willemse, M.

    2012-01-01

    Het ASz bestaat uit ziekenhuizen in Sliedrecht, Zwijndrecht en Dordrecht. Bij het ASz mogen de patiënten de juiste zorg op het juiste moment en de juiste plaats met de juiste middelen door de juiste persoon met het juiste resultaat verwachten. Maar wat is juist? Als het gaat om (medisch

  5. "Krakende kaken"; psychiatrische beschouwingen over het syndroom van het pijnlijke, slecht functionerende kaakgewricht (Arthrosis deformans van het kaakgewricht of het syndroom van Costen)

    NARCIS (Netherlands)

    Schuler, Jacques

    1966-01-01

    Naar aanleiding van klinische indrukken en mede op grond van literatuurgegevens werd een psychiatrisch onderzoek verricht naar het aandeel van psychogene factoren bij het tot stand komen van kaakgewrichtsklachten. Het klachtencomplex dat van stoornissen in de functie van het kaakgewricht het gevolg

  6. Het effect van framing op pensioenperceptie

    NARCIS (Netherlands)

    Prast, Henriette; Teppa, F.

    2017-01-01

    Het communiceren van het te verwachten pensioen in termen van een percentage van het huidige inkomen heeft een ander effect dan de gebruikelijke communicatie in euro’s. Deelnemers denken bij communicatie in procenten vaker dat het te bereiken pensioen te laag is. Communicatie in procenten kan het

  7. De relatie tussen stikstofopname en gewasreflectie bij vijf buitenbloemen

    NARCIS (Netherlands)

    Wiel, van de A.J.M.; Smit, A.L.; Uenk, D.; Krijger, D.J.; Kreij, de C.

    2002-01-01

    Bij buitenbloemen is er een grote variatie aan gewassen. Het is daarom niet mogelijk om voor ieder gewas afzonderlijk bemestingsonderzoek uit te voeren. Een N -opnamecurve is een belangrijk hulpmiddel bij het ontwikkelen van bijmestsystemen. Onderzoek is gedaan naar de mogelijkheid om met

  8. Tussen secularisering en religiositeit: De dynamiek van protestantse ...

    African Journals Online (AJOL)

    p1243322

    25 jan 2007 ... praktijk. Als Schleiermacher het bij het rechte eind heeft, is onze positie vrij eenvoudig. Zolang er protestantse geloofsgemeenschappen zijn, en zolang deze een academische opleiding van hun predikanten vereisen (gelukkig ziet de synode van de Protestantse Kerk in Nederland de noodzaak hiervan in),.

  9. Cultuurtransfer en het tijdschriftenonderzoek

    Directory of Open Access Journals (Sweden)

    Marjet Brolsma

    2008-10-01

    Full Text Available Cet article considère la notion de transfert culturel comme le point de départ d’une approche transnationale pour l’étude des périodiques. La perspective des transferts culturels permet de situer des discussions nationales dans un contexte européen. L'approche peut être utilisée aussi bien pour l’examen des rapports entre différents périodiques que pour l’analyse du processus d’acculturation à l’intérieur de ces périodiques. Tout d’abord, les bases de la théorie du transfert culturel ainsi que ses développements concrets seront discutés. Ensuite, les mérites et les imperfections de l'approche seront indiqués. Enfin, l’article propose une réflexion sur la manière dont le concept de transfert culturel peut s’appliquer concrètement à l’étude des périodiques.In the current article the concept of cultural transfer is explored as a transnational approach for the study of periodicals. Cultural transfer is a useful perspective to situate national debates in a larger, European context. The approach is valuable for researching both the processes of cultural transfer and of acculturation within periodicals. In the first two sections the development and core assumptions of cultural transfer and the concept histoire croisée or ‘entangled history’ will be discussed and criticized. In what follows the relevant insights for the study of periodicals will be designated and subsequently translated into to a workable methodology.In dit artikel wordt aan de hand van het concept cultuurtransfer geïnventariseerd hoe een transnationale benadering van het tijdschriftenonderzoek er in de praktijk uit kan zien. De cultuurtransfer is een nuttige invalshoek om debatten uit de vaderlandse kaders te halen en in een grotere, Europese context te plaatsen. De benadering is zowel geschikt om het proces van culturele overdracht en het periodiek als instituut te bestuderen, als voor een onderzoek naar de inhoud en de toe-eigening van

  10. Vocabulaire illustré 350 exercices : niveau moyen

    CERN Document Server

    Watcyn-Jones, Peter

    1995-01-01

    Cet ouvrage de vocabulaire illustré est conçu dans le même esprit que le niveau débutant auquel il fait suite. Il propose un travail stimulant et amusant pour approfondir son lexique, soit 1350 mots utiles et courants, rassemblés par thèmes (la maison, les magasins, les métiers, les animaux, le bricolage...) ou par catégories grammaticales. Il comprend des exercices d'apprentissage et d'élargissement, aussi bien pour les jeunes que pour les adultes. Un livret de corrigés est également disponible.

  11. Ik Kies Bewust; Effecten van het logo op het koopgedrag

    NARCIS (Netherlands)

    Kornelis, M.; Meeusen, M.J.G.

    2010-01-01

    Dit rapport beschrijft de effecten van het Ik Kies Bewust-logo in de markt. Daarbij wordt gekeken of en in welke mate de vraag naar de producten met het Ik Kies Bewust-logo groter wordt en welke effecten dit heeft op de vraag naar andere producten in diezelfde of andere productcategorieën.

  12. Hulpacceptatie bij jongeren tussen 18 en 24 jaar in organisatie X

    NARCIS (Netherlands)

    Tessa in 't Veld

    2017-01-01

    Jongeren tussen 18 en 24 jaar worden gezien als volwassenen volgens de Nederlandse wetgeving. Omdat ze 18 jaar of ouder zijn vallen zij onder de volwassenenzorg, deze groep jongeren ziet zichzelf echter niet zo. Jongeren tussen 18 en 24 jaar voelen zich zowel volwassen als jeugd. Ze geven aan dat ze

  13. Samen kom je er wel. Een afstudeerartikel over het Skejby halfway house: een huis waar delinquenten en studenten onder één dak wonen

    Directory of Open Access Journals (Sweden)

    Eline Broker

    2016-03-01

    Full Text Available Together you will get there. A graduation article on the Skejby halfway house: a house where delinquents and students live togetherThe Skejby house is unique and produces remarkable results. The recidivism percentage among its’ delinquent inhabitants is over 20% lower than in the halfway houses where only prisoners reside. The aim of Skejby is to ease the transition between imprisonment and reentry in society. The experiment, in which students and prisoners live together, originates from the idea that behavioral transformation is realized most effectively within a socially engaged group. The principal of collective responsibility is dominant in Skejby, resulting in a feeling of belonging to a group among the delinquents. In this group, the students serve as prosocial role models. Consequently, the standards and values that are picked up in prison are reshaped into much needed skills that are required for living a “regular” life in society. In contrast to the reintegration program in Skejby, the Dutch reintegration program mainly consists of one-to-one consultations between the delinquent and the probation officer. The reintegration thus does not take place in a group to which the delinquent can relate, while it is precisely this unique communal feeling of belonging that induces behavioral change in the prisoners. SAMENVATTING Samen kom je er wel. Een afstudeerartikel over het Skejby halfway house: een huis waar delinquenten en studenten onder één dak wonenHet Skejby house is uniek in zijn soort en boekt opmerkelijke resultaten: het recidivepercentage ligt ruim 20% lager dan bij halfway huizen waar alleen delinquenten wonen. Skejby heeft als doel om de overgang tussen gevangenis en samenleving zo klein mogelijk te maken. Het experiment, waarbij studenten en delinquenten samen wonen, komt voort uit het idee dat gedragsverandering het best bewerkstelligt wordt binnen een sociaal verbonden groep. In Skejby heerst het principe van

  14. Culturele Veranderingen: het wegen waard?

    NARCIS (Netherlands)

    Mérove Gijsberts

    1993-01-01

    Verslag van een verkennend onderzoek naar de effecten van weging op de bestanden 'Culturele Verkenningen'. In kaart wordt gebracht in hoeverre er sprake is van selectieve non-respons in de databestanden. Het verschijnsel non-respons wordt nader belicht, evenals het begrip 'wegen',

  15. Database opzet in het verkeer

    NARCIS (Netherlands)

    van Dijk, Alwin

    2018-01-01

    De ‘Database opzet in het verkeer’ geeft een overzicht van rechtspraak waarin opzetdelicten als doodslag, (zware) mishandeling of bedreiging zijn ten laste gelegd in verkeerszaken. De database is van belang voor de rechtspraak, het Openbaar Ministerie, de advocatuur en de wetenschap. De in de

  16. Het definitieve marketingplan : zonder keuze geen richting

    NARCIS (Netherlands)

    Santema, S.C.; Rijt, van de J.

    2004-01-01

    Dit praktische boekje gaat over het maken van een uitvoerbaar marketingplan. Het bevat niet alleen hulpmiddelen voor het schrijven van een plan, maar ook voor het naderhand implementeren en monitoren ervan. De auteurs hebben een uiterst praktisch boek geschreven over hoe een abstract doel met behulp

  17. Het hoge woord : Beschouwingen en boutades

    NARCIS (Netherlands)

    Willemsen, August

    2006-01-01

    'Het is bij mij begonnen met nieuwsgierigheid', zo verwoordt August Willemsen (1936) zijn levenslange toewijding aan het vertalen, in het bijzonder van Portugese en Braziliaanse literatuur. In Het hoge woord schrijft hij virtuoos over leven en werk van de door hem in Nederland geïntroduceerde

  18. Mag het een pondje minder zijn?

    NARCIS (Netherlands)

    S.G. van der Lecq (Fieke)

    2000-01-01

    textabstractOverstekende zakenreizigers en vakantiegangers merken het direct: de koers van het Britse pond is hoog. Meer dan EUR 1,50 oftewel een ruime ƒ 3,50: dat tikt hard aan in het dagelijkse gebruik. Natuurlijk is dit de keerzijde van de lage eurokoers, waarbij de rol van het pond als

  19. Ervaringen met zorg in het buitenland positief.

    NARCIS (Netherlands)

    Bes, R.; Wendel, S.; Curfs, E.; Jong, J. de

    2013-01-01

    Grensbewoners gaan vaker voor zorg naar het buitenland dan mensen elders in het land. In twee jaar tijd gingen 157 van de 5772 leden van het verzekerdenpanel voor zorg naar het buitenland. De meeste mensen die zorg over de grens zoeken, gaan naar een medisch specialist of voor een operatie. De

  20. Ecotopenkaart voor het Eems-Dollard estuarium

    NARCIS (Netherlands)

    Ysebaert, T.; Wal, van der J.T.; Tangelder, M.; Groot, de A.V.; Baptist, M.J.

    2016-01-01

    Dit rapport geeft een eerste aanzet tot het maken van een actuele ecotopenkaart voor het Eems-Dollard estuarium (NL en D deel, excl. Unterems) volgens de ZES.1 methodiek. Dit is één van de instrumenten die kan worden gebruikt voor het evalueren van mogelijke maatregelen in het MIRT-onderzoek en de

  1. Methodiekontwikkeling, evaluatieonderzoek en de body of knowledge van het sociaal werk

    Directory of Open Access Journals (Sweden)

    Koen Hermans

    2014-03-01

    Full Text Available Method-development, evaluation research and the body of knowledge of social workDuring the last ten years, a revival of the debate concerning the body of knowledge can be observed. During the same period, evidence-based practice caused a lot of resistance inside the social work profession. In this paper, we develop a broad view on evidence-based practice based on the discipline of evaluation research which acknowledges the complexity of the concept of effectiveness. In such a broad view, the first step is to develop and to describe the program theory of social interventions, which consists of the theory of action and the theory of change. We propose two methods to describe social interventions. In addition, we describe three modes to take into account the complexity of social interventions: (1 viable validity, (2 describing the interaction between the social intervention and the social context and (3 a multi-stakeholder approach paying special attention to the “silent voices”.Methodiekontwikkeling, evaluatieonderzoek en de body of knowledge van het sociaal werkDe afgelopen tien jaar leefde het debat over de kennisbasis van het sociaal werk op en zorgde de opkomst van evidence-based practice voor heel wat discussie en polarisering binnen het sociaal werk. In deze bijdrage vertrekken we van een ruime benadering van evidence-based practice die oog heeft voor de complexiteit van het effectiviteitsvraagstuk. We beargumenteren dat het expliciteren en theoretisch onderbouwen van interventies een mogelijkheid biedt om die kennisbasis van het sociaal werk beter in beeld te brengen. Deze interventie- of programmatheorie bestaat uit twee onderdelen: de handelingstheorie en de veranderingstheorie. We stellen twee methoden voor om interventies te expliciteren en theoretisch te onderbouwen. We schuiven daarnaast drie manieren naar voren om voldoende oog te hebben voor de complexiteit van sociale interventies: (1 praktische geldigheid, (2 het expliciteren

  2. Ervaringen met zorg in het buitenland positief.

    OpenAIRE

    Bes, R.; Wendel, S.; Curfs, E.; Jong, J. de

    2013-01-01

    Grensbewoners gaan vaker voor zorg naar het buitenland dan mensen elders in het land. In twee jaar tijd gingen 157 van de 5772 leden van het verzekerdenpanel voor zorg naar het buitenland. De meeste mensen die zorg over de grens zoeken, gaan naar een medisch specialist of voor een operatie. De tevredenheid over de zorg in het buitenland is hoog. Alle Europese burgers hebben recht op behandeling in het buitenland. De kosten worden vergoed tot aan het bedrag dat voor dezelfde behandeling in eig...

  3. Criteria voor het beoordelen van tentamenuitwerkingen in het vak Programmeren [Assessment Criteria in Computer Programming Courses

    NARCIS (Netherlands)

    van den Berg, Klaas; van Diepen, N.M.; van Dijk, H.W.; Koppelman, Hermannus; Moerkerke, G.; Roossink, H.J.

    Bij het beoordelen is het belangrijk te weten welke criteria gehanteerd moeten worden. Met behulp van een vragenlijstonderzoek onder de docenten is een beperkt aantal criteria geselecteerd die gehanteerd moeten worden bij de cursus Inleiding in het Programmeren.

  4. Communities of Practice. Niches voor de samenwerking tussen ervaringswerkers en professionals bij gebiedsgericht werken

    Directory of Open Access Journals (Sweden)

    Gerda Scholtens

    2015-03-01

    when providing support for people with complex multiple problems. The professionals in the CoPs who had previously been used to working within institutions became more aware of the increase in their range of control in community-based cooperation and consequently their need to develop the competencies required Communities of Practice. Niches voor de samenwerking tussen ervaringswerkers en professionals bij gebiedsgericht werkenSinds de eeuwwisseling zijn er in Nederland steeds vaker problemen geconstateerd in de zorg aan mensen met meervoudige complexe problematiek. De zorgverlening is verkokerd, aanbodgericht en is niet afgestemd op de behoeften en mogelijkheden van deze mensen (zie Baart, 2001 en Kal, 2001. Met de transitie AWBZ-WMO komt een deel van de professionals uit de geestelijke gezondheidszorg, verslavingszorg en verstandelijk gehandicaptenzorg onder de regie van de gemeente te vallen. Gemeenten maken steeds vaker beleid op gebiedsgericht werken om de problemen in de zorg en de ontwikkeling als gevolg van de transitie te managen. Om de samenwerking tussen professionals en tussen professionals en ervaringswerkers te bevorderen, is in het project “werk voor ervaringsdeskundigen” het initiatief genomen voor het organiseren van “Communities of Practice” (CoP. CoP’s zijn leergroepen van professionals die hun competenties willen ontwikkelen, om een gezamenlijk vraagstuk in hun praktijk beter te kunnen hanteren. Een benadering die adequaat is in de ondersteuning van mensen met complexe meervoudige problematiek is de herstelondersteunende zorg. Door de deelname van ervaringswerkers aan de CoP’s zijn professionals bekend geraakt met deze benadering. Daarnaast hebben de leerprocessen in de CoP’s betrekking gehad op het ontwikkelen van competenties om de toegenomen handelingsruimte bij gebiedsgericht werken te kunnen hanteren.

  5. KringloopToets: sluiten van de nutriëntenkringloop op het niveau van Noordwest-Europa

    NARCIS (Netherlands)

    Leenstra, Ferry; Vellinga, Theun; Bremmer, Bart

    2017-01-01

    The Nutrient Cycle Assessment aims at visualizing nutrient flows. In policy documents closing of nutrient cycles at the level of North Western Europe is often mentioned. Province North Brabant, farmers organisation ZLTO and NGO BMF examined together with Wageningen University & Research the

  6. Interventies in het onderwijs : Leerproblemen

    NARCIS (Netherlands)

    Snellings, P.; Zeguers, M.

    2016-01-01

    Schools leren bij kinderen kan problematisch verlopen door verschillende oorzaken, zoals dyslexie, dyscalculie, cognitieve beperkingen of juist hoogbegaafdheid. Leerproblemen kunnen ook worden veroorzaakt door een non-verbale leerstoornis of door tekorten in de executieve functies, zoals vaak het

  7. Het innovatiepotentieel van klantenservicemedewerkers benutten

    NARCIS (Netherlands)

    Schepers, J.J.L.; Langerak, F.

    2014-01-01

    Veel bedrijven zetten klantenservicemedewerkers, zoals callcenter-medewerkers of servicetechnici, uitsluitend in om problemen bij klanten zo snel mogelijk te verhelpen. Helaas gaan marketing- en servicemanagers vaak voorbij aan het feit dat deze medewerkers dagelijks in aanraking komen met

  8. Tunnelvisie op tunnelvisie? PVO en de spanning tussen voorzorg en daadkracht in de grootschalige opsporing

    NARCIS (Netherlands)

    Helsloot, I.; Groenendaal, J.

    2013-01-01

    In dit artikel onderzoeken we de betekenis van het Nederlandse landelijke Programma Versterking Opsporing (PVO) voor het kunnen onderkennen van tunnelvisie en andere procesaspecten tijdens het opsporingsproces door Teams Grootschalige Opsporing (TGO’s). Hiertoe hebben we het PVO-beleid geanalyseerd,

  9. Over ontmoetingen tussen mensen met en zonder verstandelijke beperking in omgekeerde-integratiesettingen

    Directory of Open Access Journals (Sweden)

    Gerda Scholtens

    2016-09-01

    Full Text Available Gustaaf Bos. Antwoorden op andersheid. Over ontmoetingen tussen mensen met en zonder verstandelijke beperking in omgekeerde-integratiesettingen. Nieuwegein: EPC, 2016, 379 p. ISBN: 9789462287358

  10. Handelsrelaties in de aardappel- en varkenssector; De relatie tussen aanbieder en afnemer

    NARCIS (Netherlands)

    Janssens, S.R.M.; Hoste, R.; Baltussen, W.H.M.; Bunte, F.H.J.

    2012-01-01

    De relaties tussen aanbieder en afnemers van agrarische producten zijn veelal langdurig. Telers en verwerkers van industrieaardappelen sluiten vaker rechtstreeks overeenkomsten met elkaar dan varkenshouders, die de afzet via de tussenhandel prefereren. Varkenshouders en aardappeltelers hebben beiden

  11. Exercices de vocabulaire en contexte niveau débutant

    CERN Document Server

    Eluerd, Roland

    2005-01-01

    Un entraînement à l'acquisition du lexique en contexte. Avec de nombreuses illustrations. Cet ouvrage s'adresse à des adolescents ou adultes débutants pour un travail en classe ou en autonomie. Un livre très simple à utiliser: 1 leçon = 1 thème = 1 double page - Un sommaire thématique en 50 leçons réparties selon 10 grands thèmes. Les 50 leçons suivent une progression méthodique de découverte et de pratique du vocabulaire conçue pour des lecteurs débutants (niveau A1 du cadre européen commun de référence). - Pour chaque leçon: > une présentation illustrée du vocabulaire, en contexte, en page de gauche; > des activités très simples (autonomie) en parge de droite. - Un index est proposé en fin d'ouvrage.

  12. Alledaagse omgang tussen zorgprofessionals en zorgontvangers als vindplaats voor goede (LVB zorg

    Directory of Open Access Journals (Sweden)

    Michael Kolen

    2017-09-01

    where opportunities for dealing with these problems arise, that constitutes the assessment criterion. SAMENVATTING Alledaagse omgang tussen zorgprofessionals en zorgontvangers als vindplaats voor goede (LVB zorgIn een zorgethisch georiënteerd, conceptueel en kwalitatief empirisch onderzoek naar de zorgpraktijk van professionals en jongeren met een licht verstandelijke beperking (lvb-jongeren zijn we nagegaan hoe de alledaagse omgang tussen hen verloopt en welke morele oriëntaties daarbinnen werkzaam zijn. Die alledaagse omgang is geen “tussentijd”, tijd tussen de momenten van echte zorg, therapie, behandeling, maar is juist vindplaats van goede zorg. We tonen aan hoe die alledaagse omgang doordrongen wordt van “institutioneel gewenste effecten” die van buiten komen. Ons punt is dat de omgang ook van binnenuit morele mogelijkheden in zich draagt te ontdekken wat de jongere goed blijkt te doen. Om goed te kunnen waarnemen wat er aan de orde is, introduceren we een aantal theoretische concepten die daarbij helpen. Het blijkt dat de jongeren en hun begeleiders in de alledaagse omgang ruimte creëren, met elkaar een welbepaalde dynamiek aangaan en daarin ontdekken wat het goede is dat gedaan moet worden. De resultaten van ons onderzoek presenteren we in een typologie. Zo leggen we de alledaagse omgang in moreel opzicht open. De mogelijkheden worden zichtbaar die alledaagse omgang voor goede zorg biedt. Het zijn mogelijkheden die momenteel in de zorg nauwelijks worden onderkend. De morele oriëntaties blijken niet perse van buitenaf geïmporteerd te hoeven worden.

  13. 'n Vergelyking tussen mielie en sorghumgraan as bronne

    African Journals Online (AJOL)

    drodmateriaal) is nagegaan. Die vervanging van mieliemeel met 50% nie- vodlbestande + 50% voelbestande graansorghum in die dieet is ook ondersoek. Die diete het nagenoeg 1170 ruproteien op'n vogvrye basis bevat. Ses groepe, van veer' tig agtien-maand-oud Simmentalerosse per groep, is gebruik. Die ses diijte is ...

  14. Preken tussen de verhalen: een homiletische doordenking van narrativiteit

    NARCIS (Netherlands)

    Dusseldorp, Cornelis van

    (Nederlands) Verhalen staan op vele manieren in de belangstelling. Narratief onderzoek van mens en wereld vormt een brede stroom in de sociale wetenschappen. In de preekleer is aandacht voor het vertellen nooit helemaal weggeweest, maar in de laatste decennia steeds sterker naar voren gebracht.

  15. Kritiese geletterdheid: Die ontmoeting tussen die Westerse sekularisme en Islamitiese spiritualiteit in geselekteerde romans vir jong volwasseness – 'n benadering

    Directory of Open Access Journals (Sweden)

    Salome Romylos

    2016-11-01

    Full Text Available Hierdie artikel het ten doel om aan te toon dat die geselekteerde romans vir jong volwassenes potensieel kragtige ruimtes kan wees vir die skep van ’n bewustheid en beter begrip van Moslems, Islam, en veral van die dra van sluiers en kopdoeke. Kritiese geletterdheid as ’n metodologie word gebruik om te demonstreer hoe leerders gelei kan word om krities betrokke te raak by tekste. Dit is noodsaaklik, omdat blote oppervlakkennis nie genoeg is wanneer leerders gekonfronteer word met ingewikkelde kwessies soos ras, spiritualiteit en kultuur nie. Westerse televisie, koerante en tydskrifte skilder ’n baie eensydige beeld van Moslems as ’n naatloos homogene groep. Baie jong volwassenes neem aktief deel aan gesprekke op digitale media, soos Twitter en Facebook, waar kwessies van kultuur en diversiteit gereeld ter sprake kom. Westerlinge kan baie negatiewe persepsies van Islam en Moslems vorm wanneer hulle oorval word met ’n stortvloed beelde van gruwelikhede wat uitgevoer word deur ekstremistegroepe soos die Islamitiese Staat van Irak en die Ooste (ISIS. Die gevolg is dat alle Moslems gestereotipeer word as fundamentaliste, terroriste en onderdrukkers van vroue. Hierdie kenniskonstruk word gemanipuleer deur die media. ’n Begrip van die redes waarom vroue ’n stuk lap – die kopdoek – dra, kan ’n beginpunt wees vir die verandering van persepsies van Moslems en hul verskillende praktyke. Opvoeders moet oppas om nie net verdraagsaamheid tussen verskillende kulturele groepe te verkondig nie, want verdraagsaamheid impliseer ’n blote bestuur van ’n mens se gevoelens van afsku vir dit wat verdra word. Vrae wat uit ’n standpunt van kritiese geletterdheid gestel kan word aan tekste soos The breadwinner-trilogie deur Deborah Ellis en The girl in the tangerine scarf by Mohja Kahf, word bespreek as voorbeelde wat in die klaskamer gebruik kan word. Hierdie tekste beeld Moslemvroue en -meisies baie anders uit en kan vergelykend gelees word

  16. Onderzoek naar effecten van bepaalde stoffen op het alcoholslot

    NARCIS (Netherlands)

    Muilwijk, Mirthe; Alewijn, M.; Ruth, van S.M.

    2014-01-01

    Ieder jaar vallen er doden en gewonden in het verkeer bij ongevallen waarbij alcohol in het spel is. Het alcoholslotprogramma draagt bij aan het omlaag brengen van het aantal verkeersslachtoffers en is bedoeld voor bestuurders die met te veel alcohol op aan het verkeer hebben deelgenomen. Als

  17. Beoordeling RWA-installatie Atrium Vertigo: Rookverspreiding door het gebouw

    NARCIS (Netherlands)

    Neuhaus, E.

    2004-01-01

    Het atrium van het Vertigo-gebouw is bouwkundig bedoeld als één groot brandcompartiment. De schuifdeuren en ramen naar aanliggende vertrekken staan echter vaak open. Hierdoor kan de rook zich in het geval van een brand in het atrium gemakkelijk door het gebouw verspreiden door een overdruk in het

  18. Ervaringen met ICT-onderzoek in het HBO.

    NARCIS (Netherlands)

    van Leeuwen, H.; Teeuw, W.J.; Tangelder, R.; Griffioen, P.; Krose, B.; Schouten, B.

    2011-01-01

    In dit artikel wordt het belang aangegeven van onderzoeksvaardigheden in het HBO. Met de komst van de lectoraten en de nieuwe positionering van het HBO is het belangrijk om een antwoord te vinden hoe het onderzoek binnen het HBO vormgegeven moet worden. Hierbij wordt gekeken naar de bruikbaarheid

  19. New living for elderly people. An outline of domotics and sustainability for elderly people; Het nieuwe wonen voor ouderen. Een omgevingsverkenning naar domotica en duurzaamheid voor ouderen

    Energy Technology Data Exchange (ETDEWEB)

    Dries, J.; Ellen, G.J.; Den Blanken, M. [TNO Strategie, Technologie en Beleid TNO-STB, Delft (Netherlands); Maas, N. [TNO Bouw, Delft (Netherlands)

    2003-03-01

    A brief overview is given of the possibilities for elderly people to make use of domotics in order to live on one's own. The results of the title study are based on literature and other information sources. [Dutch] Dit rapport geeft een beknopt overzicht van de mogelijkheden om met behulp van domotica ouderen langer zelfstandig en duurzaam te laten wonen. Binnen het begrip duurzaamheid wordt onderscheid gemaakt tussen ecologische duurzaamheid (planet), economische duurzaamheid (profit) en sociale duurzaamheid (people). Hiertoe zijn projecten, literatuur en andere informatiebronnen verzameld op het terrein van domotica, duurzaamheid en ouderen waaruit blijkt dat er, sinds domotica de laatste tien jaar actueel is geworden, al enorm veel geprobeerd en geschreven is. Met name de combinatie 'ouderen en domotica' en 'domotica en duurzaamheid' levert veel materiaal op. Zeldzamer is echter de combinatie van alledrie de elementen.

  20. 3D-computersimulatie van het verhardingsproces

    NARCIS (Netherlands)

    Eijk, van R.J.; Brouwers, H.J.H.

    2000-01-01

    De ontwikkeling van geavanceerde meettechnieken heeft het mogelijk gemaakt de structuur van cement en zijn hydratatieproducten te volgen en zo meer inzicht te krijgen in het ingewikkelde hydratatieproces. De beschikbaarheid van rekenkracht en vernieuwde kennis over de hydratatieproducten en

  1. Fieldlab als aanjager van het innovatie ecosysteem

    NARCIS (Netherlands)

    Stolwijk, C.; Seiffert, L.

    2016-01-01

    Recente ontwikkelingen op het gebied van innovatiebeleid tonen een hernieuwde aandacht voor de rol van fieldlabs in het aanjagen van het omliggende innovatie ecosysteem1. Voorbeelden van deze trend zijn o.a. de Europese ’Innovation Hubs’, de Duitse ‘Mittelstand 4.0-Kompetenzzentren’, en de

  2. De uitgever aan het woord / 2009

    NARCIS (Netherlands)

    Huibers, Theo W.C.; Voermans, Koen; van Hoorn, Hedde

    2009-01-01

    Het boek 'De uitgever aan het woord 2009' gaat over de trends en ontwikkelingen in de Nederlandse uitgeefsector. Het is een jaarlijks repeterend onderzoek dat in 2003 is opgezet door Theo Huibers (Thaesis). Allereerst komen de algemene trends en ontwikkelingen aan bod. Hierbij wordt gekeken naar de

  3. Het Europese uniemerk achter de douane

    NARCIS (Netherlands)

    Visser, D.J.G.

    2016-01-01

    Het ‘Gemeenschapsmerk’ wordt ‘Uniemerk’ en het wordt makkelijker voor merkhouders om op te treden tegen namaakproducten die zich ‘achter de Douane’ bevinden. Het beslag leggen op en laten vernietigen van namaakproducten vóórdat ze in de EU op de markt komen is veel efficiënter dan moeten wachten tot

  4. Consumentenonderzoek in het Restaurant van de Toekomst

    NARCIS (Netherlands)

    Wijk, de R.A.; Gorselink, M.; Steenbekkers, L.P.A.; Wabeke, M.; Thomasson, T.

    2010-01-01

    Miljoenen mensen lunchen dagelijks op hun werk. Over bijvoorbeeld motieven bij de keuze van maaltijdcomponenten, de invloed van de inrichting van het restaurant of variaties in het assortiment op dit keuzegedrag is weinig tot niets bekend. In het Restaurant van de Toekomst doet de Consumer Science

  5. Wat als de zon het licht uitdoet

    NARCIS (Netherlands)

    Zwamborn, A.P.M.

    2012-01-01

    Voor het leven op aarde speelt het aardmagnetisch veld een cruciale rol om ons tegen deze stroom geladen deeltjes te beschermen. In extreme situaties merken we de effecten van ruimteweer zelfs op aarde. Inzicht in het ruimteweer is daarom belangrijk om tijdig te kunnen beoordelen of zonneactiviteit

  6. Forum; Grote ambities van het Olympisch Plan

    NARCIS (Netherlands)

    Groot-Nuijten, de S.; Peters, K.B.M.

    2009-01-01

    De vragen in welke mate de maatschappij profiteert van investeringen in Olympische spelen, hoeveel meer gezondheid, trots en cohesie het plan oplevert en of het plan inderdaad de economie en de ruimtelijke ordening versterkt, zullen in de komende periode nog moeten worden beantwoord. Maar hoe we het

  7. Het cliché: Homeopathie is kwakzalverij!

    NARCIS (Netherlands)

    Baars, T.; Ellinger, L.; Livestock Research,

    2004-01-01

    In het project Bioveem (gericht op de biologische melkveehouderij) wordt o.a. gewerkt aan het verkrijgen van een beter inzicht in de homeopathie. Er is een deskstudie geschreven waarin wordt aangegeven waarom de toepassing van homeopathie zo moeilijk geaccepteerd wordt (de discussie rondom het

  8. Witte vlekken in het bereik van NME? : raamwerk voor het meten van gebruik en de effecten van NME in het primair onderwijs

    NARCIS (Netherlands)

    Vreke, J.; Langers, F.; Berg, van den A.E.

    2011-01-01

    In het NME-beleid wordt het geven van NME ingezet als instrument om bij te dragen aan het reduceren van de achteruitgang, in omvang en kwaliteit, van natuur en milieu. Het bereik van NME moet aangeven in hoeverre NME de bevolking heeft bereikt en aan dit doel heeft bijgedragen. Het identificeren van

  9. Bolwerk van de oude adel? Een kwantitatieve benadering van de adellijke vertegenwoordiging in het Belgische diplomatieke korps (1840-1940

    Directory of Open Access Journals (Sweden)

    Gertjan Leenders

    2016-06-01

    Full Text Available European diplomatic services in the nineteenth-century have often been characterised as strongholds of the old nobility. This article challenges this hypothesis by proposing a quantitative approach to the representation of the noble class in the Belgian diplomatic corps between 1840 and 1940. It is argued that, in comparison to the situation in the major European countries at that time, the Belgian nobility did not constitute a dominant factor in the diplomatic service, although it was better represented in the higher echelons. Throughout the nineteenth century, the number of aristocrats in the diplomatic service surprisingly rose simultaneously with the democratisation of politics. This re-aristocratisation of the diplomatic career is attributed mainly to the conferment of noble titles to diplomats with a middle-class background. Furthermore, this article will show that the democratisation of the diplomatic corps was a slow and gradual process, spread over the first half of the twentieth century.  De negentiende-eeuwse Europese diplomatieke diensten zijn vaak getypeerd als een bolwerk van oude adellijke families. Dit artikel bestudeert deze hypothese door de adellijke vertegenwoordiging in de Belgische diplomatie tussen 1840 en 1940 op een kwantitatieve manier te benaderen. In vergelijking met de Europese grootmachten van deze periode, vormde de Belgische adel geen dominante factor binnen de Belgische diplomatie, hoewel edelen wel beter vertegenwoordigd waren in de hoogste rangen van de hiërarchie. Verrassend genoeg steeg het aantal edelen aan het einde van de negentiende eeuw, op het moment dat de politiek meer en meer op een democratische basis georganiseerd werd. Deze re-aristocratisering van de diplomatieke carrière is voornamelijk toe te schrijven aan het verlenen van titels aan diplomaten met een burgerlijke achtergrond. Verder toont dit artikel aan dat de democratisering van het diplomatieke korps in de eerste helft van de twintigste

  10. Climate policy. The dirt, the country and the world. Part 1. Solo climate policy is damaging symbol politics; Klimaatbeleid. Het vuil, het land en de wereld. Deel 1. Solistisch klimaatbeleid is schadelijke symboolpolitiek

    Energy Technology Data Exchange (ETDEWEB)

    Tang, P. [Partij van de Arbeid PvdA Tweede Kamer, Den Haag (Netherlands)

    2008-01-15

    This article assumes that the objective of climate policy is to limit climate change. The alternative goal of security of supply was not considered. Some measures can be defended in view of both objectives. This is for example the case with energy saving. It is evident that the climate problem becomes increasingly urgent. If the Netherlands or Europe choose individual climate policy, some 'leakage effects' are unavoidable. Such symbol politics harm the economy, whereas the climate does not benefit. On a national and European scale all means must be put to use to bring global collaboration closer at the shortest possible term. [mk]. [Dutch] In dit artikel is verondersteld dat het doel van klimaatbeleid is om klimaatverandering te beperken. Buiten beschouwing bleef dat ook voorzieningszekerheid een doel kan zijn. Soms kunnen maatregelen met het oog op beide doelstellingen verdedigd worden. Dat geldt bijvoorbeeld voor energiebesparing. Duidelijk is dat het klimaatprobleem steeds urgenter wordt. Als Nederland of Europa kiest voor een solistisch klimaatbeleid zijn 'weglekeffecten' onvermijdelijk. Dergelijke symboolpolitiek schaadt de economie, terwijl het klimaat er niet bij gebaat is. Op nationaal en Europees niveau moet alles op alles worden gezet om mondiale samenwerking dichterbij te brengen, op zo kort mogelijke termijn.

  11. De gevel - een intermediair element tussen buiten en binnen : Over het tonen en vertonen van het twintigste -eeuwse woongebouw in Nederland

    NARCIS (Netherlands)

    Jurgenhake, B.M.

    2016-01-01

    The research focusses on the façade of the collective residential building in the Dutch city. The high complexity of functions of the façade makes it a very sensitive element of the house. The façade is the skin of the house, a boundary between outside and inside, between public and private. Here

  12. Gevormd door leeservaringen : De relatie tussen leesattitude, het lezen van fictie en het voornemen van adolescenten om lid te blijven van de openbare bibliotheek

    NARCIS (Netherlands)

    Stalpers, C.P.

    2005-01-01

    Each year more than 40 percent of all people in the age of 18 to 20 years does not renew their subscription to the public library. As nearly two-third of all items borrowed at public libraries consists of fiction, it is hypothesized that the decision to remain using the public library is related to

  13. De invloed van een verschuiving in beginnersmobiliteit op de trendbreuk in het aantal verkeersdoden tussen 2003 en 2004 : analyse op basis van veranderingen in het autoparkbezit onder jongeren.

    NARCIS (Netherlands)

    Stipdonk, H.L. & Bijleveld, F.D.

    2011-01-01

    The influence of a shift in young novice driver mobility on the broken trend in the number of road fatalities between 2003 and 2004. In recent decennia, the number of road fatalities has seen a downward trend. In 2004, the number of road fatalities showed a relatively strong decrease of more than

  14. Versoening tussen leerders: Is parallelmediumskole die antwoord op die rassismeprobleem?

    OpenAIRE

    Du Plessis, Elize; Marais, Petro

    2017-01-01

    Die Suid-Afrikaanse Grondwet stel dit duidelik dat enige vorm van diskriminasie nie toegelaat mag word nie. In ons skole beteken dit dat elke leerder ʼn reg het op goeie opvoeding en ʼn veilige skoolomgewing. Die fokus van hierdie navorsing is gerig op bestaande parallelmediumskole. Die uiteindelike vraagstuk is dus hoe multikulturele onderwys bevorder word en hoe rassisme aangespreek kan word? As teoretiese raamwerk is Kohlsberg se kognitiewe ontwikkelingsbenadering en Whitehouse se univerele ...

  15. Het Bijbelse scheppingsverhaal en de natuurwetenschap

    Directory of Open Access Journals (Sweden)

    A. A. Manten

    1958-03-01

    Full Text Available Het is dit jaar precies een eeuw geleden, dat gezamenlijk door Charles Darwin en A. R. Wallace het begrip evolutie vaste voet kreeg in de moderne natuurwetenschappen. Vanaf het eerste ogenblik werd dit begrip zowel enthouiast verdedigd als scherp aangevallen. Binnen de kringen der natuurwetenschap werd de tegenstand echter al snel minder en tegenwoordig wordt daar het feit der evolutie wel algemeen aanvaard. Als er hier nog wat strijd is, dan gaat dat slechts over bepaalde bijzonderheden en zekere voorstellingen en niet meer over het begrip evolutie als zodanig.

  16. In de ban van het incestverbod : analyse van een historische omslag in de verbeelding van erotiek tussen broer en zuster

    NARCIS (Netherlands)

    Coebergh-van der Marck, Marie-Anne

    2012-01-01

    Central in the representation of eroticism between brother and sister, classical theme in litterature and film, stands the incest prohibition as source of tension between similarity and difference. Brother and sister share the same genes and because of this they belong together and go different

  17. Mind the gap! Over het (vermeende) belang van de verschillen tussen common law en civil law voor de rechtsfilosofie

    NARCIS (Netherlands)

    Pierik, R.

    2010-01-01

    For many legal scholars it goes without saying that legal and legal-philosophical theories originate in specific societal contexts and that this contextual character should always be taken into consideration. This implies, for example, that we should take the differences between the common law and

  18. Crisis als kans? Over de relatie tussen crises en hervormingen in het vreemdelingenbeleid van Nederland en Duitsland

    NARCIS (Netherlands)

    Alink, F.B.

    2006-01-01

    Crisis: opportunity to reform? Reform in the wake of a crisis is often resisted by the bureaucracy and by society out of fear of, or lack of knowledge about the consequences of these proposals for change. Although policy reform and creation are generally the products of incremental change, policy

  19. Verheerlijken, kraken en verguizen: burgerlijke en antiburgerlijke fans rond het Amsterdamse standbeeld van Vondel tussen 1867 en 2010

    NARCIS (Netherlands)

    Jongsma, J.; Rock, J.

    2014-01-01

    This article examines the functions of the statue of early modern Dutch playwright Joost van den Vondel, since its unveiling in 1867 (in the Amsterdam Vondelpark) until the present day. Building on studies of literary memory culture and fandom, we argue that the statue can be understood as a product

  20. Het verschil tussen praten en communiceren : De functionele communicatie bij patiënten met cognitieve communicatiestoornissen

    NARCIS (Netherlands)

    Hüsers, Sarah; Jonkers, Roel

    2017-01-01

    Language and cognition influence each other and cognitive disorders can be the cause of communicative problems named cognitive communication disorders. Traditional language tests are not capable of diagnosing these problems as they appear in pragmatic language use rather than in linguistics and

  1. Immunologie in de medische praktijk. XXXI. Erfelijke immuundeficiënties: verband tussen klinische symptomen en afwijkingen van het immuunsysteem

    NARCIS (Netherlands)

    Vossen, J. M.; Kuijpers, T. W.

    2000-01-01

    Severe congenital immunodeficiency diseases occur in approximately 1:10,000 newborns, in Western Europe and North America. They are characterised by recurrent infections, mostly caused by opportunistic micro-organisms, and autoimmune phenomena. In many patients the immune deficiency occurs as part

  2. Messiaanse vredestichters: Intertekstuele relaties tussen Zacharia 9–14 en het Evangelie van Matteüs

    Directory of Open Access Journals (Sweden)

    Wim J.C. Weren

    2015-08-01

    Full Text Available Messianic peacemakers: Intertextual relationships between Zechariah 9-14 and the Gospel of Matthew. This article deals with images of war, violence and peace and with the role of messianic leaders in Deutero-Zechariah and the way in which texts from Zechariah 9–14 have been interpreted in the Gospel of Matthew. The first section describes the lines of meaning in Zechariah 9–14 on the basis of word fields related to violence and universal peace. The second section discusses Deutero-Zechariah’s own position in the development of messianic expectations in Old Testament texts. In the third section, the question is asked how the meaning of texts from Zechariah 9–14 about messianic leaders has been influenced by earlier prophetic texts, and how these texts in their turn have been transformed and updated in the Gospel of Matthew, which contains explicit quotations from Deutero-Zechariah in 21:5; 26:15; 26:31 and 27:9–10. The fourth section summarises some interesting semantic shifts appearing in Matthew’s gospel compared to Deutero-Zechariah. Moreover, some critical comments are presented against the idea defended in some recent studies that there is a sharp tension between Jesus’s role in Matthew as the bringer of a peaceful ethical message, and his violent and vindictive role at the final judgement. At the end of this article, the burning question is raised whether Zechariah’s and Matthew’s messages, both of which are characterised by a certain degree of exclusivity, can play a constructive role in modern multi-religious discussions about common roads leading to global peace.

  3. Embedded Linux in het onderwijs

    NARCIS (Netherlands)

    Dr Ruud Ermers

    2008-01-01

    Embedded Linux wordt bij steeds meer grote bedrijven ingevoerd als embedded operating system. Binnen de opleiding Technische Informatica van Fontys Hogeschool ICT is Embedded Linux geïntroduceerd in samenwerking met het lectoraat Architectuur van Embedded Systemen. Embedded Linux is als vakgebied

  4. Beter forecasten in het callcenter

    NARCIS (Netherlands)

    Ent, L. van der

    2010-01-01

    Soms loopt het storm in een callcenter en worden de weinige medewerkers overgoten met een regen aan telefoontjes. Andere keren zitten ze in een luwte en moeten ze wachten totdat iemand belt. De callcentermanager wil zowel over- als ondercapaciteit juist zoveel mogelijk voorkomen. Maar hoe kan hij

  5. Esthetische tandheelkunde in het kindergebit

    NARCIS (Netherlands)

    de Kloet, H.J.; Roeters, F.J.M.; van Amerongen, W.E.; Martens, L.C.; Stel, G.; Veerkamp, J.S.J.

    2013-01-01

    Het kindergebit heeft niet alleen een functie bij kauwen en spreken, maar ook een esthetische functie. Wellicht staat dit laatste minder op de voorgrond dan bij sommige volwassenen, maar toch is gebleken dat ook kinderen (en hun ouders) ernstig gebukt kunnen gaan onder ontsierende gebitsafwijkingen.

  6. Tussen liberalisme en conservatisme: de verkiezingscampagnes van Jimmy Carter (1962-1980)

    NARCIS (Netherlands)

    van Nijnatten, F.J.C.M.

    2012-01-01

    De overwinning van de zuidelijke Democraat Jimmy Carter bij de Amerikaanse presidentsverkiezingen van 1976 geldt voornamelijk als een gevolg van de Vietnamoorlog en het Watergateschandaal, crises die het vertrouwen van de bevolking in de regering hadden aangetast. Jimmy Carters campagnearchieven

  7. Het hoe en waarom van gebiedsondernemingsplannen : een handreiking aan het gebiedsmanagement van Het Oosten

    NARCIS (Netherlands)

    Groot, J.K.H.

    2006-01-01

    Two social housing associations (Het Oosten and De Key) and a developer (Rabo Vastgoed) have established an investment fund, called Stedenfonds. This fund will buy all the commercial real estate in certain urban areas, wherein the founders of the fund are active. In these areas value development

  8. Het nieuwe werken 2.0: menselijk gedrag als uitgangspunt

    OpenAIRE

    Hoendervanger, Jan Gerard; van der Blonk, Heico

    2013-01-01

    Het Nieuwe Werken gaat momenteel een tweede fase in. Van een periode waarin de bricks en de bytes centraal stonden in het veranderingsproces, naar een periode waarin het veranderen van behaviour leidend is. Dit gaat gepaard met meer aandacht en ruimte voor individuele verschillen en het vraagt om innovatie op het snijvlak van HRM, ICT en FM. Wat betekent dit voor facility managers?

  9. spiritualiteit in het lucasevangelie: geschiedenis en bevrijding1

    African Journals Online (AJOL)

    (Cadbury 1927) moet bezien worden of oordelen over de schrijfstijl en de presentatie van het materiaal in Handelingen ook betrekking hebben op het evangelie. Een snelle blik op het begin van het eerste deel van het lucaanse dubbelwerk maakt reeds helder dat de karakterisering van Lucas als geschiedschrijver ook hier ...

  10. Het integraal ontwerpen van gevel en installatie, slimbouwen

    NARCIS (Netherlands)

    Lichtenberg, J.J.N.; van Dartel, H.A.J.; Zeiler, W.; Panhuys, van O.T.H.

    2005-01-01

    Binnen het bouwproces zijn veel verschillende partijen en disciplines betrokken. Het langs elkaar heen werken van diverse disciplines leidt tot faalkosten. Bovendien wordt dan het vereiste kwaliteitsniveau niet behaald. Voor het wel slagen van het bouwen is de architect in zijn rol als bouwmeester

  11. Het “menschenpakhuis van de Sphinx”? : Het Boschstraatkwartier-Oost te Maastricht in 1904-1905

    NARCIS (Netherlands)

    Drs. Thijs van Vugt

    2005-01-01

    Een verslag van het onderzoek naar de bewoners van het Maastrichtse Boschstraatkwartier-Oost in het begin van de twintigste eeuw. In deze wijk woonden veel werknemers van de nabijgelegen Sphinxfabriek. Het is een analyse van het demografisch gedrag, de sociale verhoudingen en de beroepssamenstelling

  12. Natuurlijk, lekker en gezond : een enquete bij het Thuispanel over de kwaliteitsbeleving van het voedsel

    NARCIS (Netherlands)

    Cramwinckel, A.B.; Mazijk - Bokslag, van D.M.

    1991-01-01

    Aan de leden van het Thuispanel zijn 23 verschillende stellingen voorgelegd die verband houden met de beleving van de kwaliteit van het voedsel. Verder kon men zelf trends aangeven die men meende waar te nemen. Deze benadering geeft de mogelijkheid na te gaan welk beeld respondenten hebben over het

  13. Verspreiding van zout bij het terugwinnen van zeezand uit een depot in het Haringvliet

    NARCIS (Netherlands)

    Kranenburg, C.

    1991-01-01

    Dit rapport geeft een beknopte analyse van de verdunning en verspreiding van zout vanuit een gepland depot voor ontzilt zeezand in het Haringvliet. Beschouwd zijn de initiële menging van het zout bij terugwinnen van het zand, de verspreiding door stroming en turbulentie bij geopende spuisluis, en de

  14. Influenza in het seizoen 1994/'95: vaccinsamenstelling voor het seizoen 1995/'96.

    NARCIS (Netherlands)

    Claas, E.C.J.; Jong, J.C. de; Bartelds, A.I.M.; Rimmelzwaan, G.F.; Wijngaarden, J.K. van; Osterhaus, A.D.M.E.

    1995-01-01

    Het influenzaseizoen 1994/'95 werd in Nederland gekenmerkt door geringe influenza-activiteit, die zich pas eind februari manifesteerde. De influenza-activiteit bleef verhoogd tot eind april, hetgeen ongewoon laat is, en nam alleen in het zuiden van het land epidemische vormen aan. Zowel

  15. effet des ados en courbes de niveau sur la distribution et la diversite ...

    African Journals Online (AJOL)

    Administrateur

    d'arachide a permis d'évaluer les performances des ados en courbes de niveau. ... However, in a context of global environmental degradation, only some information on their effects on ..... gestion de l'eau du sol et le rendement des cultures ...

  16. 410 Contamination métallique de Gambusia holbrooki au niveau du ...

    African Journals Online (AJOL)

    youness

    Contamination métallique de Gambusia holbrooki au niveau du lac Fouarat et de l'estuaire Sebou dans la région du. Gharb (Maroc). Bachir EL BOUHALI1, Laila BENNASSER1*, Issad NASRI2,. Vincent GLOAGUEN3 et Aziza MOURADI1. 1 Université Ibn Tofail, Faculté des Sciences, Laboratoire de Biochimie et.

  17. 1001 Vrouwen in perspectief. Traditie en verandering van het biografische woordenboek in Nederland en elders

    Directory of Open Access Journals (Sweden)

    Mineke Bosch

    2014-03-01

    echter niet meer vandeze tijd. Sinds de jaren zeventig van de vorige eeuw zijn daar dan ook correcties op uitgevoerd. In Amerika verscheen bijvoorbeeld als aanvulling op de Dictionary of American Biography een biografisch woordenboek van vrouwen, de Notable American Women. De Britse Dictionary of National Biography daarentegen, besloot tot een aanvulling én algehele herschrijving van alle lemma’s, om opnieuw te verschijnen als Oxford Dictionary of National Biography. In dit werk is sprake vaneen paradigmawisseling omdat de basisvraag voor opname niet meer is wie in het verleden kwam bovendrijven, maar wie volgens hedendaagse normen van geschiedschrijving een lemma verdient. Tegen deze historische achtergrond beantwoordt Bosch vragen over hoe de relatie is tussen 1001 Vrouwen en het Biografisch Woordenboek van Nederland. Was het de bedoeling om bestaande gegenderde canoniseringsprocessen tegen te gaan? Is het werk te beschouwen als ‘herstory’ of als een ‘herschrijving’ van de geschiedenis?

  18. Het handwerk van de theorie in de praktijk van het Sociaal Werk

    Directory of Open Access Journals (Sweden)

    Hans Oostrik

    2010-06-01

    Sociaal werk is een narratieve praktijk. Vanuit een sociaal-constructivistische invalshoek, reflecteert de auteur in dit artikel op de vraag hoe vanuit deze narratieve praktijk tot theoretische handelingsmodellen kan worden gekomen. Drie elementen spelen daarbij een rol, welke door de auteur worden behandeld. Ten eerste zijn dat de vaardigheden van de professional, die bijdragen aan conceptualisering, zoals daar zijn: het signaleren van kwesties, het analyseren en vormen van begrippen en het ontwerpen van conceptuele modellen. Ten tweede kunnen theoretische modellen in de praktijk van het sociaal werk gebruikt worden als instrumenten om die praktijk als het ware te theoretiseren of reflectief te maken. De praktijk wordt met behulp van modellen zoals scenario’s en stappenplannen, verbeterd en verder ontwikkeld. Ten derde bestaat het handwerk van de theorie in het innemen van een theoretische houding of praktische verstandigheid waardoor sociaal werkers beter om kunnen gaan met de complexiteit van hun praktijk.

  19. Bestrijdingsmiddelen in oppervlaktewater van het Westland

    NARCIS (Netherlands)

    Greve PA; Luttik R; Linders JBHJ

    1989-01-01

    Oppervlaktewatermonsters, maandelijks genomen op 10 punten in het Westland gedurende de periode april 1988 t/m januari 1989, zijn onderzocht op het voorkomen van 77 bestrijdingsmiddelen en verwante stoffen. Aldicarb-sulfon, aldicarb-sulfoxide, atrazin, diazinon, dichlobenil, alpha- en

  20. "Neem het dier serieus als individu"

    NARCIS (Netherlands)

    Kleis, R.; Driessen, C.P.G.

    2014-01-01

    Ethiek op de boerderij komt het beste uit de verf door samen met dieren nieuwe technologie te ontwikkelen. Filosoof Clemens Driessen, de man van het varkensspel Pig Chase, promoveerde afgelopen week cum laude op Animal deliberation, the co-evolution of technology and ethics on the farm. Resource

  1. Business Intelligence & Analytical Intelligence: hou het zakelijk

    OpenAIRE

    Van Nieuwenhuyse, Dries

    2013-01-01

    Technologie democratiseert, de markt consolideert, terwijl de hoeveelheid data explodeert. Het lijkt een ideale voedingsbodem voor projecten rond business intelligence en analytics. “Hoe minder de technologie het verschil zal maken, hoe prominenter de business aanwezig zal zijn.”

  2. Hoe de statolder het Italiaans is binnengekomen

    NARCIS (Netherlands)

    Boer, M.G. de

    2009-01-01

    SAMENVATTING Het woord stadhouder, dat in Nederland in 1572 een gespecialiseerde betekenis krijgt en zich daarna als internationalisme verspreidt in de wereld van de internationale politiek, wordt hier bestudeerd tegen de achtergrond van een leenwoordtheorie die zich vooral richt op het

  3. Het microscopisch onderzoek van amandelspijs en banketspijs

    NARCIS (Netherlands)

    Jong, de W.J.H.J.

    1982-01-01

    Nagaan of het door middel van microscopisch onderzoek mogelijk is om de identiteit vast te stellen van de gebruikte grondstoffen bij de bereiding van amandelspijs en banketspijs. Van een aantal monsters (22) gevulde speculaas werd de spijs geïsoleerd. Voor het microscopisch onderzoek werden een

  4. Het juiste werk voor een bijzonder talent?

    NARCIS (Netherlands)

    Wijn, R.; Kleij, R. van der

    2012-01-01

    TNO draagt met diverse onderzoeken bij aan het ontwikkelen en toepassen van kennis om de effectiviteit van cameratoezicht te vergroten. Dit artikel beschrijft een onderzoek naar de mogelijkheid om mensen met stoornissen in het autistische spectrum in te zetten in cameratoezichtcentrales.

  5. Voetvochtproblemen verminderen bij het dragen van veiligheidsschoenen

    NARCIS (Netherlands)

    Huppes, G.

    1990-01-01

    Door het dragen van persoonlijke beschermingsmiddelen wordt de werknemer tegen gevaren beschermd. In de praktijk blijkt echter dat werknemers vaak moeilijk te motiveren zijn de middelen consequent en juist toe te passen. Het is daarom erg belangrijk de nadelen van persoonlijke beschermingsmiddelen

  6. Lean Six Sigma in het ziekenhuis: De beschikbaarheid van infuuspompen

    NARCIS (Netherlands)

    Does, R.J.M.M.; Kemper, B.P.H.; Koopmans, M.

    2011-01-01

    In het topklinisch ziekenhuis Medisch Spectrum Twente werd in 2008 een Lean Six Sigma-project gestart. Het doel was vermindering van operationele kosten van infuuspompen. Het is een interessant voorbeeld van Lean Six Sigma in de gezondheidszorg, omdat het laat zien dat kostenbesparing niet hoeft te

  7. Microphonische effecten in het labyrinth van de duif.

    NARCIS (Netherlands)

    Bleeker, Jacob Dirk Jan Willem

    1949-01-01

    In dit proefschrift wordt een experimenteel onderzoek beschreven over het vaststellen van potentiaalverschillen in het binnenoor van de duif bij het inwerken van geluid onder verschillende omstandigheden. De oorspronkelijke doelstelling was het effect na te gaan van de fenestratie van een booggang,

  8. WINDLIDAR: een remote sensing meettechniek voor het bepalen van windvelden

    NARCIS (Netherlands)

    van Vliet REC; van der Meulen A; Swart DPJ

    1986-01-01

    Windlidar is een remote sensing techniek voor het bepalen van wind- velden. Het systeem is gebaseerd op het herkennen van aerosol struc- turen in de atmosfeer met behulp van correlatie technieken. Afmetingen en levensduur vormen de belangrijkste parameters in deze techniek. Het verticale

  9. Strategische marketing : De tien geboden van het gezonden verstand

    NARCIS (Netherlands)

    Moenaert, R.K.; Robben, M.

    2007-01-01

    Door de jaren heen is de klassieke strategische doctrine nogal eens ter discussie gesteld. En het boek ‘Blue Ocean Strategy’ versterkt die trend alleen maar. In het boek staat waarde-innovatie centraal en het biedt, in tegenstelling tot eerdere werken zoals het pamflettistisch-kritische betoog van

  10. Slim in het verkeer met open data : adviesrapport

    NARCIS (Netherlands)

    Boelens, Danny; Plasmeyer, Luuk; van Heesewijk, Nick; Smeenge, Tetiana; Hoekzema, Niek; McCreesh, Séamus

    2013-01-01

    Rapport in opdracht van de gemeente Groningen. Aanleiding voor het schrijven van dit rapport is dat de gemeente Groningen graag wil weten hoe ze met het gebruik van open data het (openbaar) vervoer voor studenten in en naar de stad Groningen kunnen verbeteren. Het onderzoek richtte zich daarom op

  11. Twee kwesties naar aanleiding van het vonnis tegen Mohammed B.

    NARCIS (Netherlands)

    van Hattum, W.F.; de Jong, D.H.

    2006-01-01

    Aan de hand van twee kwesties rond de berechting van Mohammed B. willen wij laten zien dat een enge interpretatie van het strafprocesrecht - bijvoorbeeld een opvatting die voornamelijk uitgaat van het verdedigingsbelang - tekort kan doen aan het doel van het strafproces. In dat proces is ook plaats

  12. Kengetallen kosten-batenanalyse van het WK voetbal

    NARCIS (Netherlands)

    van den Berg, M.; de Nooij, M.; Koopmans, C.

    2010-01-01

    In Nederland bestaan ambities om in 2018 of 2022 het WK voetbal te organiseren, samen met België. Hiervan worden positieve impulsen verwacht voor het imago van Nederland, het toerisme en de economische groei. Ook krijgt het organiserend comité een vooraf vastgestelde bijdrage van de FIFA. De

  13. Aeromonas spp. in het Nederlandse drinkwater; een orienterend onderzoek

    NARCIS (Netherlands)

    Versteegh JFM; During M; Havelaar AH; Koot W

    1986-01-01

    In dit rapport worden uitvoering en resultaten van een orienterend onderzoek naar het voorkomen van Aeromonas spp. in het Nederlandse drinkwater in 1985 besproken. Het bleek dat in 71% van de onderzochte monsters (rein water "af pompstation" en water uit het distributienet) in 100 ml

  14. Het nieuwe veehouden: realisatietrajecten : verdere verduurzaming in de veehouderij

    NARCIS (Netherlands)

    Kortstee, H.J.M.; Vrolijk, M.; Bremmer, B.; Doornewaard, G.J.

    2014-01-01

    In Het nieuwe veehouden zijn 22 veehouders geholpen om hun individuele plannen voor duurzamere bedrijfsconcepten daadwerkelijk te verwezenlijken. Het doel van het project was het leveren van een bijdrage aan een transitie rond verduurzaming in de landbouw en daar (al doende) van te leren.

  15. n by- kans tradisionele insinking gevolg. Daarna het

    African Journals Online (AJOL)

    Op 3 Julie 1942 het die DAF 770 krygsvlugte uitgevoer, waarvan 155 of rekening van no 3. (SA) Vleuel gekom het. Op 4 November 1942 het Rommel se terugtog begin: Eers van EI. Alamein na Agheila, daarna na Tripoli en ver- volgens na Tunisie en in Mei 1943 die ont- ruiming van Afrika. Sedert April 1941 het die SALM ...

  16. Towards a sustainable livestock sector. Developments between 2000 and 2010; Op weg naar een duurzame veehouderij. Ontwikkelingen tussen 2000 en 2010

    Energy Technology Data Exchange (ETDEWEB)

    Van Zeijts, H.; Van Eerdt, M.M.; Willems, W.J.; Rood, G.A.; Den Boer, A.C.; Nijdam, D.S.

    2010-06-15

    A more sustainable livestock sector has been the ambition of the Dutch Ministry of Agriculture, Nature and Food Quality. The goals have been set high. More sustainable production methods are still needed, as is healthier livestock, animal suffering has to be kept to a minimum, and all of this in a healthy commercial climate. The Netherlands Environmental Assessment Agency has drawn up the balance of progress made over the past ten years. Unquestionably, the sector is moving towards sustainability. However, development is slow and so far the desired 'redesign' is not visible - a redesign that was recommended by the Wijffels Committee in 2001. Advances have been made in certain areas. Today, animal suffering is less than it was some ten years ago. New vaccination methods with different policies have resulted in less of a need for the application of large-scale animal euthanasia. The use of sustainable stables is gaining ground, albeit at a modest pace. The success of free-range egg farming demonstrates that consumers can coerce a market towards sustainability. Further, there has been a spectacular decrease in emissions of nitrogen and phosphates into the environment. However, in other areas little or no progress has been made. Long-distance transport of livestock takes place just as often as it did in 2000. Livestock farmers still use excessive amounts of antibiotics, and the consumer knows little about the environmental burden of products coming from the livestock industry. The Netherlands Environmental Assessment Agency is also looking towards the future. With clear goals and a tight schedule, the desired 'redesign' could still be developed. [Dutch] De doelstelling van dit rapport is om kwantitatief en kwalitatief inzicht te geven in de vorderingen die tussen 2000 en 2010 zijn gemaakt in het tot stand brengen van een duurzame veehouderij, geordend naar de zes speerpunten uit de Toekomstvisie op de veehouderij. De ontwikkelingen worden verklaard

  17. Recreant, patiënt en leerling; de stedeling aan het woord over het Land van Wijk en Wouden

    NARCIS (Netherlands)

    Borgstein, M.H.; Kornmann, G.J.

    2001-01-01

    In 1999 hebben enkele boeren en burgers uit het Land van Wijk en Wouden aandacht gevraagd voor de ontwikkelingen in het gebied. Dit heeft geresulteerd in het ontstaan van een gebiedscommissie. De gebiedscommissie heeft in april 2001 een integrale gebiedsvisie gepresenteerd. In het vervolg op de

  18. Meetstrategie TIG: opzet en nadere aanbevelingen. Metingen in het kader van het Nationaal Plan voor de Kernongevallenbestrijding

    NARCIS (Netherlands)

    Sonderen JF van; LSO

    1996-01-01

    De door de overheid vastgestelde interventieniveaus voor het nemen van maatregelen vormen het uitgangspunt voor het beschrijven van de noodzakelijke metingen in lucht, water, bodem, voedingsmiddelen en aan personen. Om alle meetinspanningen te coordineren is binnen het Nationaal Plan voor de

  19. Geohydrologische omstandigheden in de omgeving van het toekomstig relatienotagebied Het Limmer Die (ruilverkaveling 'Limmen - Heiloo', N.H.)

    NARCIS (Netherlands)

    Rees Vellinga, van E.

    1983-01-01

    Geohydrologische situatie van een drietal plaatsen in het ruilverkavelingsgebied 'Limmen-Heiloo'. Het betreft hier Het Die, het Limmerveentje en de eendenkooi direct ten noordwesten van Uitgeest. Dit, om te berekenen, welke gevolgen een peilverlaging in de omringende landbouwgebieden op de

  20. Évaluation du niveau de pollution par les métaux lourds des lacs ...

    African Journals Online (AJOL)

    La présente étude a pour objectif principal d'évaluer le niveau de pollution métallique des lacs Bini et Dang (Ngaoundéré, Cameroun) à travers l'analyse des eaux et des sédiments de surface. La concentration des métaux lourds (Ni, Cr, Fe, Pb, Cd, Zn) a été mesurée par spectrophotométrie d'absorption atomique.

  1. Intersectionaliteit en sociale inclusie: het Ei... van Troje. Deel 2: Het Ei van Columbus

    Directory of Open Access Journals (Sweden)

    Janneke van Mens-Verhulst

    2009-12-01

    In dit tweede deel van het artikel wordt beargumenteerd dat de intersectionele benadering op termijn echter het Paard van Troje kan blijken te zijn. Met name voor beleid en wetgeving omdat het een complexiteit binnenbrengt waarvan nog niet duidelijk is hoe die moet worden gehanteerd. Bovendien kleven er onderzoeksmethodologische implicaties aan, waardoor de gewenste wetenschappelijke evidentie maar moeilijk tot stand komt. Niettemin kan intersectionaliteit voorlopig een buitengewoon nuttige heuristiek zijn voor vraagstukken van sociale inclusie.

  2. De Grande Mosquée de Paris tussen eerbetoon en propaganda

    NARCIS (Netherlands)

    Spaan, S.J.

    2015-01-01

    In het hart van Parijs, tegenover de Jardin des Plantes, staat de Grande Mosquée de Paris, geopend in 1926. In elke toeristische gids staat dat de muntthee en baklava in het café heerlijk zijn en dat de moskee bedoeld was als eerbetoon aan de islamitische soldaten die in de Eerste Wereldoorlog hun

  3. The connection of offshore wind turbine farms to the frid. Actual developments in Germany; De aansluiting van offshore windparken op het net. Actuele ontwikkelingen in Duitsland

    Energy Technology Data Exchange (ETDEWEB)

    Linssen-van Dellen, M.J.M. [Legal Department, TenneT, Arnhem (Netherlands)

    2013-05-15

    Recently, the German energy legislation has changed with regard to the connection of offshore wind farms to the grid. The aim of the amendment was to diminish bottlenecks with regard to the (unlimited) liability of the operators responsible for the connection of wind farms. Also, coordination between the construction of wind farms and the construction of the networks at sea had to be improved. The author elaborates on regulatory changes [Dutch] Onlangs is de Duitse energiewetgeving gewijzigd ten behoeve van de aansluiting van windparken op zee op het elektriciteitsnet. Doel van de wetswijziging was onder meer om knelpunten weg te nemen met betrekking tot de (onbeperkte) aansprakelijkheid van de netbeheerders die verantwoordelijk zijn voor de aansluiting van de windparken. Verder moest worden voorzien in betere coordinatie tussen de bouw van de windparken en de aanleg van de netten op zee. De auteur gaat in deze bijdrage nader in op wijzigingen in de regelgeving.

  4. Authentieke contexten in wiskundemethoden in het vmbo

    NARCIS (Netherlands)

    Kemme, S.; Weijers, M.; Jonker, V.H.

    2003-01-01

    Centrale vraag Zijn de bestaande wiskundemethoden die gebruikt worden in de beroepsgerichte leerwegen van het vmbo bruikbaar in verband met authentiek leren en wat is daarvoor eventueel nog extra nodig. Belangrijkste conclusies De bestaande wiskundemethoden bevatten enkele authentieke

  5. Karakterisering van het "Etimologiewoordeboek van Afrikaans" (EWA)

    African Journals Online (AJOL)

    Als etymologisch woordenboek bezit EWA een aantal bijzondere, eigen kenmerken. De selectie van de woorden is bepaald door het beoogde gebruikerspubliek. Als gevolg daarvan bevat EWA verscheidene typen woorden die in traditionele etymologische woordenboeken doorgaans veronachtzaamd worden, zoals ...

  6. Applied Behavior Analysis: Het ABC van ABA

    NARCIS (Netherlands)

    Huskens, B.E.B.M.; Palmen, A.M.J.W.

    2016-01-01

    Gedragsinterventies staan internationaal volop in de belangstelling en worden ook door de Nederlandse Gezondheidsraad beschouwd als 'het best bewezen effectief' in de behandeling van mensen met een Autisme Spectrum Stoornis (ASS). Deze gedragsinterventies zijn gebaseerd op de wetenschappelijke

  7. Die verhouding tussen vertroue en diversiteitsklimaat by 'n Suid-Afrikaanse universiteit

    OpenAIRE

    McCallaghan, Sean; Heyns, Marita

    2016-01-01

    Hierdie studie stel ondersoek in na die verwantskap tussen vertroue en die diversiteitsklimaat binne 'n Suid-Afrikaanse tersiêre inrigting. 'n Kwantitatiewe benadering met behulp van 'n nie-waarskynlikheidsgerieflikheidsteekproef (N=350) is gevolg. Die vraelys wat in die studie gebruik is, maak gebruik van 'n kombinasie van drie vooraf-gevalideerde instrumente. Die resultate dui aan dat die werknemers saamstem dat die instelling bereid is tot diversiteitsbestuur en die uitskakeling van diskri...

  8. Die effek van intelligensie op die verhouding tussen lokus van kontrole en taakkompleksiteit

    Directory of Open Access Journals (Sweden)

    F. G. de Kock

    1995-06-01

    Full Text Available The effect of intelligence on the relationship between locus of control and task complexity. The aim of the study was to establish the effects of intelligence on the relationship between locus of control and task complexity. These constructs were selected by virtue of their importance in the literature, as well as the lack of empirical research regarding the assumed relationship which exists between them. The Human Sciences Research Council's (HSRC General Scholastic Aptitude Test (ASAT was used for measuring intelligence, Duttweiler's Internal Control Index (ICI was used for determining locus of control and the Raven's Advanced Progressive Matrices (APM was used as a criterion for coping with task complexity. These instruments were administered to 292 subjects to determine whether the relationship between locus of control and task complexity was effected when the effect of intelligence was controlled. The results indicated a significant relationship between locus of control and task complexity, however the relationship was no longer significant after the effect of intelligence was controlled. Opsomming Die doel van die studie was om die effek van intelligensie op die verhouding tussen lokus van kontrole en taak-kompleksiteit te ondersoek. Hierdie konstrukte is gekies na aanleiding van hulle belangrikheid in die literatuur asook die leemte in empiric se navorsing rakende die veronderstelde verband wat tussen hulle bestaan. Die Algemene Skolastiese Aanlegtoets (ASAT van die Raad vir Geesteswetenskaplike Navorsing (RGN is gebruik vir die meting van intelligensie, die Internal Control Index (ICI van Duttweiler is gebruik vir die meting van lokus van kontrole en die Advanced Progressive Matrices (APM van Raven is gebruik as maatstaf vir die bantering van taakkompleksiteit. Die genoemde meetinstrumente is op 292 proefpersone toegepas om te bepaal of die verband tussen lokus van kontrole en taakkompleksiteit geaffekteer word wanneer daar vir die effek

  9. Evaluatie van het gebruik van de iPad in het klaslokaal : Een onderzoek naar het iPadgebruik onder brugklasleerlingen van een Leeuwarder Lyceum

    NARCIS (Netherlands)

    Klaas Jan Huizing; Chantal Philipsen; Luka Linster

    2013-01-01

    In november 2012 kregen alle brugklasleerlingen van het Leeuwarder Lyceum een iPad uitgereikt. Dit nieuwe ‘device’ is de aanjager van onderwijsvernieuwingen op het gebied van digitalisering van lesmateriaal. Sowijs volgde de implementatie van de iPad en vroeg zich af: hoe is het iPadgebruik na een

  10. De opname van het conflictenrecht in het Nederlandse BW: een analyse van de gevolgen ervan voor de systematiek en de coherentie van het BW in zijn geheel

    NARCIS (Netherlands)

    Oderkerk, A.E.

    2013-01-01

    Op 1 januari 2012 is Boek 10 BW in werking getreden. Daarmee is het grootste deel van het Nederlandse conflictenrecht thans in het BW opgenomen. In deze monografie, die een bewerking vormt van de door de auteur op 16 november 2010 gehouden lezing voor de ‘Studiekring Prof.mr. J. Offerhaus’, wordt

  11. Ammoniakemissie-arme huisvestingssystemen voor vleeskuikens en het effect van vloerverwarming op emissie en technische resultaten

    NARCIS (Netherlands)

    Middelkoop, van J.H.; Harn, van J.

    1995-01-01

    Het Praktijkonderzoek Pluimveehouderij heeft onderzoek gedaan naar het gebruik van emissiearme stalsystemen voor vleeskuikens en het effect van het gebruik van vloerverwarming op de technische resultaten, strooiselkwaliteit en ammoniakemissie.

  12. Genomic clustering and homology between HET-S and the NWD2 STAND protein in various fungal genomes.

    Directory of Open Access Journals (Sweden)

    Asen Daskalov

    Full Text Available BACKGROUND: Prions are infectious proteins propagating as self-perpetuating amyloid polymers. The [Het-s] prion of Podospora anserina is involved in a cell death process associated with non-self recognition. The prion forming domain (PFD of HET-s adopts a β-solenoid amyloid structure characterized by the two fold repetition of an elementary triangular motif. [Het-s] induces cell death when interacting with HET-S, an allelic variant of HET-s. When templated by [Het-s], HET-S undergoes a trans-conformation, relocates to the cell membrane and induces toxicity. METHODOLOGY/PRINCIPAL FINDINGS: Here, comparing HET-s homologs from different species, we devise a consensus for the HET-s elementary triangular motif. We use this motif to screen genomic databases and find a match to the N-terminus of NWD2, a STAND protein, encoded by the gene immediately adjacent to het-S. STAND proteins are signal transducing ATPases which undergo ligand-induced oligomerisation. Homology modelling predicts that the NWD2 N-terminal region adopts a HET-s-like fold. We propose that upon NWD2 oligomerisation, these N-terminal extensions adopt the β-solenoid fold and template HET-S to adopt the amyloid fold and trigger toxicity. We extend this model to a putative prion, the σ infectious element in Nectria haematococca, because the s locus controlling propagation of σ also encodes a STAND protein and displays analogous features. Comparative genomic analyses indicate evolutionary conservation of these STAND/prion-like gene pairs, identify a number of novel prion candidates and define, in addition to the HET-s PFD motif, two distinct, novel putative PFD-like motifs. CONCLUSIONS/SIGNIFICANCE: We suggest the existence, in the fungal kingdom, of a widespread and evolutionarily conserved mode of signal transduction based on the transmission of an amyloid-fold from a NOD-like STAND receptor protein to an effector protein.

  13. Het effect van het bijvoeren van tarwe aan vleeskuikens op de slachtrendementen

    NARCIS (Netherlands)

    Middelkoop, van J.H.; Harn, van J.

    1994-01-01

    Tarwe bijvoeren aan vleeskuikens staat momenteel volop in de belangstelling. Redenen hiervoor zijn de lage prijs van de tarwe en het positieve effect dat tarwe kan hebben op de resultaten en gezondheid van de koppel. Door het bijvoeren van tarwe wordt de werking van de spiermaag en de ontwikkeling

  14. Het effect van creatief schrijven op het lezen van korte verhalen

    NARCIS (Netherlands)

    Janssen, T.; van den Bergh, H.

    2010-01-01

    Schrijven en lezen zijn complementaire vaardigheden, niet alleen bij referentiële teksten, maar ook bij fictionele. Janssen en Van den Bergh doen verslag van een onderzoek naar de invloed van creatief schrijven op het lezen van verhalen. Als leerlingen, voorafgaand aan het lezen van een verhaal, een

  15. Voorbij het gezinsbedrijf? : organisatie van het agrarisch bedrijf, nu en in de toekomst

    NARCIS (Netherlands)

    Backus, G.B.C.; Baltussen, W.H.M.; Galen, van M.A.; Meulen, van der H.A.B.; Poppe, K.J.

    2009-01-01

    Uitgezonderd de glastuinbouw, zal de productie anno 2020 vooral plaats) vinden op gezinsbedrijven. Het gezinsbedrijf zal wel meer worden gecombineerd met andere bedrijfsvormen, zoals gebruik maken van franchising en keurmer) ken, het inhuren van zzp'ers, en deelnemen in samenwerkingsverbanden

  16. Het effect van herhaalde versus nieuwe vragen in het testing-effect

    NARCIS (Netherlands)

    Dirkx, Kim; Kester, Liesbeth; Kirschner, Paul A.

    2012-01-01

    Dirkx, K. J. H., Kester, L., & Kirschner, P. A. (2012, 22 June). Het effect van herhaalde versus nieuwe vragen in het testing-effect. [The effects of repeated versus new questions in the testing-effect]. Poster session presented at the meeting of the Onderwijs Research Dagen [Educational Research

  17. Inventarisatie van het voorkomen van bestrijdingsmiddelen in het diepe grondwater in Nederland in 1992

    NARCIS (Netherlands)

    Boland J; van den Berg R; van der Linden AMA; Heusinkveld HAG; Baumann RA; LBG; LOC

    1994-01-01

    In 1991/1992 is een scanning uitgevoerd van residuen van bestrijdingsmid- delen in het grondwater van 5 tot 26 m beneden maaiveld in het Landelijk Meetnet Grondwaterkwaliteit. 41 Mengmonsters, samengesteld uit 2, 3 of 4 individuele monsters, zijn geanalyseerd en 15 individuele monsters. Met GC/MS

  18. Freedom Food : op de bres voor het welzijn van landbouwhuisdieren in het Verenigd Koninkrijk

    NARCIS (Netherlands)

    Waller, B.; Heijden, van der P.G.M.

    2009-01-01

    Op 11 december 2008 gaf Bob Waller tijdens de NGVA thema-avond een presentatie met als titel "Fork naar Farm; Maatschappelijke visies op aquacultuur". Freedom Food is een organisatie die tot doel heeft het welzijnprogramma van het Royal Society for the Prevention of Cruelty to Animals - (RSPCA), de

  19. Het gebruik van antropometrische gegevens bij het opstellen van normen voor kantoorstoelen

    NARCIS (Netherlands)

    Groot, M.D. de; Voorbij, A.I.M.; Molenbroek, J.F.M.

    2003-01-01

    De fysieke belasting van werknemers is bij het invoeren van de personal computer veranderd. De werkplekken zijn zitplekken geworden. Het aantal gebruikers van kantoorstoelen is daarmee enorm toegenomen. Achter een monitor zitten mensen vaak lang achter elkaar in dezelfde houding, wat in weerwil van

  20. Het groene hart van burgers : het maatschappelijk draagvlak voor natuur en natuurbeleid.

    NARCIS (Netherlands)

    Bakker, de H.C.M.; Koppen, van C.S.A.; Vader, J.

    2007-01-01

    In deze longitudinale studie wordt op basis van een publieksenquête een beeld gegeven van het maatschappelijk draagvlak voor natuur en natuurbeleid en de trends die hierbij zijn waar te nemen. Het draagvlak wordt aan de hand van drie invalshoeken in kaart gebracht: beelden en waarderingen van

  1. Het effect van een elektronische outline-tool op het schrijfproduct en schrijfproces

    NARCIS (Netherlands)

    De Smet, Milou; Brand-Gruwel, Saskia; Leijten, Mariëlle; Kirschner, Paul A.

    2012-01-01

    De Smet, M. J. R., Brand-Gruwel, S., Leijten, M., & Kirschner, P. A. (2012, June). Het effect van een elektronische outline-tool op het schrijfproduct en schrijfproces [The effect of an electronic outline tool on the writing product and writing process]. In R. Brouwer (Chair), Omgaan met ICT:

  2. Valorisation de chaleur à bas niveau thermique Upgrading Low-Thermal-Level Heat

    OpenAIRE

    Cohen G.; Rojey A.

    2006-01-01

    La mise en oeuvre à la fois de cycles thermodynamiques et de fluides adaptés permet d'élargir considérablement les possibilités de récupération et de valorisation de la chaleur à bas niveau contenue dans les rejets thermiques industriels, l'eau géothermale, le rayonnement solaire ou le milieu environnant. Ceci permettra une meilleure préservation des ressources énergétiques dans les principaux secteurs consommateurs d'énergie : résidentiel, tertiaire et industriel. On décrit les possibilités ...

  3. Gestion de bibliothèque au niveau de la Faculté de technologie

    OpenAIRE

    Mekkioui, Nadjet; Belhadj, Fatima Zohra

    2014-01-01

    Notre projet consiste à développer un logiciel permettant la gestion automatique de la bibliothèque de la Faculté de technologie. Cette automatisation concerne la gestion de prêt d’ouvrages, et ce en utilisant la méthode d'informatisation Merise. Cette dernière permet de concevoir un système d'information pour implanter le logiciel de gestion qui est développé dans un environnement Delphi. Nous avons focalisé notre projet sur la gestion automatique de prêt au niveau de la bibli...

  4. Vocabulaire illustré 350 exercices : niveau débutant

    CERN Document Server

    Filpa-Ekvall, Dominique; Watcyn-Jones, Peter

    1988-01-01

    Un travail stimulant et amusant pour se construire un vocabulaire de base, soit 1350 mots courants, rassemblés par thèmes (la maison, les magasins, les métiers, les animaux, le bricolage...) ou par catégories grammaticales. Des exercices d'apprentissage, de révision et d'élargissement. aussi bien pour les jeunes que pour les adultes. L'ouvrage se compose de deux parties : - l'apprentissage du vocabulaire élémentaire - l'apprentissage du vocabulaire de niveau intermédiaire suivi d'activités de contrôle des acquisitions.

  5. Evaluation du niveau d'activité physique dans un service Marocain d ...

    African Journals Online (AJOL)

    Plusieurs études ont montré l'intérêt du maintien ou de la reprise d'une activité physique sur l'état de santé des patients. Le but de notre travail est d'analyser le niveau d'activité physique chez nos patients hémodialysé chronique. Méthodes: Nous avons réalisé une étude transversale au centre d'hémodialyse de l'hôpital Al ...

  6. Effet des conditions climatiques sur le niveau du lac Sidi Ali (Moyen Atlas, Maroc

    Directory of Open Access Journals (Sweden)

    Claude Martin

    2011-11-01

    Full Text Available Le lac Sidi Ali est un lac naturel d'altitude (2070-2080 m, sans exutoire superficiel, déterminé par le barrage d'une coulée basaltique. Doté d'un bassin versant apparent de 15,6 km2, il est alimenté par des eaux de ruissellement et par des sources karstiques. Son niveau subit des variations très fortes, annuelles et interannuelles, sous le contrôle des conditions climatiques, et en particulier des pluies et de l'évapotranspiration. Les périodes de sécheresse qui ont marqué les trois dernières décennies, se sont traduites par un abaissement du niveau de près de 7 m. Mais les précipitations abondantes des années 2008-09 et 2009-10 ont provoqué une nette remontée. Une régression multiple d'assez bonne qualité (r = 0,87 lie la variation annuelle du niveau (d'août à août à différents paramètres (conditions climatiques et niveau initial du lac.Lake Sidi Ali is a natural lake at high altitude (2070-2080 m, without surface outlet, determined by the dam of a basalt flow. With an apparent catchment of 15.6 km2, it is fed by runoff and karst springs. Its level shows strong annual and interannual variations, depending on weather conditions, particularly rainfall and evapotranspiration. Droughts that have marked the last three decades have resulted in a lowering of about 7 m of the water level. But heavy rainfall that occurred in 2008-09 and 2009-10 caused a marked rise. A multiple regression of sufficient quality (r = 0.87 binds the annual change (from august to august at differents parameters (weather conditions and initial level of the lake.

  7. De ontwikkeling van een met onderzoek onderbouwde methodiek voor het meidenwerk

    Directory of Open Access Journals (Sweden)

    Judith Metz

    2016-03-01

    both would seem to be valuable as means for making tacit knowledge explicit, and have the potential for solidifying, substantiating and transferring it. This is because they would act as guiding principles to provide direction for methodological action by social professionals in contact with the target group. They exist alongside each other and can be deployed according to the situation, goals, persons and resources available for the range of working methods, target groups, goals and contexts. SAMENVATTINGDe ontwikkeling van een met onderzoek onderbouwde methodiek voor het meidenwerkDit artikel doet verslag van een zoektocht naar de mogelijkheden voor het ontwikkelen van een met onderzoek onderbouwde methodiek voor het meidenwerk. Het geeft inzicht in de mogelijkheden en moeilijkheden voor het opbouwen van een kennisbasis voor open benaderingswijzen in de praktijk van het sociaal werk. De aanleiding is het verzoek van Amsterdamse meidenwerkers om hulp bij het ontwikkelen van een met onderzoek onderbouwde methodiek voor een bijna 90-jarige diverse en dynamische praktijk. De achtergrond vormt de discussie over de kennisbasis van het sociaal werk. Gangbare modellen als “evidence-based practice”, “practice-based evidence” en “common factors” worden besproken op geschiktheid voor het ontwikkelen van een met onderzoek onderbouwde methodiek voor open benaderingswijzen, waarna programma evaluatie als mogelijk alternatief wordt uitgediept. De conclusie is dat er vooral met betrekking tot open benaderingswijzen binnen het sociaal werk dringend meer aandacht nodig is voor het proces van methodiekontwikkeling en de wijze van onderbouwing. De eerste ervaringen met programma evaluatie en het daaruit voortvloeiende model van methodische principes zijn voorzichtig positief. Programma evaluatie lijkt handreikingen te bieden voor het omgaan met het spanningsveld tussen de wetenschappelijke kwaliteit van de bevindingen en de bruikbaarheid voor de praktijk. Methodische

  8. Assurance en Risk Appetite : Een botsing tussen theorie en praktijk die veel energie oplevert

    NARCIS (Netherlands)

    dr. A.F. de Wild

    2015-01-01

    Presentatie over Risk Appetite: een belangrijk onderdeel van het risicomanagementsysteem. Gegeven aan de Erasmus School of Accounting and Assurance op 10 april 2015 door dr. Arie F. de Wild, lector Gedragseconomie bij Kenniscentrum Innovatief Ondernemerschap van Hogeschool Rotterdam.

  9. De daad bij het woord: Naar de optimale basisschool

    NARCIS (Netherlands)

    Mooij, Ton

    2016-01-01

    Elk kind, van minder begaafd tot en met hoogbegaafd, zou met ingang van de eerste schooldag goed onderwijs moeten verkrijgen. Dit vereist het invoeren van 'optimale leerprocessen' en het afschaffen van leeftijdsgebonden onderwijs.

  10. Energy care in relation to your management system. Linking lists between the Reference Energy Care and ISO 14001, ISO 9001 and HACCP; Energiezorg in relatie tot uw zorgsysteem. Linking lists tussen de Referentie Energiezorg en ISO 14001, ISO 9001 en HACCP

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    Several so-called care systems are in use at institutes and companies. For efficiency reasons it makes sense to integrate an energy care system to the existing care system. For the so-called Reference Energy Care, developed by the Netherlands Agency for Energy and the Environment (Novem) links to three of the most important care systems have been elaborated: environmental care according to ISO 14001, the quality care system ISO 9001:2000 and the food safety system Hazard Analysis Critical Control Points (HACCP). The elaboration resulted in three tables, indicating the connections ('linking lists') between each of those care systems and the Reference Energy Care system and how energy care can be integrated into those systems. [Dutch] Bij instellingen en bedrijven zijn diverse zorgsystemen in gebruik. Het is zinvol om energiezorg - waar mogelijk - in een dergelijk bestaand systeem op te nemen. Meerdere zorgsystemen naast elkaar in stand houden is minder efficient dan de systemen integreren tot een systeem. Novem heeft daarom voor haar Referentie Energiezorg de link laten uitwerken naar drie van de meest voorkomende systemen: milieuzorg volgens ISO 14001, het kwaliteitszorgsysteem ISO 9001:2000 en het voedselveiligheidssysteem HACCP (Hazard Analysis Critical Control Points). Hieruit zijn drie tabellen voortgekomen, die aangeven welke verbanden er zijn tussen elk van deze zorgsystemen en de Referentie Energiezorg en hoe u energiezorg kunt integreren in elk van deze systemen. Deze tabellen worden aangeduid als 'linking lists' en u kunt ze gebruiken als hulpmiddel bij het integreren van energiezorg in uw eigen zorgsysteem. U vindt ze in deze brochure.

  11. Energy care in relation to your management system. Linking lists between the Reference Energy Care and ISO 14001, ISO 9001 and HACCP; Energiezorg in relatie tot uw zorgsysteem. Linking lists tussen de Referentie Energiezorg en ISO 14001, ISO 9001 en HACCP

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    Several so-called care systems are in use at institutes and companies. For efficiency reasons it makes sense to integrate an energy care system to the existing care system. For the so-called Reference Energy Care, developed by the Netherlands Agency for Energy and the Environment (Novem) links to three of the most important care systems have been elaborated: environmental care according to ISO 14001, the quality care system ISO 9001:2000 and the food safety system Hazard Analysis Critical Control Points (HACCP). The elaboration resulted in three tables, indicating the connections ('linking lists') between each of those care systems and the Reference Energy Care system and how energy care can be integrated into those systems. [Dutch] Bij instellingen en bedrijven zijn diverse zorgsystemen in gebruik. Het is zinvol om energiezorg - waar mogelijk - in een dergelijk bestaand systeem op te nemen. Meerdere zorgsystemen naast elkaar in stand houden is minder efficient dan de systemen integreren tot een systeem. Novem heeft daarom voor haar Referentie Energiezorg de link laten uitwerken naar drie van de meest voorkomende systemen: milieuzorg volgens ISO 14001, het kwaliteitszorgsysteem ISO 9001:2000 en het voedselveiligheidssysteem HACCP (Hazard Analysis Critical Control Points). Hieruit zijn drie tabellen voortgekomen, die aangeven welke verbanden er zijn tussen elk van deze zorgsystemen en de Referentie Energiezorg en hoe u energiezorg kunt integreren in elk van deze systemen. Deze tabellen worden aangeduid als 'linking lists' en u kunt ze gebruiken als hulpmiddel bij het integreren van energiezorg in uw eigen zorgsysteem. U vindt ze in deze brochure.

  12. Taalvaardig in het hoger onderwijs: doorstroom en taalbeleid

    OpenAIRE

    Van Houtven, Tine; Peters, Elke

    2009-01-01

    Dat taal een sleutelrol speelt in het onderwijs hoeft niet te verbazen. Toch stellen we vaak vast dat voor sommige studenten de taal die in het hoger onderwijs gebruikt wordt een obstakel in hun leerproces vormt. Katho heeft zich dan ook met drie departementen (IPSOC, HANTAL en PHO) geëngageerd om zijn medewerking te verlenen aan het OnderwijsOntwikkelingsFonds-project (OOFproject) ‘Taalvaardig in het hoger onderwijs’. Dit project focust op de ontwikkeling van opleidingsspecifiek taalond...

  13. Regenwater opvangen voor het vee loont op Lagekostenbedrijf

    NARCIS (Netherlands)

    Blanken, K.

    2005-01-01

    Het Lagekostenbedrijf in Lelystad heeft ongeveer een jaar een proefopstelling gebruikt om regenwater op te vangen en als drinkwater voor het vee te gebruiken. De kosten voor het aanleggen van de watervoorziening zijn berekend en in een tabel weergegeven, evenals de besparing op de hoeveelheid

  14. Afbouw van het Wsw-bestand: update 2011

    NARCIS (Netherlands)

    Berden, C.; Tempelman, C.

    2012-01-01

    In opdracht van het ministerie van Sociale Zaken en Werkgelegenheid heeft SEO Economisch Onderzoek recent onderzoek gedaan naar bouwstenen voor verdeelsleutels van het ongebundelde participatiebudget (Tempelman et al., 2012). Een onderdeel van dit onderzoek vormde het voorspellen van de afbouw van

  15. Het aantonen en bepalen van vanille in botervet

    NARCIS (Netherlands)

    Weseman, J.M.; Ruig, de W.G.

    1980-01-01

    Doel van dit onderzoek was: Het verbeteren van de bestaande analysemethode. Bij de bestaande methode werd vanille met methanol uit het monster geëxtraheerd. Na filtratie werd het gehalte dan U.V. spectrofotometrisch bepaald. Meegeëxtraheerd vet veroorzaakte een te hoge extinctie. Bij de nieuwe

  16. Het geluid van de Beatles. Een muzieksociologische studie

    NARCIS (Netherlands)

    Tillekens, Gerardus Jacobus

    1998-01-01

    Het geluid van de Beatles. Er valt niet veel meer aan te doen. Met een soort emotionele superlijm zit het geluid van de Beatles en al die andere groepen van de Britse beatexplosie voor altijd verkleefd aan het beeld van de jaren zestig. Voor velen, zowel jong als oud kwam dat moment van culturele

  17. Illegale immigratie heeft ineens weer de aandacht van het OM.

    NARCIS (Netherlands)

    R.H.J.M. Staring (Richard)

    2014-01-01

    markdownabstract__Abstract__ Ze komen met de bus via de N35 bij Enschede het land binnen. Of met de auto over de A76 langs Heerlen. Via een vlucht naar Schiphol. Of ze worden alleen op de luchthaven afgezet om het te laten líjken alsof ze met het vliegtuig zijn gekomen.

  18. Effecten van de voorbewerking op het gehalte aan inhoudsstoffen paprika

    NARCIS (Netherlands)

    Aanholt, van L.; Elderen, van C.

    1998-01-01

    Het chemisch laboratorium werkte het afgelopen jaar een analysemethode uit voor het bepalen van vitamine-C in paprikavruchten (Aanholt, 1997). Met de wetenschap voor ogen dat vitamine-C zeer snel op verschillende manieren afgebroken kan worden, werd besloten tot een enigermate afwijkende methode van

  19. Positie van het vak informatica in havo/vwo

    NARCIS (Netherlands)

    Zwaneveld, Bert; Perrenet, Jacob; van Diepen, N.M.

    2009-01-01

    De vraag van dit artikel is: hoe moet het verder met het vak informatica in de bovenbouw van havo en van vwo? Deze vraag is relevant om een aantal redenen. Enerzijds gaat het om een tamelijk marginaal vak; slechts ongeveer 60% van de scholen biedt informatica aan. Anderzijds is er een discussie op

  20. Regulering van rendementen: snappen we het wel echt?

    NARCIS (Netherlands)

    Boot, A.W.A.; Ligterink, J.

    2011-01-01

    Bij veel economische activiteiten met monopolie-achtige kenmerken wordt het maximaal te behalen rendement door een toezichthouder gefixeerd op basis van het corporate finance gedachtegoed, en in het bijzonder de WACC-methodologie. Aan de juiste bepaling hiervan zitten echter vele haken en ogen. Wij

  1. Verspreiding van opgelost zout vanuit een zanddepot in het Haringvliet

    NARCIS (Netherlands)

    Kranenburg, C.

    1990-01-01

    Dit rapport geeft een beknopte analyse van de verdunning en verspreiding van zout vanuit een gepland depot voor ontzilt zeezand in het Haringvliet. Beschouwd zijn de initiële menging van het zout bij terugwinnenvan het zand, de verspreidingdoor stroming en turbulentie bij geopende spuisluis, en de

  2. Het nieuwe telen Gerbera - Teeltseizoen: 2009-2010

    NARCIS (Netherlands)

    Gelder, de A.; Houter, G.; Boer-Tersteeg, de P.M.; Warmenhoven, M.G.; Mei, van der M.; Groot, de M.; Grootscholten, M.

    2011-01-01

    De doelstelling van het project Het Nieuwe Telen Gerbera is het realiseren van een aanzienlijke energiebesparing met gelijkblijvende productie en kwaliteit. Dit onderzoek is uitgevoerd door de Flori Consult Group en WUR Glastuinbouw bij GreenQ-Improvement Centre in Bleiswijk.

  3. Ouders positief over iPad in het onderwijs

    NARCIS (Netherlands)

    Klaas Jan Huizing; Kirsten Andringa; Jildou Braaksma

    2014-01-01

    In 2012 is de iPad geïmplementeerd in het voorgezet middelbare onderwijs van Piter Jelles de Dyk in Leeuwarden. Sowijs volgde de implementatie van de iPad. In dit whitepaper wordt beschreven hoe ouders van leerlingen het iPad-gebruik op school ervaren. Welke voor- of nadelen zien zij in het

  4. Het biodiversiteitsideaal en de juridische bescherming van Antarctica

    NARCIS (Netherlands)

    Oudenaarden, T.A.; Verschuuren, J.M.; Van der Burg, W.; Brom, F.W.A.

    1998-01-01

    In deze bijdrage hebben we geprobeerd om een indruk te geven van de wijze waarop een ideaal langs juridische weg gestalte kan krijgen in wet- en regelgeving. We heb ben dit gedaan aan de hand van het ideaal van het behoud van biodiversiteit, zoals dat (onder meer) in het Biodiversiteitsverdrag tot

  5. Stabilisatie en samenstelling van het glycosidenmengsel van Folia digitalis

    NARCIS (Netherlands)

    Tattje, Derk Hendrik Evert

    1952-01-01

    Na een korte inleiding wordt een omschrijving van het begrip stabilisatie gegeven en besproken hoe deze stabilisatie, dit is het irreversibel inactiveren van de enzymen, in het algemeen tot stand kan worden gebracht. Tevens wordt nagegaan of ook door verschillende oplosmiddelen reeds bij gewone

  6. De ontwikkeling van bedrijfskundige kennis in het vakgebied facility management

    NARCIS (Netherlands)

    Keizer, J.A.; Vosselman, E.G.J.

    1994-01-01

    Afgezien van een onlangs gestarte postdoctorale opleiding voor Facility Management in Eindhoven blijft het wetenschappelijk onderwijs in deze sector tot op heden ver achter. In dit artikel wordt een aantal ideeën uitgewerkt voor het intensiveren van de onderzoeksinspanningen op het terrein van

  7. Het lot zelf in handen nemen. Empowerment in beweging

    NARCIS (Netherlands)

    H.D. Pruijt (Hans)

    2012-01-01

    textabstractEmpowerment – het tegenovergestelde van beheersing – is een centraal element in de ideologie van sociale bewegingen geworden. Maar ook daarbuiten is het een populair concept. Het concept wordt vaak enthousiast gepresenteerd als een win-win formule, waarbij zowel activisten als degene

  8. Hoogtepunten uit het Journal of Chemical Education 2011

    NARCIS (Netherlands)

    Machiel Stolk

    2012-01-01

    De auteur beschrijft een aantal artikelen uit het Journal of Chemical Education 2011 die interessant en geschikt zijn voor gebruik in het scheikunde onderwijs. Uit elk van de twaalf verschenen nummers wordt een onderwerp besproken. De volgende onderwerpen komen aan de orde: doping, chemie in het

  9. Astma bij peuters en kleuters: Resultaten van het PIAMA onderzoek

    NARCIS (Netherlands)

    Wijga AH; Brussee JE; Smit HA; PZO

    2004-01-01

    In dit rapport worden resultaten gepresenteerd over het beloop van gediagnosticeerd astma bij kinderen van 0-5 jaar in het PIAMA onderzoek. Specifiek voor deze leeftijdsgroep is het probleem dat astma wel voorkomt, maar medisch niet met zekerheid is vast te stellen. Bij jonge kinderen leiden

  10. Duur van computergebruik in het bankwezen : tikken, klikken en kijken

    NARCIS (Netherlands)

    Douwes, M.; Blatter, B.M.; Kraker, H. de

    2003-01-01

    Het arboconvenant Bankwezen zegt: zorg voor niet meer dan vijf uur beeldschermwerk per persoon per dag. Voor het meten van die tijdsduur is een meetmethode nodig. Met pauzesoftware kan de tijdsduur van toetsenbordgebruik en van muisgebruik gemeten worden, maar kijken naar het beeldscherm alleen

  11. Lijmen : Hoe p(l)ak je het aan

    NARCIS (Netherlands)

    Dirksen, M.O.; Mellema, T.; Overbeek, K. (Karin)

    2009-01-01

    In het Saxion Project Materialen in Ontwerp 1 is gebleken dat lijmen een veel voorkomend onderwerp of zelfs probleem is. Daarom is dit thema onderdeel geworden van het project Materialen in Ontwerp 2. In het kader van dit thema is een triatlon georganiseerd. Dit is een werkvorm waarbij deelnemende

  12. Het veranderende gezicht van reumatoïde artritis

    NARCIS (Netherlands)

    Helm-van, van der Mil A.H.M.

    2016-01-01

    Oratie uitgesproken door Prof.dr. A.H.M. Van der Helm-van Mil bij de aanvaarding van het ambt van hoogleraar op het gebied van Reumatologie, in het bijzonder Vroege Artritis aan de Universiteit Leiden op vrijdag 14 oktober 2016

  13. Grammaire progressive du français avec 400 exercices : niveau avancé

    CERN Document Server

    Boularès, Michèle

    1997-01-01

    La Grammaire progressive du français, de niveau avancé, s'adresse à de grands adolescents et adultes ayant suivi environ 250 heures de cours.Par une méthode progressive, des exemples nombreux et pertinents pour renforcer les règles de grammaire, une langue authentique, cet ouvrage a pour objectif de rendre vivant et stimulant l'apprentissage de la grammaire.Elle présente et explique des points complexes (subjonctif, gérondif, adjectif verbal, participe présent...) et relie résolument la forme et le sens afin de ne pas dissocier grammaire et communication. La Grammaire progressive du français est une grammaire pédagogique: les explications grammaticales sont simples, le plus souvent de l'ordre de la phrase, elles utilisent un minimum de métalangage; des exemples clairs et nombreux illustrent chque explication grammaticale; la langue utilisée dans les exemples et les exercices est authentique. Quand l'exemple illustrant un point grammatical exige un niveau de langage soutenue, celui-ci est signalé...

  14. Intersectionaliteit en sociale inclusie: het Ei... van Troje. Deel 1: Het Ei van Columbus

    Directory of Open Access Journals (Sweden)

    Janneke van Mens-Verhulst

    2009-09-01

    In het tweede deel van dit artikel – dat zal verschijnen in issue 4 – zal worden beargumenteerd dat de intersectionele benadering op termijn echter het Paard van Troje kan blijken te zijn. Met name voor beleid en wetgeving omdat het een complexiteit binnenbrengt waarvan nog niet duidelijk is hoe die moet worden gehanteerd. Bovendien kleven er onderzoeksmethodologische implicaties aan, waardoor de gewenste wetenschappelijke evidentie maar moeilijk tot stand komt. Niettemin kan intersectionaliteit voorlopig een buitengewoon nuttige heuristiek zijn voor vraagstukken van sociale inclusie.

  15. Understanding modal choices for leisure activities. Is it just objectively determined ? Het begrijpen van de vervoerswijzekeuze voor vrijetijdsactiviteiten. Wordt dit enkel beïnvloed door objectief meetbare variabelen ?

    Directory of Open Access Journals (Sweden)

    Kobe Boussauw

    2012-12-01

    Full Text Available Most studies on the link between the built environment and modal choice characterize and model this relationship by objectively measureable characteristics such as density and diversity. Recently, within the debate on residential self-selection, attention has also been paid to the importance of subjective influences such as the individual’s perception of the built environment and his/her residential attitudes and preferences. Expanding the analysis to also include both objective and subjective characteristics at other model levels (i.e., not only stage of life characteristics but also personal lifestyles ; not only car availability but also travel attitudes, not only modal choice but also mode specific attitudes is the purpose of this paper. To this end, a modal choice model for active leisure activities is developed using data on personal lifestyles and attitudes, collected via an Internet survey, and estimated using a path model consisting of a set of simultaneous estimated equations between observed variables. While controlling for subjective lifestyles and attitudes, the effects of the built environment and car availability on modal choice can be determined correctly and thus insights in self-selection mechanisms can be gained.De meeste studies over de interactie tussen de bebouwde omgeving en vervoerswijzekeuze gebruiken objectief meetbare eigenschappen zoals dichtheid en diversiteit om deze relatie te modelleren en analyseren. Recent wordt tevens aandacht besteed aan het belang van subjectieve invloeden zoals de percepties en voorkeuren van het individu met betrekking tot de bebouwde omgeving. Dit gebeurde vooral binnen het debat over residentiële zelfselectie, maar zelfselectie kan ook op andere punten optreden. Daarom wordt in dit artikel de analyse uitgebreid zodat subjectieve kenmerken ook op andere niveaus van het model voorkomen (bijvoorbeeld, niet alleen levensfase maar ook leefstijl, niet alleen autobezit maar ook algemene

  16. Die verband tussen lokus van beheer en die werks prestasie van swart bemarkers in die lewensversekeringsbedryf

    Directory of Open Access Journals (Sweden)

    E. L. Coetzer

    1997-06-01

    Full Text Available The relationship between locus of control and the work performance of black marketers in the life assurance industry. The aim of the study was to establish the relationship between locus of control and the work performance of black marketers in the life assurance industry. These constructs were selected by virtue of the lack of empirical research regarding the assumed relationship between them. The Locus of Control Scale of Schepers (1995 was used for measuring locus of control. Work performance was measured by the commission earned per month by the marketer, the number of policies generated by the marketer, as well as the percentage of lapsed policies. The relevant measurements were obtained in respect of a sample of 149 black marketing personnel. The results indicated a modest but statistically significant relationship between external locus of control and the work performance of black marketers. Opsomming Die doel van die studie was om die verband tussen lokus van beheer en die werksprestasie van swart bemarkers in die lewensversekeringsbedryf te bepaal. Hierdie konstrukte is gekies op grond van die gebrek aan empiriese navorsing rakende die veronderstelde verband tussen genoemde konstrukte. Die Lokus van Beheer-vraelys van Schepers (1995 is in die meting van lokus van beheer gebruik. Werksprestasie is aan die hand van kommissie per maand verdien, aantal polisse gegenereer deur 'n bemarker en die persentasie vervalde polisse, gemeet. Die tersaaklike metinge is verkry ten opsigte van 'n steekproef van 149 swart bemarkers. Die resultate toon 'n klein, dog statisties beduidende verband tussen eksterne lokus van beheer en die werksprestasie van swart bemarkers in die lewensversekeringsbedryf.

  17. De inzet van Facebook in het hoger onderwijs : Het gebruik van Facebook als communicatiemiddel binnen een onderwijsmodule op NHL Hogeschool

    NARCIS (Netherlands)

    Geert Jan van Dam; Renny Poelstra

    2013-01-01

    Traditionele digitale leeromgevingen in het hoger onderwijs sluiten niet meer goed aan bij de wensen van studenten en docenten. Twee onderzoekers van Sowijs deden in hun eigen onderwijspraktijk onderzoek naar het gebruik van Facebook in de klas. Hoe reageren studenten en docenten op het gebruik van

  18. Geochemische schematisering van de ondergrond in het STONE model : schatting van het ammonium oxalaat extraheerbare aluminium- en ijzergehalte

    NARCIS (Netherlands)

    Boekel, E.M.P.M.

    2009-01-01

    De aluminium- en ijzeroxalaat gehalten spelen een belangrijke rol bij het voorspellen van de fosforverliezen naar het oppervlaktewater. Het nauwkeurig schatten van deze gehalten in de ondergrond is noodzakelijk om op de lange termijn effecten goed te kunnen kwantificeren. Met behulp van Landelijke

  19. De vloek van de winnende taxi : Onderzoek naar het probleem van te lage biedingen bij aanbestedingen in het doelgroepenvervoer

    NARCIS (Netherlands)

    van Buiren, K.; Fijnje, J.; in 't Veld, D.

    In het doelgroepenvervoer is er sprake van te lage prijzen, veroorzaakt door te lage biedingen bij aanbestedingen, resulterend in teruglopende kwaliteit en financiële problemen bij vervoerders. De belangrijkste oorzaak van te lage biedingen in het doelgroepenvervoer is het probleem van de winner’s

  20. Artikel 2 van die Nederlandse Geloofsbelydenis as geloofsvooronderstelling in die gesprek tussen wetenskap en geloof

    Directory of Open Access Journals (Sweden)

    Jan A. Erasmus

    2014-09-01

    Full Text Available Artikel 2 van die Nederlandse Geloofsbelydenis bely dat God deur twee middele geken word, te wete deur middel van die skepping, onderhouding en regering van die wêreld (waaronder die wetenskap en deur die heilige en goddelike Woord (die Bybel. Hierdie belydenis is van groot belang vir die gesprek tussen Wetenskap en Teologie. In hierdie artikel word gepoog om die verskille, maar ook die ooreenkomste tussen hierdie twee middele van openbaring uit te lig, elkeen tot sy reg te laat kom, maar hulle ook in balans met mekaar te stel. Die wyse waarop te werk gegaan word, is die volgende: eers word gestel wat vooronderstellings is, asook die plek wat vooronderstellings in die beoefening van wetenskap sowel as geloof inneem. Daarna word nagevors watter perspektiewe artikel 2 van die Nederlandse Geloofsbelydenis as geloofsvooronderstelling vir die wetenskaps- en teologiebeoefening respektiewelik bied. Hieruit word ’n aantal gevolgtrekkings gemaak wat kan help om die problematiek in die wetenskap-geloofsgesprek op te los. Die kernbevinding van hierdie artikel is die volgende: Vanweë die verskil in die aard en die doel tussen Bybelfeite en wetenskaplike navorsingsresultate kan en sal klaarblyklike harmonieprobleme tussen die Skrif en die wetenskap ontstaan. Hierdie is egter slegs klaarblyklike probleme, omdat ’n verrekening van die verskil in die aard en die bedoeling van die wetenskapresultate en die Bybelfeite hierdie probleem sal oplos. Article 2 of the Belgic Confession as faith presupposition in the science-faith debate. Article 2 of the Belgic Confession confesses that God can be known by two means: firstly by studying the creation, preservation and government of the universe (i.e. science and secondly by studying the Word of God (the Bible. This confession is very important for the discussion between science and faith. In this article the similarities, but also the differences between these two means of revelation are researched. The aim is to

  1. Dépression et niveau de fardeau chez les aidants familiaux des sujets déments en Tunisie

    Science.gov (United States)

    Ben Thabet, Jihène; Jaoua, Feriel; Charfi, Nada; Zouari, Lobna; Zouari, Nasreddine; Maalej, Mohamed

    2011-01-01

    Introduction La démence peut retentir lourdement sur les aidants familiaux du patient. Les objectifs de notre étude étaient de déterminer le niveau de fardeau et de la dépression chez les aidants familiaux de sujets déments, et d'identifier les facteurs associés à un niveau de fardeau élevé. Méthodes Il s'agissait d'une enquête auprès de 65 aidants tunisiens. Les niveaux de fardeau et de la dépression ont été évalués par, respectivement, l'inventaire de Zarit et l’échelle de Beck. Résultats Le taux des aidants qui avaient un niveau de fardeau élevé était de 52,3 %. Une dépression modérée ou sévère a été relevée chez 46,2 %. Un niveau de fardeau élevé était corrélé, du côté de l'aidant, avec le niveau socio-économique moyen à élevé, la cohabitation avec le patient, le fait d’être son conjoint, la réduction des activités quotidiennes et la sévérité de la dépression, et, du côté du dément, avec l'agressivité. Conclusion Les facteurs corrélés à un niveau de fardeau élevé orientent vers les cibles d'intervention et sont susceptibles d’être améliorés par la prise en charge, ce qui contribuerait à alléger la détresse des aidants. PMID:22384291

  2. Een planningsmethode voor reductie van de fluctuaties in de belasting van verpleegafdelingen

    NARCIS (Netherlands)

    Vanberkel, P.T.; Boucherie, Richardus J.; Hans, Elias W.; Hurink, Johann L.; van Lent, W.A.M.; van Harten, Willem H.

    2012-01-01

    Zorgvuldige afstemming tussen het schema van de operatiekamers en de verpleegafdeling balanceert de belasting van de verpleegafdeling en vermindert het aantal afgezegde operaties. In samenwerking tussen het Center for Healthcare Operations Improvement & Research (CHOIR, kenniscentrum voor

  3. Politiekennis in gebruik. Een onderzoek naar het gebruik van het Politie Kennis Net

    NARCIS (Netherlands)

    Bakker, G.D.; Gellevij, M.R.M.; de Hoog, Robert; Kooken, J.P.; Krommendijk, M.

    2006-01-01

    I. Bakker, M. Gellevij, R. de Hoog, J. Kooken , M. Krommendijk (IPIT, Instituut voor Maatschappelijke Veiligheidsvraagstukken en vakgroep Instructietechnologie, faculteit Gedragswetenschappen, Universiteit Twente) P&W Verkenningen, Politie en Wetenschap, Apeldoorn ISBN: 90-78764-02-3 AbstractHet

  4. Waarom volwassenen met ADHD vaak te laat komen op afspraken – is het een beperking in de tijdwaarneming of het geheugen?

    NARCIS (Netherlands)

    Mette, Christian; Zielke, Annika; Groen, Yvonne

    Volwassenen met aandachtstekortstoornis met hyperactiviteit (ADHD) hebben vaak moeite met tijdmanagement en het nakomen van afspraken. Een belangrijke functie voor tijdmanagement is tijdwaarneming, die weer samenhangt met de werking van het kortetermijn- en het werkgeheugen. De onderliggende

  5. Inzicht in het presteren van de executieketen : Ontwikkeling van een monitor voor het meten van Kritieke Prestatie Indicatoren in de Executieketen

    NARCIS (Netherlands)

    Braak, S.W. van den; Netten, C.P.M.; Witzenburg, R. van

    2013-01-01

    Dit zijn de voorlopige resultaten van het ontwikkelprojcet Monitor Kritieke Prestatie Indicatoren Executieketen. Het structureel meten van de vastgestelde Kritieke Prestatie Indicatoren (KPI's) behelst het periodiek verzamelen, bewerken en presenteren van grote hoeveelheden data van verschillende

  6. Het 'wonder van Nieuw-Lekkerland'

    NARCIS (Netherlands)

    Wolthoorn, A.; Vet, de W.; Woerdt, van der D.; Temminghoff, E.J.M.

    2005-01-01

    Bij ondergrondse beluchting, een milde vorm van ondergronds ontijzeren, wordt ijzer uit grondwater in de bodem verwijderd. Een onverwacht effect van ondergrondse beluchting is dat het tijdens de opwerking tot drinkwater de nitrificatie in zandfilters sterk kan verbeteren. Voor Hydron Zuid-Holland is

  7. Bijdrage tot de kennis van het insuline

    NARCIS (Netherlands)

    Wetsema, Jan

    1932-01-01

    Getracht is een einde te maken aan de bestaande meeningsverschillen, ten opzichte van het aantal eenheden in pancreas van verschillende diersoorten aanwezig. Om vergelijkbare cijfers te krijgen diende steeds dezelfde methode van bereiding en zuivering toegepast te worden. Daartoe werd de

  8. Radium in baggerspecie afkomstig uit het Rijnmondgebied

    NARCIS (Netherlands)

    Bijwaard H; Overwater RMW; Glastra P; Nissan LA; LSO

    2003-01-01

    In 2002 zijn wederom havenspeciemonsters verzameld in de Rotterdamse havens en in de Nieuwe Waterweg. Van 25 monsters is het 226Ra-gehalte bepaald. Zoals ook in eerdere meetcampagnes is vastgesteld, worden hoge radiumgehalten gevonden in de omgeving van de voormalige lozingspunten van de

  9. De jacht op het geheim van cacao

    NARCIS (Netherlands)

    Hollman, P.C.H.

    2008-01-01

    Je kans op een dodelijke hartaanval halveert als je elke dag een groot paaseitje pure chocolade eet, blijkt uit een recente Nederlandse epidemiologische studie. En ook andere studies laten zien dat consumptie van cacao beschermt tegen hart- en vaatziekten. Maar het is nog een raadsel hoe dat precies

  10. Opstandige biologische bestrijder van het wortelknobbelaaltje

    NARCIS (Netherlands)

    Wurff, van der A.W.G.

    2007-01-01

    Uit een in vitro toets blijkt dat de bacterie Pasteuria penetrans een veelbelovende bestrijder is van het wortelknobbelaaltje. De bacterie heeft echter een sterke voorkeur voor bepaalde stammen uit een kas van een bioteler van kasgroenten. Knobbelaaltjes bij andere biotelers lieten de bacterie links

  11. Het Muziektheater (A) : A change of governance

    NARCIS (Netherlands)

    Lachotzki, F.; Schoenmakers, J.

    2008-01-01

    Cultural organizations offer their own unique challenges when it comes to effective supervision and management. This case examines changing structures of control over Het Muziektheater, Amsterdam's modern city opera house which houses both The Dutch Opera and The National Ballet companies, from

  12. Het werkwoord lasciare en de polysemie

    NARCIS (Netherlands)

    Boer, M.G. de

    2009-01-01

    SAMENVATTING Dit hoofdstuk is een beschrijving van de betekenis van het Italiaanse werkwoord lasciare op grond van een corpus van 282 voorbeeldzinnen. Voor de analyse is gebruik gemaakt van een vroege versie van de semantische theorie van Jackendoff. RIASSUNTO Questo capitolo è una descrizione

  13. Het eind van maatschappelijk verantwoord ondernemen

    NARCIS (Netherlands)

    Kolk, A.

    2003-01-01

    Hoe gaan ondernemingen, managers en accountants om met eisen en verwachtingen van de samenleving? Deze vraag - na affaires zoals Enron en de bouwfraude actueler dan ooit - heeft tot grote aandacht voor 'maatschappelijk verantwoord ondernemen' (MVO) geleid. Juist nu echter betoogt Kolk dat het einde

  14. Metageschiedenis in het werk van Peter Blum

    African Journals Online (AJOL)

    vluchtte de familie voor Hitler, want er zijn aanwijzigingen dat Blum of in elk geval zijn moeder joods was (haar meisjesnaam was Levi). Om vast te stellen of Blum inderdaad joods was, heeft Blums biograaf Kannemeyer zelfs discreet bij een niet nader genoemde getuige geïnformeerd of hij besneden was, hetgeen niet het ...

  15. Zeldzame vissen in het IJsselmeergebied : Jaarrapport 2006

    NARCIS (Netherlands)

    Leijzer, T.B.; Boois, de I.J.; Willigen, van J.A.; Westerink, H.J.

    2007-01-01

    In opdracht van Rijkswaterstaat, Directie IJsselmeergebied, is in 1994 een monitoringsprogramma gestart waarin zeldzame vissoorten in het IJsselmeergebied bemonsterd worden. In dit programma wordt door opkoop van binnen de commerciële visserij gevangen migrerende vissoorten een indruk verkregen van

  16. Toepassing ICP-AES op het RIKILT

    NARCIS (Netherlands)

    Ruig, de W.G.

    1980-01-01

    Rapportage over de toepassing van ICP-AES op het RIKILT. Bij ICP-AES worden twee manieren van lichtemissie detectie toegepast nl. simultaan en sequentieel. De voor- en nadelen van ICP-AES t.o.v. AAS worden op een rij gezet.

  17. Alternatieve instrumenten voor het EU-landbouwbeleid?

    NARCIS (Netherlands)

    Silvis, H.J.; Rijswick, van C.W.J.; Bont, de C.J.A.M.

    2001-01-01

    Het EU-landbouwbeleid staat met de parallel lopende onderhandelingen over de uitbreiding en een nieuw WTO-akkoord voor verdere hervormingen. Dit rapport behandelt de vraag of er voor de instrumenten van dit beleid alternatieven kunnen worden aangereikt. Daarbij wordt de aandacht gericht op

  18. Slimmer netwerk gaat het huis uit

    NARCIS (Netherlands)

    Zevenbergen, R. van; Andel, T. van; Widlak, A.; Sigaloff, S.; Oeij, P.; Smout, J.; Stet, A.; Torre, W. van den; Popma, M.

    2015-01-01

    De afgelopen vier jaar hebben het minsterie van BZK, Kennisland, Kafkabrigade en TNO hard gewerkt aan Slimmernetwerk. Dit netwerk, van inmiddels ruim 4300 mensen op LinkedIn, was de thuisbasis voor een serie experimenten met ‘innovatie van onderop’ en interbestuurlijke samenwerking binnen de

  19. TECHNICAL TRAINING: Programmation automate Schneider TSX Premium 2ème niveau - French version only

    CERN Multimedia

    2003-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. TECHNICAL TRAINING Monique Duval tel. 74924 technical.training@cern.ch CERN Technical Training 2003: Learning for the LHC ! Annonce de nouvelle formation - cours avancé Dans le cadre du programme de l'Enseignement Technique 2003, et en collaboration avec le GUAPI (Groupe des Utilisateurs d'Automates Programmables Industriels du CERN), une nouvelle formation a été organisée afin de perfectionner les connaissances sur l'outil PL7 de programmation des Automates PREMIUM de Schneider. Ce nouveau cours (niveau 2) s'adresse aux person...

  20. ENSEIGNEMENT TECHNIQUE : Programmation automate Schneider TSX Premium 2ème niveau - French version only

    CERN Multimedia

    2003-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an "application for training" form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. ENSEIGNEMENT TECHNIQUE Monique Duval Tel./Tél. 74924 technical.training@cern.ch CERN Technical Training 2003: Learning for the LHC ! Annonce de nouvelle formation - cours avancé Dans le cadre du programme de l'Enseignement Technique 2003, et en collaboration avec le GUAPI (Groupe des Utilisateurs d'Automates Programmables Industriels du CERN), une nouvelle formation a été organisée afin de perfectionner les connaissances sur l'outil PL7 de programmation des Automates PREMIUM de Schneider. Ce nouveau cours (niveau 2) s'...

  1. Effet des conditions climatiques sur le niveau du lac Sidi Ali (Moyen Atlas, Maroc)

    OpenAIRE

    Sayad, Ahmed; Chakiri, Saïd; Martin, Claude; Bejjaji, Zohra; Echarfaoui, Hassan

    2012-01-01

    Le lac Sidi Ali est un lac naturel d'altitude (2070-2080 m), sans exutoire superficiel, déterminé par le barrage d'une coulée basaltique. Doté d'un bassin versant apparent de 15,6 km2, il est alimenté par des eaux de ruissellement et par des sources karstiques. Son niveau subit des variations très fortes, annuelles et interannuelles, sous le contrôle des conditions climatiques, et en particulier des pluies et de l'évapotranspiration. Les périodes de sécheresse qui ont marqué les trois dernièr...

  2. Adaptation aux répercussions de l'élévation du niveau de la mer ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    , la pollution, l'utilisation intensive des terres, la croissance démographique et la dégradation des écosystèmes. Elles sont par ailleurs exposées aux répercussions de la hausse du niveau de la mer et notamment aux inondations. Réduire la ...

  3. Strategisch meerjarenplan 2014-2020 Nederlands focal point voor veiligheid en gezondheid op het werk

    NARCIS (Netherlands)

    Schrama, H.; Lange, J. de

    2014-01-01

    Dit strategisch meerjarenprogramma van het Nederlands Focal Point is afgeleid van de nieuwe meerjarenstrategie 2014-2020 van het Europees Agentschap voor Veiligheid en Gezondheid op het Werk Het Europees Agentschap (EU-OSHA) wil bijdragen de Europese werknemers gezond en veilig aan het werk te

  4. Lekken en lekkers : Een verkennend onderzoek naar het lekken van vertrouwelijke informatie naar de pers

    NARCIS (Netherlands)

    Beenakkers, E.M.Th.; Grapendaal, M.

    1995-01-01

    In dit rapport worden de resultaten van onderzoek dat op verzoek van de directie Politie van het ministerie van Justitie door het WODC werd verricht naar het verschijnsel "lekken naar de pers". Het onderzoek is in zijn geheel gericht geweest op het beantwoorden van de volgende vragen: welke motieven

  5. Een inleiding in het filosoferen : Filosoferen met kinderen op de Bloemhofschool

    NARCIS (Netherlands)

    W. Pols

    2012-01-01

    Het project Fysieke Integriteit startte in september 2008. In dit project gaat het om samen handelen, samen ervaren en samen denken. Filosofie neemt binnen dit project een belangrijke plaats in: het doordenkt de ervaringen die bij judo, het koken en het tuinieren opgedaan zijn. Bij die drie

  6. Over het belang van Temminck's „Discours préliminaire" voor de zoologische Nomenclatuur

    NARCIS (Netherlands)

    Mees, G.F.

    1957-01-01

    Het gewoonlijk als „Discours préliminaire" aangeduide artikel van Temminck heeft nimmer die aandacht van dierkundigen getrokken, die het, wegens zijn systematisch belang, verdient. Ten dele vindt dit stellig zijn oorzaak in de betrekkelijke zeldzaamheid van het werk, ten dele ook in het feit dat het

  7. Sectarian discussions limit vision on rational approaches. With ups and downs towards a coherent environmental policy?; Verkokerde discussies belemmeren het zicht op rationele benaderingen. Met vallen en opstaan op weg naar een samenhangend milieubeleid?

    Energy Technology Data Exchange (ETDEWEB)

    Sluijter, F.W.

    2008-07-01

    Current discussions on environmental policy in the Netherlands are systematically narrowed down to discussions on CO2 emissions. The mutual interaction between various measures remains undiscussed. Emotional arguments (e.g. the deployment of nuclear energy) play a larger role than rational arguments. In this article, the author sketches undiscussed and even unmentionable relations in the real world and thus hopes to contribute to a rational exchange of ideas on energy and environmental policy. [mk]. [Dutch] De lopende discussies over het milieubeleid in Nederland worden stelselmatig verengd tot discussies over de emissie van CO2. De onderlinge wisselwerking tussen verschillende maatregelen blijft daarbij onbesproken. Emotionele argumenten (bijvoorbeeld m.b.t. de inzet van kernenergie) spelen een grotere rol dan rationele argumenten. De auteur schets in dit artikel onbesproken en zelfs onbespreekbare samenhangen in de reele wereld en hoopt daarmee bij te dragen aan een rationele uitwisseling van ideeen over energie- en milieubeleid.

  8. Het beperkte recht : een analyse van zijn theoretische constructie, zijn plaats in het systeem van het vermogensrecht en zijn mogelijke inhoud

    NARCIS (Netherlands)

    Mollema, Anne Fleur

    2013-01-01

    Het beperkte recht moet niet worden voorgesteld als een afsplitsing van een deel van de eigendom. Het beperkte recht moet veeleer als een last worden beschouwd die de eigenaar op de eigendom legt en voor de beperkte gerechtigde een nieuw, eigensoortig recht schept dat daarvoor nog niet bestond. Deze

  9. De democratische paradox van de RKSP. De 'leer van de uiterste noodzaak' als uiting van de groeiende eensgezindheid tussen katholieken en sociaal-democraten in het interbellum

    Directory of Open Access Journals (Sweden)

    M.J.M. Hoogenboom

    2005-01-01

    Full Text Available The democratic paradox of the Roman Catholic State Party (RKSP. The ‘doctrine of the last resort’ as an expression of the growing solidarity between the Catholics and Social Democrats during the interbellumBetween the First and Second World War, coalition-building was fairly problematic in Dutch politics. This was partly caused by the refusal of the Roman Catholic State Party (RKSP to form a government coalition with the Social Democratic Labour Party (SDAP. On several occasions, the leadership of the party argued that the RKSP would only agree to collaborate in a so-called ‘Roman-red coalition’ out of ‘sheer necessity’. In the literature, roughly two interpretations of the Catholic refusal can be discerned. According to the first interpretation, the RKSP rejected a government coalition with the SDAP because the leadership of the party thought that the ideological differences between both parties were insurmountable. According to the second interpretation, the Catholic leadership refused to collaborate because it was afraid that the Catholic party would disintegrate as a result of the internal schism. In this article, it is claimed that the first interpretation is not tenable, and the second only partly. The refusal of the RKSP leadership to collaborate with the SDAP did not signify Catholic division or a clash between Catholic and social democratic principles but, paradoxically, a growing Catholic unity and a growing consensus between both parties. However, for the Catholic leaders a Roman-red coalition was a taboo subject since it would force the party to explicitly recognise that the Catholic and social democratic ideologies were reconcilable.

  10. De wortels van de Randstad. Overheidsinvloed en stedelijke hiërarchie in het westen van Nederland tussen de 13de en 20ste eeuw

    Directory of Open Access Journals (Sweden)

    Nikki Brand

    2017-11-01

    Full Text Available The starting point of this study concerns the origins of the polycentric nature of contemporary cities in the western area of the Netherlands, commonly known as ‘the Randstad’. Within the disciplines of planning and urban design the Randstad is considered a textbook example of a polycentric urban hierarchy. Yet, although quite a popular topic, very little is actually known about the driving forces that have given shape to existing urban hierarchies throughout the world. Moreover, the Randstad has also been dubbed ‘Holland’s paradox’ because of its assumed reversed evolution from a primate city hierarchy focused on Amsterdam in early modern times, to a polycentric hierarchy in the 19th century. Why do urban hierarchies change over time and which factors were decisive for the rise of the polycentric Randstad? This study consists of two parts and six chapters. Part I explores the determining factors of change within urban hierarchies. The first chapter gives an assessment of the usefulness of existing theory and ends in confusion: firstly, historiography turns out to be a medley of explanations that are heterogeneous and sometimes even contradictive. Secondly, comparisons of the long-term development of multiple towns are lacking, which makes it difficult to come up with a theoretical approach. In order to make such comparisons and ascertain the impact of certain factors on urban hierarchies over time, it’s necessary to look at the development of a group of towns over a long time-span. Therefore, in the second chapter, simple statistics are compared with existing theory and literature. To do so, demographic data for the nine towns of Amsterdam, Haarlem, Leiden, Delft, The Hague, Rotterdam, Dordrecht, Gouda and Utrecht were compared from their first appearance in the 13th century until the end of the 20th century by projecting their demographic hierarchy in a graph and on a map. In this manner explanations were measured on their applicability for the case of the Randstad. This explorative exercise results in both a description of long-term change in hierarchy in the Randstad and a theoretical approach. Long-term change in the urban hierarchy of the Randstad roughly proceeded in three phases. In the Middle Ages there was a polycentric hierarchy wherein the oldest cities, Utrecht and Dordrecht, were dominant. Although all towns in Holland grew rapidly in the 14th century, by the 1560s one of the youngest and smallest towns, Amsterdam, suddenly took the lead. In the second phase, between 1560 and 1795, a monocentric hierarchy developed with Amsterdam as a primate city. In this dynamic period, where many towns changed ranks, severe growth followed by shrinkage occurred simultaneously with sharpening inequality between towns. In the third phase, between 1795 and 2000, the hierarchy became polycentric once more, with a group of large towns taking the lead. This was mostly due to the extraordinary growth of Rotterdam and The Hague. In contrast with the second phase, the parallel appearance of sharp growth and inequality did not coincide with change in ranks. As a conclusion of part I, in chapter 3 the three determining factors for change in urban hierarchies over time are identified. Urban hierarchy is interpreted as a functional division of tasks between multiple centres, which is the result of differences in the towns’ competitive positions over time. The potency of a town’s competitive position is primarily determined by the interaction of (1 its properties on the one hand and (2 the conditions on the international market on the other. Additionally this interaction is structurally influenced by (3 contribution of a sovereign government. Governments can stimulate or disadvantage towns, but have done so in different ways. Part II further concretizes this approach by further investigation of the third factor. Here, governmental contribution to long-term change in urban hierarchies is given priority over the other two determining factors. Chapters 4, 5 and 6 focus successively on the constitutional periods of the Middle Ages (1200-1560, the Early Modern Age (1560-1795 and the Modern Age (1795-2000. These periods correspond to the three phases in long-term change in the demographic hierarchy from chapter 2. The aim of part II is twofold. Firstly, to identify and compare the manner in which sovereign government has been able to influence the towns’ competitive positions from the 13th until the end of the 20th century. Which trends are discernable in the toolbox of competitive advantages and their distribution by the sovereign government? How can governmental influence on change in urban hierarchies best be characterized? Secondly, if possible, to point out which governmental measures presumably contributed to change in urban hierarchy in general and, specifically, to the rise of the polycentric Randstad. Which measures show the most plausible correlation with change within the urban hierarchy? In order to identify competitive advantages for each constitutional period, a further look at the functional division of tasks, the economic context, and the governmental organization is taken in chapters 4, 5 and 6. Subsequently an impression of the distribution of so-called competitive advantages over the nine Randstad towns is sketched. At the end of each chapter the competitive advantages of a period are summed up, and their distribution is compared to the demographic hierarchy of chapter 2, to assess their impact. My research has resulted in the following conclusions to the aforementioned questions. During the Middle Ages a town’s competitive position could be stimulated with (1 international trade policy (safe conducts, trade agreements, (2 national economic policy (protectionist measures, staple- and minting policy, (3 exceptions of generally applied restrictions (town charters, toll exceptions, (4 distribution of governmental institutions, (5 donations of land property and kingly privileges, (6 granting of infrastructural concessions and awarding (7 urban autonomy. Heavy taxing and prolonged warfare were competitive disadvantages. In the early modern era (1 international trade policy, (2 distribution of governmental institutions and (3 infrastructural concessions were part of the toolkit. Heavy taxing was once more a disadvantage. During the modern era simulative measures were (1 funding of infrastructure, (2 industrial policy, (3 distribution of governmental institutions, (4 national spatial planning and (5 popular housing policy. Building restrictions were a negative for a town’s competitive position. The toolbox of sovereign government in general consists of three basic types of competitive advantages. Firstly, instruments that were aimed at the competitive position of one town exclusively, like staple rights, town charters, toll exemptions, donations of property and rights, urban autonomy and the distribution of governmental institutions. Secondly, instruments that were aimed at the region as a whole, like national and international economic policy. Third are side effects or collateral damage of other governmental policies, like prolonged warfare, heavy taxing and building restrictions stemming from spatial planning policy. The last category often turns out to be disadvantageous for towns’ competitive positions. Sovereign government didn’t apply the same variety of measures at every period. The overall package moved from a rather versatile toolbox in the 13th and 14th centuries to an increasingly limited one in the early modern period. In the 15th and 16th centuries, a discernable trend towards diminishing the variation in competitive advantages sets in, resulting in a rather limited toolbox in the 17th and 18th centuries. After a short expansion of instruments in the first half of the 19th century and a subsequent phase in the second half of the same century, where the number of instruments again strongly declined, the 20th century once again showed a governmental toolbox of various nature. On the long term, infrastructure and the distribution of governmental institutions were permanently part of the competitive advantages-toolbox; although before the 19th century sovereign government virtually never initiated the construction of infrastructure. Throughout most of the investigated period international economic policy and taxing played a role. Local exceptions like town charters and urban autonomy were exclusively medieval phenomena while spatial planning and popular housing policy are only found in the modern period. During the Middle Ages exclusive competitive advantages and common measures were both applied. Almost all nine towns seem to profit from this, although Dordrecht was generally more privileged than others. From the 15th century on exclusive privileges gradually disappear and more collective measures are taken, from which Amsterdam seems to profit. In the early modern era, the overall majority of measures taken were collective ones aimed at the common interest of towns or the region. Nonetheless, somehow Amsterdam seems to have profited above average without exception. In the modern era so many ‘collective’ stimulating measures were taken that this resulted in rather different competitive positions spatially. The distribution can best be characterized as a continuous strive for balance. Looking at the distribution of competitive advantages, governmental activity was variable throughout the entire period. Lots of competitive advantages were distributed in the 13th, 14th, early 17th and early 19th centuries. Subsequently governmental involvement gradually increased and in the 20th century government had its hands full continuously. In sharp contrast, distribution in the 16th and in particularly the second half of the 17th and 18th centuries was rather sparse. Strikingly, other measures than instruments that were explicitly aimed at the towns’ interests show the biggest correlation with change in the demographic hierarchy as shown in chapter 2. In the Middle Ages structural warfare coincided with the marked rise of Amsterdam and recession in the others; tax pressure in early modern times correlated with the decline of towns with industrial profiles; and 20th century demographic decline related to building restrictions in modern times. In general, the governmental role to change in urban hierarchy can best be understood as a facilitative one. The abovementioned centers of gravity in the distribution of competitive advantages coincided with periods of economic expansion and demographic growth in towns. This was the case in periods of urban expansion in the 13th-14th centuries and the 17th century. Only in the 19th century did governmental action precede urban growth. Although side effects in general seem to have been decisive, there’s one marked exception to the rule. The head start of the three biggest towns, and the catching up of Rotterdam and The Hague, does correlate with the construction of (international infrastructure and the distribution of governmental institutions between the 1850s en 1950s. This means that the rise of the polycentric Randstad, exceptionally, was created by conscious use of aimed governmental instruments! This study concludes with a striking hypothesis. Via the description of the governmental organization in each period, by accident attention is drawn to the fact that by bargaining over tax funds, towns themselves gathered political influence in the 15th and even power in the 17th-18th centuries. The rise of urban power coincides with stagnation in the distribution of competitive advantages and the disappearance of exclusive instruments out of the governmental toolkit. This, firstly, gave rise to the suspicion that, once in power, urban representatives preferably avoid the stimulation of opponents’ competitive positions. When combined with the fact that, after disabling towns financially and politically, sovereign government in the second half of the 19th century pursued a policy wherein they kept aloof of dominant Amsterdam and stimulated other large towns, a second hypothesis can be formulated. Could it be that the rise of the polycentric Randstad wasn’t coincidence, and that Holland’s paradox was the result of a deliberate reckoning with an old political elite?

  11. Het gezin tussen verleden en toekomst : een sociologisch onderzoek in twee verstedelijkende plattelandsgemeenten voor en na de jaren zestig : beschrijving, analyse en beschouwingen

    NARCIS (Netherlands)

    Douma, W.H.

    1975-01-01

    This study comprises the results of two investigations, the second of which was carried out more than a decade after the first. The initial project was done in 1960. The motive for starting it at the time were the strains on family life, caused by the profound economic and social changes taking

  12. The flow of goods model of the Rotterdam Port Authority; Het goederenstromenmodel voor de Rotterdamse haven. De verhouding tussen fysieke stromen en economische grootheden

    Energy Technology Data Exchange (ETDEWEB)

    Saitua, R. [Haveninnovatie van het Gemeentelijk Havenbedrijf, Rotterdam (Netherlands)

    1995-12-01

    Long term forecasts of the flow of goods through the Port of Rotterdam are essential for port development aims and to quantify the environmental effects of the generated traffic. Experience of the Rotterdam Port Authority shows that the differences between forecasts and realization can be explained by radical changes in the trends as a consequence of technological and social developments. In the `Flow of goods model number 6` scenario, techniques have been used to asses the fundamental uncertainty of the future, as well as a combination of quantitative and qualitative methods (for example expert judgements). Much attention has been given to the so called `dematerialization` trend, which means less use of primary commodities by production unit. Problems that have to be tackled within a more appropriate way are: (1) expected less growth of the trade measured in weight than the trade measured in monetary units; and (2) the influence of geographical patterns of production (lean production with global sourcing versus more local diffused production) on trade and transport flows. 2 tabs., 9 refs.

  13. Psychologische basisbehoeften van docenten-in-opleiding : Een onderzoek naar het verband tussen de basisbehoeftevervulling van docenten-in-opleiding, hun interpersoonlijk functioneren en de inzet van kernkwaliteiten

    NARCIS (Netherlands)

    Evelein, F.G.

    2005-01-01

    The aim of this study was to gain more insight into the effects of non-rational and unconscious factors on the functioning of student teachers. It focused on (1) the fulfilment of the basic psychological needs of student teachers, (2) the relation between this fulfilment and their interpersonal

  14. DE RECHTSVRAAG DER CHRISTENVERVOLGINGEN IN HET ...

    African Journals Online (AJOL)

    Test

    godsdienst, maar om allerlei crimina, anders is de rechter niet in beweging te brengen. Dit wist het volk en beschuldigde daarom maar raak. Dere. EusEBius, h.e., VII, ll,6epitokütaphy3tntrepesthüi. *") TH. MoMMSEN, Der Reitgiotis/ret'e! nach róm. Recht, Hist. Zeitschr. 64, 1890,. S. 389. Röm. Strafrecht, IV, 1, Abschn. 85.

  15. De metafoor van het washandje. Column

    Directory of Open Access Journals (Sweden)

    Yolan Koster-Dreese

    2007-03-01

    Full Text Available In hun artikel ‘Kwaliteit en Zorg’ van ruim tien jaar geleden stellen Van Houten en Prins (1995 dat de thans vigerende zorgtaal in meer algemene zin kan worden aangeduid als ‘zorg-Taylorisme’: een scientific management-benadering van zorg. Met de introductie van de ‘zorgmarkt’ is een benadering ontstaan die grote overeenkomsten vertoont met die scientific management-benadering uit het begin van de vorige eeuw, zo menen Van Houten en Prins.

  16. Tussen tekst en lezer. Een historische inleiding in de bijbelse hermeneutiek 1: De vroege kerk - Schleiermacher

    NARCIS (Netherlands)

    Zwiep, A.W.

    2009-01-01

    De bijbel is weer helemaal terug in het publieke domein, getuige allerlei discussies in de media over schepping en evolutie, over religie en geweld, over vrijheid van godsdienst en vrijheid van meningsuiting. De vraag hoe de bijbel in dergelijke debatten geïnterpreteerd moet worden – kun je van de

  17. Toerisme verrijkt? : een discussie over de relatie tussen toerisme en armoedebestrijding, inleiding

    NARCIS (Netherlands)

    Duim, van der V.R.

    2005-01-01

    Na ecotourism, duurzaam en verantwoord toerisme is er de laatste jaren een nieuwe loot aan de stam gegroeid: pro-poor tourism. Het wordt gedragen door organisaties als: World Tourism Organisation (tijdens de wereldtop in Johannesburg), de SNV (met zo'n 40 toeristische adviseurs over diverse landen

  18. Psychologen en marteling : De samenwerking tussen de American Psychological Association en de CIA

    NARCIS (Netherlands)

    Schram, Hilda

    2015-01-01

    De CIA heeft in de periode na 11september 2001, in het kader van de bestrijding van terrorisme, bij ondervragingstechnieken gebruik gemaakt van marteling. Psychologen speelden hierbij een niet onbelangrijke rol . In dit artikel wordt aan de orde gesteld dat de betrokkenheid van psychologen bij

  19. Het zelfreinigend vermogen van de wetenschap: parapsychologie en peer review 2.0

    NARCIS (Netherlands)

    Kievit, R.A.

    2011-01-01

    Onlangs werd opnieuw het bestaan van parapsychologische fenomenen geclaimd. Al vóór publicatie leidde dit tot discussies op wetenschappelijke weblogs. Rogier A. Kievit illustreert met deze casus het zelfcorrigerende vermogen van het vak.

  20. Het verbonden winkelgebied : hoe collectieve digitale marketing kan bijdragen aan een aantrekkelijke binnenstad

    NARCIS (Netherlands)

    Risselada, A.H.; Hagen, D.; Weltevreden, J.W.J.; Atzema, O.A.L.C.; Spierings, B.; Janssen, J.W.H.; Ghaus, F.

    2018-01-01

    Met het handboek ‘Het verbonden winkelgebied’ willen we inzichtelijk maken hoe collectieve digitale marketing kan bijdragen aan een aantrekkelijke binnenstad. Het handboek bevat naast onderzoeksresultaten ook een toolkit met een plan van aanpak voor collectieve marketing. Collectieven,

  1. Inventarisatie stofbadgedrag van vleekuikenouderdieren in het communesysteem en bij strooisel/rooster huisvesting

    NARCIS (Netherlands)

    Rooijen, van J.; Haar, van der J.W.

    1997-01-01

    Het stofbadgedrag van vleeskuikenmoederdieren is geonventariseerd onder praktijkomstandigheden: in een traditionele grondstal (strooisel/rooster) en in een groepskooi (het Commune systeem). In de grondstal bleken de moederdieren op het strooisel te stofbaden. Zoals op basis van de literatuur

  2. Enquête naar het gewasbeschermingsgedrag van telers en hun houding tegenover het gewasbeschermingsbeleid. Tussenevaluatie nota Duurzame Gewasbescherming, deelrapport Economie 2

    NARCIS (Netherlands)

    Lauwere, de C.C.; Bremmer, J.; Gaag, van der D.J.; Linden, van der T.; Meer, van der R.W.; Netjes, A.; Spruijt, J.; Wal, van der E.

    2006-01-01

    Een belangrijk onderdeel van het deelproject economie is een enquête die is gehouden onder 410 telers uit acht sectoren. De geïnterviewde telers staan positief tegenover het gewasbeschermingsbeleid (goed voor het milieu en goed voor het imago), maar zijn ook ongerust over vermeend

  3. Risico’s van introductie van exotische plantensoorten, in het bijzonder uit het geslacht Ambrosia L., via import van zaden voor met name veevoer en vogelvoer

    NARCIS (Netherlands)

    Denderen, van Daniël P.D.; Tamis, Wil L.M.; Valkenburg, van Johan L.C.H.

    2010-01-01

    Import van landbouwproducten, in het bijzonder zaden, zijn een belangrijke bron voor de introductie van exotische plantensoorten. In dit artikel wordt ingegaan op twee studies naar het voorkomen van exotische planten, in het bijzonder uit het geslacht Ambrosia, in geïmporteerde partijen zaden. Met

  4. The Pallas business case between dreams and reality; De Pallas business case tussen droom en werkelijkheid

    Energy Technology Data Exchange (ETDEWEB)

    Van der Keur, H.

    2013-04-15

    This report provides an overview of government policies in Canada and the Netherlands and international policies for securing the supply of medical isotopes. LAKA comments these policies with findings from own research. LAKA also identifies production methods - accelerators or research reactor - for the short and longer term that show the most benefit for recovery and ensure continuity in the supply of medical isotopes. This report also is an attempt to restart the debate on the future of medical isotope production in the Netherlands. According to LAKA the business case for the Pallas reactor is based on unrealistic positive assumptions and concludes that the Pallas reactor should not secure the supply of medical isotopes but the future of nuclear energy in the Netherlands [Dutch] Dit rapport geeft een overzicht van zowel het overheidsbeleid in Canada als in Nederland, en het internationale beleid voor het veiligstellen van de aanvoer van medische isotopen. Het voorziet deze van commentaar met bevindingen uit eigen onderzoek en stelt vast welke productiemethode - versnellers of onderzoeksreactor - op de korte en de langere termijn het meeste profijt biedt voor herstel en waarborging van de continuïteit in de aanvoer van medische isotopen. Met dit rapport wil de stichting Laka een poging doen om alsnog een debat op gang te brengen over de toekomst van medische isotopenproductie in Nederland. Volgens Laka is de business case voor de Pallas reactor gebaseerd op onrealistische positieve aannames en concludeert dan ook dat de Pallas reactor niet de aanvoer van medische isotopen maar de toekomst van kernenergie in Nederland veilig moet stellen.

  5. De middeleeuwse ambachtelijke wijk van Pamele (stad Oudenaarde, Oost-Vlaanderen). Het onderzoek in het Huis de Lalaing. 1. De pottenbakkersovens

    OpenAIRE

    De Groote, K.

    1994-01-01

    In april 1988 werd pottenbakkersafval aangetroffen bij graafwerken op de binnenkoer van het Huis de Lalaing te Oudenaarde. Dankzij de snelle tussenkomst van het stadsbestuur, en in het bijzonder van de toenmalige schepen van cultuur, Jean-Pierre Van der Meiren, werden de werken stilgelegd. Het bedreigde terrein, dat eigendom is van de stad, werd voor archeologisch onderzoek ter beschikking gesteld van het I.A.P.. De opgravingen werden voltooid in januari 1989

  6. Grammaire progressive du français niveau intermédiaire

    CERN Document Server

    Grégoire, Maïa

    2017-01-01

    Quatrième édition de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de Grammaire: une organisation claire : la leçon de grammaire sur la page de gauche; les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues un apprentissage progressif : il suit la progression naturelle des méthodes de français un usage souple : pour la classe ou en auto-apprentissage une préparation adaptée aux certifications : un entreînement efficace pour mieux réussir aux examens NOUVEAU! Appli-web de la Grammaire progressive du français incluse Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales : près de 300 exercices interactifs avec dialogues, instructions, exemples et corrigés ora...

  7. Grammaire progressive du français corrigés : niveau intermédiaire

    CERN Document Server

    Thiévenaz, Odile

    2017-01-01

    Quatrième édition des corrigés de l'ouvrage de Grammaire de français langue étrangère (FLE), niveau intermédiaire, dans la collection Progressive du français destiné aux grands adolescents et adultes. Ce qui fait le succès de cet ouvrage de grammaire: Une organisation claire : la leçon de grammaire sur la page de gauche, les exercices d'entraînement sur la page de droite 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues Un apprentissage progressif : il suit la progression naturelle des méthodes de français Un usage souple : pour la classe ou en auto-apprentissage Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens NOUVEAU!​ Appli-Web de la Grammaire progressive du français Pour s'entraîner et s'évaluer en ligne en sollicitant toutes les compétences écrites et orales: près de 300 exercices interactifs avec dialogues, instructions, exemples et corri...

  8. Communication progressive du français avec 320 exercices : niveau débutant

    CERN Document Server

    Miquel, Claire

    2013-01-01

    Ce qui fait le succès de cete ouvrage de communication: Une organisation claire: la leçon sur la page de gauche; les exercices et les activités communicatives sur la page de droite 40 fiches présentant les points généralement abordés au niveau A1 du Cadre européen commun de référence pour les langues Un apprentissage progressif: il suit la progression naturelle des méthodes de français Un usage souple: pour la classe ou en auto-apprentissage Une préparation adaptée aux certifications: un entrainement efficace pour mieux réussir aux examens A découvrir dans cette deuxième édition revue et augmentée: Un CD audio avec 69 documents sonores Un test d'évaluation avec ses corrigés Des illustrations pédagogiques acutelles et colorées 50 nouveaux exercices. Un livret de corrigés est proposé à part (ISBN 978-209-038133-7).

  9. Taxi ! méthode de français : niveau 3

    CERN Document Server

    Johnson, Anne-Marie

    2004-01-01

    Taxi ! 3 est une méthode interactive, qui développe non seulement les connaissances, mais aussi les savoir-faire et les savoir-être de l'apprenant, à l'écrit comme à l'oral. La méthode est très simple à utiliser : une leçon = une double page. Taxi ! 3 couvre le niveau Bl du Cadre européen commun de référence pour l'apprentissage, l'enseignement et l'évaluation des langues. La méthode permet de se préparer aux épreuves A3 et A4 du DELF 1er degré. Une progression et des contenus fonctionnels et langagiers solides permettent à l'apprenant d'atteindre rapidement une autonomie en français dans des situations de la vie courante. Taxi ! 3 permet de mieux connaître la France d'aujourd'hui et les comportements des Français à travers une grande variété de documents authentiques (écrit et audio).

  10. Options to reduce the required energy for cooling in datahotels. ICT. Keep a cool head; Mogelijkheden tot vermindering van de benodigde koelenergie in datahotels. ICT. Houd het hoofd koel

    Energy Technology Data Exchange (ETDEWEB)

    Sijpheer, N.C.; Ligthart, F.A.T.M. [ECN Zonne-energie, Petten (Netherlands)

    2002-02-01

    groeien. Met name de koeling van computerruimten vormt een groot deel van de energievraag. Reductie van de koelvraag door middel van het verhogen van de temperatuur in de computerruimten en het toepassen van vrije koeling resulteert in een lager energiegebruik. In de ICT sector bestaat de angst dat het verhogen van de ruimtetemperatuur een negatief effect heeft op de levensduur van de apparatuur. Naar aanleiding hiervan is een overzicht gemaakt van de klimaateisen van de computerapparatuur; de vermogensopname van de computerapparatuur; het werkelijk opgenomen vermogen van de computerapparatuur; de energiebesparingen door het verhogen van de ruimtetemperatuur in de computerruimten; en de energiebesparing door het toepassen van vrije koeling. Het koelen van de computerruimtes op een lagere temperatuur dan 30C is voor de onderzochte apparatuur niet noodzakelijk. Een minimale marge van 5C ten opzichte van de nominale werktemperatuur van de apparatuur kan het energiegebruik van de koelmachines met bijna 60% terugbrengen. Dat is ongeveer 13% van het totale energiegebruik. Wanneer tevens vrije koeling wordt toegepast, kan 95% van de energie benodigd voor de koelmachines worden bespaard, ofwel 21% op het totale energiegebruik. Het opgenomen vermogen van de computerapparatuur bedraagt circa 23% van het opgestelde vermogen. Wanneer de koelinstallatie wordt gedimensioneerd op het opgestelde vermogen van de apparatuur, zal de capaciteit van de installatie bijna een factor 5 te groot zijn. De eisen ten aanzien van de relatieve vochtigheid van de lucht in de computerruimten voor de apparatuur zijn over het algemeen niet strikt. Veelal ligt deze eis tussen de 10% en 90%. Ontvochtigen of bevochtigen kan een grote bijdrage hebben in het energiegebruik voor klimatiseren en is volgens de klimaateisen in de specificaties niet nodig. Praktisch aanvullend onderzoek naar de invloed van een verhoogde omgevingstemperatuur op de betrouwbaarheid van computerapparatuur, kan uitwijzen of de nominaal

  11. Hausse du niveau des océans et perte de terres dans le delta du Nil ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    9 juin 2016 ... Au moyen de systèmes d'information géographique (SIG), des chercheurs subventionnés par le CRDI ont déterminé les zones littorales du delta du Nil qui pourraient être touchées par la hausse du niveau des océans. Il pourrait en résulter d'importantes pertes de terres d'ici 2100. Selon les plus récentes ...

  12. Al Gore's an inconvenient truth ; waar? Het IPCC rapport geeft het antwoord.

    NARCIS (Netherlands)

    Zeiler, W.

    2008-01-01

    Het klimaat verandert. De gemiddelde temperatuur stijgt. Er komen vaker en vaker extreme weersomstandigheden voor. Denk in Nederland aan de hittegolven en de droogte van zomer 2003 en aan de vele regenbuien in augustus 2004, de natste augustus maand in 150 jaar. Vooral de mensen in

  13. Value-based project management : een aanpak voor chaordische projecten vanuit het perspectief van het complexiteitsdenken

    NARCIS (Netherlands)

    Mulder, N.T.

    2012-01-01

    Hedendaags projectmanagement bevindt zich in een crisis. Al meer dan twee decennia op rij komt het aantal succesvolle ICT-projecten niet boven de 30%. Zes tot negen van de tien innovatieprojecten mislukken. Grote infrastructurele projecten overschrijden tijd- en geldrestricties met 50 tot 100%. En

  14. Maak het Verschil met Je Merk : Het Identiteitsmanagementdashboard (IDM) voor Zorggroep Sint Maarten

    NARCIS (Netherlands)

    Bouten, L.M. (Lisanne); Morel, K.P.N. (Kaj)

    2012-01-01

    Om medewerkers en cliënten van Zorggroep Sint Maarten (ZSM) te helpen bijdragen aan goede zorg en deel je leven, wil ZSM inzichtelijk maken hoe goed zij presteert op beide aspecten. Het lectoraat Identiteitsmarketing heeft hiertoe een identiteitsmanagementdashboard voor ZSM ontwikkeld dat niet

  15. Eerste resultaten van het jaarrond volgen van Blauwe Kiekendieven broedend in het Oost-Groningse akkerland

    NARCIS (Netherlands)

    Klaassen, R.; Schlaich, A.E.; Bouten, W.; Both, C.; Koks, B.J.

    2014-01-01

    Blauwe Kiekendieven zien we tegenwoordig vaker in de winter dan in de zomer. Het gaat uitermate slecht met de Nederlandse broedvogels en als er niets gebeurt zullen we de soort binnen afzienbare tijd als broedvogel verliezen. De voormalige bolwerken op de Waddeneilanden zijn zo goed als verlaten.

  16. Het paracervicale block tijdens de baring

    NARCIS (Netherlands)

    P.K. Flu (Peter Kalev)

    1977-01-01

    textabstractDe baring is het enige fysiologische gebeuren dat met pijn gepaard gaat. Dit wordt reeds aangeduid door het Nederlandse woord 11wee" en equivalente woorden in vele andere talen (dolor, douleur, pains, Wehe e.a.). De pijn is aanvankelijk vooral gelocaliseerd in de onderbuik en onder in de

  17. Over de behandeling van het carcinoma planocellulare infiltrativum vulvae

    NARCIS (Netherlands)

    Geling, Jozephus Hermannus

    1966-01-01

    SAMENVATTING Het doel van dit proefschrift is de behandeling weer te geven van het infiltratief groeiend plaveiselcarcinoom van de vulva, zoals deze in een aantal grotere gynaecologische centra in Nederland gedurende de jaren 1946 tot en met 1960 is uitgevoerd. Aan de hand van een literatuurstudie

  18. Bedrijfsrisico's van de accountant en het Audit Risk Model

    NARCIS (Netherlands)

    Wallage, Ph.; Klijnsmit, P.; Sodekamp, M.

    2003-01-01

    In de afgelopen jaren is het bedrijfsrisico van de controlerend accountant sterk toegenomen. De bedrijfsrisico’s van de accountant beginnen in toenemende mate een belemmering te vormen voor het aanvaarden van opdrachten. In dit artikel wordt aandacht besteed aan de wijze waarop de bedrijfsrisico’s

  19. Ecologische risico's van koper en zink in het oppervlaktewater

    NARCIS (Netherlands)

    Bonten, L.T.C.; Vink, J.; Verschoor, A.

    2011-01-01

    Het merendeel van de Nederlandse (rijks)wateren voldoet niet aan de door de Kaderrichtlijn Water vereiste chemische en ecologische toestand. In veel oppervlaktewateren in Nederland zijn de concentraties van de metalen koper en zink hoger dan de wettelijke normen. Tot dusver is het echter niet

  20. Interview met Leon Deben: van tegenstellingen leer je het meeste

    NARCIS (Netherlands)

    van Diepen, A.; Huisman, C.

    2008-01-01

    Wat in de jaren zeventig begonnen is als Sociologie van bouwen en wonen is uitgegroeid tot Stadssociologie. Leon Deben heeft het medeopgebouwd. Hij nam onlangs afscheid van de universiteit met een rede over de openbare ruimte. "Het centrale bestuur van de stad is druk met de waan van de dag en dan

  1. Het stakeholder-model: over economie, bedrijfsethiek en landbouw

    NARCIS (Netherlands)

    Jongeneel, R.A.

    2003-01-01

    Oktober 2002 kwam LTO met de basisnotitie "Agrarisch ondernemen op maatschappelijke gronden" naar buiten. De notitie is bedoeld als basis voor discussie over maatschappelijk verantwoord ondernemen. Binnen het brede kader van economie en ethiek wordt in dit artikel ingegaan op het pleidooi voor

  2. Hoe je het cryptosysteem RSA soms kunt kraken

    NARCIS (Netherlands)

    Weger, de B.M.M.; Wiegerinck, J.J.O.O.

    2010-01-01

    RSA is een veelgebruikt cryptografisch systeem, bijvoorbeeld voor het beveiligen van internetverkeer. Het is een asymmetrisch systeem, d.w.z. versleutelen gebeurt met een publieke sleutel, ontsleutelen met de bijbehorende privésleutel. RSA maakt gebruik van eenvoudige getaltheorie en kan dan ook

  3. Sport, kunst en propaganda in het Derde Rijk

    NARCIS (Netherlands)

    Jan de Leeuw

    2017-01-01

    In de Duitse stad Bochum loopt op dit moment een tentoonstelling met als titel: 'Artige Kunst' (gewillige, gehoorzame kunst). Het is kunst die paste bij de cultuurpolitiek van het nationaalsocialisme van Adolf Hitler. In 1937 werd deze kunst getoond tijdens de eerste Grossen Deutschen

  4. ASS-leerlingen en open opdrachten in het voortgezet onderwijs

    NARCIS (Netherlands)

    A. van Tilborg; Drs. José Wichers-Bots; drs. M. Haasen

    2007-01-01

    'Hoe bieden we leerlingen met een stoornis in het autistisch spectrum (ASS-leerlingen) met een cluster 4 indicatie hulp bij het uitvoeren van open opdrachten?' Deze vraag stelde een havo-school aan de ambulante dienst. Fontys Opleidingscentrum Speciale Onderwijszorg, de ambulante dienst en

  5. 'We weten precies hoe we het productieproces kunnen sturen'

    NARCIS (Netherlands)

    Bitter, J.H.

    2015-01-01

    Binnen Wageningen UR wordt op grote schaal samengewerkt met bedrijven. Dat helpt niet alleen het bedrijf zelf vooruit, maar ook de biobased economy in het algemeen. Prof. Dr. Harry Bitter: ‘De kennis over de eigenschappen van bijvoorbeeld bioplastics wordt alleen maar groter.’

  6. Het optimale pluktijdstip is te voorspellen : rode bessen

    NARCIS (Netherlands)

    Westra, E.H.; Verschoor, J.A.

    2010-01-01

    Voor de lange bewaring van rode bessen moeten telers op het juiste moment plukken. Te vroeg oogsten geeft uitval door rot. Wageningen UR Food & Biobased Research (voorheen AFSG) ontwikkelde een voorspellingsmodel om het optimale pluktijdstip te kunnen bepalen op basis van de temperatuur in de

  7. Het grootste woordenboek ter wereld | van Wyk | Lexikos

    African Journals Online (AJOL)

    F. Heyvaert, A. Moerdijk, M. Mooijaart, M. Smits en R. Tempelaars (redactie). Het grootste woordenboek ter wereld: Een kijkje achter de kolommen van het Woordenboek der Nederlandsche Taal (WNT), s.j., 434 pp. ISBN 90 75566 96 4. URL: http://www.sdu.nl. Den Haag: SDU Uitgevers / Antwerpen: Standaard Uitgeverij.

  8. SEDIMENTOLOGIE IN UTRECHT : hoe staat het daar mee?

    NARCIS (Netherlands)

    Westerhoff, Wim

    Sinds het vertrek van Poppe de Boer, eind 2014, stelt de Utrechtse Universiteit het zonder een hoogleraar sedimentologie. Toch gaan er jaarlijks honderden studenten op veldwerk en speelt de sedimentologie in onderwijs en onderzoek een cruciale rol. Hoe zit dat eigenlijk? En wie zijn nu de gezichten

  9. Een moslim als gemeentelijk bruggenbouwer? Het ontslag van Tariq Ramadan

    NARCIS (Netherlands)

    Wiegers, G.; van Zessen, N.

    2009-01-01

    Het ontslag van Tariq Ramadan heeft veel ophef veroorzaakt. De doorslag gaf zijn werk voor Press TV. Gerard Wiegers en Nelleke van Zessen stellen, net zoals Ramadan zelf, dat de controverse rond zijn opvattingen over homoseksualiteit het kernprobleem vormde. Ramadan bleek niet de vrijzinnige moslim

  10. 25 jaar (uitsluiting van het) Weens Koopverdrag in Nederland

    NARCIS (Netherlands)

    Kruisinga, S.A.

    Op 1 januari 2017 was het precies 25 jaar geleden dat het Weens Koopverdrag (CISG) in Nederland in werking trad. Partijen bij een internationale koopovereenkomst kunnen de toepassing van dit verdrag geheel of gedeeltelijk uitsluiten (art. 6 CISG). Van deze mogelijkheid wordt in de praktijk

  11. Doorbraakinnovaties en ‘omgekeerde’ technologiebeoordeling: het geval van deeleconomie

    NARCIS (Netherlands)

    Frenken, Koen|info:eu-repo/dai/nl/207145253

    2016-01-01

    Dit artikel gaat over de wijze waarop de gemeente Amsterdam is omgegaan met de opkomst van het huizendeelplatform Airbnb. In samenwerking met Airbnb zijn regels opgesteld, die in de praktijk lastig te handhaven zijn zonder toegang tot gebruikersdata van Airbnb. Ook het wetenschappelijk onderzoek

  12. Syndicaatsleningen: veel eenvoudiger als vennootschap : Het syndicaat als stille vennootschap

    NARCIS (Netherlands)

    M.L. Tuil (Mark)

    2009-01-01

    textabstractIn dit artikel wordt de stelling uitgewerkt dat – in elk geval onder het komende personen-vennootschapsrecht – de syndicaatslening aanleiding geeft tot het ontstaan van een personenvennootschap en niet – zoals thans wordt aangenomen – tot een eenvoudige gemeenschap. Vervolgens wordt

  13. Gezondheidsrisico's in verband met het werken met Pentachloorfenol : een onderzoek

    NARCIS (Netherlands)

    Geuskens, R.B.M.; Nossent, S.M.; Koëter, H.B.W.M.; Dreef-van der Meulen, H.C.; Stijkel, A.; Zielhuis, R.l.

    1989-01-01

    De gezondheidsrisico's i.v.m. het werken met pentachloorfenol (PCP) wordt geevalueerd. Het gebruik van PCP in Nederlandse arbeidssituaties neemt sterk af en is beperkt tot de formulering van emeltenkorrels en de, met name preventieve, houtverduurzaming. De totale risicopopulatie is niet omvangrijk

  14. Visualisatie van het Objectgeoriënteerde Paradigma

    NARCIS (Netherlands)

    Rensink, Arend

    2002-01-01

    Programmeeronderwijs maakt een wezenlijk deel uit van elke informatica-opleiding. Veel opleidingen kiezen ervoor dit onderwijs te schoeien op objectgeoriënteerde leest. Voor studenten die voor het eerst met dit paradigma geconfronteerd worden blijkt het vaak lastig te zijn zich een voorstelling te

  15. Aantekeningen over de oostelijke begrenzing van het drentse district

    NARCIS (Netherlands)

    Clason, E.W.

    1957-01-01

    Gaan we thans over tot de akkeronkruiden en ruderale planten, voorkomende op plaatsen, waar het plantendek veelvuldig wordt gestoord en waar adventieven moer gelegenheid krijgen zich te vestigen. Hierbij zijn er een aantal meer algemene, die hij ons in het D.D. niet of niet geregeld aanwezig zijn,

  16. De syntaxis in het moedertaalonderwijs op de lagere school

    NARCIS (Netherlands)

    Boersma, Uilkje Jeltje

    1960-01-01

    Het eerste deel van deze studie omvat een historisch overzicht van grammaticale stromingen binnen en buiten het nederlandse taalgebied, die onze traditie hebben gevormd. Dit gedeelte beoogt: zeker niet een uitputtende en zuiver filologische beschrijving van de geschiedenis der nederlandse taalkunde

  17. Wegdekstroefheid en verkeersongevallen : een onderzoek naar het verband tussen wegdekstroefheid en het relatieve aantal verkeersongevallen op verschillende typen en vormen wegen buiten de bebouwde kom in de provincie Noord-Brabant.

    NARCIS (Netherlands)

    Tromp, J.P.M. Doornekamp, J. & Bos, J.M.J.

    1984-01-01

    A study has been made into the relationship between road surface unevenness and the relative number of traffic accidents on different kinds of roads outside the built-up area in the province of Noord-Brabant. There exists a statistical relation between the road surface unevenness and traffic

  18. Participatie en empowerment in de gezondheidsbevordering: Professionals in de knel tussen ideaal en praktijk?

    Directory of Open Access Journals (Sweden)

    Gaby Jacobs

    2005-12-01

    Full Text Available Deze bijdrage is gebaseerd op een onderzoek in opdracht van ZonMw (de Nederlandse organisatie voor gezondheidsonderzoek en ontwikkeling naar de state of the art van empowerment in de Nederlandse gezondheidsbevorderings- en preventiepraktijken. Daartoe is een literatuurstudie verricht en zijn acht van de in totaal 54 projecten binnen het programma ‘Gezond Leven’ van ZonMw geselecteerd vanwege hun gerichtheid op empowerment van de deelnemers, tot uitdrukking komend in zinsneden in de projectvoorstellen als ‘meer grip krijgen op het eigen leven’, 'bewust keuzen leren maken en daar zelf verantwoordelijkheid voor nemen’, ‘helpen hun kracht en kwaliteiten om met de bestaande situatie om te gaan te ontdekken of te versterken’ en ‘erkenning van de eigen ideeën en expertise van mensen’.

  19. PROLEGOMENA OVER EXEGESE EN DOGMATIEK Het is ...

    African Journals Online (AJOL)

    Test

    zijn grooten slag (in 1870) en zijn verdere carrière, las men hier zelfs. Goethe nauwelijks, terwijl b.v. Victor Hugo algemeen bekend was. Wanneer onze dogmatici oproepen tot een t e r u g k e e r n a a r d e. R e f o r m a t o r i s c h e g e e s t e s g e s t e l d h e i d en daardoor het probleem Exegese en Dogmatiek acuut wordt ...

  20. HET/JUPITER project assessment report

    International Nuclear Information System (INIS)

    Baxter, B.J.; Harrington, F.E.; Kaiser, G.G.; Wolf, J.

    1979-05-01

    This report is an assessment of the United States' Hot Engineering Test (HET) and the Federal Republic of Germany's Juelich Pilot Plant Thorium Element Reprocessing (JUPITER) Projects. The assessment was conducted with a view to developing mutually supportive roles in the achievement of hot engineering test objectives. Conclusions of the assessment are positive and identify several technical areas with potential for US/FRG cooperation. Recommendations presented in this report support a cost-effective US/FRG program to jointly develop high temperature gas-cooled reactor fuel recycle technology. (orig.) [de

  1. Computerized tomographic visualization of niveau by turning the head in a case of pituitary apoplexy

    International Nuclear Information System (INIS)

    Sasajima, Toshio; Mineura, Katsuyoshi; Kowada, Masayoshi; Sasaki, Junko; Sasajima, Hiroyasu; Sakamoto, Tetsuya

    1987-01-01

    A case of pituitary apoplexy is presented in which a free niveau formation, a pathognomonic sign of this entity, was proved by means of computerized tomography (CT) by turning the head. A 48-year-old female had developed a sudden, excruciating, retroorbital headache, vomiting, and visual disturbance twice prior to admission. The visual acuity was 0.1 in the right eye and 0.6 in the left eye. The optic fundi were normal. There was a right temporal field loss and a left upper temporal quadrantanopsia. A plain skull film disclosed ballooning and a double floor of the turcic sella. A CT scan of the head, performed by means of a GE CT/T 8800 Scanner, showed an intrasellar low-density mass with a slightly enhanced rim. We were not convinced of the presence of a high-density area, though there seemed to be one adjacent to the posterior clinoid process and the turcic floor, because of the partial volume effect and the artifact related to the neighboring bones. Another high-resolution CT scan on the ensuing day, as the head was turned and then kept still at about 45 degrees to the right, while the patient was supine, for ten minutes, made it possible to visualize a free fluid level, comparable to a fluid-blood-density level. A transsphenoidal pituitary exploration identified blood fluid collection in the encapsulated tumor, a finding which was histologically consistent with the sinusoidal type of chromophobe adenoma. There was some microscopic evidence of necrosis and hemosiderin laden cells. The postoperative course was uneventful; visual acuity improved without delay, and the temporal field defect became significantly smaller. Two weeks later, visual acuity had recovered to 1.2 uncorrected in each eye. CT and the pertinent position of the head might be quite helpful for the visualization and confirmation of a subtle free fluid level in cases of pituitary apoplexy. (author)

  2. Bronnen van nutriënten in het oppervlaktewater in het beheergebied van Wetterskip Fryslân

    NARCIS (Netherlands)

    Boekel, van E.M.P.M.; Groenendijk, P.; Renaud, L.V.

    2016-01-01

    Om inzicht te krijgen in de herkomst en beïnvloedbaarheid van stikstof en fosfor in het oppervlaktewater in het beheergebied van Wetterskip Fryslân zijn met de ECHO-methodiek stofbalansen opgesteld voor een zestal polders. De beïnvloedbaarheid van bronnen is afgeleid conform de werkwijze die wordt

  3. Afbouw van het Wsw-bestand: actualisatie op basis van Wsw-gegevens ultimo 2013

    NARCIS (Netherlands)

    Berden, C.; Tempelman, C.

    2014-01-01

    In opdracht van het ministerie van Sociale Zaken en Werkgelegenheid heeft SEO Economisch Onderzoek onderzoek gedaan naar de verdeling van het Participatiebudget over gemeenten. Een onderdeel van dit onderzoek vormde het voorspellen van de afbouw van het huidige zittend bestand in de Wsw op basis van

  4. Onderzoek naar de ultraviolette stralingsniveaus bij lassen, uitgevoerd door het Metaalinstituut TNO apeldoorn

    NARCIS (Netherlands)

    Cox, C.W.J.; Haan, T. de

    1989-01-01

    In dit onderzoek zijn metingen van de spectrale irradiantie bij drie lasprocessen verricht. Het betrof het lassen met beklede elektroden, het TIG-lasproces en het MIG-/MAG-proces. Bij de diverse processen zijn een aantal van invloed zijnde parameters zoals materialen, beschermgas en stroomsterkte

  5. Are all Building Information Models (BIM) the same?; Het ene BIM is het andere niet

    Energy Technology Data Exchange (ETDEWEB)

    Bouwman, J.W. [VolkerWessels, Rotterdam (Netherlands); Kuijer, H.J. [DHV, Amersfoort (Netherlands)

    2011-04-15

    Building Brains has been set up by TNO as a cooperative and started September 21, 2009. The aim of the project was to answer the question how the energy consumption in the Netherlands can be reduced by 50% up to 2030 or how the built environment can be made energy-neutral. This issue of the magazine is dedicated to Building Brains project. BIM (Building Information Modelling) is one of the major buzzwords in the building industry today. However, not every BIM in the market is the same, nor have they the same intentions, nor have they the same functionality. In this article the authors argument the reasons behind the structure of BIM data as used by the project Building Brains as well as its use in the newly developed building process. In the second part of this article the authors demonstrate the advantages of this structure by means of an example in the design process, where, thanks to a BIIM and a suitable library, the data always represents a 100% finished building (however in the early design stage the largest part of the data will be 'in progress' as towards the end of the design the largest part of the data will be 'final') [Dutch] Building Brains is een door TNO opgezet samenwerkingsproject dat op 21 september 2009 van start ging. Het doel van het project is antwoord te geven op de vraag hoe tot 2030 het energiegebruik in Nederland kan worden gehalveerd of hoe de gebouwde omgeving energieneutraal kan worden gemaakt. Deze aflevering van het tijdschrift TVVL is vrijwel geheel gewijd aan het Building Brains project. Het gebouw was een van de onderwerpen in Building Brains. De onderzoeksdoelstelling bij dit onderwerp luidde: 'Onderzoek wat nodig is om te komen tot een breed toepasbaar, bestendig recept met ingredienten en gerei om in de nabije toekomst gebouwen aantoonbaar duurzaam te maken'. Een randvoorwaarde was: 'Hoe en in welke vorm is BIM (Bouwwerk Informatie Model) in dit recept inzetbaar'. Dit artikel gaat in op de

  6. Integraal economisch en ecologisch toetsingskader voor de Nederlandse boomkorvisserij (ECOTOETS) Fase 2: relaties tussen visbestanden, CPUE en winst Fase 3: analyse secundaire indicatoren en boomkor AMOEBE

    NARCIS (Netherlands)

    Oostenbrugge, van H.; Quirijns, F.; Poos, J.J.; Hoof, van L.; Pastoors, M.A.

    2003-01-01

    Het onderzoeksprogramma EcoToets heeft tot doel geïntegreerde economische, visserijbiologische en ecologische indicatoren voor beleidsmatig gebruik te ontwikkelen. Het Rijksinstituut voor Kust en Zee (namens Directie Noordzee) en Directie Visserij (LNV) hebben het LEI en RIVO opdracht gegeven een

  7. Waar klinkt het beste startschot: bij de taaltest of bij de behoefteanalyse?

    OpenAIRE

    Van Houtven, Tine; Peters, Elke

    2010-01-01

    Wat is een behoefteanalyse? Hoe kan je een behoefteanalyse inzetten voor taalbeleid? Waarom is een behoefteanalyse belangrijk voor de ontwikkeling van taalondersteuningsmateriaal? Met welke belangrijke principes moet je rekening houden? Op deze vragen proberen we tijdens het eerste deel van deze sessie een antwoord te geven aan de hand van een praktijkvoorbeeld: een behoefteanalyse die in het kader van het project “Taalvaardig in het hoger onderwijs: doorstroom en taalbeleid" (van het Onderwi...

  8. Valorisation de chaleur à bas niveau thermique Upgrading Low-Thermal-Level Heat

    Directory of Open Access Journals (Sweden)

    Cohen G.

    2006-11-01

    Full Text Available La mise en oeuvre à la fois de cycles thermodynamiques et de fluides adaptés permet d'élargir considérablement les possibilités de récupération et de valorisation de la chaleur à bas niveau contenue dans les rejets thermiques industriels, l'eau géothermale, le rayonnement solaire ou le milieu environnant. Ceci permettra une meilleure préservation des ressources énergétiques dans les principaux secteurs consommateurs d'énergie : résidentiel, tertiaire et industriel. On décrit les possibilités que présentent : - Les cycles thermodynamiques directs (pompes de chaleur à compression ou à absorption dans le domaine du chauffage résidentiel et tertiaire où elles sont déjà bien implantées et dont les applications commencent à pénétrer le secteur industriel. - Les cycles thermodynamiques inverses (thermotransformateurs et cycles moteurs à fluide organique pour lesquels les progrès techniques accomplis et l'accroissement du prix de l'énergie devraient permettre d'en assurer la diffusion progressive dans le secteur industriel. The implementation of both thermodynamic cycles and suitable fluids makes for a considerable widening of the capacity to recover and upgrade the low-level heat contained in industrial heat wastes, geothermal water, solar radiation or the surrounding environment. This will make for better conservation of energy resources in the leading sectors of energy consumption, i. e. residential, tertiary and industrial. This article describes these possibilities in the form of: (a Direct thermodynamic cycles (compression or absorption heat pumps in the field of home and tertiary heating where they have already obtained a solid foothold and for which applications are beginning te penetrate into the industrial sector. (b Reverse thermodynamic cycles (heat transformers and organic-fluid motor cycles for which the technical advances made and the increase in energy prices should enable them to spread progressively

  9. Een jaar later, onderzoek naar de implementatie van de iPad bij het Leeuwarder Lyceum : Een vervolgonderzoek naar het iPad-gebruik onder leerlingen en leraren van het Leeuwarder Lyceum

    NARCIS (Netherlands)

    Stephanie Nijssen; Klaas Jan Huizing

    2013-01-01

    In september 2012 is de iPad geïmplementeerd in het onderwijs van het Leeuwarder Lyceum. Sowijs onderzocht tijdens de implementatie welke verwachtingen leerlingen en leraren hadden van de iPad. Nu, een jaar later, hebben we opnieuw onderzoek gedaan onder leerlingen en leraren naar het iPad-gebruik.

  10. Screening op (pre)maligne afwijking van de cervix uteri in Noord-Nederland : Een studie van de resultaten van het cytologisch onderzoek van de cervix binnen en buiten het kader van het bevolkingsonderzoek

    NARCIS (Netherlands)

    Zanten, Alje van

    1985-01-01

    De aanleiding tot deze studie is het feit dat vanaf 1978 in Groningen, Friesland en Drente het bevolkingsonderzoek naar cervixcarcinoom gaande is en de wens om de doeltmatigheid ervan aan een onderzoek te onderwerpen. Op deze wijze zou een bijdrage kunnen worden geleverd aan de bestudering van het

  11. De alcoholverkeercursussen : interimverslag van het evaluatie-onderzoek

    NARCIS (Netherlands)

    Brouwers, M.; Leuw, E.

    1990-01-01

    Het onderzoek is erop gericht informatie te geven over de volgende punten:Welke typen alcohol-verkeerswet overtreders worden door de Alcoholverkeercurussen (AVC's) bereikt?Welke effecten hebben de AVC's op relevante kennis, attituden en gedragingen van de cursisten?

  12. Gezondheidsrisico's in verband met het werken met Polychloorbifenylen : een onderzoek

    NARCIS (Netherlands)

    Geuskens, R.B.M.; Nossent, S.M.; Koëter, H.B.W.M.; Dreef-van der Meulen, H.C.; Stijkel, A.; Zielhuis, R.L.

    1989-01-01

    Met behulp van gegevens verkregen uit een werkplekinventarisatie naar gegevens over produktie/gebruik, risicopopulatie en (mogelijke) blootstelling aan polychloorbifenylen (PCB's), en een literatuurstudie naar mogelijke schadelijke eigenschappen van PCB's op het reproductiesysteem en/of nageslacht

  13. Hoezo Waardering? Het waarderen van ketenpartners in kwaliteitsgerichte ketens

    NARCIS (Netherlands)

    Ingenbleek, P.T.M.

    2004-01-01

    Het waarderen van ketenpartners is essentieel in kwaliteitsgerichte ketens. Via gesprekken met toeleveranciers over hoe de consument beter zou kunnen worden bediend, werden toeleveranciers van twee bedrijven steeds meer betrokken bij de productontwikkeling en kwaliteitsverbetering. De wijze waarop

  14. Achtergrondconcentraties van 17 sporenmetalen in het grondwater van Nederland

    NARCIS (Netherlands)

    Fraters B; Boumans LJM; Prins HP; LBG

    2002-01-01

    Er worden achtergrondconcentraties gegeven van 17 sporenmetalen in het grondwater in Nederland. De drie typen achtergrondconcentraties die onderscheiden worden, zijn: natuurlijk, semi-natuurlijk en regionaal. De natuurlijke achtergrondconcentratie is de concentratie zoals die gemeten zou worden op

  15. Voedselverspilling, waarden van voedsel in de keten : de mogelijke rol van het groene onderwijs bij het oplossen van een maatschappelijke opgave

    OpenAIRE

    Waarts, Y.R.; Onwezen, M.C.; Wiersinga, R.C.; Eppink, M.M.; Thoden van Velzen, E.U.; Timmermans, A.J.M.

    2009-01-01

    Het doel van deze verkenning is om op basis van literatuur en interviews met belangrijkste stakeholders een visie te formuleren over de wijze waarop het groene onderwijs een bijdrage kan leveren aan het verminderen van voedselverliezen binnen alle schakels van de keten inclusief de consument, en aan de nuttige toepassing van reststromen.

  16. Snacks en frisdrank op de middelbare school: Evaluatie van het proces en de implementatie van het automatenexperiment [Snacks and softdrinks in secondary schools

    NARCIS (Netherlands)

    Bassa-Dafesh, Z.; Buijs, G.J.; Kesteren, N. van; Snel, J.; Kocken, P.L.

    2011-01-01

    Op middelbare scholen werd een experiment uitgevoerd om het aanbod van snacks- en frisdrankautomaten gezonder te maken. Niet alleen het assortiment in de automaten werd veranderd, ook werd geëxperimenteerd met het bieden van productinformatie en verlaging van de prijzen van minder calorierijke

  17. ME O uwehand , Het groeiende kruis, GF Callenbach, Nijkerk, SJ ...

    African Journals Online (AJOL)

    Test

    de taal en gedagtes. Sagaria, die vader van die Doper, is eerste aan die woord. Hy ken die moderne digter Aafjes, en dis nie ver gesog nie want hy is self 'n digter of liewer het 'n ... Hy eindig, „Stel u voor, dat u in uw tijd weer de lof van God leerde ... het om met 'n man uit die geslag van Dawid te trou, om die moeder te.

  18. Between words and deeds. On interdisciplinarity and the importance of policy studies; Tussen woord en daad. Over interdisciplinariteit en beleidsrelevantie van onderzoek

    Energy Technology Data Exchange (ETDEWEB)

    De Wit, B. [Raad voor het Milieu- en Natuuronderzoek RMNO, Den Haag (Netherlands)

    2006-07-01

    An overview is given of recent studies on the title subject and the added value of interdisciplinary studies. [Dutch] Her belang van interdisciplinair onderzoek wordt vaak met de mond beleden. Waarom is het belangrijk en wat weten we over de praktijk van interdisciplinaire samenwerking? Recent buitenlands onderzoek licht een tipje op van de sluier. Naar aanleiding van de interimevaluatie van het Stimuleringsprogramma Biodiversiteit in 2003, werd er door de evaluatiecommissie op aangedrongen het tweede deel van het onderzoeksprogramma interdisciplinair op te zetten en te focussen op biodiversiteit in agrarisch gebied. Ook hier was vergroting van de beleidsrelevantie van de resultaten de achterliggende reden. Aangezien het Stimuleringsprogramma Biodiversiteit ooit is opgezet naar aanleiding van een advies van RMNO en NRLO, is onderzocht hoe begrippen als interdisciplinariteit en beleidsrelevantie zijn geoperationaliseerd in het programma. Dit resulteerde in het rapport 'Een studie over (bio)diversiteit'.

  19. Communication progressive du français avec 320 exercices : niveau débutant : corrigés

    CERN Document Server

    Miquel, Claire

    2013-01-01

    Ce qui fait le succès de cet ouvrage de communication: Une organisation claire: la leçon sur la page de gauche; les exercices et les activités communicatives sur la page de droite 40 fiches présentant les points généralement abordés au niveau A1 du Cadre européen commun de référence pour les langues Un apprentissage progressif: il suit la progression naturelle des méthodes de français Un usage souple: pour la classe ou en auto-apprentissage Une préparation adaptée aux certifications: un entrainement efficace pour mieux réussir aux examens A découvrir dans cette deuxième édition revue et augmentée: Un CD audio avec 69 documents sonores Un test d'évaluation avec ses corrigés Des illustrations pédagogiques acutelles et colorées 50 nouveaux exercices. Communication Progressive du français niveau débutant, 2ème édition (ISBN 978-209-038132-0).

  20. Het effect van grondontsmetting en organische bemesting op het bouwplan in de Veenkolonien : een technisch-economische analyse

    NARCIS (Netherlands)

    Groenwold, J.G.

    1990-01-01

    In dit deelonderzoek van het project "Veranderingen in de Veenkoloniale Akkerbouw" wordt aandacht besteed aan de technische en economische gevolgen van vermindering van grondontsmetting in de aardappelteelt en de haalbaarheid van dierlijke mest en groenbemesters. Berekeningen zijn uitgevoerd met en

  1. LED lighting and the Next Generation of Greenhouse for Tomatoes. Proof of Principle; LED belichting en Het Nieuwe Telen bij tomaat. Proof of Principle

    Energy Technology Data Exchange (ETDEWEB)

    Dueck, T.; Janse, J.; Eveleens, B. [Wageningen UR Glastuinbouw, Wageningen (Netherlands); Nieboer, S.; Valstar, W.; Grootscholten, M. [GreenQ Improvement Centre, Bleiswijk (Netherlands)

    2012-08-15

    het gewas en 85 {mu}mol m{sup -2} s{sup -1} LED-tussen. De LEDs hingen in 2 rijen: op ca. 40 cm boven de onderste bladeren en de tweede streng op 40 of op 70 cm hoogte daarboven. Er werden twee typen LEDs gebruikt: productie LEDs (lichtefficiëntie 1.6 {mu}mol m{sup -2} s{sup -1}; 13% blauw/87% rood) en interlighting LEDs (lichtefficiëntie 1.9 {mu}mol m{sup -2} s{sup -1}; 5% blauw/95% rood), met dezelfde lichtintensiteit. Bij de start van de teelt is zoveel licht gebruikt als het gewas aankon, en omdat het gewas zich goed ontwikkelde, is er al relatief vroeg besloten tot het verhogen van de stengeldichtheid. Dit heeft geleid tot een té hoge plantbelasting relatief vroeg in de teelt, terwijl er eigenlijk onvoldoende licht beschikbaar was om het aan te kunnen in de winter met weinig zonlicht. In het 192 cm rijafstanden systeem zijn de planten té dicht bij elkaar komen te staan. Een aantal problemen hebben zich daarbij voorgedaan met spoorelementen, een mindere bevlieging door de hommels, en het vochtige kasklimaat waardoor het gewas verzwakte in de winter. Hierdoor kon Botrytis op blad en stengel optreden. Het gewas heeft tot in het vroege voorjaar met een toename van de lichthoeveelheid moeite gehad met herstel. In vergelijking met een referentieteelt met 79 kg m{sup -2} tomaten, is er onder productie LEDs 75 kg m{sup -2} tomaten geproduceerd, en 80 kg m{sup -2} bij de interlighting LEDs, vnl. omdat laatst genoemde LEDs langer brande in de zomer. Op de ontvochtiging en warmte is 30% energie bespaard en op de elektra 27% t.o.v. de referentieteelt. Het blijkt dus goed mogelijk 30% energie te besparen met nagenoeg gelijke productie.

  2. Investigation of the structural preference and flexibility of the loop residues in amyloid fibrils of the HET-s prion.

    Science.gov (United States)

    Dolenc, Jožica; Meier, Beat H; Rusu, Victor H; van Gunsteren, Wilfred F

    2016-02-17

    The structural variability of a 16-residue loop (residues 246-261) which is in part disordered and connects two layers of the β-solenoid formed by the prion-form of HET-s and its prion domain HET-s(218-289) is investigated using molecular dynamics computer simulation. A system of three HET-s(218-289) molecules in a β-sheet structure as in the fibril is simulated in aqueous solution. The trajectory structures appear to be consistent with the Cα chemical shift data obtained. In order to delineate the influence of the β-sheet core of the fibril upon the structural variability of the loop, the latter is also simulated without the β-sheet core, but with its N- and C-terminal residues restrained at their positions in the fibril. The analysis of the trajectories shows that the structural variability of the loop is restricted by the β-sheet core, least at its N-terminal end and most in the middle of the trimer.

  3. Verlies van (thuis en haard. Het belang van verliesbegeleiding als onderdeel van de maatschappelijke begeleiding binnen het Vluchtelingenwerk, regio Utrecht

    Directory of Open Access Journals (Sweden)

    Birgit Hoogenberk

    2014-06-01

    Full Text Available Loss of home and house. The importance of loss counseling as a part of refugee social supportIn this article it is advocated that it is important that the implementation of loss counseling is part of social support for refugees, also called integrative eclectic working. Social support from VluchtelingenWerk, also known as Refugee Council, is about supporting the client in an effective manner with their personal problems which can hinder their integration. Because the target group of VluchtelingenWerk is a group of people whom have suffered many losses, attention should be brought to this subject. Unfortunately in current work methods there is no room for loss counseling, partly due to the lack of methodological tools. The losses associated with this group have a lot of impact on their daily lives and often are the source of functional limitations. By offering loss counseling and multi-method grief counseling, volunteers and employees are offered tools to make loss more negotiable. In this article different examples will be discussed and the new loss model of Stroebe and Schut will be explained. What will be clarified is the importance of the implementation of loss counseling, for the well-being and the integration process of clients as well as achieving organizational goals.Verlies van (thuis en haard. Het belang van verliesbegeleiding als onderdeel van de maatschappelijke begeleiding binnen het VluchtelingenWerk, regio UtrechtIn dit artikel wordt gepleit voor het implementeren van verliesbegeleiding als onderdeel van de maatschappelijke begeleiding, er is sprake van integratief eclectisch werken. De maatschappelijke begeleiding van het VluchtelingenWerk heeft als taak de cliënt zo goed mogelijk te begeleiden bij persoonlijke problemen die de inburgering kunnen belemmeren. Aangezien de doelgroep van het VluchtelingenWerk bestaat uit mensen die ontzettend veel verliezen hebben geleden dient hier aandacht voor te zijn. Helaas is in de huidige

  4. Restauration fonctionnelle du rachis : effet du niveau initial de douleur sur les performances des sujets lombalgiques chroniques

    Science.gov (United States)

    Caby, Isabelle; Olivier, N; Mendelek, F; Kheir, R Bou; Vanvelcenaher, J; Pelayo, P

    2014-01-01

    HISTORIQUE : La lombalgie chronique est une douleur lombaire persistante d’origine multifactorielle. Le niveau de douleur initial reste faiblement utilisé pour analyser et comparer les réponses des patients lombalgiques au programme de reconditionnement. OBJECTIFS : Apprécier et évaluer les réponses des sujets lombalgiques chroniques très douloureux à une prise en charge dynamique et intensive. MÉTHODOLOGIE : 144 sujets atteints de lombalgie chronique ont été inclus dans un programme de restauration fonctionnelle du rachis de 5 semaines. Les sujets ont été classés en deux groupes de niveau de douleur: un groupe atteint de douleur sévère (n = 28) et un groupe atteint de douleur légère à modérée (n = 106). L’ensemble des sujets ont bénéficié d’une prise en charge identique comprenant principalement de la kinésithérapie, de l’ergothérapie, du reconditionnement musculaire et cardio-vasculaire ainsi qu’un suivi psychologique. Les paramètres physiques (flexibilité, force musculaire) et psychologiques (qualité de vie) ont été mesurés avant (T0) et après le programme (T5sem). RÉSULTATS : L’ensemble des performances physiques et fonctionnelles des sujets très douloureux sont moins bonnes et le retentissement de la lombalgie sur la qualité de vie, pour ces mêmes sujets, est majoré à T0. Toutes les différences significatives constatées à T0 entre les deux groupes s’effacent à T5sem. CONCLUSIONS : Les sujets lombalgiques chroniques très douloureux répondent favorablement au programme dynamique et intensif. L’intensité douloureuse de la lombalgie n’aurait pas d’effet sur les réponses au programme. La restauration fonctionnelle du rachis apporterait aux sujets la possibilité de mieux gérer leur douleur quel que soit son niveau. PMID:25299476

  5. Effecten van wintergewassen op verliezen en benutting van stikstof bij de teelt van snijmaos; verslag van onderzoek op ROC Aver-Heino tussen voorjaar 1991 en najaar 1994

    NARCIS (Netherlands)

    Dijk, van W.; Schröder, J.J.; Holte, ten L.; Groot, de W.J.M.

    1995-01-01

    Tussen 1988 en 1994 is onderzoek verricht naar de effecten van wintergewassen (winterrogge en onderzaai van gras) op de verliezen en benutting van stikstof bij continuteelt van snijmaos op zandgrond. Gemiddeld over de gehele onderzoeksperiode nam zowel rogge als gras 30-40 kg/ha op in de

  6. Vocabulaire progressif du français avec 250 exercices : niveau débutant : corrigés

    CERN Document Server

    Miquel, Claire

    2002-01-01

    Pour travailler en autonomie, un complément indispensable au Vocabulaire progressif du français niveau débutant : les corrigés de toutes les activités.Les corrigés sont organisés sur le modèle du livre par chapitres thématiques correspondant à divers domaines de la réalité quotidienne et contemporaine. Le lexique est présenté de façon thématique. Chaque chapitre est constitué de plusieurs séquences assurant un enrichissement progressif. Ce manuel aborde un vocabulaire vivant qui correspond à la réalité des français d'aujourd'hui. Il constitue une véritable initiation aux codes culturels.

  7. Van monetaire naar fysieke groei - het transformatiemodel - Achtergronddocument bij de Nationale Milieuverkenning 3

    NARCIS (Netherlands)

    Wieringa K; Nieuwenhuijzen JEC van den; MTV

    1994-01-01

    Voor de Nationale Milieuverkenningen is een transformatiemodel ontwikkeld, waarmee fysieke scenario's voor de Nederlandse economie kunnen worden afgeleid. Het model is specifiek aangepast voor de Nationale Milieuverkenning 3. Het beschrijft de toekomstige ontwikkeling van de nationale

  8. ‘Do justice, Justice’ : Over rechterlijke rechtsvorming in het Europees consumentencontractenrecht

    NARCIS (Netherlands)

    Mak, C.

    2015-01-01

    Recente rechtspraak in het Europese consumentencontractenrecht laat zien dat rechtsvindingstechnieken op dit terrein van grote invloed zijn op de manier waarop het recht zich ontwikkelt. In deze bijdrage staat de ontwikkeling van adequate remedies in hypotheekuitwinningsprocedures centraal. Hoe

  9. De auteursrechtelijke aansprakelijkheid van intermediairs, het kabelpiratenarrest revisited in de tijd van Internet

    NARCIS (Netherlands)

    Dommering, E.J.; Verkade, D.W.F.; Visser, D.J.G.

    1998-01-01

    Het kabelpiratenarrest vestigde de auteursrechtelijke aansprakelijkheid van de kabelexploitant voor het verspreiden van gestolen films die clandestien na de uitzendingen van de reguliere omroepen werden uitgezonden met gebruikmaking van de centrale antenne-inrichting van KTA. Zouden wij de

  10. Het Voorstel voor een Verordening over een Gemeenschappelijk Europees Kooprecht, zo gek nog niet?

    NARCIS (Netherlands)

    Cauffman, C.

    2012-01-01

    Voortbouwend op het DCFR en de Feasibility study uitgevoerd door de door haar aangestelde Expertencommissie publiceerde de Commissie in oktober 2011 een Verordeningsvoorstel betreffende een Gemeenschappelijk Europees Kooprecht (GEKR). Het voorstel betreft de invoering van een zogenaamd optioneel

  11. Geen debat zonder publiek : het internationale debat over synthetische biologie ontleed

    NARCIS (Netherlands)

    Stemerding, D.; Est, van Q.C.

    2013-01-01

    Dit rapport brengt het internationaal opgekomen debat in kaart over synthetische biologie in vier verschillende landen: de Verenigde Staten, Nederland, het Verenigd Koninkrijk en Duitsland. De beschrijving richt zich op vier onderscheiden discoursen in maatschappelijke debatten over nieuwe

  12. Bladeren door het Amerikaanse landschap. Een index van boeken en beelden

    NARCIS (Netherlands)

    Jong, de E.; Schreiber, H.; Sijmons, D.F.; Hoogewoning, A.

    2009-01-01

    Van de highrise in de steden tot de zuidelijke woestijnen, van urban sprawl tot de onbetreden canyons: het Amerikaanse landschap is eindeloos in zijn verschijningsvormen. Op initiatief van het Fonds BKVB trok een gezelschap van landschapsarchitecten, architecten, stedenbouwkundigen, beeldend

  13. Veiligheidsrapport voor de PIV-goot in het Laboratorium voor Vloeistofmechanica

    NARCIS (Netherlands)

    Hofland, B.

    2002-01-01

    Bevat een veiligheidsvoorschrift voor de PIV (particle-image velocimetry) goot. Het rapport is vooral gericht op het gebruik van de krachtige Nd: YAG laser (veiligheidsklasse 4) die gebruikt wordt voor de PIV techniek.

  14. Compost duurzaam ingezet. De Compost Scorekaarten: een instrument voor het afwegen van de waarde van compost

    OpenAIRE

    Schrik, Yannick; Koopmans, Chris

    2015-01-01

    Het duurzame gebruik van een reststof zoals compost hangt sterk samen met de waarde die de compost heeft bij toepassing. Deze publicatie geeft via heldere Compost Score Kaarten inzicht in het vinden van de juiste compostsoort voor het gewenste doel. Of het nu gaat om organischestofvoorziening, verbetering van de bodemstructuur of de nutriëntenvoorziening van gewassen: een bewuste keuze voor de compostsoort en –kwaliteit draagt bij aan een duurzame inzet en duurzaam hergebruik van reststoffen.

  15. The energy consumption of control systems; Het energiegebruik van regelinstallaties

    Energy Technology Data Exchange (ETDEWEB)

    Van Gulik, A.R.; De Wildt, M.G. [Grontmij Nederland, Amersfoort (Netherlands)

    2013-07-15

    Control systems for e.g. indoor climate and illumination are essential in modern building services, and useful for comfort or energy conservation. Energy conservation is of course an important aim, but what is the energy consumption of the control systems? Is the consumption higher than the savings? This question was subject of a comprehensive study, with measurements and simulation calculations. It can be concluded that the energy consumption of control installation for spaces is substantial [Dutch] Regelinstallaties voor bijvoorbeeld klimaatregeling, verlichtingsregeling en domotica zijn niet meer weg te denken uit de moderne installatietechniek, of ze nu dienen voor comfort, gemak of energiebesparing. Maar hoeveel energie gebruiken deze installaties eigenlijk? Voor ontwerpers blijkt dit helemaal geen issue te zijn terwijl adviseurs, installateurs en zelfs fabrikanten zeggen hiervan geen idee te hebben. Door metingen en het gebruik van berekeningsmodellen is vastgesteld wat het energiegebruik van regelinstallaties op jaarbasis is. Dit blijkt substantieel te zijn, maar er zijn mogelijkheden om het gebruik te reduceren.

  16. De kristallisatie-methode bij het onderzoek van de liquor cerebro-spinalis

    NARCIS (Netherlands)

    Wittermans, Aafko Willinge

    1941-01-01

    Ongeveer twaalfhonderd liquores zijn volgens een in de kliniek nog weinig bekende zeer eenvoudige methode van onderzoek van den Roemeenschen Hoogleraar TOMESCO onderzocht. Deze methode berust op het beoordeelen van het kristalbeeld dat ontstaat bij het indampen van druppels sterk verdunde liquor

  17. Funktioneel programmeren als basis voor het programmeeronderwijs [Functional Programming as Base for Computer Programming Courses

    NARCIS (Netherlands)

    Joosten, S.M.M.; van den Berg, Klaas; Mulder, F.

    1990-01-01

    Aan de Universiteit Twente is de afgelopen vier jaar geëxperimenteerd met een inleidende kursus in het programmeren, op basis van funktioneel programmeren. Dit artikel gaat in op het waarom van deze aanpak, de doelstelling van het programmeeronderwijs, de opzet en inhoud van de kursusonderdelen en

  18. Voortgangsrapportage van het WOT programma 406: Wettelijke Onderzoek Taken Visserijonderzoek voor LNV in 2004

    NARCIS (Netherlands)

    Beek, van F.A.

    2005-01-01

    Voortgangsrapportage van het WOT programma 406, Wettelijke Onderzoek Taken Visserijonderzoek van LNV in 2004. In het WOT-programma 406 worden Wettelijke Onderzoeks Taken uitgevoerd die betrekking hebben op het visserijonderzoek. Dit rapport bevat de rapportage en verantwoording van de activiteiten

  19. Voortgangsrapportage van het WOT programma 406: Wettelijke Onderzoek Taken Visserijonderzoek voor LNV in 2003

    NARCIS (Netherlands)

    Beek, van F.A.

    2004-01-01

    Het WOT-programma 406 heeft betrekking op Wettelijke Onderzoeks Taken die betrekking hebben op het visserijonderzoek. Het onderzoeksprogramma WOT 406 loopt gedurende de periode 2002-2005 en is een voortzetting van WDT programma’s 212 en 339. Dit rapport bevat de rapportage en verantwoording van de

  20. Debatteren in het Engels. Leerzame ingrediënten in de ogen van leerlingen

    NARCIS (Netherlands)

    el Majidi, Abid; de Graaff, Rick; Janssen, Daniel

    2015-01-01

    De afgelopen decennia heeft het debat zichtbaar zijn weg gevonden naar de lessen in het voortgezet onderwijs, waarbij debatteren ook wordt gezien als een effectief didactisch middel voor vreemdetaalverwerving. Deze effectiviteit wordt voornamelijk toegeschreven aan het feit dat debat in een

  1. Lasius niger houdt rechts, vooral als het druk wordt op zijn verticale straten op bomen

    NARCIS (Netherlands)

    Heuts, B.

    2009-01-01

    Houden mieren rechts als ze foerageren op hun straten zoals de meeste mensen doen? Rechts houden, en ook links houden, zijn gedragsstrategieën die het verkeer sneller doen verlopen. Het lijkt waarschijnlijk dat sneller verkeer bij mieren een reproductief voordeel oplevert omdat het voedsel dat

  2. Landbouwontwikkelingsgebied De Ass, gemeente Cuijk. Toetsingsadvies over het milieueffectrapport en de aanvulling daarop.

    NARCIS (Netherlands)

    Bekkers, L.C.J.; Broekmeyer, M.E.A.; Ouwerkerk, H.G.; Spapens-Reijnders, I.; Woerden, van R.A.M.

    2010-01-01

    De gemeente Cuijk stelt een nieuw bestemmingsplan op voor het landbouwontwikkelingsgebied (LOG) De Ass. Het bestemmingsplan wordt opgesteld voor de verplaatsing van twee ondernemers van de directe omgeving van de kern van Haps naar het LOG De Ass, de woningbouw op de te verlaten bedrijfslocaties en

  3. Een toekomst door ambachtelijke sociologie : De KNAW Verkenning Sociologie en het eindrapport Samenleven en samenwerken

    NARCIS (Netherlands)

    Raub, Werner

    2006-01-01

    Deze reactie op de resultaten van de KNAW Verkenning Sociologie begint met enkele opmerkingen over het perspectief op de Nederlandse sociologie, dat uit het eindrapport van de Verkenningscommissie naar voren komt. Vervolgens komt het onderzoeksprogramma van de Verkenningscommissie aan de orde: hoe

  4. Gamma-exposietempometingen rondom het COVRA-terrein te Petten in november 1984

    NARCIS (Netherlands)

    Dongen; R.van

    1985-01-01

    In verband met de ingebruikname door COVRA B.V. van een inrichting, alwaar radioactieve afvalstoffen worden opgeslagen, is door het Laboratorium voor Stralingsonderzoek van het RIVM een onderzoek ingesteld naar de verhoging van het exposietempo aan de terreingrenzen. Op een 20-tal punten aldaar

  5. Computerbeveiliging kijkt naar buiten, maar het gevaar komt van binnen de organisatie!

    NARCIS (Netherlands)

    Luiijf, H.A.M.

    1997-01-01

    Ieder bedrijf wil tegenwoordig op het Internet. De voordelen zijn bekend. Wereldwijde, goedkope en snelle communicatie met tientallen miljoenen computers en toegang tot een overvloed aan gratis beschikbare informatie. De nadelen zijn minder duidelijk. Aansluiting van de computers op het voor het

  6. Het beslissingsproces van de huisarts bij de keuze van een geneesmiddel

    NARCIS (Netherlands)

    B. Wierenga (Berend); S.J.T. Jong; A. Mantel

    1989-01-01

    textabstractHet beslissingsproces van de huisarts bij de keuze van een geneesmiddel, zoals het uit dit empirisch onderzoek naar voren kwam, kan als volgt worden getypeerd. In het merendeel van de gevallen (ca. 90%) beperkt de arts zich tot de informatie die hij al in zijn geheugen heeft. Vaak wordt

  7. Kwik en chroom in het milieu. Verschijningsvormen, gedrag en toxiciteit Literatuurstudie

    NARCIS (Netherlands)

    Kotterman, M.J.J.; Heuvel, van den M.J.

    2010-01-01

    Kwik is een metaal dat door zijn toxische eigenschappen al jaren in de aandacht staat van milieumonitoring. Het metaal werd en wordt gebruikt voor vele toepassingen, en door zowel de natuurlijke als menselijke emissie komt het overal in het milieu voor. De voornaamste bronnen van kwikverontreiniging

  8. Robots in het magazijn: prestatiesvan robotsystemen modelleren met wacht-rij netwerken

    NARCIS (Netherlands)

    Lamballais Tessensohnt, T.

    2017-01-01

    Het verwerken van e-commerce bestellingen stelt magazijnen voor grote uitdagingen. Het assortiment aan producten is vaak groot, waarmee de afstanden in het magazijn ook groot worden. Daarnaast bestaan de bestellingen meestal uit één eenheid, in plaats van complete dozen of pallets die

  9. Infrastructuurontwikkeling voor zorgapplicaties : Lessons learned bij het project De Vitale Link

    NARCIS (Netherlands)

    Y. Schikhof; P. van der Wekken; W. Nattekaas; Dr. A.L. Cordia

    2012-01-01

    Hoe kan de verbinding van mensen met hulp van communicatietechnologie tot betere zorg en meer participatie leiden? Vanuit vier praktijksituaties zal kennis gegenereerd worden op het gebied van co-creatie met professionals en ouderen, de inzet van ict-toepassingen in de zorg en het effect op het

  10. Influenza uitbraken in verpleeghuizen 2004-2005: wat zijn de consequenties voor het komende griepseizoen?

    NARCIS (Netherlands)

    Sande, M. van der; Ruijs, H.; Cools, H.; Meijer, A.; Plas, S. van der; Morroy, G.

    2005-01-01

    Voorafgaand aan het influenzaseizoen 2004/2005 verschenen het LCI draaiboek Explosies van luchtweginfecties in instellingen en de NVVA-richtlijn Influenzapreventie in verpleeghuizen en verzorgingshuizen. Beide werden van theoretische commentaren voorzien in onder andere TvT en het Nederlands

  11. Het optreden van spruitvorming en kale uien tijdens de bewaring : literatuurstudie

    NARCIS (Netherlands)

    Brink, van den L.; Broek, van den R.C.F.M.

    2006-01-01

    In de praktijk valt de bewaring van uien regelmatig tegen. Een belangrijk probleem is dat de spruitrust onvoldoende blijkt te zijn. Dit ondanks het feit dat de uien behandeld zijn met een spruitremmer. Een ander probleem is het optreden van kale uien op het moment dat de uien uit de bewaring gehaald

  12. Ervaringen van patiënten met het Achmea Medisch Callcenter tijdens weekenden.

    NARCIS (Netherlands)

    Mistiaen, P.; Delnoij, D.; Gubbels, J.

    2003-01-01

    Patiënten die op zaterdag naar de centrale huisartsenpost belden en doorgeschakeld werden naar het Achmea Medisch Call Center, zijn even tevreden als patiënten die niet werden doorgeschakeld. Het callcenter handelt de telefoontjes af die de centrale huisartsenpost niet aankan en doet zo in het

  13. Johan de Boose, Het geluk van Rusland. Reis naar het eenzaamste volk op aarde

    Directory of Open Access Journals (Sweden)

    Eric Metz

    2008-10-01

    Full Text Available Ces dernières années Johan de Boose, slaviste, poète et romancier, a publié plusieurs livres retraçant ses expéditions en Europe centrale et orientale. Son dernier ouvrage, consacré à la Russie, peut être perçu comme l’apogée de ses récits de voyage. Il y dresse un bilan à la fois élaboré et très personnel de ses rencontres avec la Russie et ses habitants au cours des trois dernières décennies.Het geluk van Rusland (Le bonheur de la Russie appartient au genre du « voyage sentimental » : à l’...

  14. Maatschappelijk belang van fietspad 10; fietverbinding door een Habitatrichtlijngebied, tussen de Haagse agglomeratie en de Vallei Meijendel via de Waasdorpervlakte

    NARCIS (Netherlands)

    Goossen, C.M.; Regt, de W.J.; Langers, F.

    2004-01-01

    Provincie Zuid-Holland wil fietspad 10 aanleggen van de rand van de Haagse agglomeratie door de vlakte van Waalsdorp (een Habitatrichtlijngebied) naar de vallei Meijendel. Het maatschappelijk belang van dit fietspad moet worden aangetoond. De Haagse regio heeft een fors fietstekort. De kwaliteit van

  15. Visies op ECT: een vergelijking tussen oordelen van patiënten, familieleden en behandelaren over elektroconvulsie-therapie

    NARCIS (Netherlands)

    A.M. Koster (Annemiek)

    1992-01-01

    textabstractIn het voorjaar van 1986 is de Geneeskundige Inspectie voor de Geestelijke Volksgezondheid (GIGV) een onderzoek gestart naar ervaringen van patienten met elektroconvulsie-therapie (ECT). Dit onderzoek werd in 1991 afgesloten met een rapport (GIGV, 1991). De aanleiding tot dat onderzoek

  16. Uit de bodem- en natuurprogramma's : Effecten van zware metalen op de Das. Interactie tussen versnippering en vergiftiging

    NARCIS (Netherlands)

    Klok, T.C.

    2004-01-01

    In dit infoblad wordt de invloed van bodemvervuiling door cadmium en koper op de Das besproken. Deze effecten worden gerelateerd aan de effecten van versnippering. Uit deze studie komt naar voren dat in leefgebieden met een lage kwaliteit als gevolg van vervuiling het aannemelijk is dat dassen

  17. Landelijk Meetnet Grondwaterkwaliteit ; Vergelijking "in situ"-pH-meting met pH-meting in het laboratorium

    NARCIS (Netherlands)

    Reijnders HFR; Boumans LJM; Gast LFL; LBG

    1995-01-01

    In het Landelijk Meetnet Grondwaterkwaliteit is tot 1989 de pH in het laboratorium gemeten. Vanaf 1989 werd de pH "in situ" en in het laboratorium gemeten. Onderzocht is in welke mate resultaten van pH-metingen "in situ" en pH-metingen in het laboratorium van elkaar

  18. Een nieuwe toetsdiepte voor nitraat in grondwater? Eindrapport van het onderzoek naar de mogelijkheden voor een toetsdieptemeetnet

    NARCIS (Netherlands)

    Fraters, B.; Boumans, L.J.M.; Elzakker, van B.G.; Gast, F.L.F.; Griffioen, J.; Klaver, G.T.; Nelemans, J.A.; Velthof, G.L.; Veld, H.

    2006-01-01

    Het verlagen van de toetsdiepte voor nitraat in het grondwater in zandgebieden van de bovenste meter van het grondwater naar de bovenste vijf meter, blijkt niet opportuun. Het verlagen van de toetsdiepte wordt gezien als mogelijkheid om aan de doelstellingen van de Nitraatrichtlijn en de

  19. Een zoektocht naar de identiteit van het sociaalwerkonderzoek: een reflectie over de kenmerken van een academische discipline

    Directory of Open Access Journals (Sweden)

    Peter Raeymaeckers

    2016-06-01

    Full Text Available SAMENVATTINGEen zoektocht naar de identiteit van het sociaalwerkonderzoek: een reflectie over de kenmerken van een academische discipline Wat is sociaalwerkonderzoek? Verschillende auteurs stellen vast dat het sociaalwerkonderzoek zich niet makkelijk laat definiëren. Sommigen drukken de eigenheid van sociaalwerkonderzoek graag uit in termen van eclecticisme, holisme en diversiteit. Dit is niet zonder gevaar. De specifieke eigenheid van het sociaalwerkonderzoek dreigt hierdoor immers verloren te gaan. Deze bezorgdheid vormt de aanzet voor dit artikel. We schetsen de contouren van een academische discipline die door de recente internationale definitie van het sociaal werk op de voorgrond is komen te staan. Hoe gaan we te werk? We stellen vast dat we de grenzen van het sociaalwerkonderzoek niet stevig kunnen vastzetten. Het is wel mogelijk om enkele kenmerken te formuleren. Een eerste kenmerk gaat over de inhoud en betreft het terrein waarop de sociaalwerkonderzoeker zich begeeft. Een tweede behandelt de wetenschappelijke methode en een derde bekijkt de verhouding tussen theorie en praktijk. Een vierde kenmerk gaat over de gemeenschappelijke maatschappelijke bezorgdheid die eigen is aan elke sociaalwerkonderzoeker. Meer specifiek benadrukken we het belang van de bezorgdheid over sociale uitsluiting en sociale rechtvaardigheid op verschillende terreinen van het maatschappelijke leven.  ABSTRACTThe identity of social work research: reflections on an academic discipline What is social work research? Scholars agree that the search for the identity of social work research is a challenging task. Some authors express this identity in terms of holism, eclecticism or diversity. We, however, argue that when scholars embrace the diversity of social work research, social work research loses its specific identity. We therefore believe that it is crucial that social workers as well as social work academics reflect on the identity of social work research. We

  20. Radium in baggerspecie afkomstig uit het Rijnmondgebied. Resultaten over 2001

    NARCIS (Netherlands)

    Lembrechts J; Glastra P; Nissan LA; Overwater RMW; LSO

    2002-01-01

    Van 25 havenspeciemonsters is het Ra-226-gehalte bepaald. De monsters zijn in 2001 verzameld in de Rotterdamse havens en in de Nieuwe Waterweg. Zoals ook in eerdere meetcampagnes is vastgesteld, worden hoge radiumgehaltes gevonden in de omgeving van de voormalige lozingspunten van de

  1. Plantenkaartjes uitgegeven door het I.V.O.N

    NARCIS (Netherlands)

    NN,

    1959-01-01

    De serie door het I.V.O.N. gepubliceerde verspreidingskaartjes van Nederlandse plantensoorten is wederom verkrijgbaar. De prijzen zijn als volgt: afl. 1, 1935, 21 kaartjes van diverse soorten f. 1.35 afl. 2, 1936, 32 kaartjes van diverse soorten „ 2.00 afl. 3, 1936, 18 kaartjes van Potamogeton „

  2. Welzijnsrichtlijn vleeskuikens : 20 lux bij vleeskuikens : het kan

    NARCIS (Netherlands)

    Harn, van J.

    2009-01-01

    De lichtsterkte op ooghoogte van de kuikens moet op 80 procent van het vloeroppervlak minimaal 20 lux bedragen, volgens de EU-welzijnsrichtlijn voor vleeskuikens. Momenteel worden vleeskuikens gehouden bij lichtsterktes die lager zijn vanwege de vrees voor stress en onrust bij de kuikens. Uit

  3. Casus: behandeling in het buitenland. If you pay peanuts...

    NARCIS (Netherlands)

    van der Weijden, F.

    2015-01-01

    Tandartsen in Ierland hebben vorig jaar de noodklok geluid, omdat een groeiend aantal patiënten verminkt terugkomt van tandartsbehandelingen in het buitenland. Een onderwerp waar tandartsen in Nederland ook tegenaan lopen, maar waar weinig over wordt geschreven. In dit artikel een casus uit mijn

  4. Dendrobates ventrimaculatus: voortplanting in het water van een bladoksel.

    NARCIS (Netherlands)

    Poelman, E.H.

    2007-01-01

    Vanaf het Guyanaschild tot de oostkant van de Andes van Colombia tot zuidelijk in Peru komt Dendrobates ventrimaculatus of een sterk daaraan verwante soort voor. De kikkertjes zijn gebonden aan planten die kleine poeltjes in hun bladoksels hebben. Zowel de eieren als de kikkervissen worden in deze

  5. Verkennend Onderzoek Microplastic in het beheersgebied van Waterschap Rivierenland

    NARCIS (Netherlands)

    Besseling, E.; Foekema, E.M.; Koelmans, A.A.

    2014-01-01

    Waterschap Rivierenland (WSRL) heeft samen met Wageningen UR een verkennend onderzoek gedaan naar de aanwezigheid van microplastics in haar wateren. Er was interesse in de volgende drie vragen: 1. Waar zit het microplastic? (in bagger en/of oppervlaktewater, in landelijk of stedelijk gebied?) In

  6. Vitamine K voor zuigelingen: overzicht van het huidige beleid

    OpenAIRE

    Cornelissen, E.A.M.; Hirasing, R.A.; Jonge, G.A. de

    1994-01-01

    Orale toediening van vitamine K aan borstgevoede zuigelingen tot 12 weken, ter preventie van bloedingen, blijkt een eenvoudige en effectieve maatregel te zijn. Een onbekend percentage zuigelingen met borstvoeding krijgt echter nog geen goede vitamine-K-profylaxe. In dit artikel wordt het huidige beleid geschetst.

  7. Expertiseontwikkeling in het project ‘Begeleiding Startende Leraren’

    NARCIS (Netherlands)

    Swennen, J.M.H.; Dengerink, J.

    2015-01-01

    Het onderzoek gaat over de expertiseontwikkeling binnen een projectgroep die van 2014 t/m 2016 leiding geeft aan een omvangrijk regionaal project ‘Begeleiding Startende Leraren’. De projectgroep bestaat uit acht leden afkomstig uit vier lerarenopleidingen en vier samenwerkingsverbanden van scholen

  8. Het potentieel van de volgende grote mediasport: eSport

    NARCIS (Netherlands)

    Rene Foolen; Pieter Marechal

    2016-01-01

    Is eSport een echte sport of niet? Hoe je het fenomeen ook wil categoriseren, eSport is de nieuwste ster in de sportmediawereld. Voorlopig lijkt er nog lang geen einde te komen aan haar steile groeicurve. De vraag is volgens ons dan ook niet of eSport een plaats opeist bij de grote mediasporten,

  9. Het effect van hamsterbeheer op de overwintering bij hamsters

    NARCIS (Netherlands)

    Beek, van der M.; Ligtenberg, H.; Haye, la M.J.J.

    2006-01-01

    De afgelopen decennia is het aantal hamsters (Cricetus cricetus) in Nederland sterk afgenomen. Door onderzoek te verrichten naar de levenscyclus en naar de effecten van agrarisch beheer is getracht de afname te verklaren en oplossingen aan te dragen. In voorjaar 2006 is een verkennend onderzoek

  10. Drogen van mest onder het rooster geeft hoge kosten

    NARCIS (Netherlands)

    Ellen, H.H.; Haar, van der J.W.

    1999-01-01

    Voor de vleeskuikenouderdieren is in de Uitvoeringsregeling ammoniak en veehouderij (Uav) een systeem opgenomen waarbij de mest onder het rooster wordt belucht. De gebruikte lucht moet daarbij aan bepaalde eisen voldoen. Dit heeft onder andere gevolgen voor de energiekosten. In dit artikel wordt

  11. 'Dat kan beter, ja...' : Webcare en het voorkomen van reputatieschade

    NARCIS (Netherlands)

    Renée van Os; Daphne Hachmang

    2018-01-01

    Klanten uiten op social media steeds vaker hun ongenoegen over de diensten of producten die bedrijven aanbieden. Het effect op de reputatie van uw organisatie kan desastreus zijn, zeker wanneer u niet, of op de verkeerde manier, reageert. Tegelijkertijd kan één positieve recensie van een klant op

  12. Het praktisch gebruik van virtuele omgevingen voor ergonomische studies

    NARCIS (Netherlands)

    Werkhoven, P.J.; Punte, P.A.J.

    1998-01-01

    De term Virtual Reality is misleidend. Met name het woord Reality suggereert dat men door high-tech 3D visualisatietechnieken computer gegenereerde omgevingen als realistisch kan ervaren. Niets is minder waar. Allereerst kon de synthetische wereld alleen gezien en soms gehoord worden, maar wordt

  13. Ontwikkelingen in het EU-recht: Uber een vervoersaanbieder

    NARCIS (Netherlands)

    de Vries-Stotijn, Anne

    2018-01-01

    In twee recente zaken voor het Hof van Justitie concludeert A-G Szpunar dat taxi-applicatie Uber kwalificeert als aanbieder van vervoersdiensten. (Asociación Profesional Elite Taxi Zaak C-434/15, conclusie 11 mei 2017 ECLI:EU:C:2017:364 en Uber/France SAS Zaak C-320/16, conclusie 4 juli 2017

  14. De toekomst van het oorlogserfoed. Herdenken in 2020

    NARCIS (Netherlands)

    van der Laarse, R.

    2011-01-01

    Het gaat om een verzoek van en advies aan: Staatssecretaris van Volksgezondheid, Welzijn en Sport, mevr. Drs. M.L.L.E. Veldhuijzen van Zanten-Hyllner, kenmerk brief DMO/OHW-U-3086756, Directoraat Generaal Langdurige Zorg, Directie Maatschappelijke Ondersteuning, Afdeling OHW II (contactpersoon dhr.

  15. Caissons voor het dichten van dijken in Zeeland 1953

    NARCIS (Netherlands)

    Verhagen, H.J.

    1953-01-01

    Foto's van caissons voor het dichten van dijken in Zeeland in 1953. Geleverd werden 493 caissons en 203 manchetten door een combinatie van: • N.V. Amsterdamsche Ballast maatschappij, Amsterdam • Christiani en Nielsen N.V., ’s Gravenhage • N.V. van Hattum en Blankevoort, Beverwijk • Hollandsche Beton

  16. Bitcoin: Informational Money en het Einde van Gewoon Geld

    NARCIS (Netherlands)

    Bergstra, J.A.

    2014-01-01

    Deze paper bevat een verkorte beschrijving van de Nakamoto architectuur voor informational money, een positionering van Bitcoin, een "money-like informational commodity", als een verschijningsvorm van iGoud, en een bespiegeling over de vraag hoe hoe informational money het einde van Gewoon Geld in

  17. De optimale datum voor het afsluiten van een lening

    NARCIS (Netherlands)

    van Ommeren, Bernard; Allers, Maarten; Vellekoop, Michel

    Wie een lening moet afsluiten kan dat direct doen, of afwachten in de hoop dat de rente zal dalen vóór het moment dat de lening echt nodig is. Maar als de rente niet daalt maar stijgt, wordt de lening duurder. Dus wat is wijsheid?

  18. Ervaringen van straatagenten met het Criminaliteits Anticipatie Systeem

    NARCIS (Netherlands)

    Anthonie Drenth; Ronald van Steden

    2017-01-01

    Predictive policing mag een veelbelovende ontwikkeling lijken, het is nog te vroeg om te spreken van een effectief middel. De wetenschap uit zich nogal eens kritisch over de effectiviteit en negatieve neveneffecten. Ook agenten die als eindgebruiker van CAS zijn geobserveerd en geïnterviewd in

  19. Afspraken voor het uitwisselen en hergebruik van onderwijsmateriaal

    NARCIS (Netherlands)

    Manderveld, Jocelyn

    2005-01-01

    Manderveld, J. (2004) Afspraken voor het uitwisselen en hergebruik van onderwijsmateriaal. In: Gorissen, P., Manderveld, J., Benneker, F. & Cordewener, B. Leertechnologie in de Lage Landen (pp. 17-19). Utrecht, Stichting Surf. Ook beschikbaar in dspace: http://hdl.handle.net/1820/270

  20. Het laatste avondmaal: Ronald Dworkin (1931-2013)

    NARCIS (Netherlands)

    Maris, C.

    2013-01-01

    Op 14 februari 2013 overleed Ronald Dworkin, de invloedrijkste rechtsfilosoof van de afgelopen decennia. Cees Maris schrijft in deze bijdrage over de opvattingen van Dworkin, het Juiste Antwoord, morele waarheid, zijn publicaties en deelname aan publieke discussies, maar ook over de kritiek die

  1. Enkele gedachten over de arbeidsovereenkomst in het concern

    NARCIS (Netherlands)

    Beltzer, R.M.

    2015-01-01

    De werknemer in het concern heeft veelal niet alleen te maken met degene met wie hij de arbeidsovereenkomst ondertekende, maar ziet zich tevens geconfronteerd met allerhande ‘derden’ die direct of indirect hun invloed uitoefenen op de arbeidsovereenkomst. Denk aan de situatie dat de werkgever niet

  2. CDM Werkvormen : Creatieve werkvormen voor het Collaborative Decision Making proces

    NARCIS (Netherlands)

    Bemmel, I.E. van; Eikelboom, A.R.; Thönissen, F.H.

    2012-01-01

    Eén van de grootste uitdagingen bij complexe vraagstukken is het creëren van unity of effort bij de verschillende partijen die aan complexe samenwerkingsverbanden deelnemen. Maar, hoe gaan alle neuzen dezelfde kant op staan? Hoe geven de partijen handen en voeten aan doelstellingen? En hoe gaan zij

  3. Kustversterking Voorne: advies voor richtlijnen voor het milieueffectrapport

    NARCIS (Netherlands)

    Evers, F.W.R.; Gun, van der J.H.J.; Hoekstra, P.; Maas, F.M.; Slim, P.A.; Beerlage, B.F.M.

    2006-01-01

    De kust van Voorne is aangemerkt als een zwakke schakel in de Hollandse Kust. Uit berekeningen blijkt dat de veiligheid tegen overstromingen onvoldoende is. Het waterschap Hollandse Delta – als beheerder van de waterkering – stelt een verbeteringsplan op voor de kust van Voorne. Voor dit

  4. Hoe veilig zijn transacties via het World Wide Web?

    NARCIS (Netherlands)

    Luiijf, H.A.M.

    1997-01-01

    Recent is in de pers breed uitgemeten dat hackers enkele 'home pages' van vooraanstaande Amerikaanse overheidsinstellingen wijzigden. In september moest de CIA eraan geloven en in december werden bezoekers van de 'site' van de Amerikaanse luchtmacht op porno getracteerd. Is dit het topje van de

  5. Onzekerheid in praktijk: Utrechtse vraagstukken op het gebied van onderzoeksonderwijs

    NARCIS (Netherlands)

    Pim van Heijst; Stijn Bollinger; Behzad Assadolahi

    2014-01-01

    Praktijkgericht onderzoek heeft zijn vaste plaats verworven in het curriculum van de Utrechtse SJD opleiding. Aan de hand van een aantal kwaliteitsnormen voor praktijkgerichte onderzoeksonderwijs maken we in dit artikel inzichtelijk hoe dit in de praktijk uitpakt en welke nieuwe vraagstukken dit

  6. Het belang van groot dood beukenhout voor paddestoelen

    NARCIS (Netherlands)

    Veerkamp, M.T.

    2003-01-01

    Derde artikel in een serie van drie over de rol van dood beukenhout voor de biodiversiteit. In Nederlandse beukenbossen op zowel zand- als kleigrond is onderzoek gedaan naar de paddestoelenflora op dode beukenstammen. Belangrijke factoren voor de soortensamenstelling blijken het verteringsstadium en

  7. Fungal prion HET-s as a model for structural complexity and self-propagation in prions.

    Science.gov (United States)

    Wan, William; Stubbs, Gerald

    2014-04-08

    The highly ordered and reproducible structure of the fungal prion HET-s makes it an excellent model system for studying the inherent properties of prions, self-propagating infectious proteins that have been implicated in a number of fatal diseases. In particular, the HET-s prion-forming domain readily folds into a relatively complex two-rung β-solenoid amyloid. The faithful self-propagation of this fold involves a diverse array of inter- and intramolecular structural features. These features include a long flexible loop connecting the two rungs, buried polar residues, salt bridges, and asparagine ladders. We have used site-directed mutagenesis and X-ray fiber diffraction to probe the relative importance of these features for the formation of β-solenoid structure, as well as the cumulative effects of multiple mutations. Using fibrillization kinetics and chemical stability assays, we have determined the biophysical effects of our mutations on the assembly and stability of the prion-forming domain. We have found that a diversity of structural features provides a level of redundancy that allows robust folding and stability even in the face of significant sequence alterations and suboptimal environmental conditions. Our findings provide fundamental insights into the structural interactions necessary for self-propagation. Propagation of prion structure seems to require an obligatory level of complexity that may not be reproducible in short peptide models.

  8. Signs: een wetenschappelijk tijdschrift in transatlantisch perspectief

    Directory of Open Access Journals (Sweden)

    Ieme van der Poel

    1997-06-01

    Full Text Available Het Amerikaanse feministische tijdschrift Signs is een belangrijke bron voor de receptie van het Franse feminisme in Amerika. Bovendien geeft het een indruk van het verschil tussen de academische, Amerikaanse vrouwenstudies enerzijds, en de literair en politiek getinte Franse vrouwenbeweging anderzijds. Ieme van der Poel analyseert de jaargangen van Signs tussen 1975 en 1981 vanuit deze gezichtspunten.

  9. Grammaire progressive du français corrigés : niveau intermédiaire : avec 680 exercices

    CERN Document Server

    Thiévenaz, Odile

    2013-01-01

    Les corrigés de la 3e édition de la Grammaire progressive du français - niveau intermédiaire Ce qui fait le succès de cette grammaire : Une organisation claire : la leçon de grammaire sur la page de gauche ; les exercices d'entraînement sur la page de droite ; 52 chapitres présentant les points généralement abordés aux niveaux A2 et B1 du Cadre européen commun de référence pour les langues ; Un apprentissage progressif : il suit la progression naturelle des méthodes de français ; Un usage souple : pour la classe ou en auto-apprentissage ; Une préparation adaptée aux certifications : un entraînement efficace pour mieux réussir aux examens ; Une large place faite à l'évaluation : de nombreux exercices de révision et des bilans réguliers. À découvrir dans cette troisième édition tout en couleurs (ISBN 978 209 038 124 5) : Un CD audio avec 14 documents sonores ; 80 nouveaux exercices et activités communicatives ; Des chapitres révisés et des exercices plus variés ; Un test d'�...

  10. Voorstellen voor toekomstig europees landbouwbeleid uit Duitsland en Zwitserland : debat over het GLB na 2014 met nadruk op biodiversiteit en multifunctionele landbou

    NARCIS (Netherlands)

    Schröder, R.R.G.

    2011-01-01

    Het voormalige ministerie van LNV heeft in het voorjaar 2010 twee helpdeskvragen gesteld over het toekomstige Europese landbouwbeleid in de periode 2014 - 2020. Nederland heeft in 2008 het standpunt ingenomen dat het GLB meer gekoppeld dient te worden aan maatschappelijke waarden, zoals natuur en

  11. Resultaten van het RWS-RIKZ JAMP 2005 monitoringsprogramma van bot (Platichthys flesus L.) : Biologische gegevens van bot en milieukritische stoofen in bot

    NARCIS (Netherlands)

    Kotterman, M.J.J.

    2006-01-01

    In opdracht van RWS-RIKZ werden door het RIVO werkzaamheden uitgevoerd in het kader van het Joint Assessment and Monitoring Program van de OSPARCOM. De opdracht hield in het verkrijgen van biologische gegevens van bot. De werkzaamheden bestonden uit het verzamelen van monsters bot waarvan

  12. Ecologische effecten van het bestemmingsplan Birkhoven-Noord : beschrijving van de ecologische gevolgen voor vleermuizen en een toets van deze effecten aan de EU-Habitatrichtlijn en Natuurbeschermingswet

    NARCIS (Netherlands)

    Koolstra, B.J.H.; Verboom, B.; Dirksen, J.

    2001-01-01

    De gemeente Amersfoort heeft het bestemmingsplan Birkhoven-Noord in ontwikkeling. In het ontwerp-bestemmingsplan voor Birkhoven-Noord wordt de visie van de gemeente Amersfoort over de toekomstige inrichting en het toekomstig gebruik van het plangebied beschreven. Het voorkomen van vleermuizen in

  13. OOC in de DSM-Rl. en COO in de OOVo. De uitgelekte DSM-richtlijn en Online Omroepverordening in het kort

    NARCIS (Netherlands)

    Visser, D.J.G.

    2016-01-01

    De uitgelekte DSM-richtlijn en Online Omroepverordening in het kort. DSM verwijst niet naar de voormalige Staatsmijnen, noch naar het chemiebedrijf dat daar voor in de plaats kwam. In het auteursrecht is het voortaan de naam van een nieuw richtlijn-voorstel dat het vervolg vormt van een eerdere

  14. Het bevel 'persoonlijk verschijnen' en de last 'medebrenging' voor het aanhoren van een uitspraak in strafzaken. Naar aanleiding van Mohammed B

    NARCIS (Netherlands)

    van Laanen, F.

    2005-01-01

    Op 21 juli 2005 werd in de media bericht dat de Rechtbank Amsterdam de verdachte Mohammed B. zou dwingen tot het aanhoren van de uitspraak in de strafzaak die tegen hem werd gevoerd, onder meer betreffende de moord op Theo van Gogh. De verdachte was al eerder verplicht om te verschijnen bij het

  15. Study on energy efficient mushroom business in 2010. Highest feasible level of energy conservation and energy efficiency; Onderzoek naar het energiezuinig paddenstoelenbedrijf anno 2010. Hoogst haalbare niveau van energiereductie en energie-efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Suurmeijer, J.M.; Mikkers, E. [Grontmij, Amersfoort (Netherlands); Hilkens, J. [AdVisie, Herkenbosch (Netherlands)

    2010-06-15

    Targets of Dutch mushroom cultivation businesses include an energy efficiency improvement of 2.5% annually, implementation of sustainable energy options, and climate-neutral and economically viable cultivation by new mushroom cultivation businesses that are to be built in 2020. This report describes the measures that could be implemented in support of these targets [Dutch] De doelstellingen voor paddestoelenbedrijven zijn een energie-efficientie verbetering van 2,5% per jaar, implementatie van duurzame energieopties, en klimaatneutrale en economisch rendabele teelt van de in 2020 nieuw te bouwen paddenstoelenbedrijven. In dit rapport staan de maatregelen beschreven die genomen kunnen worden ter ondersteuning van de doelstellingen.

  16. Benzene leaks in sight; Benzeenlekken in het vizier

    Energy Technology Data Exchange (ETDEWEB)

    Okkerse, W.J.; Van Doorn, R.; Bison, H. [DCMR Milieudienst Rijnmond, Rotterdam (Netherlands)

    2013-02-15

    About five years ago, elevated concentrations of benzene were detected at air measuring stations of the DCMR Environmental Protection Agency in the Botlek area, the Netherlands. Extensive research of potential sources in industry followed. A wide range of advanced techniques were deployed. A smart combination of techniques has ultimately resulted in the identification and clean-up of the benzene sources. A bright future is anticipated for these techniques [Dutch] Ongeveer vijf jaar geleden werden rond het Botlekgebied verhoogde benzeenconcentraties geconstateerd op luchtmeetstations van de DCMR Milieudienst Rijnmond. Een uitgebreid onderzoek naar de potentiele bronnen in de industrie was het gevolg. Daarbij is een scala aan geavanceerde technieken ingezet. Toepassing van een slimme combinatie van technieken heeft er uiteindelijk toe geleid dat benzeenbronnen werden opgespoord en gesaneerd. Een grote toekomst wordt voorzien voor deze technieken.

  17. Conception et réalisation de l'unité de décision du système de déclenchement de premier niveau du détecteur LHCb au LHC

    CERN Document Server

    Laubser, Julien

    2007-01-01

    Le detecteur LHCb est l'une des quatre experiences de physique des particules installees sur la nouvelle chaine d'acceleration LHC (Large Hadron Collider) du CERN a Geneve. Afin de reduire la quantite de donnees destinees au stockage pour les analyses hors ligne, un dispositif de selection en ligne des collisions interessantes selon la physique a etudier est mis en place en parallele de la chaine d'acquisition des donnees. Ce dispositif est compose d'un premier niveau(niveau 0) realise par un systeme electronique complexe et d'un second niveau de selection realise par informatique HLT (High Level Trigger). L'unite de decision de niveau 0 (L0DU) est le systeme central du niveau 0 de declenchement. L0DU prend la decision d'accepter ou de rejeter la collision pour ce premier niveau a partir d'une fraction d'informations issues des sous-detecteurs les plus rapides (432 bits a 80 MHz). L'unite de decision est un circuit imprime 16 couches integrant des composants de haute technologie de type FPGA (Field Programmab...

  18. II, Het Nieuwe Testament. JH Kok NV, Kampen 1957.

    African Journals Online (AJOL)

    Test

    duivel „in een slang gevaren” tot die mens gekom het. Dis moontlik, maar 'n mens kan dit moeilik 'n „feit uit die Bybel” noem. So ook berus die Messiaanse interpretasie van Gen. 3:15 en 9:26 nie regstreeks op die woorde van d'e HeUige Skrif nie, maar op 'n bepaalde teologiese uitleg daarvan, 'n Ander voorbeeld van die ...

  19. Using HET taxonomy to help stop human error

    OpenAIRE

    Li, Wen-Chin; Harris, Don; Stanton, Neville A.; Hsu, Yueh-Ling; Chang, Danny; Wang, Thomas; Young, Hong-Tsu

    2010-01-01

    Flight crews make positive contributions to the safety of aviation operations. Pilots have to assess continuously changing situations, evaluate potential risks, and make quick decisions. However, even well-trained and experienced pilots make errors. Accident investigations have identified that pilots’ performance is influenced significantly by the design of the flightdeck interface. This research applies hierarchical task analysis (HTA) and utilizes the Human Error Template (HET) taxonomy to ...

  20. RAAK MKB Wireless Sensortechnologie bij calamiteiten : Werkpakket 3 Proximity

    NARCIS (Netherlands)

    Leeuwen, van H. (Henk); Sondervan, N. (Niels)

    2011-01-01

    Het project Wireless Sensor Technologie bij Calamiteiten is een samenwerkingsverband tussen Saxion, Thales Nederland (de dochterondernemingen D-CIS Lab en Iseti), Ambient Systems, Ti-WMC, het beveiligingsbedrijf Vigilat, het Regionaal Centrum Criminaliteitspreventie en Veiligheidsregio’s

  1. Démarche pour la mise à niveau d’un secteur de soins pharmaceutiques : le cas de l’hémato-oncologie pédiatrique

    Science.gov (United States)

    Bussières, Jean-François; Robelet, Antoine; Therrien, Roxane; Touzin, Karine

    2010-01-01

    Contexte : Bien que le concept de pharmacie clinique ait été développé dans les années soixante, il existe une grande variété de programmes et une grande disparité entre les programmes en clinique externe et en hospitalisation, bénéficiant de la présence d’un pharmacien dans un secteur de soins. Objectif: Éprouver une méthode de mise à niveau des secteurs de soins pharmaceutiques en établissement de santé. Méthode : Il s’agit d’une étude descriptive se déroulant au Centre hospitalier universitaire Sainte-Justine, un établissement mère-enfant de 500 lits. Le secteur de soins pharmaceutiques ciblé pour illustrer la méthode de mise à niveau est l’hématologie-oncologie pédiatrique. La méthode comporte trois étapes, soit une revue de la documentation scientifique, un profil du secteur et une mise à jour du niveau de pratique selon un profil des activités pharmaceutiques dans le secteur avant et après la mise à niveau. Résultats : Au total, 108 articles ont été recensés et 22 ont été retenus à partir d’une recherche dans PubMed. Après une recherche manuelle complémentaire, 36 articles ont finalement été évalués. Parmi les articles retenus, on compte trois lignes directrices, 11 études de développement, une revue de la littérature scientifique, six études pré- et post-interventions et 15 études quasi expérimentales. Bien que les patients de ce secteur ne comptent que pour 5 % des admissions de l’hôpital, la complexité des cas est élevée tant sur le plan de la codification de l’épisode de soins que du potentiel d’intervention pharmaceutique par admission. Conclusion : Il existe peu de données illustrant une démarche de mise à niveau de la pratique dans un secteur de soins pharmaceutiques. Cette étude a éprouvé une méthode de mise à niveau dans un service d’hématologie-oncologie pédiatrique et comporte une revue de la documentation scientifique, un profil du secteur et une description des t

  2. De ecologische achtergrond van de crisis

    NARCIS (Netherlands)

    Lyklema, J.

    2013-01-01

    Het recente gebeuren met de Fyra illustreert weer eens dat het progressief moeilijker wordt significante verbeteringen op infrastructureel niveau te realiseren. Deze talrijke dagelijks waarneembare afgeleide symptomen van het ecologische probleem worden door de politiek vaak als het probleem gezien,

  3. Solar PV. Innovators talking; Zon PV. Innovators aan het woord

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-02-15

    Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on solar PV [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar zon PV.

  4. Gas. Innovators talking; Gas. Innovators aan het woord

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-02-15

    Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on gas [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar gas.

  5. Smart Grids. Innovators talking; Smart Grids. Innovators aan het woord

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-02-15

    Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on Smart Grids [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar Smart Grids.

  6. Solar PV. Innovators talking; Zon PV. Innovators aan het woord

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-02-15

    Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on solar PV [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar zon PV.

  7. Smart Grids. Innovators talking; Smart Grids. Innovators aan het woord

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-02-15

    Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on Smart Grids [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar Smart Grids.

  8. Gas. Innovators talking; Gas. Innovators aan het woord

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-02-15

    Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on gas [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar gas.

  9. Instromende studenten in het hoger onderwijs talig sterker maken: een pleidooi voor gecontextualiseerd en opleidingsspecifiek materiaal

    OpenAIRE

    Peters, Elke; Van Houtven, Tine

    2010-01-01

    Er is veel te doen over de taal van instromende studenten in het hoger onderwijs. Een grootschalig onderzoek (Peters et al., 2010) toonde aan dat er inderdaad studenten zijn die talig over onvoldoende startcompetenties beschikken. In deze workshop lichten we toe hoe we studenten die in het hoger onderwijs starten talig sterker kunnen maken. We besteden vooral aandacht aan ‘gecontextualiseerd en opleidingsspecifiek taalondersteuningsmateriaal’ als voorbeeld van taalontwikkelend lesgeven. Het m...

  10. Partially-deuterated samples of HET-s(218–289) fibrils: assignment and deuterium isotope effect

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Albert A.; Ravotti, Francesco; Testori, Emilie; Cadalbert, Riccardo; Ernst, Matthias, E-mail: maer@ethz.ch [ETH Zürich, Physical Chemistry (Switzerland); Böckmann, Anja, E-mail: a.bockmann@ibcp.fr [Institut de Biologie et Chimie des Protéines, Bases Moléculaires et Structurales des Systèmes Infectieux, Labex Ecofect, UMR 5086 CNRS, Université de Lyon (France); Meier, Beat H., E-mail: beme@ethz.ch [ETH Zürich, Physical Chemistry (Switzerland)

    2017-02-15

    Fast magic-angle spinning and partial sample deuteration allows direct detection of {sup 1}H in solid-state NMR, yielding significant gains in mass sensitivity. In order to further analyze the spectra, {sup 1}H detection requires assignment of the {sup 1}H resonances. In this work, resonance assignments of backbone H{sup N} and Hα are presented for HET-s(218–289) fibrils, based on the existing assignment of Cα, Cβ, C’, and N resonances. The samples used are partially deuterated for higher spectral resolution, and the shifts in resonance frequencies of Cα and Cβ due to the deuterium isotope effect are investigated. It is shown that the deuterium isotope effect can be estimated and used for assigning resonances of deuterated samples in solid-state NMR, based on known resonances of the protonated protein.

  11. Interventieteams: werken op het snijvlak van rechtstaat en maatschappelijke urgentie

    Directory of Open Access Journals (Sweden)

    Jacqueline de Savornin Lohman

    2009-06-01

    teams efficiënt, maar de inzet ervan is strijdig met een juridisch perspectief. Met succes klaagden burgers in de rechtszaal en bij de Ombudsman over de inzet van deze interventieteams, zich beroepend op het feit dat hun privacy door het opdringerige handelen van deze teams wordt geschonden. Als reactie hierop is door de rechter bepaald dat elk teamlid zich moet kunnen identificeren en de reden voor zijn bezoek moet kunnen toelichten. In de praktijk staat deze formele eis een efficiënte probleemoplossing in de weg. De auteur oppert dan ook de mogelijkheid van de contextgericht gezichtspunt. Het concept “dynamische legitimiteit” is bruikbaar om deze benadering een normatieve basis te geven. Dit omvat het perspectief van de bewoner, van wie de privacy op het spel staat. Onderzoek naar best practices bevestigt dat teams die dicht bij “de voordeur” werken een voorwaarde zijn voor succesvolle interventies, mits zij gebaseerd zijn op een stevig fundament van gerechtelijke principes en fatsoensnormen.

  12. Achtergronden bij de berekening van vermesting van bodem en grondwater voor de 5e Milieuverkenning met het model STONE

    NARCIS (Netherlands)

    Overbeek GBJ; Grinsven JJM; Roelsma J; Groenendijk P; Egmond PM van; Beusen AHW; LBG; LAE; CIM

    2001-01-01

    Ten behoeve van de vijfde milieuverkenning is de voorgenomen Integrale Aanpak van de Mestproblematiek van de Nederlandse regering doorgerekend met het model STONE naar landsdekkende milieueffecten op bodem, bovenste grondwater en belasting van het regionale oppervlaktewater voor de periode

  13. Factoren die het foerageergedrag van honingbijen bepalen (deel I); Dracht in Nederland (cultuurgewassen en wilde planten) (deel II)

    NARCIS (Netherlands)

    Steen, van der J.J.M.; Cornelissen, B.

    2015-01-01

    Om een inschatting te kunnen maken van het risico dat honingbijen blootgesteld worden aan gewasbeschermingsmiddelen, andere stoffen zoals atmosferische depositie van fijnstof en organismen zoals plantpathogene microorganismen, is in opdracht van het Ministerie van EZ/Landbouw een samenvatting

  14. Rapport over een inventarisatie van- en een studie over de entomofauna van het C.R.M. reservaat Broekhuizen

    NARCIS (Netherlands)

    Peerdeman, M.P.

    1976-01-01

    Inventarisatie van het terrein rondom het kasteel te Broekhuizen/Leersum. De inventarisatie werd hoofdzakelijk gericht op de entomofauna, maar in dit rapport zijn ook enkele gegevens over andere diergroepen opgenomen.

  15. Van strijdtonelen en luchtkastelen. Gedachten en observaties over de rol van communicatie bij innovatie in het publieke domein

    NARCIS (Netherlands)

    Leeuwis, C.

    2003-01-01

    In een bewerkte versie van de inaugurele rede, die de auteur heeft uitgesproken bij de aanvaarding van het ambt van hoogleraar Communicatie en Innovatie Studies aan Wageningen Universiteit, volgt een schets van de veranderingen in het denken over communicatie

  16. Inventarisatie van Aeromonas spp. in het drinkwater van 21 pompstations in de periode september 1985-december 1986 (deel I)

    NARCIS (Netherlands)

    Versteegh JFM; During M; Havelaar AH

    1987-01-01

    In de periode september 1985-december 1986 is in samenwerking met een aantal drinkwaterbedrijven een inventariserend onderzoek uitgevoerd naar het voorkomen van Aeromonas-bacterien in verschillende typen drinkwater geproduceerd op 21 drinkwaterpompstations. Nadat in de loop van het onderzoek

  17. Inventarisatie van Aeromonas spp. in het drinkwater van 21 pompstations in de periode september 1985-december 1986 (deel II)

    NARCIS (Netherlands)

    Versteegh JFM; During M; Havelaar AH

    1987-01-01

    In de periode september 1985-december 1986 is in samenwerking met een aantal drinkwaterbedrijven een inventariserend onderzoek uitgevoerd naar het voorkomen van Aeromonas-bacterien in verschillende typen drinkwater geproduceerd op 21 drinkwaterpompstations. Nadat in de loop van het onderzoek

  18. Boeren op de centimeter - precisiebesturing van werktuigen in het open veld

    NARCIS (Netherlands)

    Zuydam, van R.P.

    1997-01-01

    In het kader van 'precisielandbouw' doet IMAG-DLO onderzoek naar het met hoge snelheid besturen van landbouwmachines. Met behulp van een sattelietnavigatie en een van tevoren gemaakt plan in een computer wordt een werktuig keer op keer nauwkeurig langs hetzelfde pad gestuurd. De trekker mag

  19. Het nieuwe Jeruzalem komt uit de hemel : christelijke religie en seculiere utopie

    NARCIS (Netherlands)

    Verkerk, M.J.

    2008-01-01

    Nu de ChristenUnie meeregeert zien sommige christenen nieuwe kansen om orde op zaken te stellen op ethisch gebied. Maarten Verkerk wijst aan de hand van het werk van Francis Bacon en van de regering Bush op het grote gevaar om hoge doelen te stellen aan een machtspositie.

  20. LTE HetNet Mobility Performance Through Emulation with Commercial Smartphones

    DEFF Research Database (Denmark)

    Jensen, Anders Riis; Pedersen, Klaus I.; Lauridsen, Mads

    2014-01-01

    In this paper we introduce a laboratory emulation setup for evaluation of Long Term Evolution (LTE) mobility performance in a co-channel heterogeneous network (HetNet). The setup consists of two eNodeB emulators, signal faders and release 9 LTE User Equipment (UE). It is shown how the LTE HetNet ...